5GHWH

Crystal structure of broad neutralizing antibody 10e8 with long epitope bound
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
233
structure length
233
Chain Sequence
EVQLVESGGGLVKPGGSLRLSCSASGFDFDNAWMTWVRQPPGKGLEWVGRITGPGEGWSVDYAAPVEGRFTISRLNSINFLYLEMNNLRMEDSGLYFCARTGKYYDFWSGYPPGEEYFQDWGRGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB 10E8 HEAVY CHAIN
publication title Structural basis for broad neutralization of HIV-1 through the molecular recognition of 10E8 helical epitope at the membrane interface
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 40
structure length 233
sequence length 233
ec nomenclature
pdb deposition date 2016-06-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ghwH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ghwH01
2BNRD 2MOVA 3SDXB 3PGDB 5F89A 4RGNB 2F19H 4CU8A 1XCTB 2VABA 3QG6B 4FG6D 4Z7VB 1U8QB 4Y2DB 5DJ2A 3S88L 1C12A 3ARBC 4GUPA 4JREB 4Q6YA 4GH7B 3RX7A 3B9KA 4NQEA 3GSOA 4P23C 4LASL 4XC3H 1LP9E 3QDGA 4KK6D 4R2GD 5EFIB 1DANT 2J8UF 2VLJD 4Z7QF 3HMXL 1XZ0A 3GMPB 4P4RA 4P2QE 3SDAD 2DTMH 1UVQA 1CXLA 1I1CA 1RK1B 3KYOA 5I1HH 1EEZA 3QEHB 4LSSL 2CRZA 4HV8A 1BFSA 1KXQE 4KKAC 3BGAA 3LKRB 1BP3B 3BXNB 1R3HA 5HJ3B 3HRZB 4FQXB 1TLKA 4N8VG 2D7TH 2CK2A 2JELL 1HKLL 4JRYA 4QYOA 5GIRA 2HVKA 5C07B 1ADQA 3HR6A 1F3DJ 4TUKL 2P5EA 2X4UB 4XTRD 3UTPE 4PJ7A 7CGTA 3VE0A 4HEME 4U1LA 2DLGA 3LEXB 3U0TB 1P4BL 4RMTA 4LHUG 2NTFB 4XPBH 1D5IH 3FTGA 4JZOB 1QPXA 2HFFB 4PJ8B 3RWDB 3S35L 1U8KA 1F13A 4MQTB 3MRNA 1GC1L 2H32H 1L6XA 3P77B 5HHVH 2UZIH 3ARQA 5L2KB 2GCYA 1UH2A 4BZYA 5DDHA 4XHJD 1S9VB 3VA6A 1RZJH 4CVXB 4XRCA 3MBEB 1XGYH 2C26A 3DTXB 3H9HA 4BZ2L 1GOHA 3DVGA 4PRAA 2BVTA 4QF1B 1BLNA 3V4PH 1NJ9A 1JZ8A 5F1IB 2DQIH 5E2TL 3NCCB 3O11A 3SDXA 2FX8L 1I8LC 2W07A 4APQD 3RKPA 4L8CB 1I7TB 1K2DB 4YXKL 5KOVC 1XCTA 3QG6A 4JRXB 5JR1L 4Y2DA 3ZLQC 3D9AL 3ARWA 2IG2L 4Y4KC 1X5IA 4U3HA 2FJGB 4JN1H 2VLMD 5HVGB 5DEGA 4F9LA 5GGQL 2OMNA 1W72H 3X13A 3T4AB 5EFIA 5HYJE 5E00B 2OMBA 3E2HC 4J3VA 3L3JA 3CFIC 3GMPA 2O61A 2WSKA 3VXOA 1RK1A 3D2UD 3QFJD 1NFDB 3D85B 4U1NA 1YECL 5FECA 3LKRA 1X5HA 3BXNA 3D3VE 2L7UA 3C5ZA 2O5XH 1AO7E 2B5IB 3MCLL 2YD8A 5TF1L 1CR9H 1IAMA 3MBXL 2WP3T 4IIQC 4XNXH 2CO7B 4FQCH 5IHLB 3O8XB 3P4OA 3SPVA 5E6ID 1Z5LB 5D2LF 2AJSL 1NEUA 2B7DT 1JGEA 4A6YL 4Z7NF 3ARGB 5ILTL 5F9JB 3WFDH 3ULUH 5FUOH 4NJ9H 4ERSL 2HJFB 4XI5D 3RY6A 1K85A 1NUGA 3U0TA 4P3CH 4RAVA 2NTFA 4JZOA 4PJ8A 2I24N 3BQUD 1F90H 2DYPB 2JKXA 2Y06H 4WI8A 2WV3A 2AXJA 3LKPB 1AQKL 2GITB 5EUKA 2BVEA 4OCWH 5KG9B 4HUNB 2MQCA 3MOBH 3BD4A 5GGRB 4FQ1L 4UT7L 1BOGB 3IF1B 5E8OB 4K07A 5IIEB 1S9VA 3MX0A 4CVXA 4Y4FC 5F6HJ 4OT1H 2ATKB 2DDQL 3V4VL 3TBTA 3FRPA 1LO0L 1FZJA 2ZKHL 4QF1A 4ISVA 3KPMB 3STZB 2GYSA 2AJ3A 1RHHA 1CQKA 3ETBF 5BV7B 3ECBA 2EDFA 2PF6A 4U6VL 4L8CA 2HTKD 3G5XA 1K2DA 5CEXA 4LCWB 3E3QC 4JRXA 3LKOB 3HZKA 4XP5H 3I2CH 3N85H 4FFVD 2ADIA 5AEAA 1QFUL 1YQVL 1UCBH 4OZHB 5IW1A 4N0UB 1T7XA 4AIXA 2WUCH 3C6LB 4BQBA 5B38A 5CEYB 3HC4H 5T33L 3WIFA 4WFFE 3GRWH 2WK2A 1XIWB 5KN5A 5A3IC 5AZEL 5KJRH 2WAHA 4WFGD 3W9DB 5F1SA 3K1DA 1P1ZA 2X4TB 3FQXB 4DOHB 1CQYA 1A9BB 5T5NG 4U6YB 2YPKB 4YEEA 5HGBA 4RRPG 4KRMB 3BDXA 4LU5H 3U0PA 4Z7WE 4PJGF 1IGYA 2AJXH 1QPPA 3LQZB 3O8XA 1H0DB 3BKCL 1A7NL 3JWDL 1Z5LA 3GMQA 4ZPTA 1CICC 5BQ7A 1JTPA 2NX5A 3MRBA 5D7LA 5F9JA 1IGTB 1V3MA 3C8KB 2EO1A 2HJFA 3VWJB 1X5FA 4ZTOH 5HYSG 1G7LA 1HH6A 4U0RC 4JFYA 5I30L 1YMHB 1BGXL 2R0ZH 4I0KA 5DJ8B 2R15A 3P4NB 4HK0B 2GITA 3SEPA 3O3BB 2BVQA 5C0DB 4QOKE 2FYYA 4YR6B 5KG9A 4K7PL 1WLHA 3PP4H 2H2SC 1MNUH 3IF1A 5IIEA 4M43L 3RDTA 5HY9B 2EYSA 4GAGL 3CXHK 5IHBA 1MJ7L 1F3DH 5JOFB 2HYMA 3PL6C 3VRLE 25C8L 4R3SB 1HYSC 4FNLL 5CLWA 4XMLH 3AB0B 3QNXA 4LCWA 5IVXB 2V2TA 4KI5F 1QHOA 5J13B 3OR7B 2X42A 1GHFL 3DO7A 1ZHNA 4YE4H 1QYGL 1LILA 1A4KA 1LK3H 3H9ZA 1OTSC 3GSNL 4FMKA 3U30B 4PGZA 3W9DA 1SEBB 2X4TA 3FQXA 1CDJA 4G7VL 4L4JA 1WK0A 4U6YA 2YPKA 3P11H 4UQ2B 3ES6B 5AYUL 5BRZA 5HVHB 5JQ6H 2VR9A 1EFXD 2E27H 2V5MA 4KXZH 3LQZA 1H0DA 1W0VB 5F96H 4E0RB 3MRMA 1U8MB 1VGKB 2A73A 1F4YH 1AXTH 3MRKB 5IV2B 3QSKB 4FP8H 4WI3A 2VXVH 4JCLA 1YMMA 4X7CC 1QRND 4DQOH 1V7NH 1C5BH 2CSPA 1S7RB 2W60B 1MFEL 3BSZH 4YDVA 1KB5B 1LEIB 3F58L 3WUWB 4EN3B 5ISZB 1CBVL 1IGMH 5C0DA 1KJ2B 2XPGA 4QRTB 3SO5A 1FGVH 5TDOB 1T2QL 4PJEE 1OT1A 4O9HL 2D31A 2DQEL 3BYYA 5E4EC 5JOFA 2OYPA 5C0IA 2O5ZH 2YWYA 4JQXC 4M61B 4U6XB 5C0RL 3BWAB 1DJSA 3T65B 3BKJL 5GGTH 5IVXA 1I9IL 5DR5H 5B4MD 5EUOA 3O6LL 1OP5H 2FO4B 4P2QD 1CFNB 3CGTA 5IJKA 2XZQL 3JUYA 5ICYB 2R56H 5HXMA 4HQQH 3PWVB 1OARH 1F4XL 3OXSB 3LB6D 1T0NB 1WWCA 4YZFE 5DC4B 2AK4D 1PKOA 1EEQA 2DB8A 2VZTA 3SGKA 3VXRA 3JVGA 2IADA 1BEYL 5KS9F 4RISL 3V4UH 2FHBA 2XQBL 1DUYB 2IH1B 4M1CD 3PWPB 3T0BA 3VD7A 1FVDA 3V6OC 4DZBB 3O4OC 3PE9A 3V2AR 4C4KO 4MNHA 2X4QB 3ES6A 4NQTA 3OGOE 3FN0L 3TT1H 3UTPD 4WI7A 3LS5L 1DZBA 2JJSA 4J4PC 5JNYB 3WLWC 5CP3H 5H2BB 4FXGA 2DQGH 2EE2A 4GBXC 3MV9D 1F3JB 3TBVB 4BA8A 1JWMA 2FECL 5K9OA 1U6AH 4H25A 3X3FH 1U8MA 4G8GB 4ZNEA 2OL3B 4JO1L 1QLRB 2CDEB 2Z31B 5IV2A 3CXDH 1ACYH 2YA0A 3VFOA 4P3DB 2HLAA 3O3UN 2FB4L 3C60B 1J1XL 3RBSA 1AD9B 4PRIE 2HT2C 2VWEE 1NCCH 4PRNB 1LEIA 1LE5B 4M5YL 4YXLL 1LK2B 4EN3A 1F8TH 1A1NB 1BHGA 5IWLC 5MENB 3BH8B 3FQWB 3KHOA 1RIHL 1QR1B 3SN6N 4Q6IA 1JYVA 4MAYD 4RGOH 3VDCA 4JGMA 3ZTJH 4I0CC 4M61A 4FQQB 5JPNA 3BWAA 1LEKB 4ODUA 5HYJD 5DD5H 2J5LB 3FRUB 3W9EB 2XZCH 2XWTB 3MCG1 4HK3N 4ALAH 4UTBL 1CFNA 1TPXB 1D5BA 3C6SB 4PG2A 4HAFA 4X4XB 4PRPB 3UZQA 3OXSA 3KVQA 2Q20A 4UB0L 1A6VL 1GVIA 1ITBB 1T5XB 3D3VD 1CTNA 5IB2B 1AO7D 5C09E 4ONHA 4K3JL 2NY2C 3O6FB 1UWXH 2JIXB 5FYKH 2CIKB 1RI8A 4F7TA 1DUYA 1HI6B 2DLFL 3OAYK 4OLXL 5IFHH 2A6DA 3WIHL 5JOPE 1J87A 1GGCL 4DZBA 4OBSA 2FBJH 3DWTA 3NACH 3SDDD 2X4QA 1ZAGA 4R8WL 4GW5A 1FNFA 4QHUA 5JNYA 4N8CL 2ICWJ 5H2BA 4KVCH 3B5HA 3UJTL 1CXHA 5F9OH 3QR2A 1FNGA 1NBVL 1UJ3C 2BVOB 4I2XB 4XMPH 1IKFL 1LHZA 5D7JB 4G8GA 3G6JB 5BVPL 3ZHLA 4NWUH 4JR9L 1J12A 3IDYB 5ESVA 4AEHH 1QLRA 2Z31A 4G3YL 5EZJA 3V7MA 4QT5B 5DVLA 1ZLVK 3QJHB 4ZO9A 4P3DA 3DPBA 3S3SA 3LN5B 5FOJA 5CGMA 5F7DB 4PRNA 5DWUL 1SJEB 4P9MH 4DFHA 1LE5A 3TJHC 1I3UA 3P0YL 2P44B 4HGKC 5TE7H 3FFCA 3W2DH 5MENA 1G0DA 1M05B 3CDYA 4KHTL 2KDGA 3MLXH 2IPKA 1QR1A 5HHOD 3VH8A 3NH7L 1CD9B 1QO3B 3PUCA 4ODTL 5KW9H 3QHFH 1LEKA 1Y6KR 3UTOA 1EJOH 1JIBA 1DFBL 1BD2A 4WFFD 1XFPA 3FRUA 1TTGA 3PHSA 5DEFA 5KSAB 4AEFA 4NGHL 4JN2B 3VGEA 1MFDH 4NOFA 2VRAA 3BN9D 2D9QB 3MA9H 3GMMB 1JHTA 1C1EL 1OD7A 3JV6A 4M6ML 5JXED 5GS2H 3O6FA 3QPQD 2JIXA 3TIEA 4OLVH 1MCHA 1NCUA 1FAIL 1BM3H 1HI6A 2R9HC 1DBAH 3WS3B 5J6GA 2Z91B 5GZOC 1OWWA 5DD1L 3RWGA 3T2QA 3TH4T 1QSZA 1UM6L 1TTUA 3GB7B 5CEZL 1RZIA 3LIZL 4OI7A 4LASH 3ZDZF 2X44D 5F71A 1H9VA 4M1DH 5F6HI 4TRPL 5F7MC 2IAMC 5AWNH 3HMXH 4JO3H 4I18C 4UUJB 3S34L 3EOAA 1BREA 2CH8A 1MPAH 4S1QH 5D7JA 3MGTB 4XB7A 2EE9A 2BRQA 5GGSB 4WV1C 3ARDD 2BY3A 2AXGB 4QOKD 4QT5A 4DFIA 4F15C 4POZC 4I48B 3V5DB 5F7DA 1OVZA 4R2GC 4KK6C 2YPLB 3BUYA 1DQQA 3PV6B 4OFDA 5EB9A 1HKLH 1K5NB 4MCYB 3U48A 3SDAC 3ZKXC 4DCQA 1IGJA 3RY4A 2UUDK 4JPWL 1CDYA 1M05A 2FL5B 5I6XB 1WZMA 1WCBA 4PP2B 2V9TA 5ACZA 4NNPL 4PJBB 1P4BH 4K94L 4M7ZB 4X6FB 4Y5VC 3L3IB 1QO3A 3H6JA 2NXZC 3S35H 5I0ZA 2D03L 4L4VE 5J12C 1GC1H 2ESVE 4KROC 4I3RL 4K23H 1I1RA 2E8ZA 3CUPB 5KSAA 2G2RA 2V2WB 3QXDA 3TYGL 5EU3B 2O26U 4XNQB 2V7NA 5CIPB 4XTRC 1YJDC 1JUFA 5JTWA 5HPMA 1HIML 4BZ2H 1YEEH 4NP4L 3DURA 4QXUL 3IDMB 4Y5YB 3WS6A 3O45B 3I84A 1BZ7A 2LU4A 1AQDB 4GKZA 2FX8H 2VDPH 2NNAB 1P84J 4JO4L 1DBBH 2HTLD 3WS3A 3DUSB 3BPCB 4LLVB 4P4KA 5E5MA 1S7XB 1OTUC 3GMRB 3D9AH 5T1DL 4ODSL 2XV6B 2QBWA 2IG2H 5IVOA 1INQB 4AZ8A 3AC0A 4YDIL 5GGQH 4ZG1A 5F9AC 3WHXB 1MIEL 3AU1A 2CRIA 3MRGA 4GMSL 4F7CB 1FNHA 4PJFF 1S78D 2HFEB 1XR9B 4LARL 3WXVL 4DW2L 3MGTA 4APQC 4UBDD 4KRNA 2R2HB 2OS7A 1CTOA 6FABL 1CK0H 1YECH 4YIQB 3ARFC 5JHLL 4MS8D 1KLUB 2XXMB 5TF1H 4GO6B 3U2SB 5KOMC 3V5DA 4TTDD 3MBXH 4DKEL 5KSBF 2YPLA 3TPUA 4HKBB 1FJ1B 3DOSA 3PV6A 4PB9L 4Q2ZB 4F58H 1JRHH 1K5NA 4MCYA 1FRGL 3HFML 5IEKA 2AJSH 7FABL 1QP1A 4A6YH 4P2RA 2EDDA 4GKNA 5TPWL 5KVDL 1KTRL 1MRDL 1IC7L 1P4LB 4ERSH 3U9UA 4PJBA 1KIPA 1J05B 4RBPH 1FZMB 5I19L 5I74C 4PRHE 3GO1L 2C9AA 2YD7A 4OZ4A 1N3NB 3ROLA 5BJTA 3MA7B 1BZ9B 4DVRL 1B2WL 1NCTA 5DJDB 1H3GA 3ZSTA 3IFPA 1NMCC 2PETA 1H15B 2GJ6B 5IOPA 4ORZC 5E6IC 3V0WL 5SV4A 4FQ1H 4UT7H 5KVEH 2R23B 2XTJE 1DBJH 3CU1A 4XPAL 2NLJA 4XI5C 5GRXG 1HZHL 2ZKHH 2R0LL 3IDMA 4Y5YA 5LCVL 1VFAB 4UQ3A 3O45A 2Y5TA 3QUZD 3GHBL 3REVB 2R2BB 4DAGL 4U6VH 5IK3B 4LHUD 4OD3H 4JQVC 3BFOA 2XA3A 2NY5L 4LLVA 1XGTB 8CGTA 1S7XA 1VADA 1E27A 3QNZA 3GMRA 4YPJA 3ARBA 4EUPB 3B4NA 4Y4KB 1YQVH 2LTQC 1INQA 2PO6D 4LQ1A 2HN7B 4P23A 3WHXA 5T33H 1KEML 1LP9F 1WTGT 4PLNC 3E2HB 4RA3A 5CMAB 5TE6L 3RX5A 4F33A 4PRID 5AZEH 4O4YL 1YY8A 2HTKC 4Z7UA 2R2HA 4OGAC 2VZ3A 3FL7A 4IJ3B 2XFXA 1N5AA 2MCPL 1KLUA 4CU7A 2VQUA 2FLRT 3L3OA 5FEBA 1GZPB 1FJ1A 1RJZB 5EZLA 2EIZA 2YN5A 3BKCH 3JWDH 5C0BB 1II4E 1CYGA 1GZQB 4IRSD 2GAZA 1W0WB 1IM9B 2V6HA 5EBLB 3G6DL 1P4LA 1D7FA 3AS3A 2AJYH 2APFA 4ODBD 5T3ZE 1J05A 5E8DL 4TOYL 5IBTH 5DJDA 1FYTB 1IJ9A 5C09D 3HE6D 3CVHH 4WENB 1WAAA 3TBSB 4HW6A 3P0VL 4H0IA 5LKNA 4KTEL 3SJVE 2R23A 4M43H 3CDCA 4O02H 4HIIA 3IFLL 1RZKH 2HFGL 2R69L 4M6NH 1VFAA 1S7UA 1RIUL 4YC2C 3REVA 3NVQA 4LCIL 4FNLH 4XT1C 1NCDL 1ZLUH 1XGTA 1EHXA 5EO9A 2DI9A 4EUPA 1KG0B 4Y4KA 3MRPA 3IU3B 4K9EC 1F6FB 4JFDA 4R7DA 2HN7A 5CD3A 4XWOC 1GHFH 2YUVA 1CFBA 3DUHA 4U1GC 4Y4HD 4Q9RH 4NQEE 1QYGH 4X6EA 2AQ2A 3GSNH 3QDGE 3MLRL 3TM6A 1QLEL 3PJSB 5TFSH 3OPZL 4NRZB 1T1XB 1HHJA 1WFUA 4M1GL 1FIEA 2LVCA 4G7VH 1S5HA 1FORL 3QXAB 3UJIL 3U36A 4LEXL 4MX7B 5DFTA 4WVRA 4F57L 5AYUH 5A43C 4JM2B 3TO2A 3K3QA 1BVZA 1L7IH 1O7VA 3MO1B 5C0BA 2V7HB 1JZ6A 1ONQB 3S98A 2OI9C 1I85C 3S7GA 4JRYE 5GGUA 3T2NH 1NDGB 2I27N 4NNXB 2P5EE 2YZ8A 4IMKC 4Y89A 4B5EA 4CNIB 4PJ7E 3EUUA 3PHQA 3BO8A 4F7EB 5EH1A 3C9NB 4XP1H 1MFEH 1EV2E 3MYZA 3F58H 3UCRA 4MJ2A 3IT8D 4OZFA 4NN7C 1JRHI 4M6OH 2CUHA 4P5TD 3WJJC 1T2JA 1ZT7B 2XACC 2QKIB 4YGAB 5IW6A 4MXQD 4Y4FA 2NMSA 1T2QH 1BMGA 3IYLW 1DQLH 3WNLA 4CGTA 4H26B 2DQEH 4GAFB 1P2CA 2DD8H 5DMIL 4Z76B 4FXLA 1WTLA 2IFGA 1KCUH 5KANI 3QIUD 1FYHB 3B8SA 3BKJH 1C8PA 3SDXE 3HC3L 1EFQA 4B41A 5E1AB 3O6LH 3KYNA 1TCRA 4B50A 1KG0A 2ZSWA 5BOPA 2Q3AA 3IU3A 5ICZA 3B2VL 4KQ3L 2I9TB 2DKMA 5IR1B 2FR4B 1ETZA 5D1XD 1QA9A 3LKSB 3GDBA 1J86A 4G5ZL 4RISH 2XQBH 3RHWK 4CMHB 3PJSA 1J18A 3D48R 2P45B 4WRLA 2F5BH 5MHSD 4DTGL 1TITA 5B4MC 3HKFA 1H8SA 1T5WB 5BCAA 4MX7A 4Z0BH 1H3XA 2QL1A 3B9AA 3JV4B 4O00A 3INUH 1WICA 3B3IB 3LS5H 3LB6C 4ZAKD 5IW3A 4Z7WF 1ED3B 5DC0A 4NUGL 1BWMA 1LO4L 5CJOL 2ENYA 2NY4D 3MO1A 3CFBB 1E0OB 3KXFB 4QRPA 1CICA 3TN0C 5F1NB 4L4VD 4LSVL 2ESVD 4M1CC 2APBA 4X4ZA 5CINL 1NDGA 2Q86B 3H9YA 4NNXA 1MAKA 2DQFA 3TJEL 3H3PL 4X5XB 4XVTH 2K9UA 3VXNA 2FB4H 4F7EA 1EGJH 1J1XH 2IC2A 5IBUB 1MCWW 4M5YH 4X7EC 4YXLH 2ORBH 3I6GB 1D5MB 4W81A 4Z95L 1T22B 5EN2B 1ZT7A 2BVPA 1T20B 4HWBA 5EOTA 4Z18A 3MXVL 2QKIA 3RWHB 4MVBD 1OTTD 3BDYL 3IXTB 5I9QB 3KAAA 1UG9A 4Z76A 3DI2B 1T80A 15C8H 4TVPE 2Y6SD 4TSCL 4AG4L 1UQSB 4QTHB 2OZ4L 5JW5B 2EH8L 2LVEA 2J12B 4JRXE 4ZDHB 3REWB 3QRFM 2YN3A 4E5XB 4NN5C 4HBQA 4UB0H 1T04A 4QTIL 4ZO6A 4UNUA 2FR4A 2DF3A 4MAYC 43C9B 5DLML 4ZXBC 2FO1A 4K3JH 4GOSA 3VW3H 3K8MA 2R1WB 3Q1SL 2PW1B 2DLFH 3H7LA 4OLXH 2AEWA 2I9LB 3U7WH 1T5WA 4KDVA 4MB3A 4OFPA 1A47A 5LAXA 1EX0A 3GGWB 5DUBA 3SDCD 3WEXB 1FFNB 4JFPA 2OCFD 3B3IA 4LK4A 2YUWA 1OAYL 4N8CH 1JZ5A 5CJ5A 1U3HC 4GBXB 2FH8A 3CFBA 1YPZB 2YHGA 3KXFA 4PRHD 1MAMH 1TTFA 2V5TA 1A64A 2NCMA 5BVPH 4O51A 5ESAB 2PXYB 1INEL 3B6SB 4JHWL 5EIIB 4G3YH 5D2LA 2OM5A 2NX5E 5D7LE 4UDTB 1YYMH 3VFMB 1CVSC 3K2UL 1M7DA 2XTJD 5MEPB 4KJQD 4WCYL 4XXDB 4LAQL 1W2KT 3OJ2C 2VDRL 3MREB 5DWUH 5J89A 3HB3C 3UTQA 3P0YH 1D5MA 3QUMH 4K71C 1K6QL 4U1JB 2H2PD 4H88H 1GOGA 4NN6B 3RWHA 5J0BA 4KHTH 5GPRA 4NQXA 5DJ0A 3IXTA 3KPQA 5DRXB 3MFFB 6CGTA 5F1OB 3NH7H 3OJMB 3WIIL 1T3FB 4J12A 4ODTH 5FHBH 3THMH 3OF6A 4OZIB 1OLLA 2D0GA 5FA4A 2NW3B 1DFBH 3NOIA 1UQSA 2UWEB 4X9BA 1MIML 2SEBB 4LCWE 1FO0L 1KCKA 2MTPA 3RNQB 5C7XL 5DZOA 1DEDA 4E5XA 5HHXL 2IEPA 3CDGA 3K74B 3TT3H 3OV6A 4I0PB 4Y5XB 1C1EH 2P4AB 4YZFF 2AJVH 4R90H 3HUJB 3E6HB 4GXUN 2EDXA 3LHPH 4LNVA 1EZVY 2YEZB 4YHZL 5J1SC 2FJFA 2XN9A 5KSVA 1ZSDB 4JHAL 1CD1A 4NM4L 1JPSL 2GK0B 3V7AG 1X5ZA 2NY0B 1WCQA 5KVGH 2EKSB 1RVFH 5CILH 1JI1A 1FFNA 3HE7D 1UM6H 2XRAL 2E5EA 4J4PA 1IC5H 5BRZE 4YK4C 2C3VA 5T3ZD 4GBXA 5JXEC 2D2OA 1YPZA 1NGQL 4ETYA 1AGCA 3RAJL 4L3CB 2RJMA 1U8LB 1AY1L 1WFOA 2A9MH 4KI1A 1VKXB 4U7KA 5IMMA 1J0IA 2VE6B 1OPGL 2ICWB 1MCIA 1Q9KB 5CGTA 4UDTA 5GGRY 4I4WA 4BH8B 1EXUB 5A2LH 3SJVD 1UWGL 3RL1B 5MEPA 4XXDA 1YMME 1CL7L 3RY5A 2NY7L 2VKXA 3LMJH 1TZGH 3LPFA 1A5FL 4HDIA 5FYJL 1UACL 3W39B 3IDGA 2OLDA 3I3BA 1PAMA 4LKXA 1JNNL 4U1JA 2FECI 5IWLA 4JPWH 3MPCA 1I3RB 5JA9A 3ARDC 2GY5A 5DQDH 1FFQA 1U0QA 4XP4L 1G84A 4NNPH 1NAMB 4K94H 5LBSL 4Q7DA 2XWBB 3HMWH 5IFAL 4X6CB 2HWZL 2D03H 4DK6A 5CP7B 1GGYA 3B9KD 3FO0L 4NQED 2NW3A 3BISA 4I3RH 4GRWF 2B4CC 4M48L 3QDGD 1IEHA 5FB8B 2JTDA 5IVXE 1UB6B 3RNQA 3NAAL 2N7BA 1SJHA 5A16B 3STLB 4JM4H 4NP4H 3U83A 5I1DB 3HUJA 3H0TB 3R06B 4K3EH 4QXUH 1JN6A 3WDJA 4YWGL 3T2PA 5GGVY 3UMTA 4WHYG 3VXRE 1NFIA 4JO4H 4BKLB 2Q3ZA 4NQCA 5HPOA 4LGPB 4UTAH 4YHKH 1R5VA 4HCRH 5C0ND 3OKMB 4ODSH 3B83A 3RA7L 3NCJL 5E6YA 4YDIH 2P5ED 4ETQB 1RUPH 1MIEH 2Y5EA 5D4QA 2E7BA 1NH6A 4HUKB 1CFTA 5I73B 3BRFA 3DHMA 1UJ3A 3T4YB 3CFJB 1I8IA 1U8LA 3WXVH 1MHEB 3SO3C 4HUWB 2VE6A 3J7HA 2RR3A 2CDGB 2DL2A 2ICWA 5FFLA 1SM3H 1FVCB 3PABA 3FT2A 4ZNEE 4O2FB 1G9EA 1BBJA 4U1HA 4IRZH 4JFEB 5C8JA 1OP5K 1Z9MA 1EXUA 4OZGA 2GFBB 3RL1A 2WBJD 4EXKA 1NMAH 3V6FB 2QQQA 1JNHA 4DKEH 1JBJA 4EDWL 4PB9H 5F8RC 1EIBA 3TZVC 1IKNC 7FABH 1DN0B 5IMOB 3OKDB 1I3RA 1QSFB 3UPCA 1BQHB 5KVDH 1Q1JL 3TP4A 2IFFL 4OCRL 3VD4A 1NUFA 4MS8C 1G9MH 4Y2DD 2H8PA 1QZ1A 1OCWH 3GM0A 4JGJA 1H3TA 5I19H 3S9DB 2XWBA 3IS1X 3GO1H 5JW3H 4X6CA 5D6CB 1FLRH 5J8OA 3LN9A 1BWWA 2X09A 2R0WL 5HHNB 3MUGB 3V0WH 3UYRH 1RZ8A 1T1YB 4NQDA 1MCBA 3ZHDA 5MI0C 1YEKL 4OF3A 2WBWB 5SWSB 3VCLA 5MEQB 4JPKL 4YFLF 2VKWA 3C5SA 3BEWB 4DN4H 1NEZB 3IFNH 3DARA 5I1DA 5T5NF 3H0TA 2BSTB 1B0RA 2R0LH 1PD6A 5LCVH 1U8IB 4M93B 3GHBH 3QIBC 3C5ZD 4DAGH 4JG1H 3BRDA 3CLEL 1UZ6E 2OXHA 5ADPL 5L2JB 4PJ9B 1MHCB 4BKLA 2NY5H 5KS9A 1FH5L 3PWPE 4NRXB 4ZFOB 4D0BB 2RAMA 4NYLB 5F7FA 3V8OA 3GSXA 2UY6A 1T1WA 3TH3T 3UTTA 3JTSA 4LPVA 1HE7A 5KVFL 2X9WA 4PV8B 1KEMH 3QUZC 2IAMA 5TE6H 4I18A 3S4SA 4MA7H 4G43B 4LVHB 3CFJA 4R4NC 1MHEA 3U46A 4HUWA 4PJ8D 5IHUH 4PP1C 2CDGA 4WV1A 3B8YA 4EUPG 4G8GE 1HN1A 3OKYA 1HILB 1HSAB 4JFEA 1IFHL 1NBQA 1PZUB 1IT9L 5FAAA 4TUOB 3RPIB 2GFBA 4OI9A 4U2ZA 1SYVB 3V6FA 3MNVB 1ULVA 4OGZA 3BE1L 4QO1A 5BO1H 1XCQB 2BHZA 4M03A 3SDAA 1IGCL 1OP9A 1DN0A 2VWEC 3QIWB 4TVPD 3OKDA 5DVMA 5IMOA 2JB6B 4LRIC 1N6VA 5AG9A 1BECA 4CADB 3TIDA 1H8OA 4DKDC 1BQHA 1C08B 3G6DH 5MENE 2ZOKA 3SKJH 4JRXD 5HI3C 3EYFB 3OHXB 4Y5VA 1JTTA 1HEZA 4X5WA 3BMVA 3D25A 4L9LB 1P7KB 5F7UA 3BN3B 1UXWA 5C0CB 1CXIA 3QYCA 2CJUL 4MZ2A 5C0AB 4PJXB 3MACH 2AEQL 2B39A 3T77B 4GQPH 1JK8A 3GJFA 4GW4B 3O6KH 1BD2E 3P0VH 4UNTA 2QHLA 4KTEH 1PX3A 2K1MA 3BEWA 1NEZA 3ZT5A 3R8BB 3PNWA 2HFGH 2P48B 1VFOA 3CFEB 2BSTA 3RUGB 3B9DA 4OQTL 1U8IA 5AD0A 3TLRA 4XNUL 4LCIH 2CDFB 1RZFL 1MHCA 3KJ6L 5I1JL 4W4NA 3BEVB 5C3TA 5B8CB 3O8XD 1DANU 5DEZA 4S1SL 4WW2F 2H9GB 3SCMC 3LD8C 3ARGD 4W6YB 3DRTA 4GFTB 5D7LD 1GIGH 3HPJB 4PV8A 2DOCA 4OIAA 1I1AB 12E8H 4LVNC 5I8EB 5EU5B 5TQ2H 2CRMA 3VRIB 3EO1A 2FH6A 4M7KL 1MCCA 1KTLB 3MLRH 4FZ8H 1QLEH 4APQA 1NANH 4I2XE 1DVFC 4M1GH 2DYPD 3CFCL 4N5UA 2VXQH 4UT6L 1FORH 1HILA 1HSAA 3ARFA 5IROC 4I1NB 5ANMB 4P5MB 3GBML 4PJDB 3EOBB 3KR3L 4TUOA 5EC1A 3RPIA 1XMWA 1B0GB 1KFAH 3NCMA 4EKXA 1K8DA 3RDTD 1T2XA 3TVMC 3MNVA 2C4XA 4Z8FL 1N0LA 4PYHA 1CD0A 3DX6B 1XCQA 4ZFFA 1CDHA 2VN4A 3UDWC 2JB6A 1M71A 3QFJA 5FUZL 1C08A 4FFWC 1A02N 4Y7MA 4ODXB 4I5BB 1ADQL 4LCWD 1A6TB 1IZKA 1EMTL 2WBKA 3EYFA 2EDNA 2CMRH 1R24A 2X7LB 1FZKB 2AK1L 3I02A 4NSKA 1P7KA 3S96B 1Q94B 4G8FB 5C0CA 3DNKA 5I2IB 4NO5B 3VG9C 4JVUA 3T77A 4KKCC 1OSZA 1MJ8L 5E6IA 1U8HB 3HI6L 1P53A 4I3SH 1EERB 2ZPKL 3D6GA 3V7AE 3AREC 4XMKL 3V9FA 5AAMA 5I18H 2GW5A 2A1WH 4CVZA 2NY1B 4LLAA 5CLTA 5DMIH 1WZKA 3RUGA 5DZLA 2UVFA 1T21A 3RRQA 3SE3C 4MNQB 2EDQA 5D6DC 1TZHB 1MCNA 5BRZD 4NKIH 5I1EL 3K4DA 2BFVL 3HC3H 5DUML 4OV5B 4ZQKB 4HEPG 4Y1AB 5IVZB 3EJZD 3AVEA 3QG7L 1MWAB 2W0PA 4MXQC 2VMFA 3FQTA 4M7LL 1PBYA 2H9GA 3H3KA 3T3PE 1UH3A 5SX5H 1P4IL 4U1GB 4OCSH 4O5LL 3VWJD 3VRIA 2VLKA 1YMMD 2PKDA 2H32B 4IEFB 3EYUL 4YBLB 4ODHL 1G7QB 2XTLA 1EAPA 3HLAB 4DTGH 4JG0L 4D0CA 1CZ8L 3PQYB 1UB5A 1RK0B 1I8KB 4P5MA 2BOBA 35C8H 3U79A 2RHEA 4G9FA 4Z78B 1DSFL 4LSDA 4MD4B 1HCFX 3BPNC 1LO4H 2IBGA 4GRMB 4HFUL 4OSUL 2XQYK 4TULH 3JWOL 2YPLE 2AW2A 4FHBD 4F7MB 3EJYC 2Q76B 3MJ7A 1DL7L 4LSVH 2E7CA 2Y36L 1J8HB 3VI3E 5CBAA 3O9WB 4XNYL 3IS0X 3W81A 4ODXA 3EAKA 4I5BA 3QXVA 4P2RE 3IAGC 2F58L 3TJEH 2JJWA 3H3PH 3RVVC 2X7LA 4LFHG 1MAJA 3IDIB 1IILE 1YN6B 4LAJH 3S96A 4ZAKC 1W72B 1Q94A 2DJ4A 4PJBE 3E6FA 2KQMA 1SHMA 2NY4C 1TCMA 2W0LA 3NFNA 4Z95H 1U8HA 2CGRL 3MLWL 4Z5RB 4X0KA 3VXRD 1T83A 3IJHB 5E99L 3D18B 1C16B 5HD8D 2DS4A 3UO1H 3BDYH 4S2SB 4MXWH 1KOAA 5C0GA 5IQ9B 1X9QA 1BBDL 1EO8L 4JJ5A 4M8QA 1ZEAL 5IBUG 4MNQA 1KUMA 3EDDA 3QHZL 3UPRB 4TVPL 4AG4H 4MQ7A 4HUMB 3FCTA 3LDBB 2CKBA 4ZQKA 4OV5A 3CSYB 3RVWC 3QEQB 1IZJA 1K4DA 3ESVF 4Y1AA 4BJLA 5IVZA 2C4FT 4YHML 2AQ3A 1MWAA 4ZNCD 1DQJA 4JANB 4XAWL 3PWLB 3CPLA 4OUUB 4QTIH 3C09C 4HPYL 4KUZL 4WW2C 5J1TC 5DLMH 5HTSA 4JKLA 1TVHB 1IE5A 1JPST 3Q1SH 3G9AB 4JVWA 5KSUA 1G9NH 5F3BA 4ZOCA 3ALPA 4NWTH 4BK4A 4PJFA 3HLAA 5HYQB 1RUQL 3VXUB 4Z7UE 2XKSA 1RK0A 5HGGS 3OKOA 1JHLL 4GRLB 3P30L 4EN3D 4ENEC 3QAZC 1MY5A 4ONFL 4RWYH 3QFDA 2GSGB 2NYYD 1XF1A 3WNMA 2ZP0T 1OAYH 4MD4A 5IT2L 1NDMB 3NCFB 4HUVA 5D71H 3RVTD 1N2RA 2YD2A 4EIGB 2EXWC 4KPHL 4PGEB 2Q76A 1I85A 1NANI 3QUMA 4JKWA 2ZUYA 1J8HA 4L29B 3UYOD 1MCPH 1INEH 2X2YA 5IP4A 4IMKA 4WNQB 1FNEA 5AUMB 4JVPA 4PFEA 4PJ7F 1HHIA 2I07B 3PWJB 5E8PA 3VFWB 1B6DA 1WVZA 3I75B 4R0LC 3WNOA 3MSPA 3FB8B 4XP6L 3C08L 4LPCA 4YDLC 2DKSA 4TUJA 5DUPL 1CLZL 5ALBL 4Z5RA 4BUHA 2X4RB 5E70A 1F6AB 1WAAE 4Q97A 2H26B 3IJHA 2QQKH 3MV01 4CW1B 5TQ0H 1PYWB 3PWPD 4PGJA 3HHRB 5IQ9A 2K3TA 2XTJC 4KJQC 2APXA 1I7RB 3BW9A 4LQFL 4RFNC 4YO0A 1MFCL 3SDXF 3CSYA 3QEQA 2HFTA 1T4KB 3PHOA 3CX2A 2EYRB 4JANA 4RFEB 5HHXH 4HG4J 3PWLA 4G8GD 1MEXH 4HS8L 5ITBL 4JFDE 2FBOJ 1MY7A 2Z31D 3WFEL 2E9JA 2QHRH 2G75B 1I4FB 4X6BB 2B0SL 1VENA 4NM4H 2LU7A 5HYQA 4JGUA 4GRLA 1FG2B 1ZLWH 2XRAH 1FC2D 1N4XH 5MEND 3G5ZB 3KJ4B 3K1KC 1CDGA 1JFQL 2AK4A 2ERJC 4P5KB 4QHMA 1U3YA 2AEPL 4PGEA 3TN0A 3K7UA 5C0BE 5SWZB 4AENB 1RFDL 1F97A 3GJFK 4NHUA 4XGZB 3UAJD 4ZS6C 1G7MB 1HINL 1F58L 2EDEA 1YUHB 3V0AC 1ZLUK 1BD2D 4HUUB 4L8BA 2I07A 2W38A 3I75A 3UJJL 2B1HH 4XVSL 1CL7H 3PGCB 2NY7H 3O6ML 5ACLA 1A5FH 3FB8A 1YDPA 2ITDA 3MV9A 1UACH 2XWJB 5IG7B 1BJ1J 1IC4H 2PTTB 3O6FD 3VGDA 1F6AA 2JIXD 5BS0B 2BSED 2WWKT 5DK3A 3M8OL 4ZSOB 2L4OA 5IMKB 1C7SA 1KIUA 4ZOBA 1P84K 2EICA 4MHHG 5LBSH 1ZT4A 4S1RL 4NPYB 5F21B 1LMKA 2O5YL 5GS3A 2G5RA 1I7RA 3FO0H 5JO5A 3H7BA 1W8OA 3BJ91 4M48H 2CO6B 1GRWA 3E3QE 4P3WA 2EYRA 4IM8A 1A6UL 1KPVB 4LSRL 4RFEA 3MRFB 3NAAH 1MLCA 4JO2L 5D7JD 2FJHB 1RUKL 3FN3A 1KN2L 3VJ6B 4MAYA 2MSPA 1JMXA 4ZXBA 2GUOB 1AXSB 1QSEA 2KL6A 4XPGL 4N9GB 4YWGH 1I4FA 2G9HA 4YUEH 5J11C 3GI9L 3B9KC 4HPOL 4WDIB 5I1CL 1KCLA 3MUZ1 5EU6B 5CKGA 1U41A 4Z7QE 1NFDF 4GJTB 1F11B 4R26L 4JY6B 1HXYB 4V1DB 3GKZA 1TQCB 4LSUL 4U33A 1PDKA 2P8PB 4IOIB 4YK4B 1U3HA 1Y0LA 2XNAB 5GISL 4WGVB 3CH1B 5DD0L 4HIJA 4AM0B 1XF3B 2J4WL 1MRCH 5FCUL 5SWZA 3EOTH 4AENA 2DWEB 4IHOB 4PYGA 5FM8A 1JWSB 5GJSL 1G7MA 1JGVH 3RBGA 3VGAC 1MJUL 5DFVD 2E7MA 3T1FB 1CDUA 2ZCKH 2Y72A 4KZDH 2Y07L 3VD5A 3JXAA 5KSAD 3UROR 4AH2A 2Z8WC 1WUNT 4KHXL 3S4SG 5F88B 4EDWH 1YEDB 4GT7A 5IG7A 5KZCB 5DS8A 2JJUA 3DGGA 2R4SL 3BIKB 4X9FA 5EU7E 3EYOB 3MYJA 2HJLB 2QQNH 3W11D 1JPFA 2IFFH 1NGXB 1LDPL 1MH5A 1S7SB 1AKJB 4U1MB 2VZOA 2WBJC 4OI8A 4RZCA 1F45A 3NZ8B 1NQBA 2J8UB 2H1PL 1H5BC 1KXTB 1RSFA 3HS0B 3OBAA 3BAEL 2A6IA 5IEHB 1BQHG 1YEKH 1KPVA 3O41B 4JPKH 1I9EA 3OTTA 5CUSL 4RGNC 4H8WL 3T0DA 4OZHF 1U8OB 3MLZH 4WW1B 1RU9L 3ARVA 4Y2DC 5HHOA 1BQSA 3R8QA 3VXMB 4NKDB 1AXSA 1GPOL 4TSAH 4JREC 1HOCB 5E8NA 1EH9A 4MA8L 4XZUB 2C7UA 4OLWH 3E8UL 3WSQL 2YPLD 3GSRB 4BSWA 1FH5H 2WIIB 3F6LA 1NEZG 4V1DA 4YFLI 1HXMB 4P2RD 3IETA 2BOCB 5KVFH 5JXEA 3CH1A 4K2UL 1IQWL 2GTWB 5F9WB 2ZUSA 5EPMB 1XF3A 5T1LB 3X12A 1MFNA 3QXUA 1URLA 2DWEA 3KXFE 1A6WH 4IHOA 1A7PH 1IL1A 4LSQL 4PGDA 2Q87A 1JWSA 4FQXC 4HZLB 1MREL 4FXKA 1H8NA 2VAAA 1QVOA 1RJLB 1F3RB 1IFHH 3FO2B 5D2LE 3RWEB 2P8LA 5DT1L 4QRRA 1A2YA 4D8PA 5F88A 1AGFA 3KPNA 2YUZA 1XF5B 3SKNB 5L88L 3EDEA 2YMXL 2QSCL 3RNKB 5CZKA 1IBGL 5BVJA 4W4OA 1X4XA 2UVEA 5E8EB 3EYOA 3IGAB 1NSNL 3ARDA 2HKHL 4JLRA 4PUBL 3BHBB 2HJLA 1S9WB 5HHMB 2A0LD 2LE9A 1CE1H 3TNNA 4BK5A 5T3ZH 1TVDA 3WO3B 3ARBD 3DVNA 1QBLL 3ILPB 1E4WH 1CL7I 2VH5L 3MBEC 4X80H 4ZUWB 1FN4B 5F93C 2AEQH 4LLQA 2ARJA 3SE9L 5JOEA 3KPPB 4QRQB 5IVXF 4MQSB 3QZWA 1BJ1H 2NTSP 3O41A 1AGDB 1XGRA 3T8XA 1I3GH 1A7QL 1U8OA 2F19L 4WW1A 3SDYL 1SYSB 4NKDA 5DURB 3QIBB 1PKQB 3ROOB 4XZUA 3GNMH 2BMKB 4U3XA 3IU4L 3ZL4L 4ODVL 2XN9E 3Q5OA 3VXQB 3SY0A 3G6AA 3KJ6H 5I1JH 3GSRA 4FS0A 4M7LT 3IDJB 4GXVL 1NAKL 1ND0B 4S1SH 2DTML 3BP5B 4LF3B 1MCQA 5I1HL 4XPHL 5JXAL 2BNQB 4QHKJ 5L8KB 3P9WB 4H20L 1RMFH 3O3EA 2FX9L 1PFCA 2GTWA 2VDMH 3PDOB 2B5IC 5EPMA 5T1LA 1YPZE 3RZCB 5FM4A 2IH3B 3CFCH 3MNWB 2D7TL 4PRDA 1RJLA 1SBSL 3ULVL 5M94B 3KS0H 1RURL 4RGMB 3WO4B 3ARGC 1CF8H 1U95A 1KLGB 1NGZA 1OHQA 5GJTL 1B6UA 2P8MB 1AC0A 3RVUC 4HWUA 4Z8FH 3M1BA 1XF5A 3NFPA 1WBXB 3TZVA 3RNKA 4OLYL 2Q7YB 1IKNA 4YHNB 1A3RL 1L0YA 1CE6A 4RCAA 1YQ2A 5FUZH 3U0WL 1S9WA 3ARSA 1ADQH 2UZIL 4LGSB 4KUCF 4QY8B 1EMTH 3QHTC 4R4FL 4KK5C 2PYEA 4GKOA 5IBLD 3BUTA 1KACB 2KUTA 4S0TD 2OR8A 2X70B 3T3ME 4Y4KD 4NDMA 1CDCA 1XGYL 5GHWL 3QDMB 2EECA 3JTTB 3A67L 1UKTA 4NQSB 4PBXA 1OL0A 3JUZA 4JZNB 1S9KC 3KPPA 5C9JA 2UWEE 2DQIL 1LE9A 2ZPKH 4CN1A 3HG1B 5BV7C 5JUEH 4XMKH 2ZCHL 5K9KA 1HHHB 1BPVA 4GAJH 3PG2A 4PJHB 4YEFA 2YK1H 3QIBA 1PKQA 2ICCA 3HUJE 1MI5B 1UZ6F 4NBZB 3QWOA 1DQTA 3C6LC 3K4ZA 5DRZA 1ZGLM 1Q8MA 5DVOA 3VXQA 5I1EH 5DUMH 1KJ3H 4OCYL 5HDBE 2JF1A 3L9RB 4QXTB 2VYRE 1XIWC 3IDJA 1NBYB 5C0BD 1ND0A 4LGRB 2APTA 3QG7H 3BP5A 4LF3A 3SCMB 4G6JH 2BNQA 4HKJB 3LD8B 2YKLH 2WLYA 1P4IH 5KTEH 4E9LA 2XKNB 4L4TB 3QUZA 4O5LH 4RFOL 2CPCA 5HYFA 2VZVA 5CZVL 1IAIH 1V3JA 4XNXL 3MNWA 4JG0H 3L3KA 3PIQB 4M6AA 1XGUB 3EFDH 3MMEB 1F02I 5D7KE 1HWHB 3DMMB 1WC7A 4DJMA 2P5WB 3WFDL 1KLGA 4OZGE 4NJ9L 4FFYH 4Y4FD 5FGRA 3TVMB 4DGYH 2P8MA 3TF7C 4HFUH 3VWJC 3QWRA 5D7IB 4OSUH 3ZE1E 4J6RH 2DICA 2A74B 2Q7YA 4P3CL 5E95B 3OAYH 5CJ8A 1F90L 2Z93B 1PEZA 2Y06L 4XNYH 3S5LB 4MYWB 5E56A 1AHWB 1FBIL 1DCLA 1WBYB 2B1AH 1DQDL 4P2CG 4J3SA 3TO4B 1XR8B 3VG9B 3JTTA 4X6CE 5FM5O 1MCWM 1NC4B 4JZNA 3VG0H 3AGVA 3MLWH 3VMPA 1DN2A 3HG1A 5C6WH 3AREB 4NQDE 5E99H 4YAQB 5A3ID 4YBQD 1WEJL 4KZEL 3AB0C 1I7ZB 1MHPL 4GLRH 4PJHA 3GSQA 4XP5L 3N85L 3FOMA 1EO8H 5J13C 3CH8A 1J5OH 1NL0H 2IPUK 4B7LA 3QHZH 1UCBL 1MI5A 2W59A 3C2SA 4M02A 3WUZA 4TVPH 4QCIB 4JM2D 1QBBA 3GIZL 4XNMA 1I7UB 3HC4L 4OCNC 2YBRB 3V6ZA 3FOLA 3GRWL 3L9RA 4H5SA 4QXTA 4A6YB 1NBYA 5KS9E 4QXWA 1CICD 1GAFL 4XAWH 3SCMA 3U30C 5ERWB 4HKJA 4LPYA 4DEPB 3KLAB 3UTTE 4GG8A 4HPYH 4KUZH 3MOQA 4X9GA 4Y19B 3ZYOA 1AFVH 3F5WB 1WFTA 3ZMRA 3BZEA 4YFDB 3V79C 1DBMH 3DBXA 5EIQA 1AGBB 3VFSB 3ZKSD 1REIA 4LU5L 5HVHC 4ZOAA 1UZ8B 1DVFA 3P4MA 3ZKND 1RUQH 3AY4C 4C83A 1XGUA 5IROA 3KYMB 1Q9LA 1UM4H 4LVEA 3P30H 1KJMB 5I0DA 2CR3A 3MLTB 4ONFH 5INCB 1JGDA 5I75B 4JFEE 3RGVB 3B9VA 3TVMA 1KIRA 3BPNB 4R9HA 2IQ9H 4JFOB 4X7SL 4JZJB 4NQUA 1E28A 5EORL 4ZUSB 1J1PL 1X5GA 3S8WA 2ATPA 3UDWA 2R1XA 5D72H 1HYSD 2R0ZL 2Z93A 2PW2A 3S5LA 5B39A 5K59E 1WBYA 4OIBA 4PY7A 4WUUB 1MCFA 3PP4L 3OKKA 3TO4A 2OJEA 1U8NA 4GXUM 4UU9B 3C08H 1GGIL 3MV8B 3W0WB 1NC4A 5DUPH 3RVTC 1CLZH 3BD3A 2GQHA 3SKMA 2E7LC 1IQDA 4PB0H 1DE4B 1OTSD 3AREA 4JY5H 1T6VN 3NTCH 4C4KT 1P6FA 4XMLL 4WI6A 3U9PL 1I7ZA 3FHQA 5F70A 1L6ZA 5TDPB 1HHGB 2OTWB 3D5OF 3L5XL 3SE3A 4PG2C 5D6DA 2BJML 1C5DB 5DF0A 3AS0A 1O0VA 3ZE0F 4X7DC 5E7BA 3G04A 1Q72L 4LFHD 4LQFH 2YBRA 1MFCH 1S7TB 1JNLH 1MCOH 4N0FB 4D0DB 1LK3L 3KXFD 2UUDH 4P9HC 1MOEA 3WD5L 1U42A 5E2JA 4JFQB 1GGUA 4PTTB 4XC1L 2RFXA 3KLAA 2D7PA 3WFEH 1FP5A 4JDVA 2VLJB 1K4CA 3BVNB 5I8CB 2LU3A 4CU6A 3V52L 4BFIA 1AGBA 2Y23A 2B0SH 1UZ8A 3D0VB 1G6RB 2DQCL 2MPAH 3MRCB 4PD4J 1KJMA 3MLTA 3QO1B 1A7OL 1HQ4B 4IDJH 1S7VB 4QGTA 4EQ2A 1JFQH 3AUVA 1AXTL 3RP1A 5GGVH 4XP9H 1LO3L 2AEPH 2IF7A 5JIIA 5I76B 5J1AA 3C60C 1WJ3A 1U9KA 1IAII 2WUBH 3BSZL 3OF6D 4M3JA 3MRRB 1ES0B 1DEEA 5T1KB 2M1KA 4E41B 1JPGB 4PRBB 2OQJA 4R0LB 3QNYB 4ZAKA 1DTUA 2OTUB 4XVSH 1FGVL 4MZ3A 4PJBF 2J8OA 2QADB 3W0WA 5C0CE 4YDLB 1GH7A 3GSNB 2DQDL 4X99A 5D5MB 5DA4A 2PNDA 4L4VA 2O5ZL 2ESVA 4FRWA 4F80A 1DE4A 1AJ7L 2V5YA 2KPNA 2HVJB 1J0KA 3I3DA 1J7VR 1RHFA 3M8OH 4WWKB 1N5YH 1X3DA 5TDPA 1D5XB 1HHGA 1GCFA 2OTWA 2PTUA 3RWJA 2R56L 1C5DA 4HQQL 3RUGE 2VAJA 4UV4H 2O5YH 1BVLA 3ZTNL 5IHZA 2NY3C 2A77H 2F74B 4J4PD 4QRSB 3WLWD 2Y9RT 5MEOB 4JPVL 3VFGH 2X1OA 1QEWB 1U8JA 4GBXD 4PJ5B 4POYA 4D0DA 1R5IA 1AP2A 1HDMB 4OLZH 3WV0A 2EZ0C 4LSRH 3ZE2E 2X4PB 4PTTA 2PXYD 4OF7A 4GLRI 4WW2A 4LKCB 2DLEA 4XPGH 1H3VA 5DK2B 5I66A 3ZHKA 5TGBB 1FL5B 2VLKE 1F4AA 4WO4C 4AL8L 3D0VA 1G6RA 2HT2D 4JKMA 2DQGL 3PXJA 1B90A 4Z7UF 1VA9A 2EDJA 3QEGL 1EHAA 1L9MA 4R26H 1B9ZA 2VNCA 4HS6B 1JPTL 5D7JC 1YA5A 5ANME 4M5ZL 1HQ4A 3VXPA 4LSUH 3IDYC 1VEOA 5IQ7H 1ZMYA 1ZXQA 2X1PA 5GISH 2CIIB 4G9FE 1T0MB 4O58L 1ACYL 3ZKMC 3QULB 5F7LB 1J0ZA 4HJGA 4K55A 1SQ2N 3KDMB 2J4WH 5FO8A 5I76A 2ED7A 5DHVB 1A9EA 2RB8A 4OB5H 5GJSH 1NCCL 3MRRA 4Y2OA 5T1KA 1F8TL 4P2YA 4E41A 1JPGA 4PRBA 2Y07H 4AIOA 2C3HA 3QUXB 4R0LA 3QNYA 2OTUA 4CMMA 4HKXB 1A6ZA 4KHXH 5SX5K 2EIEA 5D7SL 5L7XH 3MLUH 2EDLA 3LS4L 4PRHA 1FE8L 4FQJH 4QHKI 5D5MA 3FMGH 1KB5H 1X7QA 3O3AB 1WAAF 1CGUA 2J3SA 1KBGL 3GSWB 5DFVC 2H45A 1KGCE 2NY0D 2XZCL 3CFKB 2CR6A 4DWHA 3FZUD 5CS7A 4OIIH 3GFUA 3RVXC 1V7MH 4MNQE 4PGBB 3PXHA 5C1MB 4MJ5B 1ZHLB 3L95B 1P9MC 4OJFH 4PJ5A 3GMOA 1HDMA 4PY8J 2B20A 5JDSB 4Y1AE 1VFBB 4H8WH 1Z9SA 3LEVL 3CLFL 1HKFA 1E4KC 1RU9H 5D7KD 3T0EC 1GPOH 2WWKO 4H1LB 3MODL 5DK2A 5DD6B 1WFNA 5TGBA 1AR1C 4MA8H 5J11B 4P2OB 4LLDB 4AIZA 2X4OB 4LRNH 3E8UH 2JCCB 1NGWA 3WSQH 3TJHD 1IEBB 4PJFE 5FO9B 4L5FL 4XMPL 4HS6A 1BZQK 2W91A 3O2DH 1DUZB 1A0QH 1T7VA 4AEHL 1KNOB 2H3NB 4C56A 2CIIA 1R3LB 4H0GA 4OFIA 4K2UH 1IQWH 3RL2A 4K8RC 4JY4B 3D69B 4QRUB 4K7FA 5ITFB 3DGCR 3VXSA 5LQBL 3LQMA 4BFEA 1KTDB 4P9ML 1I3VA 1J8HE 2OL3H 1H3PH 3W2DL 2APWA 1TJHH 1SY6A 5DT1H 1TVBA 4HKXA 3FO9B 2Z4QB 5I6XC 5IB1B 1TIUA 3CSPA 4JFXA 4HUXA 2BC4A 5L88H 2YMXH 3G08A 2QSCH 4OF0A 5ALCH 4M7ZC 5D2NB 5BZDB 1IBGH 1E4JA 5HYEA 3O3AA 3OZ9L 2MKWA 3QHFL 3BKMH 1U92B 2HKHH 4PUBH 4YFEA 4PGCB 1EJOL 2G60H 3NA4A 4U1KA 5GZOD 4LSPL 4PS4L 3O2WL 2HKFH 5C08B 1HHKB 1U93B 1MFDL 2EXYC 2FIKB 4F3FA 4LEOB 5J06A 1QBLH 3MA9L 4NC2B 4QEGA 4YPGA 4FTVB 3K8KA 4XCEB 1H5BB 1QFPA 1VFUA 1ZHLA 3SE9H 3L95A 4LCCB 4KJWD 1S3KL 2YC1B 3ME0A 4OLVL 1HQRA 4WU7B 1BM3L 5JDSA 3QEQE 2MHAB 1VFBA 1DBAL 4GW1A 1A7QH 4NRYB 2A0LC 3SDYH 1TZIB 4OAWB 4JFED 5AZ2H 4BQ9A 1EHNA 3DX9B 4POZD 4P2OA 5A40E 5KSBB 3IU4H 4LLDA 3ZL4H 2X4OA 4ODVH 1A3LL 4C58B 2JCCA 4WU5A 4ZS7H 2ITCB 4IRJB 4M1DL 1IEBA 5FO9A 5AWNL 4JO3L 1V3KA 4GXVH 1NAKH 1W8NA 2Z35B 5FUCC 1MPAL 3OB8A 4S1QL 2LAAA 4LCYB 1QSFD 3OGCB 4XPHH 5JXAH 3KPLB 1NBZB 4H20H 1EFXB 1KNOA 2H3NA 4JM2F 2FX9H 1ZOXA 2AK4E 5GS0D 4JY4A 3RWFB 3BI9X 3WKMH 5ITFA 3QPXH 3RU8H 3DV4A 2NXZD 4B7IA 1AH1A 4KROD 1CFQA 4MD0A 3DROB 3U7YL 4HGMA 1SBSH 3ULVH 3EDJA 2IJ0C 1QRNB 1RURH 4NNYB 5IB1A 2Z4QA 5SWSD 3LSOB 3OKNA 1OAZL 5GJTH 3EYSH 5HDQH 2Q8AL 5SV3A 3NGBB 3UTSB 2V2XB 3BOVA 4OLYH 5EULV 4GG6B 2DI7A 3MV9E 3VFPA 3L5WB 1A3RH 1ZHBB 2MQ3A 3WIHA 4GQ9H 1G7HB 3U0WH 1CT8B 4K23L 1CWVA 2EIDA 4WHDA 1BOYA 4R4FH 3FT4B 4XCYB 1OTUD 3QA3A 2WBJA 2VISB 2FIKA 1ZLWK 5IF0B 1BIIA 1DQMH 3PWNA 1RD6A 5GHWH 1ZS8B 1X5LA 4FTVA 4XCEA 1H5BA 1YEEL 1J0YA 3A67H 4C55A 1ORQB 4EDXB 3KWWA 2YC1A 4WU7A 1T0NA 2IMNA 2ZCHH 2VDPL 1VGEH 3PGDA 1DBBL 4RMVA 4RX4A 2OBGA 1A8JH 4R6UA 4V2BA 4Z7VA 1U8QA 1TZIA 5IBLC 3ARFD 4OAWA 2F8XC 5I8KL 5JIHA 1QSEE 5F8QC 3NN8B 1KCSL 4MMXC 1CFSB 2A9NH 4KV5E 2ITCA 4OCYH 2AVGA 4MCZB 5EZOL 1MCDA 1KN4H 1JTOA 4LCYA 5A2FA 3QEHA 3KPLA 4YHOH 3V5HB 1NBZA 4IJ3C 5EA0L 4R96B 3DSNA 1CK0L 4OF6A 3MR9B 4RFOH 3CCHB 3RWFA 4HK3J 1VFMA 5HJ3A 4MJ4A 3HRZA 5CZVH 4ORGB 4FQXA 5C0CD 2QEJA 3O0RL 5SWZE 4F58L 1JRHL 3B5GA 1CG9B 3IJYB 3FN9A 2BCKB 1JI2A 5C07A 5TF0A 5FGBC 2X4UA 4NZRH 1NKRA 1LEGB 1Y18B 3WYRA 3LEXA 3UTSA 3JBG7 2V2XA 1XT5A 5HHPB 4GG6A 2HMID 3L5WA 1ZHBA 2HFFA 3RWDA 3UEZA 2A83B 4JKKA 1FNLA 1KEGH 2D9CA 3NIDE 3P77A 4P46C 5FK9B 1EVTC 1FBIH 3I50H 3U1SH 5L2KA 3HZMB 3OG6B 1PLGH 1DQDH 5JIPA 5KVEL 4AK1A 4IOFC 1DBJL 4IDLA 2YD3A 3AM8C 1MLBB 3MBEA 3DTXA 4G6ML 3Q48A 5A1AA 1IAOB 1JWUB 4Z7OE 4EDXA 5F1IA 2VLKD 2DKUA 3A6CH 4R97B 4WHYH 3S5LG 4NQVB 5M95B 5B39G 1WEJH 1YEGH 1GGTA 4OD3L 1I7TA 4KZEH 4OGAD 2ZG3A 1MHPH 3R4DA 2E9WA 5C70A 5HHOE 3N50A 1ZT1B 2FJGA 3L6FB 3NN8A 1CFSA 3GIZH 4G9FD 2RQ8A 3T4AA 5IJVB 5E00A 4MCZA 3SDDB 4S10A 4HKZB 4YBQC 1GAFH 1YEIH 3PF2A 1NFDA 4V1DE 4R96A 3D85A 4HXAH 3MR9A 5CHNB 5HI5C 1QFHA 1YPZF 4JM2C 4MJIB 4LOUC 4ORGA 4WTXA 4NUJB 4MXVE 4LLWB 5LVEA 1T03L 3GJEB 4GMTH 4HF5H 5FGCB 3IJYA 4RAUB 4TTGA 5CWSB 5DTFB 3NBNA 1GYAA 2DL9A 3ARGA 3RWIB 1KGCD 1Y18A 4X7SH 4BH7B 2AJYL 5C0JB 4LSTH 4QRRE 5E94B 2NY1D 4OD1L 5EORH 3GSVB 2R4RH 5HHPA 1MCKA 2YSSB 1J1PH 5DZNA 5IBTL 3WN5B 4MNQD 4RMSA 2N4IA 2P24B 1XGPB 3ZKNC 2DYPA 4GS7B 4M4RA 1YEHL 5FK9A 4PLKC 3LKPA 3NA9H 3CVHL 3WMSA 3GHEH 3HZMA 5EU7C 1VEMA 2IBBA 5GGRA 4Y1AD 1U8PB 1BOGA 3U4AA 5E8OA 4YGVB 3T3MF 3NIGE 4O02L 1MLBA 2ATKA 4ZUVB 4XWOD 4JQIL 5DYOB 1GGIH 1RZKL 4M6NL 3PV7A 1K8IB 2CLRB 2E6JA 3KPMA 3STZA 2UWEF 4NQVA 1V05A 3U9PH 2C3XA 1EDQA 3LKOA 4JJHA 1IRAY 1YJDL 3L5XH 5EOCJ 4OZHA 3HUJF 2BJMH 1IM3B 3QQ9C 4Z7WB 4N0UA 3DYOA 3RGHA 2Q7NA 3C6LA 3NCYP 1Q72H 5CEYA 4Q9RL 5IJVA 4UIKL 5HDBF 4LHQB 5INDB 1XIWA 4NC0B 3WHE0 3M45A 2W65B 4CMHC 3WD5H 2E6PA 5TFSL 4YHLL 4EUPH 1J8HD 4XC1H 4YHYB 3O9WD 1D5ZB 3GIVB 3B2UC 5CHNA 1A9BA 4HX1B 3V52H 2OJZH 5ICXB 1CLYL 4MJIA 2BVYA 5LGKA 4NUJA 1NFKA 4LLWA 2DQCH 1L7IL 4I8DA 2XOTA 4HHAB 1I9JH 4EBQH 2GKIA 4HMEA 2BSSB 1A7OH 2WIMA 3RWIA 3T2NL 1IGTA 4OZGF 4BELD 4ZD3L 3C8KA 3VWJA 4NJAH 1LO3H 1XH3B 3ZE1F 3OB0K 3IJSB 2YSSA 3VWKB 1YMHA 4N1HB 1XGPA 3VI4E 3HN3A 3IAQA 4XP1L 1KPUB 4N5ED 5DJ8A 3P4NA 3WNKA 4HK0A 3ZT6A 3LRGA 4ZUUB 1PGRB 4M6OL 3O3BA 5HHME 4YR6A 2HRLA 4M9PA 3EO0B 3QEQD 3BD5A 3HNTH 4JRWA 4YGVA 2PYEE 5HY9A 4ZUVA 1DQLL 4G80B 4XBPB 4X6CF 5C9KA 2DD8L 2HP4A 2DQDH 3HTLX 5I9QC 4R3SA 1AJ7H 3X17A 4OZFH 1KCUL 1SMAA 3MUHL 2XA8L 1X5XA 1F2QA 3VXUD 1MFAH 4KY1H 1FLTX 3OKEB 1FL3B 4GRLD 3OR7A 3ZTNH 1RQ5A 1PKQE 3HCVB 2X4NB 2UYLB 2VR4A 5DJCB 4JPVH 2CQVA 3SE8H 2W65A 1A21A 3BESR 4HAGA 3TN0D 3VA2C 2F5BL 1SEBA 1D5ZA 3RQ3A 4PBVC 2BNQE 1P7QB 4Z0BL 4HX1A 4UQ2A 2BDNH 3INUL 5ICXA 3TWCL 2CLVB 4GSDL 1A1OB 5E9DB 4AL8H 3SGJC 3AY4A 5E6ZA 1F5WA 3KLSA 1W0VA 3QEGH 4MLSA 4E0RA 1EEYB 4HHAA 1JPTH 4M5ZH 1VGKA 4PJEB 5ID0B 4CN6A 2PXYC 4PPTA 3MRKA 1XH3A 4O58H 1DLHB 4U6TA 2ZUQB 4XVTL 3OL2A 2QV2A 1S7RA 1EGJL 2W60A 1KPUA 1PZ5B 1KB5A 4YDJB 3WUWA 2DWDB 3EZJB 2ORBL 4CDGC 1L4IA 5ISZA 5K59F 1KJ2A 2I5YL 4QRTA 4HJJH 2C1PB 3Q6FB 4NN6C 4GAYB 3MJ9A 5TDOA 1FNSL 4U1SB 4EJ1C 4G80A 5D7SH 4EI5C 4KWUA 3LS4H 4XVJL 1FE8H 1FQ9C 4NT6B 4BQ8A 2VXTL 2VZUA 4RSVA 1FL6B 4ZXBD 3HR5B 3F7VB 1QSED 2E7LA 3N1MC 4U6XA 15C8L 3MRDB 1KBGH 3TFKD 3HG1E 3A6BH 3T65A 4HWBH 4GRWE 1NMBL 3KHQA 2FO4A 4X5LA 3OQ3B 5ICYA 5IMLB 2DM2A 3LPWA 4PJHE 1JF5A 3PWVA 2C4FU 3WNNA 4I0PC 4Y5XC 5B21A 2NY3B 1MI5E 4KQ4H 3ALXA 5DJCA 1U3HD 3VW3L 4CN4A 2XIDA 2CKBL 2IH1A 2PO6B 3EDKA 3NFSL 5SWZD 3PWPA 1P6AB 2NY0C 3CLFH 3LEVH 3U7WL 1RZ7L 3FZUC 3O2DA 1P7QA 4OGYL 1Z2KA 1UC6A 4WHCA 3MODH 2XYCA 5GSRB 5JDJA 2CLVA 5E9DA 4WO4B 5EOCH 1ITCA 5IM7B 1VB9A 3HB3D 1F3JA 3TBVA 3OSKA 3VFNB 4L5FH 1MAML 5MP6L 5BS0D 4KKBC 5DMJB 3MLVH 4MSWB 1ORSB 2OL3A 1NCWL 4H1LG 2CDEA 4X8JB 2P5WE 1ZHKB 1DLHA 1YYML 3MNZB 4UIMB 1WWAX 4IRSB 3C60A 5ABDE 5LQBH 1AD9A 4Y8AA 1J0HA 1VPOL 4HH9B 4WI4A 5FYJU 4PREB 1BIHA 1LK2A 3CDFA 1CLOH 3QUML 4XCFL 2ZOLB 1A1NA 4IS6B 2VQ1B 3UBXB 3RIFF 1MHHB 1TJGH 4H88L 3Q6FA 5DC9B 4GAYA 4U7MA 3MV7B 2GK2A 3BH8A 3FQWA 5JW4Q 4U2YA 1C7TA 3S97C 4DZ8B 2EE6A 4PJXF 2EEBA 3UYPA 3OZ9H 2EKJA 3THML 4FQQA 5FHBL 2A6JB 3WE6B 3UPAA 3W9EA 3TYFB 2XWTA 4LSPH 2G5BB 4PS4H 2VDLH 3O2WH 3UC0H 3C6SA 5IMLA 4X4XA 4PRPA 1E4XH 4NO0B 1M4KA 4ZYKB 3RUGF 2J7LA 4V1DD 3TT3L 2F15A 3C5JB 1UKQA 3T1WA 1T5XA 2AJVL 4R90L 5IB2A 2ADJB 2EDWA 3LHPL 3RZWA 1S3KH 4EVNB 2BVUA 2CIKA 4ELMB 2BRRH 1IAKB 2E8YA 3ZE2F 2AKRB 4UINH 2FWOB 3T0EB 5KVGL 4KU1A 1RVFL 5CILL 5DQJB 4Y16B 4JEGB 5C2BH 4WO4A 1IC5L 4QRRD 1A3LH 3RKDC 5IM7A 1QBML 3X11B 4KJWC 1YY9D 2ZNWA 5I73C 5KZCD 2BVOA 4I2XA 1DDHB 2A9ML 4M62H 4D9LL 3G6JA 4NFDA 2BY2A 1ZHKA 5IFJB 3QJHA 1WWWX 1NKOA 3JSSA 3WL9B 4NO2B 3LN5A 4PJIB 1T7WA 3FB7B 3LMJL 4HH9A 1TZGL 3JV0A 1SJEA 2OZ4A 3IDUA 3QUKB 1FO0B 2Z8SA 4PREA 3U7YH 5MHSE 2AP2A 4NCC1 1MHHA 3MV7A 5DQDL 4Z6AT 1OAZH 3IKCB 4DZ8A 3LZFH 2Q8AH 3AFLA 5GS0C 5BMFH 1YZZA 2FATL 2HT3D 5H37G 3VXMD 3W0WE 2X4SB 3HMWL 4G6FB 2A6JA 1QFWL 2VDQH 2UZYB 3TYFA 4IOSD 1AXIB 2R8SL 3OR6B 4JN2A 4HJ0D 4ZYKA 3LQAC 4Q9BA 3GMMA 5CSZB 4JAMB 3QEUB 3C5JA 4JM4L 5CJBA 2ADGB 4K3EL 2ADJA 1P9MA 4M93C 4ELMA 3GSUB 1KYOJ 2ENSA 5T1LD 3O4LB 3DETC 1WT5C 4PJ9C 5BZWB 3G5YB 4KKLD 2AKRA 2Z91A 4Q9QL 1E4KA 3DX7B 2FWOA 1A1MB 3T0EA 4UTAL 4YHKL 4HCRL 1FGNH 3FO1B 5I8KH 1UENA 3GB7A 5DQJA 3QRGH 4Y16A 4M4PA 1KCSH 2YA2A 1RUPL 3QO0B 2ICEB 3X11A 5D70H 4UUJA 3DXAB 4LVHC 5EZOH 3TZVD 4I77H 1AIFB 5GGSA 4PJAB 3MJ6A 1SM3L 5EA0H 3U4BH 2AXGA 9CGTA 5HHMD 3BGMB 4IRZL 5IFJA 1WBZB 4HGWB 2IMMA 1A6AB 2PYED 3CC5B 4I48A 4NO2A 3LH2L 3WFBL 1BVKB 1NMAL 4YHPB 5C92A 2JB5L 3F7YB 3O0RH 5F7YC 3QUKA 3F12B 3H42H 1A6PA 4KK8C 2GSIB 1U58B 3QIWC 4UNVA 3MJGX 2P42B 4E41E 2FL5A 5BXFB 5IKCB 4PP2A 3MOAL 3QBTB 1G9ML 4HIEB 4X6FA 1OCWL 4O2EB 3L3IA 4L9LC 5DURD 3QIBD 1I1YB 5JW3L 5D5ME 1BFVL 1OF2B 1FLRL 3UYRL 2MFNA 3CUPA 2V2WA 2VIRB 3D39B 4YJZL 1MJJB 5EU3A 4XNQA 5CIPA 1J1OL 4DN4L 3I3EA 3DVIA 4E42B 2F8OA 5BW7C 5CSZA 1W0YT 3QEUA 4JAMA 1N6QH 2QTEA 3IFNL 1HNFA 2BNQD 2DQUH 4G6MH 1PJ9A 5JW4R 3GMLB 1UWEL 2HMIC 2Y4SA 4ODWB 2J88H 3GSUA 1QFOA 4JG1L 4BUGA 4DN3L 1AQDA 3O4LA 4PJ5E 4R4ND 2NNAA 5DJZB 4PP1D 3RZCD 3ULUF 3DUSA 4K7PY 3BPCA 3DX7A 1A1MA 1FZOB 5B8CC 3WXWH 1I8MB 4AEIH 1SEQL 1E4XI 1RV6X 4OCMC 3L5HA 4HLZH 2X41A 3QO0A 1D6EB 4NM8H 1I1AC 4R7NB 4F7CA 5H94B 3QWRD 1N8ZB 2XKUA 4MA7L 3DXAA 4KRPB 3O81A 3SDCB 4PR5B 2HFEA 1XR9A 2VITB 3K4AA 5IHUL 4PJAA 2NY6C 3ISWA 3UP1A 4YIQA 1V5JA 3BGMA 1L7TL 4TQEL 4HGWA 5HI3D 2R2EB 3ILQC 5E5RB 4C56E 3UTZB 1UA6L 3U2SA 2AXFB 1D9KB 3PWUB 3VXSE 5JORB 3BMWA 3QQ4B 3QDMD 3F12A 4HKBA 4J3UA 2GJJA 4Q2ZA 1T03H 5BO1L 4RIRB 4S1DC 2H41A 3F8UB 3HG1D 4L3AA 3KLHC 3SKJL 4OD1H 4O2EA 1FZMA 3T2OA 1KC5L 2A2QT 1N3NA 1PEWA 3MA7A 1BZ9A 2D7OA 1OF2A 1MI5D 5DQ9B 3CMGA 2NZIA 4P46B 1YEHH 2BHUA 3CK0H 3MACL 4KTDL 3K80A 5HGAB 1H15A 2GJ6A 2WANA 1RZGB 1B0WA 5DD3L 2QSQA 3O6KL 3D39A 2YRZA 1MJJA 1CI5A 1T83C 5GS0H 4E42A 4OFYA 3C8DA 3SCMD 4JQIH 3NABH 5EO0B 2GY7B 2NY1C 4D3CH 3GMLA 4YBHA 4XCNB 4LP4A 2R2BA 1ZGLP 2B4CL 3GJFH 3QCUL 5IK3A 2W9DH 1DVFD 3LQAH 1FZOA 1YJDH 2R29L 4MQXC 4RAHA 3G5VB 4PD4K 1EVUA 3DMMD 2KZ1B 3VGGA 2EEDA 5DMGC 1D6EA 1XF4B 2AGJL 1GIGL 2P5WD 3CNKA 2EC9T 1RJYB 3TVMD 4KV5F 4R7NA 12E8L 4UIKH 5TQ2L 3SGDH 5H94A 5CMAA 2JCCE 3ZO0A 3HE7B 4PR5A 2I60H 2ZZUT 4YBLC 4FZ8L 5BOZG 4YHLH 2DLHA 1CFVL 1AGEB 4FFWD 2VXQL 4JPIB 5DO2C 3FT3B 4MGXA 4HWZB 4RMUA 3TNMB 2R2EA 1RZJC 3UTZA 1JV5B 5DJXB 3MZTA 1CLYH 1KFAL 3TO4D 5LXGL 4B0MM 3S36H 1NC2B 5JORA 1GZPA 4QWWC 1RJZA 4KKCD 4RIRA 1NC4D 3QI9B 1U3JA 1GZQA 3U82B 3KGRA 2VZ1A 5FGBA 3F65A 3ARED 1W0WA 1NGPL 1IM9A 5EBLA 3O9WC 4ZD3H 1OAQL 2J2ZA 2UZXB 2CMRL 4MLIA 3VGHA 3WNPA 1IGFH 4CJ1A 3V0VB 1T0PB 5DQ9A 1FYTA 4P46A 1D6VH 3NIDF 1RZGA 1WZ1H 4BSJA 2VABB 5E08L 2ICWI 4NKMB 4K3GA 3G9VA 5DJ2B 4I3SL 3TBSA 3AMKA 3HI5L 3X3GL 3AM8A 5C08E 5I18L 4OM0L 2A1WL 4NQEB 2IGFL 4PLOB 1AI1L 4Y19D 3QDGB 4FOMA 4Z7OF 4FTVE 1TJIH 2DJSA 1A7BA 1I9RL 1XZ0B 2FEEI 3WUWG 4D2NA 4N5EC 1S7QB 2XA8H 3KPRB 4N8PA 4NKIL 5T3XE 4L8SC 3B43A 3LDBC 4HV8B 1G7IB 3QCVL 4RGNE 2XT1B 4Z7VE 3ULUC 3KPTA 3X14B 1XF4A 3WBDA 1RJYA 1XF2B 4OCSL 1XEDA 1UXSB 4JRYB 4N9OB 3LRSB 3EJYD 4QYOB 4NRZA 1T1XA 3S3PA 3VE0B 3FB6B 3QXAA 4GRLC 1RIVL 5C86A 1EBAA 4HWZA 35C8L 1CCZA 3RVVD 1QHPA 5DRNB 3AS1A 4WUUD 3J8F7 3TWCH 3FTGB 4JM2A 4GSDH 1UYWL 1RUML 3MRNB 4MXVF 3F7RA 4NKQB 3N1QC 2M8XA 3W0WD 4TULL 4Y88A 2V7HA 3QI9A 5HGHB 1A7RL 1ONQA 2GCYB 4YX2L 3AS2A 2OTPA 4OQTA 5C07E 4XRCB 4WUKH 4CNIA 4XBEL 3NZHL 2DIAA 2JK5B 3DVGB 4PRAB 1BLNB 4B53A 3UTSE 3C9NA 4GG6E 3ZYIA 1OQOA 3BH9B 3TH2T 5LGJB 4P57B 1BQUA 4HC1A 4NKMA 3RVWD 2I5YH 3JWNC 2IANB 4JHBA 4M7JH 5L2KE 2FNBA 1UM5L 5CEZE 3TV3L 3NIGF 1FNSH 4TPRL 4H26A 5DEGB 3UO1L 4XPFH 2FGWH 4MXWL 4XVJH 3X13B 3L7EB 4EEEA 1WF5A 2VXTH 3L3JB 2P1YA 2VDOH 2O61B 1S7QA 3Q5YA 3KPRA 3VXOB 5LJYH 4KJPD 4U6HB 1NMBH 3L3HB 5E1AA 1G7IA 3BKYH 4U1NB 1WV7T 5FECB 4ENED 1F42A 1N7ML 3C5ZB 3X14A 2VDNH 1WIPA 5C6PB 2I9TA 3DJ9A 3KYKL 4J7RA 5IR1A 4RWHA 1XF2A 2XZAH 3MLYH 3LKSA 3P4OB 3SPVB 1UXSA 4YH6A 4AT6B 2EXWD 3LRSA 1G9NL 2CKBH 3WJLC 1RULH 3TFKC 1FV1B 3NFSH 1JGEB 4NWTL 1AE6L 2GI7A 1MWAH 4K9EH 1RZ7H 3FB6A 5FO7B 1NFDE 4OGYH 1R0AH 1BAFL 2V9QA 5T1KD 3JV4A 5DRNA 4E41D 4RWYL 4RAVB 3EFFB 3KJ4C 1ED3A 3HC0B 2QADD 5EWIL 3RTQC 3SGDI 1GGBL 3R0NA 4K7PX 5D71L 5EUKB 5HGHA 3GMNB 4OCXH 4OM1H 5F1NA 5MP6H 4MDJB 2KBGA 3VD3A 2YD1A 2AS5M 1MCPL 2Q86A 1NCWH 4WWKD 3TBTB 5EZIH 1FZJB 4UAOC 4X5XA 2JK5A 4ISVB 4LPXA 2AJ3B 1RHHB 3M17B 3VI4F 3ECBB 1VPOH 3WKNA 3BH9A 3SOBL 3G5XB 3I6GA 4P57A 5LGJA 4P59H 5CEXB 4XCFH 1T22A 3HZKB 2IANA 4PJ5D 5EN2A 1T20A 2ADIB 1VDGA 1YEJH 2QQKL 2X1WL 5IW1B 4EI5B 5D1ZB 5TQ0L 5L0QC 5B38B 3L7EA 3WIFB 4MB5A 3T0VA 5KN5B 2DMKA 1X5KA 3ALWA 2ZNXA 1CLCA 3CX5J 3LRHA 3UBXG 1KPRB 4QTHA 4U6HA 1OT2A 3L3HA 1P1ZB 5D93B 5JW5A 4HZAA 2ZJSH 3SQOL 2FD6H 4ZDHA 4D9QE 2IPTH 2F5AH 1KB9J 3REWA 5HGBB 4DKFL 1J8KA 3DYMA 4L8DB 4OZHE 2YZ1A 1QBAA 1MEXL 3PDGA 3U0PB 5E03A 4N0UE 1IGYB 3ARRA 43C9A 2OSLB 3MRQB 4C56D 2YR3A 1UT9A 2ZG1A 2QHRL 2R1WA 4LL9A 4ZPTB 3GMQB 2PW1A 1EA9C 4AT6A 1WSST 2XI9A 4AQOA 3BGFB 3VXSD 1FV1A 3EOYG 5BQ7B 3MRBB 2NX5B 5D7LB 2I9LA 4YNYB 4ZS6D 1X6NA 5FO7A 3ZZ1A 3GGWA 3WEXA 1FNAA 1G7LB 1HH6B 3ARUA 3LPGA 4DOHE 3EFFA 4JFYB 3QUXD 1N4XL 1TQCC 3K2MC 3SGJA 2MJWA 3HC0A 1QBMH 4MJIE 4F37F 5D1QC 3GMNA 2OK0L 2BVQB 2FYYB 4MDJA 4D9LH 3CD4A 2ED9A 5FGCE 5CZXD 5ESAA 2PXYA 3RDTB 3B6SA 5EIIA 2EYSB 3CJJA 4WHTB 4QXGL 5CCKH 3VFMA 5GRWA 5T5FH 5DK0B 5ECJE 5EOQH 2B1HL 3M17A 3MREA 5DJ6B 3MRHB 1YY9C 3QNXB 1IC4L 2ZUVA 2V2TB 4W4OC 1G1CA 1QKZH 1CDIA 2MMXA 4EI5A 2ZCLL 4PLJC 5D1ZA 1GL4B 5DRXA 3DO7B 2FHFA 1QTYT 3MFFA 1ZHNB 3B5TA 1Z3GH 2FATH 1A4KB 2P43B 1T3FA 4XAKE 4OZIA 4RDQG 1QFWH 1U2CA 4P2OD 4PJCB 3BP6B 4QNPF 2VC2L 1JJUA 1KPRA 1N6UA 2UWEA 5HVWA 2SEBA 4LIQE 2R8SH 4JCMA 1HNGA 1C5CH 4PJHF 4L8DA 5FM5M 5BRZB 4I0PA 4Y5XA 1M7IB 3VXTB 3MXWL 5IGXL 1NUNB 1ZKAA 2HT3C 2OSLA 3E6HA 3MRQA 4AYFA 5FKAB 2YEZA 2D0HA 5TH2B 1ZSDA 1KCVL 4YUEL 3MRMB 5FV2A 2GK0A 1R3IH 4YNYA 4Q9QH 5DSCB 2A73B 4LBEB 3QUYC 4G6AC 2EKSA 4LVOB 3MLSH 2BK8A 4HJ0C 4ZFGH 3P9LB 1YMMB 1DLFL 1E6OH 1FPTH 3HI1B 3O2VL 4LDEB 4NCC2 2YWZA 3DUUB 5L6YH 1Z6JT 4YDVB 1JZ7A 4LLYB 3DVFA 4WY7L 5GRUH 5F7WC 5F9WC 1G6RL 4L3CA 1MRCL 2XPGB 4ZO8A 3EOTL 1VKXA 4KKLC 3D0LB 1Q9KA 1KT2B 1JGVL 4WHTA 3IVKB 2ZWLT 4JE4B 2D31B 5I71B 5JPMB 1GOFA 2ZCKL 4BH8A 4KZDL 3BT2L 5DK0A 5C08D 5D7IF 5C0IB 1T7YA 3LH2H 4KVNH 3WFBH 1VERA 3KYAA 1WIOA 2JB5H 5DJ6A 3I85A 3MRHA 2NR6C 3W39A 4FTVD 4ZFZB 5EUOB 1P69B 2L0DA 5ISZE 1IGIL 5T3XD 2QQNL 2RBLA 2VO5A 4RGND 3MOAH 4LDOB 1RUAH 4RX4D 3HRPA 5F7NC 3WFCH 1NAMA 5ESQB 3L5IA 1FIGL 4JB9H 3H8NA 2EE3A 3VXRB 3FFDB 5M7QA 2IADB 1BFVH 3OJVC 5CP7A 4PJCA 2GTZB 3CMOL 3BP6A 5JMRA 4FQ2L 3BPOC 1FVDB 2ZSVB 2X89A 3N06B 4IRJD 5FB8A 4QHLB 1HYRC 5I1IH 1UB6A 4MNHB 1J1OH 2HH0L 2QLVB 1EHLH 4CVWA 5A16A 1M7IA 3VXTA 3STLA 3MLZL 1UWEH 3R06A 4FXGB 5F97E 4TSAL 5FKAA 1ZGLB 5TH2A 4DN3H 4CDHA 1QG3A 1JWMB 1CGXA 5K9OB 4Y8DC 4H25B 1P5UA 4OLWL 4FQXD 2ARJQ 5DSCA 4LBEA 3VU2A 4DVBB 1CXFA 3OKMA 1SEQH 3P9LA 3VFOB 2HLAB 3HI1A 5C07D 1KJVB 4ETQA 1OW0C 3DUUA 3EBAA 5FHAL 4NZUH 1YYLH 4LLYA 2OP4L 2DAVA 5E9DE 3UTSD 2C5DC 3LKNB 3T4YA 4OKVB 1A6WL 3RZCC 1A7PL 1PSKL 3D0LA 3IAPA 5FYLE 1FVCA 1KT2A 1JYNA 3EKCA 4O2FA 3IVKA 3TBWB 3L1OL 5JPMA 1L7TH 4TQEH 5EO1B 5L2KD 4OFKA 4RGMC 4Q6IB 5CEZD 1UA6H 3KG5A 3UX9B 3WO4C 1A14L 3HAEB 5C0FB 1KTKE 5JPNB 1NCBL 3QT2A 4TSBL 1CVRA 3MBED 4ODUB 3GI8H 4ZFZA 1MELA 4TNWF 3QDJB 4UMGA 1D5BB 1QSFA 5ETUB 2LFGA 4KGLA 3SE4C 2I26N 4KC3B 3BPLB 4DGIL 1SY6L 1CE1L 3MJ8B 5ESQA 4ONHB 5T3ZL 1U91B 2QSTA 2FX7H 1KC5H 3FFDA 1TENA 2WNGA 4F7TB 1E4WL 5D6CA 4YQXH 4X80L 2GTZA 4KTDH 1KENL 1MSPA 4UOW0 2A6DB 2ZSVA 1OAKH 5HHNA 3JZ7A 3MUGA 1T1YA 5DD3H 4QHLA 4L9DA 5SWSA 1Q0XH 5MEQA 1I3GL 4GW5B 1CD8A 1IEAB 4PRPE 4QHUB 5FDYA 4YHIB 3D85D 1VEPA 1MVFA 2Q8BL 3MLPA 2CXGA 1ZGLA 1FNGB 1F4HA 1L0QA 3GNML 5L2JA 2B4CH 1QFWI 1WT5A 3QCUH 4PJ9A 5I1LB 4NO3B 2ID5A 5ESVB 4NRXA 2R29H 5EZJB 4D0BA 4ZFOA 4NYLA 4DVBA 5HHQB 4J2XA 3ZSSA 1RY7B 2AI0H 1KJVA 4YDKH 2AGJH 1I75A 1RMFL 1AC6A 2NXYB 4HSQA 5A2JH 1WZLA 1Z0NA 3RVUD 3P73B 5SX4H 4CL7A 2VDML 3LKNA 4G43A 4OKVA 1GC1C 3FFCB