5GHWH

Crystal structure of broad neutralizing antibody 10e8 with long epitope bound
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
233
structure length
233
Chain Sequence
EVQLVESGGGLVKPGGSLRLSCSASGFDFDNAWMTWVRQPPGKGLEWVGRITGPGEGWSVDYAAPVEGRFTISRLNSINFLYLEMNNLRMEDSGLYFCARTGKYYDFWSGYPPGEEYFQDWGRGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for broad neutralization of HIV-1 through the molecular recognition of 10E8 helical epitope at the membrane interface
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords FAB 10E8 HEAVY CHAIN
total genus 40
structure length 233
sequence length 233
ec nomenclature
pdb deposition date 2016-06-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ghwH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ghwH01
3LMJH 3C8DA 3L3JA 3BKYH 4N1EA 4J3VA 3CK0H 4NO2B 2A83A 4B50A 5LQBL 3CXHK 2WUBH 2X4PB 2Z93B 4OCWH 4PJ8C 4U7KA 1KC5L 3J7HA 4G5ZL 4JFDB 3IVKB 3MLPA 2DQFB 5CEYA 3VFTB 4I9WD 1G9NH 3QRFM 4WWKA 2IANA 5DR5H 1XGPB 5FHAH 1PZ5B 5C3TA 2IALA 3T2QA 3ZT5A 3MLTB 2PXYC 5IVZA 1JRHH 2XXMB 3GBLA 3V5DA 2KQNA 1IAMA 2FEEI 5E8NA 5T1KB 1F13A 1FRGL 1FHGA 5EOCH 2DJSA 3AS1A 3BO8A 3IFPA 2E7CA 3SGDH 2QL1A 4G43B 1ZHLA 2JK5A 1I7ZB 1HH9A 4NOBA 4PJBE 4U2YA 3U7YH 1N5YH 3VD9A 5CBAA 5L88H 2DJUA 1HZHL 3IDMB 4R0LA 3MPCA 2X9YA 3SDDC 3LRHA 4C55A 3VH8B 1A7PL 2NY3B 3W0WA 2E9IA 3UTSE 4ZUVB 3P4OB 1L0YA 4ALAL 4BH7A 2AJXL 3A0OA 4WU7B 2UVFA 15C8L 5F1SA 1UFUA 1ZLVH 5I8OL 4NWTH 5ECJE 3SGJA 1OF2A 1N8ZA 4JCLA 4XNZB 3VFMA 5EO0A 3BN9D 4AYFA 2X4UA 2C7UA 5JIPA 3UJJH 4BJLA 3QUZB 3WE6B 4G6AC 3V8CA 3PUCA 3RNQA 1HQ4A 4JO3H 3HS0B 4NQUA 1S9WB 4DKEH 2JJTA 4HF5L 4ODTL 2F19L 1J0ZA 2R2CA 1VESA 4KXZH 1L0QA 3CSPA 4N8CH 5I74C 3T8XA 3JWOH 5FGSA 2IFFH 4TNVK 4ZNEA 4GAYA 4XAWL 1NAKL 4MS8D 3DVGB 4MJ6B 3O11B 4D0BA 4ZAKB 4P2QB 3O2WH 5GZOD 3BIAX 3BMWA 4X7CC 3LZFL 5TH2A 4XCCH 3LRSB 4JGJA 1A1NA 3GI8H 2VLRE 4LSSH 1D9KB 1WTLA 1BVLA 3HE6A 2A9NH 4FQCL 5CS7A 4GLRH 2C3HA 3UC0H 4G3YL 5KOVC 3G5XA 1X4ZA 4X7SH 2RCSL 3DIFA 3ECBB 3ARUA 2VMFA 3DUSA 1RZJC 3KPRA 3N1GC 1J12A 1FGNL 4UT6L 1CYGA 4HC1A 3GSRB 2NLJB 1MRFH 1ZK9A 3ULVL 1P4IL 4AENA 1QVOB 3NMEA 2M26A 3MJ9A 4M4RA 4OIIL 3QEQD 1A7OL 2ESVB 2XYCA 4WI5A 5IHBA 3QCUL 5IG7A 4J1UA 3QB7C 5I2IB 1NCAH 4L8SC 1S7QA 5E8DL 1T22A 5LGJB 2X09A 1M7IA 1HHKA 2W9DL 4LLQA 4HWUA 4LIQH 4H0HB 2XPGB 4JY6B 4JRXA 4Y5XA 5D1XC 3EUUA 4PYHA 3ZE1E 3IDGB 4UINL 1ZLVK 3ISWA 2WBJD 3W81A 2XG5A 4J8RA 4YPGB 3ZKXC 2ATKB 5DUMH 1J11A 1FAKT 3DX6A 5C0EB 1YEDA 5DVKA 3IFNL 3HNTL 4XVJL 5GGTA 2AABL 2C3VA 3BDYH 3BPOC 2W0LA 1PX3A 5H8DA 1B0WA 1SBBA 1X5XA 4OLWL 4PJ9D 3IDXL 1LNUB 5HSFA 1NDMA 2OI9C 1ZVSA 3D25B 4HCRH 4MNQE 1YEIH 3DVIA 4E41D 4GW4B 5DGRA 1WT5A 5C0IA 2XG4A 43CAA 3B9EA 25C8H 3GK8H 3OZ9H 4OLEA 2EDRA 3MBXH 2VN4A 5J56B 3NFPA 5KANI 2A73B 1A6UL 4YPJA 2ZSWB 3PXJA 4ZFGH 2DF3A 3FOLA 4DQOH 3RVWC 1FIEA 4CADA 1D5ZB 2NXZD 4NDMA 4X5XA 4WO4B 1P9MC 4PJ7A 4MAYB 3EJJX 4XH2B 1JNHB 3C08L 3L3HB 4PYGA 1KTKE 1J5OL 2EYSB 4Y16A 3E6HA 3WL9B 3SKUD 1FFPB 4N8VB 1OPGL 1LO3L 32C2B 3S35H 1LO0H 5GS1A 5H94B 4GRWB 2V5SA 4ZOCA 3WFCH 1CCZA 1JGLH 2B4CH 5DK0A 3MO1A 3C5ZD 3LS4H 5CSBA 1NBYB 3VXRD 1TCRA 4YHYC 4M5YH 1NKOA 2X4TB 1CWVA 2AEPH 3M45A 4XWGL 5D6DC 3P3YA 3H3PL 1K8IB 2YSSB 1C1EL 4MVBC 2OXGA 1JP5A 4POYA 1JPTH 4OGXH 5D7IE 4JREB 3HMWL 4HG4K 1R3KB 2A6KA 1RZFH 1N7MH 2CKNA 2A6IA 4NN7B 2CK2A 1QFWI 1BVZA 4XCEA 2O5XH 3KPPA 1RHHA 3BJLA 1EH9A 2PKDA 1IZKA 2ARWA 1MAML 2D7PA 3WUWB 1C5BH 3GHBH 3GSOB 4IJ3B 1A7RH 3VRIA 3GIVA 2HYMA 1I8KB 4JJ5B 3H3BC 5ICZA 3CU1A 4FS0A 4U1HA 3FRPG 1UJTA 1V3JA 1GIGH 3NAAH 5C0DA 1YQVL 4LQFH 3KPMA 1F2XK 5KZCB 2NY2B 2E7LA 1YJDL 5C0JA 1UVQB 5HHQB 5ICYA 5MEQB 2R2EB 4KH2A 1CFTB 3BQUA 3AU1B 4FN0A 1AXTL 2GK0B 4UI2A 3I6GB 3VE0B 1OGTA 4UOW1 5I8EA 4NJ9H 5HI5C 2QR0B 3GM8A 4UMGA 2CKBA 4W81A 1KJ2L 1ZT7B 1KB5H 3P9MA 5DJXB 4TQEL 3QIWC 3IDIB 4XPFH 2O26U 3MA7B 1FV1B 5F1KC 1NUDA 5GS1C 1BBJB 2QQKL 1WWAX 5JXAH 1MCCA 2UVEA 4PJAF 2EDKA 1JGEB 5EU3A 1RUKL 1NC4B 4NJAH 5CINL 4P3DB 3GKZA 3LN4B 3D1MC 2AK1H 3IDUA 4MD0B 4OGYH 5D7KE 5JW4Q 3KLAB 3RTQD 3CDGA 3GB7A 5IW1B 3SCMA 3Q6GL 4P57A 3TVMB 2VDML 4YHOH 4QHNB 3IU4L 1SJVA 5DRXA 1I8IB 2RHEA 4LHUA 4R0LC 4F3FB 5L7XL 2ITCA 4LKXA 3JV4B 3RHWK 4PRDA 2VZ3A 3V0VB 1KN4H 2BXYA 1EJ6A 4GQ9L 4PR5B 4N9GA 4Y16C 3L3IB 4OZIF 1FZMB 1DQJA 1D9KC 1NBQA 2GUOA 4WHTB 3V52L 3O4LB 1CVRA 5EULV 5F70A 3QWOA 4BQBA 5J8OA 1FZOA 3TN0A 4A6YL 4PGJA 1LO0L 1T20B 4QRSB 3H9YA 4ZAKC 4KKBC 1EHLH 3T3MF 5EOTB 5BRZB 3U2SB 4KVNH 4LRNH 4AEIL 3MMEA 5ID1B 4QCIB 2B20A 1QFPA 2VLRD 5BMFH 4CJ1A 3T0DA 3DX8A 5HTSA 4OSUL 1CT8A 4Z7UB 1R6VA 5IIEB 1AH1A 3PG2A 5E00B 5C0CD 3FFCE 3GSVA 2HRLA 3BP5B 4K94C 3MR9A 1D6EB 4M1CD 1FO0H 4IS6A 1OP3K 5KVFL 3EOBA 3MREB 4MYWB 3EAKA 4X6FA 1SY6H 4HS8H 3RVTD 2E8ZA 1HSBB 5DJCB 1A6PA 2Y6SC 2R0WH 1KXVC 1ZHKA 4M43L 4UDTB 3V4PH 1TJGL 3WJJC 4JAMA 1TPXC 4FQHB 4MNQA 3L3KA 5EBWB 2JJSC 2PYFA 2R2HB 1OLZA 4APQD 3BPNC 2PO6B 4U0RB 5CUSH 2W07A 3EFDL 3AAZA 5DHXB 5EFIB 1CFNA 5EZOH 3T2OA 3UTPE 4TTDC 4PJGE 1VENA 4PRHA 3ARZA 3LEVL 5E70A 2FLBT 4EVNA 5GGSA 2LVCA 5CSZB 2I26N 3PQYD 4ZS7H 1Y18B 4XWGH 4U33A 5F7UA 1II4E 1T0NB 3PNWA 2AS5M 5CP7A 2E3VA 4G7VH 4LKCB 4V2CB 3O8XB 5FB8A 1DQDL 3C60D 3F7VA 4JFED 1QR1A 2WNGA 1WC7A 1ZGLM 4M1GL 1Z0NA 1H3VA 1LDPH 4HXAH 4NSKB 4EI6B 5DVOA 2EYRB 3D5OF 5E6YA 3L7FB 3QZWA 1VADB 1HWHB 3P0VH 2NR6C 1PFCA 3FJTA 4WCYL 1LD9A 1B4JH 1A7RL 1JHLL 2AV7A 4NQDB 5JR1H 1Z3GL 5I19L 5D2NE 1I1AB 5D7JD 1FNEB 4PLJD 2NY5H 3EO9L 1IBGH 1BQSA 3VG9C 4OLXL 3MNZB 4M9PA 3QEHB 4MWFB 4LCWD 1S7UB 1BGXL 3FO0L 4H5SA 4JO4H 5JIHA 4W6WB 4TPRL 5JW4R 2EDBA 5FA3B 1YDPB 2DLEA 1WBXA 4M6AA 4G80B 3QIUD 1OLLA 4KQ3L 3QQ3B 1A9BB 2AI0H 1D5MA 5HGBB 5EC2A 3SPVA 2ICWB 3HNTH 3GJFA 4ALAH 1KIUA 1YNLH 5GRZA 3M1BA 4PJXB 1IE5A 4EZMA 1A22B 4OGAC 3RVXC 2ADIA 5GGTL 5TF1L 1I1AD 4NZTL 4MAUH 2LTQB 2DQEL 3JVGC 1AJ7H 3VWKB 1QRKA 3MA9L 2OJZL 1UC6A 1AIFB 3BEVA 5ANMA 1DANU 2VO5A 4B7IA 3DUUB 5IW6A 1C12B 3MRJB 3DV6A 3QUXB 1QBBA 3DYMA 1NAMA 3DSNA 3D85D 4QY8A 4C56D 2NXZC 4J3UA 5GGVH 4S1DC 1BHGA 4QHLA 1EBAA 1QOKA 1UZ8A 2CIIB 2EYRA 5CP3H 3EDJA 2ED7A 1VACA 2AJVL 4JKPH 1W0VA 4I3SH 3JWDL 2VDKL 1NAKH 5CCKH 3FQUA 5HDBF 4ZFFA 3BDXA 4X4ZA 2E9WA 4TRPL 3SDAA 1TNNA 3UZEA 3KJ6L 1JPFB 3Q5YA 4IRJA 2B4CL 1MCOH 3BE1L 2OR9L 2OP4H 4A6YB 1MIML 1WGOA 1I9JL 3FOMA 3RWHB 4O58L 3MROA 2VDNL 3MRFB 4J3XA 4LSQL 4PJFE 3UJIH 3GSNA 3SGKA 5ESVA 1OSZA 4HUXB 4ZYKA 5DFWH 5TQ2H 4LFHG 2P24A 1GHFH 3LKOB 3A67L 4LCYA 4R4BB 4WI4A 1I1CA 1ZHKB 3QXVA 3F12A 1R3LB 3G6JA 4WDIB 1C16B 1KPVB 3MLRL 3DMMB 4PGDA 3IFOB 2GSIA 1JUFA 4MXQD 4ETQB 1X5IA 2VISA 1CFSA 3GHBL 4JFFA 3BVNB 1MRDL 3IF1A 5MHSD 3I6LD 4OUOA 4XNQB 4CNIB 3PP4H 2FZ3B 2PXYD 1VPOL 4IRZH 5IIEA 6FABH 1J7VR 3U4BH 3TFKC 1E4XH 5SX4H 1B4JL 3K8KA 5DJ6A 1KTDB 4DOHB 4GAGH 3CD4A 4Z78B 5IFHL 5B39G 3OB0H 1CD9B 1ZVYA 1LQSR 3Q2CA 1RZGA 4NN5C 2B7DT 5D1ZB 5C08E 3VGBA 4Q6YA 2OQJA 3KS0J 1JZ5A 5AWNL 5EU7E 2CKBL 3D85A 1CGWA 1SMOA 2HKFL 3DX7A 4NHCL 4M7KL 5B39A 5CEZL 1IVLA 2XQYK 4QRUB 4UQ3A 3SDXB 1JPSH 4M6OL 1LP9E 2BJMH 2DJ4A 1DBAH 2ESVE 3QUXD 2WMPA 4ZFGL 3REVA 5BS0D 1WF5A 3LRGA 5B8CA 2NTFB 2UY6A 4PG2A 4YR6A 4APQC 5I1LB 5IK3B 4DCQB 4G7YH 1XZ0A 4P2OC 2FCBA 3JV6B 4AEHL 3HI1A 5B38A 1NGZA 2V5RA 4XZUA 3MSPA 1KCUH 2YBRB 4YWGH 1MCLA 4YHIB 1IEBB 2GJ6D 4I3RL 5CIPA 5LCVL 5H37G 3E6FA 2F54E 3QO0B 3LKQB 4QGYA 4M5YL 1ZS8A 4HKZB 4X6EA 5ENWA 4OT1L 3S4SB 4Z95H 1HKLL 4ZTPH 5I30H 1U8HB 1JV5B 4FXLA 4X6CF 1Q9LB 5DF0A 3WNPA 3JWOC 5MEQA 4BQ6A 1SEBA 1SQ2N 2B5IC 1VFBA 4I9WE 3V0AC 4JZNA 1G1YA 4OLVH 3P30H 3O3AA 4JCMA 4MB4A 1A6VH 4JDTL 4JQXA 1MFEL 5IK3A 4DCQA 1KNOB 1T3FA 5IV2B 5KW9L 1MCHA 4LASL 4XBGA 2QKIA 4BH8B 4RWYL 2WLZA 3RGVB 3V5HA 3QWRD 3BZ4B 3QZWG 2MHAA 1S8DB 3SOBL 4X6DA 5CGYC 1FFOA 1CXHA 4DUXA 1A02N 1J8HE 3U46B 3V4PL 1WSST 4W70A 4HIXL 2OTWA 3C09C 3SDXA 4I13B 3OMZA 4XCEB 1FZJB 3WYRA 2NY0D 1QKZH 4GG8A 1CGXA 3OXRA 1T21A 5HYJE 4UIMA 5FYJD 4NQSA 4WI2A 1IM3B 4PJEB 4ELMB 2EDHA 2OTUA 5TE7H 4NQEA 4AZ8A 5E2UL 3GMLB 3VWKC 3MRCB 1PLGH 2CLVB 4LCWE 1KIQA 3VXPB 4BA8A 3S88H 1MREH 5DQJA 3QAZC 3FT3A 4WI8A 3NVQA 4LEOB 2LAGB 4PJHF 5DTFA 3QUML 1AGDB 3FB5A 4HK0B 3IJHB 1Z0MA 1U36A 3OL2A 4LSSL 3QFDB 5JXAL 1UYWH 3UC0L 3EDFA 1FVCB 2HJKA 4P2RA 5MEPA 1JHKH 1VKXA 5C0BD 2ED9A 2X1PA 4OGYL 3BD3A 2DQDH 1OD7A 1RK0B 5DURD 2GSGB 4M5ZH 4PRPA 4KRNA 1CF8H 3DPBA 4POZD 5F6HI 4AH2B 2APBA 3UYPA 1MJJA 3VDAA 5FM5M 3C09B 3G6JB 5LXGH 2F74B 5C7XL 2RBLA 2CIKA 3H0TB 1UKQA 2P5WD 4OZIB 3LKOA 3OGCA 1ZEAL 1ZVSB 3D25A 4TUOA 3VXTB 5F88B 4G42B 5J9PB 3RDTA 1F3DJ 1R0AH 4BFIB 4YEFA 4OFYA 1ZT4A 3BGAA 2CDEB 3HPJB 5DD1H 4P9HH 2VLRA 1ZGLA 1MI5B 2CDEA 1ZKAA 1QPXA 1FQ9C 2D03L 3OKMA 4LPUA 1UM5H 4LNRB 1UM4L 5GGQH 4L3ED 1V3MA 3MUGA 2KPNA 4MAUL 5EU6E 3SQBA 2HMID 2WZPD 5T3XD 4BQ9A 1AXTH 2XPGA 4G8FA 2F74A 2F53A 4ZUSA 4JKMA 3DVFA 4H20H 5ADOH 3TIEB 4PJIE 4H0GA 4EBQL 4OJFL 1MJJB 3AXLA 3RWEA 4WEBH 1BJ8A 4OLWH 3E3QE 1IAII 3BHBA 4FQPA 1H3PH 1BOGA 4HIHB 1FVCA 3DSFL 4XX1E 3RBGA 5IMLB 1TVDA 3GSRA 2FJFA 3ZSTA 3QEUB 2Y5TB 2C3GA 5C0BE 3TN0C 1L6XA 3ARBB 2QHLA 3I75B 3FB5B 1AGDA 3IAGC 2ZCKH 4QHUA 4LEOA 1JZ7A 2ZUQC 4XXCC 4HPOH 2DAVA 3QEQA 1R5VB 3M1BB 4PJXA 1G6RH 2XZQL 3GJFB 1KBGH 1JFQH 3F5WA 3F7RA 3PL6C 3TT3L 4BFGA 1EUUA 2Z4QA 3MRCA 5TE7L 1UZ6F 3W5NA 2VLMD 1JNNH 2DICA 2OTUB 3QDHA 4G80A 4HEME 5SWSE 3GMQB 3HNVH 4MJ6A 1AP2A 3D0LB 1I1YA 2EICA 5BQ7A 4GAYB 2ENSA 1DR9A 3LS5H 4GMTL 4IIQB 4Y1AE 5I76B 1AD9B 4BSVA 3W9DA 2EEDA 3X11B 1TVBB 4XHQA 2CDGB 3H7BA 4Z8FH 1AC0A 5D7JA 1FNEA 4NNYB 4OZIE 3RKDC 5IB4A 1FGVH 1MF2H 1E27B 3EYVB 3BUYA 4EN3D 4AL8H 1NGPH 1AGFA 4XPTH 4Y8DC 3EGSA 1MRFL 1VPOH 4IRZL 1CLCA 3TP4A 3U4BL 5AD0B 4K7FA 3G04B 4KJPD 1CFBA 4XNMB 3W2DH 1YEKH 5FCSH 5C2UB 1T0MB 5D5MF 1EHNA 1PYWA 3VXSA 1AE6L 1Y18A 3C5JA 2BVQB 4P5TD 3VWJA 1KYOK 1U0QA 3O6FC 3PE9A 1C08B 4PD4K 1U92B 3QDJE 2DI8A 2MQ0A 1OY3B 3S34L 1MH5B 5I75C 4GG6B 1G7MA 2WV3A 3KPSA 4M6NL 3LKRB 4NRXB 2YWYA 3OR7B 3KPLB 1HH9B 2FL5A 3BD5A 2BOBB 1P5UA 1LK3L 4DW2L 3STBA 5B8CB 1P69B 3REVB 4H25B 4IDJL 3B9VA 3STZA 2BXZA 1W8OA 5FUOL 4AQOA 2R15A 3QXTA 1H3XA 3V5DB 4F58H 2C1PB 4FFWC 2WBJC 4FZEL 3MOAL 1OAUL 1IQWH 3ELAT 3FQWB 4JFOA 5E00A 4M62H 4FQ2H 3HE7A 3MXVL 4Z7UA 1BAFL 3KYNA 1JWSB 1MIEL 5D8JL 3VA6A 2EC9T 2Z93A 5IBLD 2WWKO 3UO1H 4CW1A 3ARTA 4JHWL 3LVEA 1CTNA 5INDB 2Y72A 5IMOB 3H9HB 4PJCE 5FK9A 3QYCA 1FNHA 5AZ2H 4YHMH 5EZJA 3LDBB 4DN4H 3DLQR 4LF3A 2FJHA 5E94B 2CDGA 4L8CA 1AGEB 1RUQH 4QXUH 3BP4A 2APVA 4Y4HC 3P30L 4LSRL 2F58L 3HR5B 2FGWL 1OTSD 4LHUB 4NFBA 5BO1H 4E5XA 1HHIB 1ADQH 2O5ZH 3GMQA 5E2VH 5BRZE 1S78C 3B9KB 3VFGH 4CVWA 4R26L 1N3NA 3DMMA 4PGDB 1ZXQA 2WBKA 1KCLA 4XNYL 3KJ4B 3BRGC 1ZGLP 1MRDH 1N7ML 5L2KE 3QUXC 4HIJB 1T80A 1J8HD 1F6AB 4RBPK 3TYGL 1WQVT 3SBWA 4GKOA 3ARBA 4XTRD 5I74B 1CN4A 1YMMD 5J12B 3R0NA 3W11C 2FBJH 4AL8L 3QUYB 2GAZB 4I3GA 2Y7QB 3O2DH 1GAFH 1U92A 5IMLA 5KS9A 2OI9B 1BOGB 5TJWK 3SGJC 3FAWA 3OWEA 2Q86A 1NMCB 1HH6B 5I8EB 2WBJA 3BZEA 4GSDH 1NQBA 3BIKA 2EE3A 1X5ZA 3WXWH 1PGRB 2AGJH 2VOTA 5E8EA 4WW2B 1INDL 2HFGH 4R3SB 4G8FB 1ERNA 3D0VA 2OX5A 3KPMB 3BN9C 3VGGA 1I9RH 5HPMB 4TSCL 1WZMA 4MB3A 5DFVC 4C59B 1AGFB 4N0CD 1WFUA 4JR9L 3U1SH 2YC1A 1OTTC 1YNKH 4KI1A 3S5LB 3CVIL 1NAMB 5EB9A 3GSOA 3VD4A 1YY8B 4OZFH 5GJSH 4JVWA 3EYFA 3O2VL 4ETYA 5B3JF 3OJDB 3X11A 1RZKC 4ISVB 1AD9A 4BFIA 2HWZL 2NY4D 4GKSB 2KL6A 1A7NL 3R8QA 4HIIB 4RFEB 1R3KA 2IPUG 3MUJA 5HVHC 1UGNA 5FHBH 2JIXA 3DYOA 4OZIA 5DR5L 5FA4A 3WDHA 3VGFA 3MLYH 2PW2B 4FFVC 4DKFH 5EC2B 4HFWB 4KRLB 4JZJC 4KI5F 5B38G 4K8RL 4PRPB 2XV6B 3G6JF 2GTZA 3ZYIA 3ZKNC 4YDVA 4D9RE 5F6HJ 4YAQB 1KLUA 4GRWH 4PGZA 2Y5TA 5MEPB 4KKAD 1RI8A 3QEUA 1KCRH 5TPWL 3HUJA 4BUHA 2F5AL 4QRPE 1EHLL 1A6AA 3IFLL 1JNHA 5DQ9B 2BOCA 5LWYL 1NCDH 4WO4A 3BGFB 3W9EA 4I0PB 1G0XA 2GTWB 3UAJD 4Y4HB 3CCHB 2AV7B 2FJGA 4XCFH 2VL5A 4NC1C 2NZ9C 4UINH 5E9DA 2ZSWA 3FT3B 3SOBH 4LU5L 1PKQA 2BHYA 3I84A 1U58A 4NM4H 3KXFA 1INEH 5E99H 1BQLL 1S7XA 3F7VB 3I3BA 1HNFA 5K33A 4FQIH 4GKZB 1S7SB 4LKCA 3ULUH 5BV7L 5C0FA 3BGMA 1Y6NR 5DJZA 4QXGH 1YJDC 5E2WH 3MRQA 2ARJA 4NCC1 3TV3L 2AV1B 5F96L 3T09A 4QRRD 1YPZB 3EZJB 5CSZA 2X44D 2VC2L 3F62A 4RMVA 4UUJB 4LHQB 4N9OB 3RUGF 4YPGA 1A6TB 2GJJA 4JRYB 1HSAA 1ZT1A 3CFCH 3AREB 2GHWB 4Y5VB 3EOAA 2X9WA 3QDMA 3T77A 1BWMA 5DK2A 4I3RH 3Q0HA 3VXTA 1RUML 1FIGL 2JB6B 2PYFB 1CD8A 2R2HA 4ZPTB 4X8JB 2R56L 1LO2L 3KHOA 3O0RL 4NRYA 3KLSA 5DRNA 2BSRB 1A6WH 3QCVL 1Y0LA 2NY3D 1UXWA 3V95A 4I4WA 3SEPA 2V2WA 4FG6D 3GKWH 4OT1H 4KKCC 4AH2A 3LS4L 3PXHA 5C0AD 5I75B 3KYMB 3MREA 3GI8L 4S2SB 1NGYB 3UTTD 2A9ML 3WLBB 2R29H 4IS6B 4MJ5A 3SO3C 1D6EA 4HQQH 3B43A 3FKUS 3QNZA 4G9DB 4V1DB 3UTSB 1FVEA 5H2BB 3HCVB 3WIIL 1HCFX 2MPAH 3VXNB 5T3XL 5KVEL 1X6NA 5K9OA 4OFYD 3HZYB 4XMLH 3AROA 3DX8B 1M6OB 2F9BT 5JR1L 1A3RH 5HDQL 1SYSB 4WCYH 1CQKA 1NGQL 2F19H 4UT7H 2NW2B 5JW3H 4HMDA 3ZT7A 3G5ZA 4GXVH 4S10A 3AM8A 4PJEF 3GI9H 1WITA 3O4LA 1KGCE 1KCVL 1P53A 4U7SA 3TPKA 3W0WE 1ZTXH 2F8OA 3MJ8A 4OLYL 4N0CC 1QSFD 1N59B 1U8OB 3DGGB 5JORB 4LVHB 5E5UB 2NY0C 4ELMA 4PJGB 1HILB 4XP1H 5IWLA 3DX9A 5L9DL 3WDIA 3DX7B 4PB0L 5CHNB 3FONB 5I0DA 1HILA 1FNSL 1EZVY 5HHXL 1JMZA 2OZ4L 1J1PL 1JF1A 5F7LB 4JO2L 3U46A 1ITCA 4XMKL 1I3GH 2QEJA 4UTBL 3CDGB 3OAYH 3S3PA 1P6FA 2V2TB 3BZDA 3BZ4A 3V6OC 3EYSH 3SO3B 1A8JH 4WO4C 3MV7E 2BY3A 4LLMA 3WN5B 1Q9KA 1FYTD 3B6SA 4G8GA 4FZ8H 2H8PA 3CZFB 3EDKA 1KTDA 2BJML 1FG2B 1OVZA 2MFNA 1Y6MR 3VFMB 4K71C 5FCUH 5EOCL 1PKOA 3VXNA 3HCVA 3TNNB 2DLFL 2R4SH 4KZEL 1T03H 1EO8L 3S4SA 1TNMA 4HKZA 4X6EB 5D7SL 3T1FB 2YRPA 1G0DA 3H42H 3VFVB 1JUFB 4WWID 2V2WB 3GSWA 5EPMA 1UXWB 3HNVL 1MLBA 3M17B 4YHIA 4G6ML 4PJHB 2F58H 5FOBA 3T0BA 3AUVA 1NGZB 1RUQL 2VERN 2DMBA 4YBLC 1LO4L 1I7ZA 4PJIB 3PDOB 3RKPA 5HPOA 1CVSC 3N9GH 3AREA 4GQ9H 2NTFA 4Y5VA 3BO8B 3BDYL 5TGBA 4EIGB 1MF2L 3LPWA 3S36H 5HGGS 4ZXBA 3EKCA 2R4RH 5GRUH 5C6TH 4A6YA 4O02H 4X4XA 5C92A 5IF0B 4JGMA 3MLTA 2E6QA 2X1XR 1UACH 5IBLC 5BCAA 4H8WH 3JXAA 3SDAB 2UWEA 3DARA 4HUWB 3FQUB 1S9YB 5EWIL 2A1WH 1F42A 1IQDA 2QSVA 4RNRB 4UZGA 4NQDE 4KRPD 1A7QH 3NABL 3THMH 1EIBA 2OJEB 5DC4B 5D1ZA 5IVOA 4LDLB 4O5LL 4OF6A 5F7EL 5IM7A 2UWEF 1K9TA 3MO1B 4E42A 2PYED 1QSFE 4Y4HD 5JW4M 2HG5A 2VABB 2VDRH 4M6NH 5EZLA 1JF5A 1J1OH 5HDOA 4OCMC 1BWWA 4PJ7B 5CUSL 4LVOB 3QQ4B 4D0CA 4CADB 1RFDL 4TVSa 2IH1A 2OL3L 4OCSL 3UPCA 4XB7A 5ID0A 1CDYA 1G7HA 2XIDA 4ETQA 2ICWA 5KSAC 2GSIB 3FQRB 3QISA 1CLYH 3IETA 43CAB 2BNRD 5FA4B 5HDBE 3QQ3A 1TJIH 5FUCE 1IGML 5I1AA 2P8LA 3RU8L 5IB2B 5HHMD 5D7LE 5C0GB 3WEXA 5GPRA 2YR3A 2X41A 4TVPH 5ESVB 1U8MA 4WTWA 1FRGH 2OSLA 5KAQF 4LLUA 4EXKA 4R7DA 4JKWA 1Q94A 5BW7C 3QXWA 1I8MA 3MLYL 1YY8A 2IQ9L 3SKJL 4BELD 4G7YL 3R1GL 4KJYA 4YHML 4R4ND 4R4FH 1NFDB 3ARED 3PWLA 2BSSB 1R0AL 4RX4A 4JPVH 5DJ8A 2G60H 3IGAB 4Y2OA 4P46A 2APXA 2Y06L 4L8BA 3CAFA 5T3ZH 3CH1A 3WHE1 1QSED 2WP3T 3O8XA 4NJ9L 5FB8B 3OKYA 1HHKB 5I2IA 12E8H 4MHHI 4KQ3H 5SWZB 1WZKA 1AR1C 3ILQC 4W6YB 4HH9A 4WUKH 4XPBL 3WO4B 3DI2B 4AENB 1LEGB 4HWBH 4HPYL 2MOVA 2WIIB 3I6KA 4NJAL 3NN8A 4ZXBC 3O6KH 3TJHD 1OGAE 4Q0XL 1U95A 4DTGL 5F6IC 2PO6A 1DUYB 1MCSA 2FIRT 3ECBA 5E9DE 4OZHA 4YXHH 4FQHA 1J87A 2VZSA 3F65A 2DLFH 4HJJH 3CDCA 4PJ5A 5DHVH 1CTOA 1J05B 3VXUB 5EORH 3TIDB 2VWEE 5CLWA 5CP3A 1YEFH 5GZOC 1WK0A 1MHCB 3NCBB 2ORBH 1MI5E 2EDFA 5F7YC 3V6FB 1NGXA 5DLMH 3BFOA 3QUZC 4CVZB 3G6JE 4EDWH 3J8F7 3DETC 3O41B 2KQMA 4YFDB 1DBKL 3DVGA 1V5JA 4PV9B 3MLXL 4MGXA 3DXAE 2L4OA 2UYLB 4HPOL 4EQ3A 1CT8B 5IVXB 1I9RL 2XTJD 2FIKB 3DYPA 2FR4A 3H3PH 2YN3A 4KDWA 1IC7H 4A2MA 1V7NL 3FN3A 3NIGF 3QI9C 3VGAB 1HYSD 1S9XB 4FQXA 1FLRH 3X17A 3L7FA 2GUOB 3QZWB 4PR5A 4L4TE 1MFBH 2JJVA 3BD4A 5T3XH 1HE7A 2AJYL 2YD5A 5B4MD 5HDQH 3KYNB 2AXHA 1NGQH 4PJ8B 1A3RL 1SY6L 4HS8L 1XR8A 1URLA 3DTXB 2LU3A 1DQMH 4LK4A 3I6KB 2MWCA 2XTJB 1CG9B 2V17L 5DD0H 2ADGB 3GGWB 2AQ1A 4K7PX 4ZO9A 5HYJB 4OM1H 1EO7A 2FDBP 2HAZA 3B2UC 5DVLA 2BOBA 4CL7A 1I3UA 2FL5B 3ZDYF 1I9IL 4I2XA 5FYKE 1G6VK 3L3KB 3HR6A 4FABL 4BQ8A 1ZHLB 2BDNL 4AM0A 2AW2A 4OIAA 1F4AA 2AQ3A 1A0QL 4LMQI 2W9EH 4G6JL 4PB9H 2BVQA 3C5JB 3IT8D 3PDGA 2IADB 2R2BB 1MUJB 1NC2A 5HVWA 5L2KD 3I6GA 3VE0A 3ULUC 3AU1A 1YNLL 2E27H 1A4KA 2NXYC 2ATPB 3I85A 4TNWK 25C8L 1OSPL 3RU8H 1A1OA 3HRPA 3ZTNL 4EBQH 4NZTH 1U8MB 3P0VL 3G04A 4Q74A 1HCVA 1UCBH 5ID1A 3DETD 3MMEB 3T0EC 1QBLL 3UXFA 5IB2A 1KPRB 4P23D 5LBSL 1A47A 1IQWL 1FDLL 3FFCA 3QRGH 2VKWA 4NBXB 4XT1C 3V2AR 4YHNA 4EN3A 2ARJQ 5IKCB 4Z0BL 4K7PH 3HE6C 3BDBA 4FXKA 1FNGA 5J89A 1BGXH 3FO0H 2D4DA 1BZQK 1CDUA 1FC1A 3TA3A 3L5IA 4GMSL 4JGUA 5BQ7B 3D0LA 4OFPA 1E6JH 1KCUL 3C5ZA 3RUGA 1T5WB 4P4KA 1HXYA 3ZKSD 3SKOA 1UA6L 35C8L 4R2GB 1MCQA 4U1KA 3F5WB 1S5HB 4LVEA 4MVBD 3T08A 4E42B 3EYOB 2EDEA 5ESAB 4F57H 1IL1B 4UAOB 1UACL 1A7PH 1RIVL 3LS5L 1EHXA 1QEWB 3LEYH 4PJXE 4B41A 2DQIH 1YMMA 1IQDB 3OR6A 2E9BA 3L3HA 3QWQB 5GGVL 4JFDE 3DGCR 4UQ2A 1B9ZA 2YRZA 3EOTL 4NDMB 4X5XB 4MCZA 4KDTC 3ARDB 4UTAL 5IEHB 4H1LA 4JZJB 4JM2F 4Q58C 1CIDA 1ED3A 3ARFB 4PFEA 4S1QH 2GK0A 4K3JH 4RGNB 2JJWA 3AXLB 3RWEB 1B3JA 5EZOL 1F02I 2Q76B 3SKNA 5JO5B 4FFVD 3V6ZB 2BY0A 2A0LD 4PJIA 1T4KA 3MXWH 4LSPL 4WFED 2ZUWA 3TBVA 2OK0H 1IC5H 3QHFH 1EGJH 5H37H 3QUKA 4DGIH 4NT6B 4ZFZA 2QADC 4F7TB 3K1KC 4G8GD 5CZVL 4HX1B 1GGCL 3HPJA 1D5XA 3TO2B 1CZ8H 2NY0B 5DC0A 1LDPL 4HXAL 4FZ8L 3U30B 3LAFA 4HAFA 3TO4D 3T4AA 5AWNH 5JOFB 5E7FA 3MNWB 1MHPH 2EYTB 3WKML 3NTCL 3OGCB 4WFFD 1LE9B 3BJ91 4Y8AA 4P0DA 4M62L 1M7IB 4R90L 4Y1AD 1MNUL 1ZWIA 3C9NA 5IROC 5SWQA 3R1GH 2ZOLB 3LSOA 2ENYA 3GMPA 4X4YA 4ZUWB 4ACPA 2HP4A 2CLZA 2G60L 3CFDB 3L3OA 1QVOA 1CLOL 4PRIA 1J10A 2O93L 4ZMAT 5AAWA 2B0SL 3EYUH 2VLJD 5GGUA 4Q97A 4NKOB 5IVNA 5I17A 1UWXH 4GLRI 4HK0A 2OR8A 1KJ3H 5C09A 3N06B 5ACZB 4XPBH 3G5XB 2R4RL 1AJ7L 2CK0L 1PQZA 5DQJB 1YMHA 3F7YA 1KIQB 3VXPA 5E8OB 3MRGB 2CLVA 1INQA 4HPYH 4QLRA 4BZ2H 3MLSH 1PY4A 3RDTC 4GRWE 4X0KB 3O6KL 1J88A 1AQDB 1KPUB 5D5ME 2NW2A 1HI6B 3U9UB 4NQSB 4KXZI 5FYJH 1YEIL 1A5FH 3Q5OA 4HIEB 3OKKB 4HXBH 2VXSH 4KUCF 4OZ4B 5LBSH 2AEQL 4QRRA 3ZMRA 2YS4A 2MMXA 3ET9F 4KGJA 4V1DA 2MHAB 4DKEL 5JUEH 3P4NB 5DFVD 3OJ2C 4XBGB 4XCYA 2JCCA 3CXDL 2P42B 1JN6A 3H7LA 1ZWIB 2VDRL 4JY6A 2EIZA 1S7TB 4XX1G 2DQJH 1RUAH 2I25N 5L8JB 4JREC 4QHMA 5DRNB 1P84K 1NLBH 3BKML 2DWEB 1VFBB 3SDDA 2OBGA 1QD0A 1LILA 3AS3A 1T7WA 1FFQA 1E4JA 1JIBA 4J1UB 4U1JB 4XCCL 3ZT6A 2BY2A 35C8H 3PGFH 3FZUD 1FBIL 3DI3B 1NCBH 3P4OA 4X7EC 1HSAB 1ZT1B 5T3ZE 1TTGA 3FMGL 3QO0A 5CJQH 3WBDA 4L9LC 2E7LC 4K07A 1I4FA 3JUYA 1NEUA 2DTMH 2QQLL 1JPTL 2XNAB 2APTA 4JFEA 1FYTE 5D2LB 1TDQA 2V7HA 1S9VA 4IMLA 4HMEA 3BGMB 5C0FB 3D39B 5AAMA 4FQQA 4W4OC 3NPSB 4WO4D 4XRCA 5MERA 2ZCHH 1HINH 4DKDC 5GRUL 1K85A 1PEWA 4LOUD 3KS0H 4NC1E 2XFXB 1B2WL 1TLKA 1A7NH 3CJJA 4FP8L 1EBPA 2Q76A 3MOQA 3MV8B 3SKNB 2IWGA 3C6LC 4R4FL 5CGMA 3U36B 1U8JB 1BPVA 3MBED 2LTQC 1CGVA 3MODL 1D6VH 4F9LC 4KRPC 4H1LB 4H88L 1W2KT 4ZAKA 1E4KC 2VB5A 4PRBA 5TQ0H 5KBNC 4Q9QH 4K8RH 4K8RD 3HKFA 4Y19E 4RQQB 1ZEAH 2VNCA 5IHUL 4K9EL 2VXQL 5CWSB 5FYLE 4XBPB 4Z5RA 3V8OA 4PRIB 2CKBH 4PS4L 1UG9A 1ZLSL 4Z77B 1RZKL 4ZUWA 3MJ7A 2P8MA 3FQTB 3CMOH 5FM4A 5EU7C 2OJZH 4P9HL 4TSBH 3MRPB 5GZND 2FH8A 1RURL 3L5HA 3KPQA 1RUPH 2Z31D 5JQ6L 5AG9A 3CFEA 2BCKA 5JIKA 3PDDA 4NQCA 2ZCLL 4G6FB 1OB1B 1DZBA 4HIIA 3V79C 2FZ3A 5L6YH 4PGCA 1PJ9A 3SE4C 4KKLD 4WU7A 5L8LB 3TA3B 4S1RH 5C7XH 5DURB 3HMXA 3SE3C 2A6JA 2VDLL 3CK0L 5LQBH 4UU9B 1ULVA 2DS4A 5BZDA 4LPTA 1OGAA 3TH3T 1FZKA 5F97E 3ZHDA 4KRPB 5DUBA 2P43B 3QUKB 5IESH 3VG0L 1T04A 3TBVB 4U1SA 2GITB 3LPFA 5HPMA 5DD1L 5GRXG 1J86A 4NO0A 4TUJA 5L7XH 4LSTL 1JGLL 3F7QA 3MRFA 5GGVY 1ZANH 4TULH 4U1NA 1OPGH 5F1IB 2KZ1B 3V52H 2F54B 1TZIB 1D9KD 3ARFA 3LPGA 5HHOD 5F7HA 3CZJA 4KVCL 3ARBC 4YBQC 1Z6JT 4PRIE 1J0JA 4XNXH 5JHDD 5DZOA 3QEQE 1CFVL 4WWKB 5CEYB 5F1IA 2QSTA 1BFTA 3EFFB 3PL6A 1U8PB 1WT5C 1VACB 3K46A 3OKLB 4KI5E 2CJUH 1U42A 1F58H 1ADQL 2QQLH 2EKSB 1HQRA 2X7LB 3HI5H 5C07D 5DHVB 4BSJA 3GBMH 3FB6B 1FCGA 1KELH 3ZDYE 3T3PE 5A3ID 3Q1SL 1B0GA 5EWIH 4M7JL 3HG1B 4L3CB 3DBXA 2I24N 5AUMA 3WS3B 1AIFA 3NAAL 1HXYB 4JRWA 2J8HA 1WFOA 2Z92A 4NGHL 4M3JA 1U8IB 4ESKA 3K0WA 5DSCB 3NCYP 3VXOB 4X6BB 2NW3A 1N26A 2NX5B 2BCKB 5SX5H 1ETZA 1FBIH 4P3CH 2C3XA 1YC7A 4Y4KA 4P59H 1FNGB 3T65B 2DQCL 3RNKB 1OQXA 1L7IL 5FK9B 1A9BA 2BFVL 2Z31C 3WJLA 2VE6A 5CJXC 1M7XA 1F4WL 1KB5L 3RIFK 5SWSD 4KROD 3TVMC 4QHKJ 1RU9L 2W0PA 3MNZA 2CH8A 2UY7A 5D96B 4WGWB 4Y19A 3OAZK 2XZCL 5HVHB 4PRBB 4CVZA 5I9QC 3PWPD 5FCUL 3B5GA 2IADA 2YK1H 1T66D 1A3LL 1U3HB 4HS6A 5IVXF 2VRAA 3RTQB 4G8IB 3GHEL 4NSKA 2RFXA 1OWWA 5ELIA 3SJVE 5FHAL 4NIKB 2R4SL 4KZEH 2HWZH 1QSEA 3EO9H 5TDOB 1D5IH 3BZFA 4MQSB 3ULVE 2BNQA 5DD3L 4WHYG 4F7MA 1X44A 5CP7B 2E5EA 3FB8A 2EH8H 2DKMA 4OV6F 1T1WA 4K94L 4YHZH 1WTGT 3WFBL 1KLGA 2EE9A 3RHWF 1RMFH 2PYEA 2FO4B 1I4FB 2WQ8A 1RULL 4MD4B 2JJTC 5E5RB 3VRLE 4FHBD 2V7NA 1BMGA 4WFGE 4EOWH 3IYLW 7CGTA 3LV3A 4U1JA 1HXMB 5TDNA 1ZLUH 2PO6D 2ZNXA 5GRVK 2AJZB 4P2YA 4CKVX 5I1IH 2D31B 5IMMA 5AD0A 2RFXB 4O2EB 1DBBL 2EIZB 5CZKA 3ZHLA 3SDXE 2GCYB 1NFDA 1DLFH 1NLDH 4J3TA 2P7TA 2JCCB 3NZHH 1NAML 3MUHL 2CRIA 3VW3L 1P7KB 4EXPX 3BXNB 5IB4B 2FEDC 3HC3L 4MNGE 4X7FC 4XWOD 4PY8J 3ME0A 5CEZD 4RGOH 1JBJA 1G6RL 2XZQH 3GK8L 1AHWB 2AJVH 3BESR 1B6DA 3WEXB 2C3WA 4PG9B 3HPLA 1AP2B 3PWVB 4X4ME 4ODTH 5T1DH 3K2MC 2P44B 2R0LH 3HC4L 5TE6H 3UROR 1WICA 4RZCB 5GGRB 1INQB 5LGKA 1MHCA 1IT9H 3I3EA 3FQRA 1YEHH 4PJCA 3O3BA 2I5YH 3N85L 4OKVA 1UT9A 4IRJD 3PHQA 1ETZB 2VITA 2VLLA 5KVDL 3VFPA 2NW3B 2HVKB 5JA9A 4FRWA 1AKJD 3ARGB 1IARB 2ZUTA 4OZHB 5JLZA 1W0YT 1FLRL 2EDQA 3QPXH 5BVPL 1ACYH 4OAWA 1YA5A 4FQJL 4XNYH 5DD5H 5K9JL 1MAJA 3KG5A 4Y4FC 3ROOA 2UV3A 4WI9A 3TH2T 1JGUL 4P57B 1V3LA 4LOUC 4OM0L 2WUBL 2OR7A 5FYJE 5DS8A 5BOZG 4K8RC 3C8KB 3ZHKA 5T1LA 1ONQA 2J88L 1J8HB 3SE3A 4QOKE 4OLZL 2J5LB 3N50A 4X99B 2D7TL 3WIHH 3REWA 2M8XA 4MXQC 1FV1A 2FSEB 1LVEA 3RWCB 1QZ1A 3BW9B 4Z7VE 5B3NA 2UWEB 4HUWA 1XGRB 4PJDF 1JWMB 2NZIA 4FXGB 3QHTC 5KJRH 4K3EL 1GGIL 1C5DB 4X9BA 3P77A 2DDQH 3WS6C 3D3VB 5IF0A 5HHOB 1D5XB 2DQHH 1UXSA 4DW2H 3PHOB 1ZHBA 2R2EA 4KUZH 1BF2A 1AO7A 4TUKL 3O9WC 5GGSY 3U1SL 1P9MA 5FUOH 3RA7H 2Z35A 4M7KH 5E24E 5IMKA 2P5WE 5DI8A 4ZQKB 5J6HB 2XWBB 1N0XH 3UMTA 5DJDB 3KXFD 3BKCL 4LVOC 1G9MC 2XWTB 3FFCD 1FH5L 5DUBB 1DL7H 2IF7A 4NFDA 5I1HL 3CFKB 2VDOL 3GMMB 5ID0B 4FQLH 3P4MB 2YOCA 3ROLA 2GIYA 3ARDD 5ISZD 3RL1B 1C5CH 2DQJL 4MCZB 2W38A 2CO7B 1OB1A 1XGQA 4JFHD 5C9KA 4AIXA 3D2UD 4Y4FA 5BV7H 1H15B 3K74B 2H26A 3ULVF 3L7EB 3CZFA 1G7IA 3SE9H 3KPQB 5HVGB 1WVZA 3CIQA 1SVCP 4PLKD 5EUOB 1YQ2A 3MCG1 1JVKA 3MV9D 5I1EH 2B5IB 5EU6A 5EUOA 1S5HA 2WWMD 4FQXC 5HYIA 1G7IB 4XNUL 5H94A 1H15A 3FFDB 1LK2B 4N8VA 3AB0B 1FGVL 1QRND 1BLNB 1I7TA 1T5WA 4P4KB 4Y5YA 3RUGB 3G6DL 4BSWA 4GG6E 1MFEH 3BP7A 1BF8A 1MFBL 4KJPC 1QFWL 3OXRB 3MOBH 1B90A 5KVDH 3RL1A 4XTRC 4X6DE 2VIRA 1CLZL 4H1LH 4LAQL 4MA7L 4BQCA 4M8VA 1U8JA 4X4XB 1N4XL 1MVFA 3MV8A 4FXKB 4MJ2A 3P73B 1CGSH 1IRAY 1RZFL 4GRWF 4H88H 4LARH 3X13A 3RGVA 4JFZH 3L3GA 3VFUB 1BX2A 2ADFH 4P9MH 1P6AB 5IV2A 1KNOA 4GW4A 1KN2L 2XWBA 3TV3H 1NGWA 3UPAA 1U8QB 2JTDA 1SYSA 5HHPA 1U8LA 4XXDA 3CFBB 4UNUA 1M6OA 3PIQB 1AO7B 1U91A 4NZRL 3THML 1CXIA 1G7JA 3DX6B 1TPXB 5EIVA 2FYYB 3FZUC 1JV5A 4J8RB 1ODAA 4WFEE 4WHYH 1NC2B 2I5YL 1MUJA 4IRSB 1L7IH 1NGYA 2YN5A 3RTQC 3QG7H 3OTTA 3KYMA 1C5DA 3VFWA 3H9SB 2K7QA 1PEZA 1A14L 3EFDH 1JWMA 3G5VB 2BVPB 1MJ7H 5CIPB 3UP1A 4P4KC 3WFEH 3T0EB 5KSBE 3LEVH 4FTVA 1X4XA 4X8JA 5DUML 2JB6A 1FL6A 1KC5H 2P8PB 4G5ZH 5SX5K 2ZJSL 1MRCL 1JPSL 2XZCH 4YR6B 3C8KA 2ESVA 1N5AB 4JKKA 2FWOA 3OHXB 1EMTL 2CXKA 5D7IA 1IGCL 1ORSA 3GSUA 3I02A 5HYJA 1M7DA 4JHAH 1L6ZA 2VZVA 3BKCH 1IGMH 3ROOB 3VG0H 4ONFL 7FABL 4UQ3B 1RUKH 1RV6X 1A4JB 4PJGF 4HIEA 3PABA 1G9EA 4OZFB 4GKZA 1N5YL 3TJEL 5C09D 2B1AL 2B1HL 2PR4L 4G6KH 3VFPB 3MFFB 1K4DA 3LHPL 2E9JA 5BZWA 1MY5A 2OQJB 3O3BB 1HN1A 1KCSH 5E8OA 3VDCA 4X5WB 4P48A 1YEEL 4FG6C 4LMQE 4JVPA 2FJGB 5HHXH 5HHMB 3MRDA 5FECA 5HGHB 3UBXI 4DK3A 3HPLB 4M1CC 4PG9A 5I17B 4ZUTB 4NKOA 3LKNB 2FIKA 3FO1A 2ITDB 3HLAA 4TOYH 4U7MA 5FYJU 3RWGB 5ADOL 4JDTH 2J6EL 1E28A 2ZG2A 1KLUB 1RURH 2GQHA 1JMXA 1P7KA 4F7EB 3GMPB 1UWGH 2VXVL 1H5BA 5IQ9A 1CU4H 5E1HB 1XF5B 3V6FA 1V7MH 3GMOB 3BMVA 1PX4A 4ZO8A 3TO4A 4HFWA 1VB9A 4J4PA 4N8CL 4R4BA 4RMWA 1LE9A 5JIIA 5JUEL 1J5OH 4M7LH 3MNWA 5JPNB 5DRWA 1L7TL 2IH3B 4C56A 4OD3H 4RRPA 3GSNB 2G2RA 2V7NB 4HD9A 4L3AA 4ORGA 2YD7A 5C2BL 3HNSH 2VZTA 4KMLB 3S98A 4LFHD 1CDBA 2VDKH 5CCKL 1YPZA 4PRID 1NC2D 5I66B 5I16A 1MREL 1B0RA 4P2OD 5FGCE 3MRQB 2IQAB 1XCTB 5IW3A 1FE8L 3MJGX 1IFHL 3BKJH 4DZ8A 3BPLC 4KK9C 2JK5B 5H35B 3FMGH 4L1DA 2HT4D 3CH1B 3KXFB 4WW2A 2YPLB 1JGUH 1S7VA 2CIIA 3QIWA 2P5ED 2P46B 1ED3B 2HKHH 5IVZB 1BFVL 4PJ7F 1RK1A 3MJ9L 1QSZA 4FMFA 2D3VA 2OMBA 2GTWA 4GAJH 4U31A 4U6VH 1DJSA 4WI3A 4DFHA 1YEJH 3CLEH 2DQUL 2IGFH 2A83B 5EOCJ 1JK8B 3GO1H 5C0GA 3BP6B 4TVPL 3QEGL 4JDVA 4YAQA 4YJZL 4ODVH 5DA4A 1QRNB 4P4KD 1YN7B 5ADPL 4N5ED 4JY4B 4QKXB 3EYOA 5ESAA 1K5NB 5HYFA 2HJFA 3VU2A 4QTHB 4ENEC 4M6ML 1IM9A 1KT2B 1EUTA 4TUKH 2YRLA 4DVBA 1F5WA 5DVNA 3CPLA 1YC8A 5BW7A 4KPHL 3CLFL 1I7RA 3B9KA 5A2JH 5DSCA 1HK6A 2D03H 2QSCH 1YDPA 4RMQA 1BEYL 4F37F 4H5SB 5GISL 4MNHA 4MLSA 3ZO0A 1S9KC 3QIBA 4JRYD 3HG1A 4L3CA 4OUUA 3U82B 4MHHG 4GRLD 2H45A 1OGAD 4N8PA 4PRAA 3FTGB 1K3IA 5AYQA 4HJ0D 5IMOA 2YC1B 5CJXA 5EDXA 5F72S 3HB3C 1RJLA 3D48R 4EI6A 5FOJA 4PLOB 2KDGA 2XTLA 5MP6L 3DMMC 2B4CC 1Z9OA 4TN9A 1S9YA 2V5TA 1SM3L 4PJ9A 3SE9L 3UEZA 3MLWL 1J1XL 5MEOB 4YGVB 5I1GH 5T3ZL 2R2BA 2I07A 2BSTA 3D18A 4MX7A 1I9EA 1GOHA 2R0ZH 1M05B 1MVUA 1WCBA 2YMXL 3G6DH 3FT2A 3AAZB 2FEEL 1JNNL 4MD5B 4EUPB 4LDOB 4U1SB 3Q3GB 4S1DD 4D9QE 5KSBB 1BZ9B 4I2XB 3QXAB 2ICWJ 3UPRB 2H41A 3ZKXB 1F6AA 2XZAH 4Z7WE 5D70H 1FZKB 3ARDC 1WEJH 3IDYB 5DJCA 1KUMA 3AMKA 3VRLF 4KI5C 2ADGA 3RVVC 3ZTJH 1W72B 1CGSL 1DFBL 3T1FA 3A6CH 1GXEA 1OAYL 1HHIA 4KHTL 5D71H 5BOPA 5ANME 4HLJA 3QH3A 3S3JA 3W82A 4PJ8A 3SE4A 5BJTB 2NY4B 4RWYH 3MJ9H 3QJFA 3AY4A 5IBUB 4ZODA 1BQHB 5TQ0L 3SGEH 5E94A 3QAZB 2FJHB 4I48A 4PBXA 5E2TL 3EO1B 1EA9C 4UTAH 1HYSC 3OG6B 5EZJB 3EGSB 3LEXB 2Z8SA 3B5HA 3MRPA 3MV7D 1TETL 2ZOKB 2MCPH 5F9WC 5C2BH 3FQTA 2P8MB 3MJ7B 1MI5D 2RIKA 2O5YH 3VH8G 4WHTA 1E4XL 2BC4B 3TF7C 1T1ZA 1IAIM 4N0YH 1YYLL 4O00A 4CW1B 2IPTL 4PRDB 2FHFA 2DQCH 4RQQA 3RUGE 3SGDI 3P2TA 1IKNA 1BECA 2LAAA 3FQWA 2Y07L 3V0WL 3QI9A 3ARFD 1MJ8H 2AJYH 1IAOA 4KHXH 3UJTH 3IB4A 3BWAB 2DQEH 2VQTA 4FQLL 2NY1C 3MA9H 4PY7A 3TEUA 4CVXB 5DRZB 3TIDA 2A38A 1J05A 1P4IH 1UWEH 1PKQE 4MJ4A 3SKMB 3PL6D 3V5KB 3IU3A 5CEZE 2ICEB 3KPLA 4IHOA 4PV8A 3QO1A 5IQ7H 1RSFA 3VGHA 1U95B 4KK6C 1BBJA 1TQBB 4IMLB 3GMRA 4M5ZL 1X5HA 2FHCA 5EIIA 4KU1A 5EU6D 4AIZA 1LEGA 2B1AH 1C08A 2PR4H 2VR5A 3UYRL 1MLCA 3HUJE 1DANT 5IT2L 5HHVH 3EO0A 4NCC2 3U7YL 1KIRB 2NXYD 3T2NL 5KN5A 3NCFB 4POUB 3ARWA 5I15H 5EU5B 3VFNA 2XOTA 4HZLB 4JO1H 1XF2B 2J6EH 4N1HB 4YBHA 1U2HA 3ZKND 4LHUD 1KJ3L 3MGOB 4Y4KD 5LG1A 4KTDH 4MQXD 5DK2B 1R3HA 4QOKA 2W65A 3MFGB 2FB4H 1EAJA 4XCFL 3VRIB 3HI5L 1WUNT 4JFDD 2MSPA 1RVFL 4XMPL 1F00I 3ZE0E 3FB7A 3MV7A 1MHEB 1NJ9B 2DI7A 3U6RA 4OJFH 3GSXA 3E2HB 2NY2C 3MBXL 4P49A 2A6IB 1WLHA 5IBTH 3WNNA 5KSVA 5HD8C 1PG7W 4DFIA 2F15A 4F15C 4P2RE 3VI4E 2QQQA 4OFKA 1WIOA 4LGPB 3AY4C 2X4TA 3VFRB 3LQZA 2YKLH 3F7YB 2OYPA 5KSBF 1NBYA 4JM4L 4GBXC 4P9HC 3WXWL 2CDFA 4LVNC 3CCHA 4Y4HA 1DE4B 1INDH 4GSDL 4LVHC 2R1WB 4LSQH 2Z31A 3U4EB 4HWEH 3IJYB 5GGUB 3CNKA 1FFPA 5FGBA 4Y16B 5TE4L 1KG0B 2P5WB 4OZGA 4ZD3H 3U4EA 3QHFL 2VLJE 5EUOF 2R1WA 2VYRE 4U0QB 4D3CL 4L4VB 4YDVB 4L4TB 4DN3H 4G6FD 5I1KH 4OD1L 2ERJC 1M71B 3QDAA 2A73A 4POZC 5ICXA 2ZOLA 1ACYL 2MPAL 3L9RA 2DM2A 1GL4B 4LGRB 2DTML 2R29L 3ULVH 5J11B 3BEWA 2DQGL 4X7DC 2YPVL 2F53B 1TCMA 4ZUSB 5BXFB 2ZNWA 1PD6A 3IXAB 2CUMA 2VAJA 2EYTA 3WV0A 2X70A 2IGFL 4J23A 4PJEA 1NDMB 2A77H 1X5KA 1XF3B 4JQXC 1EK3A 3K8LA 3VDBA 5IFHH 3OKMB 3GSXB 4ODVL 3MUY1 1RAMA 5IHZB 4I18C 5DD3H 4PJ9C 3BWUC 4P46D 1GIGL 5TGBB 4IBLT 2YZ8A 5I1DB 4ZFZB 3O6LL 1ZT4B 5EOQL 1NL0H 3IDGA 5LGHH 2W65B 1P7QB 3RDTB 3OAUL 4G42A 5J9PA 4NNPL 3VXRB 1JGDB 4JZNB 2HKFH 5FOBB 2VAAB 3OQ3B 2DLIA 1XH3B 5D4QA 3GSWB 4J12A 2A74B 1MCNA 1U8HA 5GJTH 2CGRL 4YFEA 2GSGA 3RA7L 3X3GL 5EO9B 4MAYD 2HTKD 3UJJL 3ARDA 1QA9B 4E9LA 1QHPA 4P2RB 2HJKB 4RSVA 4PGBB 1PSKH 1PG7X 3UTZB 4LCUA 2EDXA 3O45A 1CL7L 1RZIA 4K7PL 1UB6B 1OAZH 4FMKA 1YMME 2UWEE 1AD0B 5B38B 2H8PB 3JV6A 3C60C 5ITFA 2FATH 2NZ9D 4IHOB 3SJVB 2F53E 1HIMH 3ULUF 4S11A 2IANE 3SKMA 3AS2A 1T83A 4QXWA 1EFXB 4XNZC 4XAWH 3BE1H 4L4TD 2FLRT 3CFCL 1OTTD 3H42L 3WNLA 1A1NB 3SKOB 3H9ZA 5DWUL 4RISL 2BY1A 4X80L 3HC0B 4HV8B 4NUJA 3WFDH 3IS1X 1BJMA 4JRXD 4UIMB 3S37L 2ERJB 5AZ2L 3O3EB 4BFBD 4GXUN 4XVUC 4WEUD 4Y19D 5L88L 4GW1A 4LF3B 1KOAA 5FGBC 3SN6N 1NMCC 5HHNB 2QLVB 1IGTA 4BH8A 2XN9B 2HTLD 3FO9A 5E8PA 3G5ZB 3A6CL 5EO1A 1T7XA 1OTUC 4JFFE 3TBSA 4U1LB 2AJXH 5EBLB 4I48B 4X9FA 2IBBA 1I85A 4ZSOB 1IC1A 1U3HD 1P7HL 1UEMA 4DJMA 3QA3B 4UT7L 5CKGA 2WIMA 1N8ZB 1OW0A 3OAZH 5A2LH 1EXUA 5E2UH 5F9AC 1FVEB 5H2BA 3UTSA 3VXME 3WIHL 5C71A 4G9DA 2VUYA 1A7QL 3NABH 2C1PA 3SGKC 2YUWA 1BP3B 3VD5A 4HGMA 5J1SC 1P4LB 4FFWD 4EI5C 4KRMB 4AM0B 5JDSB 3DXAB 2YBRA 3KPNB 4YX2H 4Q9QL 1WBYB 3QXAA 4R4NC 3O9WB 4ODWA 4HHAB 4MA3B 4U6YA 4YDLC 1J1PH 2YUVA 3H8NA 4PRNA 3QDMB 1GGBH 1F4HA 3T77B 2C1OB 4UTBH 1OAXL 5JDSA 1FAIL 1KJ2H 1MVUB 1EHAA 3GBNH 1BQUA 1A6TA 4OGZA 2OZ4H 1T5XB 3VRJA 2R23A 4UILH 3CUPB 4FNLH 1NANH 4HUNB 5LJYH 4R90H 5A2FA 4HGWA 3LQAH 2Q8AH 5F93C 1PYWB 4HZAA 1B2WH 2H2PD 2AVGA 3VI4F 3WN5C 4F33B 4NKDB 5F7DA 4HC1L 1BZ7B 1JTPA 5EBLA 1PAMA 1PKQB 4XP9H 4QRRE 3DWTA 1AY1H 1XGUA 3BUYB 3SKJH 1EEUA 4QY8B 1E6JL 4PRAB 1OTSC 1KENH 3GNML 3ALXA 1QSFB 5EBGA 3W9EB 5ACMA 2XA8L 4QTIL 2BOCB 2V9TA 5GGQL 1TVBA 3KJ4C 3TA3D 3LDBC 4BSVB 4IIQA 5I76A 3F58H 1GJIA 5F3HB 4PV9A 3MQIA 1OAQL 2GK2A 3NGBC 3O41A 4LCCC 3HC0A 4HV8A 1CE1H 3LY6A 2VISB 4MZ3A 1F11B 1CD0A 2NY6B 3CLFH 3O8XD 2LABA 2Z4QB 4UBDC 3NIFE 3IFOA 3UTQB 1CICA 3SPVB 1IM9B 1KT2A 5HGBA 4PJBA 4LPXA 2E7HA 2VXTL 1OAYH 1X6LA 2DYPA 4Z7VF 3F6IA 2JIXB 1DBMH 3SGEI 3CU7A 4PJDE 3JZ7A 3IFNH 3SJVA 4S1SH 4A2LA 1JK8A 1LP9A 1OP5H 4PJAB 2EDTA 3OJMB 4H8WC 4UV4L 1QNZH 2J8OA 3ILQD 3TM6A 3DHJA 4Z7UF 4HUMB 5I1CL 5IUSA 1QA9A 5HYJD 1LD9B 3ULUL 4WENB 1SEQH 3QWRA 2ZKHL 1VADA 1YYLH 4XPHH 2WP3O 1OAKH 3RIFF 3QUMA 5ERWA 3KJ6H 3OXSA 5DMIL 2H6PA 5CD5D 4R97B 1H9VA 5I71C 1W0VB 1P5VA 3AREC 3I50L 4Y5VC 5ERWB 2VLKA 5BVJA 2UZIL 5DJ8B 1AGBA 1LO3H 3BIKB 3GJEA 4E41A 4JM2A 4XBEH 1ACZA 2P5EA 2JB5H 5DMKB 2VLRB 1ZGLB 1XIWD 3DV6B 5JDJA 3WIFA 4R7DB 4XPTL 2PTUA 4NUGL 4YQXL 4X7SL 3ZE0F 2GAZA 2HLFD 1Z9LA 4HSQA 3VWKA 4UILL 1L0XA 2JLLA 4NPYA 5T5FH 4ONFH 2BERA 7FABH 4UV7H 3QNYA 1KF9B 4R96B 3MLUH 2AXGA 3O4OC 4NN6C 4Z7WF 3IXAA 4HIJA 3T3PF 5A2IH 3UDWC 4X6CA 5A40E 1X3DA 1N3NB 3FQNA 1B6UA 5FYLD 3LN9A 3MV9A 1BD2D 1RK0A 1FVDB 3EJZD 3VI3E 5F44A 1T1YB 5CEXB 3SBWC 5E5MA 4ZTOH 1U9KA 3QQ4A 2EDNA 1E28B 2P5WA 4OZGB 2HVJB 4L8DB 2ITDA 3HLAB 3R4DA 2WANA 3CC5B 4GKNB 4XGZA 4QCIA 2IAMB 1TZHB 3GM0A 1XCQA 1ZLWK 2BDNH 1QSFA 3IJSB 4GRLA 3O6ML 3LB6C 2X4OB 1OTUD 3PQYA 3WD5L 3X3GH 2FD6L 1P84J 3JWDC 4X5WA 4KAQH 4PP1D 4S1RL 4N9GB 2CXGA 1FO0L 4NHCH 5CEZH 1X5YA 3VFGL 3WDJA 5JPMB 4DTGH 1JWSA 3DV4A 4U1IB 3ZTNH 4OLUH 4TVPE 1ITBB 3HE7B 5DHYB 4M43H 1I8IA 1T0NA 1A4JA 4Z9KB 4HGWB 1NJ9A 4K23H 1NH6A 3O81A 5A16A 1FFOB 3GB7B 5IW1A 1S8DA 4WWKD 5B21A 4HF5H 5C08A 5LCVH 2FWOB 3WHXA 5T1MA 3C2SA 2C1OA 4LP4A 4L9LA 1P1ZA 4K3DH 2FBOJ 1MPAH 4MJIA 3OR7A 1PBYA 3C08H 2OP4L 1G7MB 3KPSB 2AP2A 3IDIA 1QFUL 2XKUA 1K6QL 1DEEB 2O5ZL 3M17A 3WCYA 1Q9OA 4DN3L 1AKJA 4M93C 4R2GD 4F57L 1DQDH 5ENWB 3MNVB 2ZCHL 1OGTB 3LKQA 3QXUA 4XNUH 2ZUVA 4IEFB 3LKPB 3KDMA 3NIFF 1WZLA 1ZHNA 2EH7H 4PG2C 4OCYH 5ESQB 5EZIL 1HDMA 1XGYL 1IGYA 2DMCA 4HKXB 5DUPL 5D70L 4KTDL 5JW5B 5E6IB 3F7PC 1TQCC 3LN5A 4XZUB 4KK8D 3GMRB 1J0KA 3QPXL 5BVPH 2UUDH 2NY5L 1QYGL 5GGRY 3MOBL 3P11H 3CVHA 4U3XA 1YEKL 1NGWB 3HI6H 3MBEC 3WN5A 4LLMB 5E8PB 4ORZC 5IJVB 5C86A 2CLRA 1E27A 3U48A 4XMLL 4N8VG 4CVXA 2X4RA 1JF1B 4YC2B 4PLNC 3V7AE 4RIRB 1BM3L 4OFVA 4JE4B 5K59F 4CUCA 1Q0XL 3NZ8B 4O5LH 3S37X 2HRPL 2XA3A 5E4IA 1MCFA 4JRYE 1YQVH 1X5LA 3DGGA 3KLDA 1NCCH 5F7KC 2YSSA 5FDWB 4C54A 3NA9H 3MJ8B 2P45B 1OM3H 1CDCA 4U6XB 2BC4A 4XP4L 4P3DA 1EJOL 5MI0B 5FYKH 1C7SA 5DK0B 3X14B 5C0NC 1CR9H 1FPTL 1R3IL 3EO1A 4KY1H 5DXWA 1AD0A 1IILE 3RWIA 2EDLA 5ALCH 3ZDXF 3V6OE 4XH2A 4Z7UE 2X05A 1XGQB 5EBMA 3VWJC 3CFIC 2BHZA 4UB0H 1BQLH 3QNZB 2HFEA 3SY0B 1DL7L 1FG9C 5EO9A 1DVFA 2OLDA 3BUTA 5GIRB 4QRQA 4XPAL 3GMMA 4LGSB 2AAVA 5CINH 2VR9A 1CFTA 4RGNE 5MP6H 3G08B 1C16A 3B3IB 5E2WL 4X6DF 3EYUL 4GMSH 1Y0LB 1KSRA 4KK5C 1DEEA 4KI5D 4BKLA 4NRYB 4FOMA 1NMBH 3VXRA 4OZGE 4EUPH 5KSBA 4EUPA 2FGWH 2Z35B 4ONGH 3OF6A 1TZGL 4MD5A 4G6KL 1P1ZB 1OSZB 2JE8A 4ZYKB 2WINA 4U1HB 3EOAB 5I1DA 4N68A 1JZ3A 1MI5A 4OCNC 2LVEA 3QIWD 3EW3B 4UUJA 1CS6A 4XP5L 5HHOA 3UAJC 4NZDA 4R6UA 5D2NA 1F4YH 2QHRH 3BIBX 4AY0A 5A3IC 2K3TA 3I2CL 3JSSA 5DJZB 1E4KA 1M1SA 3TH4T 4NBZB 1EEYA 5DHYA 2VXSL 4H20L 1FJ1A 4JFXA 4QNPF 4DEPC 1WEJL 1LO5B 4OSUH 4YFLF 5GJTL 5I6XB 5BMFL 1LMKA 1QUNA 4W68A 1QFWH 3M07A 2ADJB 3V4UL 2NMSA 1YEGH 2XQBL 4GS7C 2DL9A 4K23L 3VI3F 1F3JB 4OFDA 2QQNH 4MCYB 4HG4J 5KOMC 1I75A 5E9DB 2OM5A 3INUL 4LP5A 1SEQL 2SEBA 4QYOA 1GC1C 3CSYB 5IW6B 2IAMA 5GS1B 2BVTA 32C2A 1A6AB 1KGCD 3CC5A 3HUJB 5F8QC 3OAYK 4KTEH 3TBWA 3WSQL 4NN5B 4FFYL 1ND0B 4NZRH 5CJOH 1MWAH 5SWZE 5CEXA 3MV9B 1G9NC 3WNKA 4WUUB 4LRIA 4HUVA 2YPKB 2HJFB 3KNBA 4OV5B 1D5MB 1GGCH 4RZCA 4AJ0A 4NQXA 4LBEA 4WHDA 3U7WL 5CMAB 5CFHA 3CGTA 4RFEA 4Y5YC 3LQMA 1UH4A 3GSNL 1FORL 2HJLA 2D7MA 5GSRB 4OF5A 1FL3A 2XN9D 5T5FL 5EUKA 2C3VB 3G9AB 3E3QC 4U49A 2IBGA 5JW3L 1YEDB 1MCJA 2H32H 4N0FA 3NOIA 4XB8A 1KN2H 5HVFB 2G5BA 3HTLX 3TZVC 1K2DA 1S7WA 2BVOA 1TTUA 3V5HB 4FP8H 3S5LA 1XMWA 4YHLL 2AQ2A 4XP6L 1U93B 1NBVH 4M48L 4YHKH 5I6XC 1P4BH 3QUZA 3WE6A 4M3KB 3OPZH 4ZTOL 3ORJA 1REIA 3MACH 1U3HC 1QP1A 4HUKB 3RQ3A 4AIOA 5F9JB 3GFUA 3TN0D 2ZG1A 3S35X 1CD1A 3V7MA 1HEZB 3MRHA 4XXCA 5TDNB 4ZG1A 3P0YH 1I7UB 2NX5D 1I3GL 4BH7B 5CZXC 3VMOA 5J3HD 5FO9A 1HH6A 2Q8BL 4NNPH 1R5IA 1RZKH 4BZ2L 4PJ7E 4LPYA 4MA1B 1MCIA 4OTXH 3E6FB 4PRHB 2RR3A 1KLGB 2FGZA 4LASH 2VXUH 4JFFD 1LE5A 5ALBH 1FO0A 3IDMA 4NYLB 5EIIB 1T1WB 3VXMA 3LH2L 4PJAA 1OAXH 1GH7A 3E0GA 2FB4L 3UTPD 1JPGA 3MZTA 4P5KA 4MNQB 4JAMB 1QSEB 2CRZA 5TDOA 2E27L 4QXGL 4M8QB 5L2KA 3DSFH 5I8OH 4H8WL 5F96H 5EG6C 3MOAH 1ES0B 3HMXL 4PUBH 3GMOA 3CXDH 3BWAA 4PJAE 2XICA 1GPOL 1H5BB 2F8XC 2C9AA 4R7NB 4RFNC 4YH6A 3MR9B 2FRGP 3BP5A 3O11A 1PZ5A 4OQTA 4D0BB 3LHPH 1XGPA 2NY7H 5IFJB 4PY8I 3FRPA 4GRLC 1K6QH 3BP4B 1N6QL 4DZBB 3Q6FA 1N2RA 1T2QL 1QTYT 3FO1B 4PBVC 3LKNA 1OT2A 1L7TH 5F1NB 3MCKB 4KMTH 1RIUL 4QRSA 5TE4H 2EXYC 4QTIH 1UYWL 3H9HA 3W39B 4NO0D 4LLYB 4XP5H 1RZGB 1VEOA 4LAJH 4HJ0C 3T65A 4Y4KB 3L5XL 4L3EA 3ILPA 4IRJC 1OL0A 4PRHE 5GQBA 3TZVD 1BZ7A 3V0VA 1V7NH 1D5BB 3MJ6A 1QYGH 1T2JA 5D72H 2A0LC 2YPVH 2MJWA 4XNQA 4CNIA 2Z92B 3NH7L 4XC3L 1ADQA 1F58L 5T1LD 3MLZL 2G9HB 4MNGB 4QHNA 4Y5XC 5D1XA 3NGBB 3CUPA 3MTRA 5DDHA 5TDPA 4QT5A 5D6CA 3STZB 2FX9L 4S0SD 1R3LA 2KKQA 3KYKL 5I0ZA 4L3EE 1N5AA 5E03A 1HKFA 1DUZA 3DOSA 5T3XE 4OZHF 1NC4A 4HIXH 1IBGL 2EKSA 4HHAA 4MA3A 1NFKA 2DQUH 5IHLB 1DP0A 2WQRA 2QSQA 3IRZA 4QGTA 5HI4D 4JO4L 3ZDZF 3PL6B 4JN1H 3QDGD 3U9PL 3T0EA 4LHUG 1MWAL 5C0AE 2CRMA 2A6DB 4Y7MA 3CFJB 2V6HA 2BVPA 4MNQD 5CD3B 2OZ4A 5T1KA 3CMOL 5ISZB 1DBJL 3BPOB 1HHJA 4M6MH 3VXSB 3FCTA 3QXDB 1JPFA 4IRJB 2F54A 4KUCD 2CGRH 3HG1D 4P5MB 4RGMB 3T0WA 3IVKA 1F97A 5ACLA 1FORH 4WUKL 4L9DA 3RGHA 2Q6WA 4WW2C 5F3BA 1U8QA 1PY9A 4HWBL 4WY7L 1JHTA 1U8KA 4JM2C 4HT1L 2VDLH 3OJVC 4YQXH 3FTGA 1W0WA 3CXHJ 4K2UH 2IBZY 3DO7A 3IRPX 3GHEH 5HHNA 3MRJA 2XN9E 3D87B 4ZOAA 3KLHC 5D7JB 4JG0H 3OKDA 4D9LH 1A3LH 1I85C 3GMNB 2A6JB 2VZOA 3PJSB 5MENE 1K8DA 3MLVH 1AQKL 4MZ2A 4Y1AA 1GC1L 4QF1A 5CAYB 4MMXC 4LIQL 4GXUM 4P3WA 4PGCB 1BJ1H 4ODBD 2PYEE 4K94H 4Y5YB 1YN6B 4RA3A 4YHZL 4ELME 1KJ2B 3BH9A 1LK2A 1CLOH 4RDQG 4Y89A 4YK4C 3WFDL 2BNQD 4DGYH 5MEND 1EFXA 2Q20A 5EC1B 2WWMC 3O6FB 3D9AH 5L0QB 5HI3D 1HHHA 5BV7B 3QULA 5I18L 2LU7A 3CVHL 3UTZA 2CO6B 4P9ML 1D5ZA 5I1IL 2EO9A 3BH8B 4KAQL 4KROC 2IC2A 4KKCD 3LKSB 2W59A 3MV8E 1YY9C 2R69L 3HN3A 4P2QD 1AXSB 5JQHC 3DRTB 3B8SA 3JWDH 4RMTA 1Q9WB 3HFMH 1S7VB 3QIWB 4QWWC 2CR3A 2YPLA 4I18B 4XC3H 3Q1SH 3TIEA 1OARL 4JPKL 2MTPA 2IFFL 1YECL 1D7FA 4WFGD 1FYHB 1S7RA 3MUGB 5IBTL 4Q9CA 4XCNA 4ZUUB 1U3ZA 1NCCL 1SYVB 1A1MA 4WV1A 4ZPVA 3WO4C 1OAKL 1JNJA 3LZFH 4WFHE 3RWFB 4PTTA 5C0EA 3UBXB 5I1JL 3RWJB 1JGVL 2GI7A 1FAIH 3L5XH 2R56H 1CFNB 1FL5A 5D1QC 1OT1A 4IIQC 1FPTH 4KY1L 5E0QA 1JCKA 1ZA3A 5CGTA 1XF3A 1BFVH 4K71B 4JG1H 4HQQL 4JVUA 4ELMF 3PGCB 2X1WL 4GW5A 1QSEE 4PJFB 4X99A 4OF0A 3DMMD 3ARSA 3LCYA 4LHJB 5IG7B 4NN7C 1JN6B 2PF6A 1M71A 3TYFB 3UO1L 4KZDH 2VUOA 1T83C 1ZAGA 1VKXB 3GSVB 5FHBL 4JFPB 2J1KA 5GS0L 3TVMD 1IKFH 3A6BH 4YK4B 2H9GB 4QRRB 3ARQA 3QPQC 1EFXD 4GJTB 3HI6L 4OZ4A 5C1MB 1YYMH 1MCBA 3E8UH 4DGVH 3QQ9D 4NHUB 3E2HC 1AY1L 3IJHA 4K3EH 1AO7E 4NC2B 3IKCA 3ARGA 3T4YA 5DTFB 2NNAB 3MBEA 4LLWA 3TPUB 5KSAB 2VLLB 2DQHL 1GGIH 1D3CA 2I27N 1DQQB 2Q8BH 5DEFB 2HFFB 1Q1JH 4OCXL 4LIQE 3VFRA 4LCCB 5CZXD 3WKNA 4L29B 4YHPB 4RMRA 1K4DB 3HAEG 1HKLH 4ZTPL 4F9PA 5ACZA 1JNLH 5ALBL 4P2QA 3PWVA 2Q1EA 1DVFC 3IKCB 3EYSL 4KROB 5L2JA 4HLZH 1N0XL 3TESA 1UM6L 1FZJA 1ZVHA 1KFAL 3K80A 4B53A 4PJ5E 3L3OB 4WEBL 1B88A 4KJWC 2YA1A 2ORBL 2GFBA 1S9WA 3QUYD 1GPOH 5D1QA 3OSKA 3VWJD 3O8XC 2GCYA 4OD3L 4YUEH 4RFOL 3HC3H 3ZDZE 3MRLA 3S35L 3SDCA 1BFOB 3NIDE 3STLA 3WSQH 4MXWH 2O61A 4HDIA 1Q9LA 5HYSG 2VZ1A 2QR0A 1YNTA 4L5FL 2ZG3A 3MXWL 1XGTA 4ZUVA 2KH2B 2FEDD 3T04D 1RUAL 5BS0B 1LEKB 2BVUA 1IEAA 2FYYA 5HYEA 4JY5L 3U7WH 3ULVD 3RWFA 1EPFA 5ICYB 1G7JB 4RCAA 1CE6B 1IEBA 2JKXA 4O2CA 4I77H 4WV1B 5M95B 3PGFL 3UBXG 3I9GH 3LIZL 4XCNB 1AR1D 2I9TB 4X6CE 5LAXB 1WWWX 3EOTH 3IU3B 5I1LA 3V5KA 2N7AA 3NH7H 5E1AB 1I8KA 3GIVB 3MLZH 4JJ5A 4ODXB 4LPWA 3GZKA 1Q38A 1Q0YL 1Q8MA 2K9UA 1BBDH 1IAOB 2FX9H 3RJQB 2DQTL 1T7VA 2XKNB 3NCEB 1OCWL 5AZEH 1NUNB 2G5RA 4XAKD 4X9IA 2W9DH 3BH8A 2IANB 3VFTA 1Q72H 1QSVA 3CMGA 2A6KB 1LEIA 4OCRL 1YJDH 1I1FB 2B8OT 3RGVC 3OR6B 1BVKA 4N0YL 1G0YR 4RMUA 5HHME 1DLHA 3O6FA 3MRIB 4NQED 5DJYA 1TQBC 2Y07H 3RVTC 1UB5A 3LEXA 3HZKA 5FFLA 4CBPA 4Z78A 3IXTA 3L7EA 2N4IA 2YA0A 3E6HB 3WL9A 1KV3A 2GJZB 1KJ2A 2EYSA 3BH9B 4Y16D 2AJ3B 3VXOA 5CKAA 2Q7NA 4JZOB 5J13B 4JHBA 2X6MA 5IOPA 4JFQB 1EJOH 3OKNB 4X7TA 1INEL 5E99L 2A9NL 1LK3H 3ROLB 4N0UE 3SDAC 3FN0L 1XF4A 3QDGB 3PJSA 1GGYA 1DQLH 3NFPB 1F3DH 3DVNA 3GMNA 1T6VN 2X4NA 3V6BR 4MQTB 4F58L 3VMPA 4M61A 1UZ6E 3TCLA 4MA8H 3KLHD 5DHVA 1VEPA 2X7LA 4GUPA 1LNUA 3PQYE 2DL2A 4UNVA 4TTGA 5JHDB 3RAJH 5GSVA 5EU4B 3FL7A 3ES6B 4P2CG 3KPSE 3PWPA 2IPUK 1WCBB 1WBZB 5FYKU 1NL0L 4DGYL 4RFOH 2ATKA 1UXSB 1A4KB 4J4PC 1Q1JL 2WBWB 4OCXH 4YEEA 4WV1C 1QLFA 4RFNB 4NKIL 1JTTA 1MCEA 4K3GA 3U0TB 2PTTA 4ZFOL 4CDGC 1XEDA 3N9GL 3QDJD 4W6XB 2D4FA 2YD1A 5DD6A 1XGRA 4L4VE 2A6DA 2OTPA 4WFHD 1KTLA 1I1AC 1RJYA 1VFUA 5J12C 3D39D 1YY9D 4DAGL 4I0PD 2PUQT 4MJIE 3V6OA 4YXKL 4Z76B 2E6JA 4QHLB 1UJ3A 3RKDD 5T1LB 2NXYB 2ZPKH 3G6AB 3O3DB 2FX7H 1OGAB 1W8NA 3U83A 1VEMA 4NNXA 4OUUB 2J7LA 2J5LC 4JPKH 1H0DB 3M8OH 3GI9L 2Z8VC 1KB9K 3BEVB 5ANMB 3QDGA 4YXHL 3T0ED 4X5LA 4LARL 4P46C 4B7LA 1FNLA 3SDDD 1W72H 1XR8B 5TFSL 1KJVA 3L6FB 2PXYB 3DURB 4V2BA 4LLDB 4F9LA 1NAMH 1UCTA 3D2UB 1UENA 3OZ9L 1MWAA 4YHYB 1EGJL 3CPLB 5FGCB 4L5FH 4YGAB 4WNQB 3ARGC 2VC2H 2EDYA 4WTZA 5HI3C 4JY4A 4JO2H 4Q2ZB 4GAGL 4O58H 4JFHE 3HAEH 3HAEA 3GRWA 4HW6A 3F6LA 5ISZE 4XBPA 4Z5RB 1AGCA 4F9PC 1BVKB 5CWSA 1N2RB 3T8XB 5IVXA 4P2OA 3QG6A 5JA8B 2BP3A 1LWRA 1J0HA 1S5IH 3ZDXE 4NQDA 4R7NA 1X4YA 3MLRH 1CGUA 3Q6GH 1HQ4B 2V9QA 3ARXA 1KJMB 4ODHL 4GAJL 5DD5L 4F15B 4NUGH 2IJ0C 3MLVL 1FFNB 3S9DB 4O2EA 4WUUD 3NIGE 4MDIB 3U0PB 3UYOD 3PP4L 3QDMD 2AJZA 1DBAL 4MJID 1YYML 4P5KB 1AFVH 3L95B 1OF2B 4FQQB 3PF2A 4O51A 2VXQH 2Y36H 1G1CA 2NY6D 1MFAH 3D6GA 3PWUA 1KN4L 4F7CA 4G8GE 1Z9MA 2W60A 1B0RB 5IESL 4MXVF 5E8DH 3W0WB 2N56A 5GGSB 4EVNB 2DB8A 2L7UA 4ONGL 3VH8A 1I9IH 4YLQT 4DKFL 5ETUA 5C0RL 3FHAA 4HH9B 3MYJB 5HJ3B 1AC6A 2G2RB 3C6SA 5KSUB 5DRWB 4JN1L 3FB8B 5FO8A 4P5TA 5D2NC 2BX5A 4JEGB 2GJ6E 3EBAA 1CD1B 2O61B 1G6RB 1OD9A 2WAHA 3KAAA 1VDGA 1ZOXA 1HOCA 1JWUA 5F9JA 2XWJB 1IGIL 5TPWH 4MDIA 4U6HA 3U0PA 4DEPB 4P46B 5DK3A 1KULA 4G8IA 5E8NB 4EUPG 4X6FB 8CGTA 4XCYB 2W91A 3O2DA 4JQIL 4KJYB 2IALB 2HA1A 2DWDB 5C07B 2DOCA 1I8MB 1V7ML 2EZ0D 3QUYC 5M94B 5KW9H 1CDJA 3K1DA 1MHHB 1YEGL 1KELL 4FQIL 2X4PA 5EUKB 2F5BL 4I0CC 4M7JH 1VGKB 4EDWL 4TULL 3WUZA 2X4SB 4U1GC 1PVHA 5J1AB 4R8WH 3RL2A 1DQJB 4L29A 4YHPA 3MRGA 4V1DD 4MMZC 4RX4D 1KACB 1QFWM 4NBYB 3C2AL 4NCDA 1G7HB 1OAQH 3HZVA 2D0FA 3FT4B 5HGAA 2Y4SA 1MPAL 4JPIA 3V7AG 2NNAA 3MBEB 1PW3A 3T4YB 3W5MA 2Z91B 3RZCA 4CDHA 4FQCH 1TQCB 3GUTA 2APWA 5EZLB 4PRPD 3WS3A 2DQIL 1F8TL 4JKLA 3TVMA 4NNXB 4DUWA 4QYOB 4MD0A 2CLZB 1DFBH 3CFDA 5IB5A 5AYUL 3FQXB 1UJ3B 2Q7YA 1MFCH 1QNZL 9CGTA 4EI5B 5K9JH 1WAAF 4OCRH 1FL6B 3O9WD 4CJ0A 1Q72L 3MA7A 1MAMH 3EHBC 3B5TA 5D7LB 4JPVL 4JFXB 3IAPA 1FJ1B 3O6LH 3MACL 2XXCB 3H9SA 2KBGA 1U3YA 2J12B 2Y23A 2X4QA 1DCLA 3LD8C 4NM8H 5HHOE 1ZLUK 3B8YA 1TVHA 2AK4D 4ZXBB 1GGBL 4L1HA 4U1MA 4WU5A 4DKAA 1GCFA 4GRMB 2VKXA 5SWSA 3UZVB 5GGTH 3ULVC 3PIQA 5IB1A 4IDLA 3S5LG 4WUUE 4HK3J 1RULH 1I1RA 1T7ZA 1F45A 5CZVH 3MV11 2VH5H 4EDXA 1XR9B 3V4VL 5FYKD 2PCPB 3OKOA 4PJHA 4LEXH 1NBZA 5IB1B 4MA1C 3P0GB 4RBPH 5IWLC 3WKMH 1A6ZB 5BZDB 3G08A 2GY7B 3QIBC 4CMHB 4QRQB 1H3UA 4J7RA 5DVMA 1DVFB 1QR4A 5DJAA 4JB9L 4X7TB 4Z0BH 1A2YB 1AFVL 2ESVD 4QXTB 4NQCD 3QFJA 5C0AB 5FXCH 1QQDB 2B0SH 5CD5C 1UH3A 3TT1L 3HZKB 1Q9KB 5EC1A 1T2QH 4KK6D 5DJYB