5GHWH

Crystal structure of broad neutralizing antibody 10e8 with long epitope bound
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
233
structure length
233
Chain Sequence
EVQLVESGGGLVKPGGSLRLSCSASGFDFDNAWMTWVRQPPGKGLEWVGRITGPGEGWSVDYAAPVEGRFTISRLNSINFLYLEMNNLRMEDSGLYFCARTGKYYDFWSGYPPGEEYFQDWGRGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB 10E8 HEAVY CHAIN
publication title Structural basis for broad neutralization of HIV-1 through the molecular recognition of 10E8 helical epitope at the membrane interface
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 40
structure length 233
sequence length 233
ec nomenclature
pdb deposition date 2016-06-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ghwH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ghwH01
4K3HA 5HI4D 3O81A 3MOAH 3SKJL 1BQSA 4CL7A 5FYKD 4LCWD 4G3YH 4ZUVA 2LU3A 2JIXA 4IS6B 5HVGB 1IKFL 1K85A 5LAXB 4HD9A 3Q6FB 3PWPA 4HV8A 3SO3C 1RK0A 3B8YA 1MCLA 5ADOL 4HIEA 4CVXB 3FT2B 3S37H 1NEZA 3WN5B 1TJGH 2B4CH 2UWEB 4JRXA 3ESUF 2CQVA 2HVKB 3MV8D 4KK5D 2CDGB 4KDVA 4WI7A 3FO2A 2A1WL 2AJXL 3CSGA 5KG9A 5TQ2L 3WXVH 4BH8B 2X4UA 3HC3H 5AYUL 3QUZB 4FZ8H 2ZPKL 4OCLC 1XR9B 1BGXL 4OGAC 4P2RD 1KJ2B 4G7VL 4LOUC 4GRLA 1I3VA 3BRGC 3BUTA 3BEWB 2EH8H 1RPQA 5IFAL 3BGFC 4EI5C 4N8CH 3MACL 3QCVH 3MREB 4ZS6C 5C9KA 2YC1A 1A21A 4O9HL 3RZCA 5C0DA 3VFRB 3VFMA 3U0WH 3HG1B 3C8KA 4J3SA 1BBJB 3VXRD 2SEBA 1RUMH 2Y5TA 3OQ3B 1CF8L 5L2KB 3VFTB 4PGDA 1MI5E 2BSSA 3ZKXB 1PAMA 2P24A 3QG7L 4R3SA 3UTSD 3V0VA 1IT9L 1T6VN 2FD6L 4WEUD 3MNZA 5D6CB 4O4YH 2XT1B 2R2BB 2FL5B 3QUKB 3ORJA 5I73B 4MQXC 4H26B 3HI6L 4HFWA 4G8GE 4HJ0D 4M4PA 4UINH 3VWKA 3TT1H 1ZT1A 5ESQB 3EOBB 3RVUD 4MNQB 4PRBB 4LASH 1T1XB 4GLRI 3HRZA 4KHTL 2MCPH 3AY4C 1T20B 3O2WH 5I1EH 1A8JH 4OZFB 3BH9A 4HX1B 3VXMD 4ZO9A 5CSGA 3KJ6L 3IDJA 2IH3B 3MGTB 1CL7L 4P23D 4F9PA 1A3LH 3P9LB 1YNTB 3OB0H 5ISZA 5TF0A 5C6TL 4CJ0A 5D7JA 1ZHBB 1ZA6B 5K9JH 1CDJA 1AFVL 1U91A 1OTUD 3ALWA 4KUCF 1IBGL 3TBWB 1FORH 3LV3B 2AJSL 4M03A 5JW5B 3FMGL 2KKQA 2OZ4L 4CDGC 3G6JE 4YQXH 1D5IH 2Z31B 3MPCA 4KI5D 4AEHL 1JPSH 3SDDC 2OJZH 2AGJL 5A2LH 2NW3A 5GRXG 4YNYA 3DSFH 4N0YH 5CWSA 2Z92B 4AQOA 3BH8B 4JFDB 5IT2L 4CADA 2C4FT 4M5ZH 3NAAL 1ORSB 1TZIB 2FWOA 3IETA 1BFSA 5D9SB 1AI1H 4NZRL 2BNRE 1WWWX 3KAAA 3MCKB 3PGDB 3QUZD 1BF2A 5CCKL 1ZK9A 2BC4B 2AKRA 2EC8A 4NGHH 4NKDB 5C0IB 5KSBA 3CCHA 4FQIH 5HHMB 3C6LB 2DM7A 4L8CB 4ETYA 3NIFF 5EH1A 4WIQA 3VG9C 3VD7A 5FKPB 5IG7B 5ESVB 3LKNB 5GGTL 2KZ1B 1I1AA 5CUSH 1C12B 1CICA 1ORQB 1QTYT 3SGEH 4YDKH 4PJFF 1ZS8A 3L3OA 4HS3A 5L6YH 2GK2A 2FR4A 1MCOH 3UCRA 5E5MA 3G6AB 3HG1D 4GO6B 4MNGA 4WO4B 2XKSA 4I3SH 5L2KD 4RDQG 1Q72H 3C60B 1P7QA 1WC7B 1KFAH 4KAQH 4HSQA 4XCFL 1OGAB 2ID5A 2ENYA 5FXCH 1RVFL 3T8XA 5F8QC 5F1IB 3LD8C 4NKMB 4PGJA 1JNNL 2UV3A 1IAOA 5D1ZB 5EOCL 5JIHA 3LN5A 3EYQD 5C09E 4AM0B 3F7YA 3JV4A 2XI9A 4OCNC 1U8MB 4RIRA 3RJDA 1E4XI 4X8JB 1HHHA 5ETUA 2HJKB 5I17B 1IFHL 2ZP0T 3UPRB 2OM5A 2A0LD 5FYKH 2NPLX 2JB5L 5J12B 1TQCB 4MNQD 8CGTA 4YZFE 4PJ9C 5GISL 1FYTA 3WNLA 3E8UL 5CILL 3RTQC 3BGMA 1RK1B 3RVXC 4I48B 4YEFA 1NBZB 4NO5A 5ALBL 4FP8L 4ZPTB 3RKDD 3IF1A 5TF1H 4ODXB 2AABL 4H1LA 3B2UD 4RWYH 5EIQA 4JPIB 4O58L 1YQVL 3GSRB 3O8XA 4JQVC 3R06A 2MHAB 4HT1L 4W68A 3PDGA 4KHXH 1V7NL 4M1CD 5FYKE 2AVGA 3MTRA 5L88L 1S7SA 3MYZA 3QHFL 5DRNA 3HUJF 4G5ZL 4IMLB 1PX3A 2H32B 3HA0A 3L3IA 3JV6B 5GJSL 3STZA 4JFFA 3QH3B 1N0XH 4LVOC 5CLWA 2F53B 4Q9CA 5AG9A 1LEGB 3GI8H 1A6TB 4M61B 3LRSA 3P4MA 4ERSH 4KVCH 1R3IL 2Z31D 2HJFA 2ICEB 1X5ZA 3MV8E 1YEEL 4XXDA 1FAIL 2W9EL 3AC0A 2DQDL 2OI9C 4Z5RA 4LEXH 1WF5A 2YR3A 5D8JL 3TIEA 4OFDA 4XXCC 1MHHA 3JWOC 4PRNB 4XZUB 5DD1H 4N90D 4F37F 1UH3A 3S35X 4LMQI 4MLSA 5L8KB 3NMEA 1RJZA 4HAFA 1Q9LA 2CJUH 3TO4A 2OP4L 3VXTB 3VG0H 5FUOH 1RUQL 5HHMD 3C6LD 4OCXH 2V5RA 4MA3B 4LLDB 1JJUA 1G7IB 4J3WA 4F33A 1MF2H 4M93C 4YR6B 2BFVH 4RFOH 2N1KA 2HRLA 4K9EC 3HZKB 5JOPD 2PYEA 4NZUL 1HKLL 2FB4H 4X8XA 3U0PB 5B3JE 2PNDA 4GW1A 1IC5L 4MXVE 4YFEA 2OJEA 1IM9A 4XNUL 4P9ML 1HZHH 4WO4D 2OTWA 2Z8SA 3C60D 2EH7H 3B9DA 4NC1E 5KSUA 4AG4L 1Z9SA 3CX5K 4AEIH 1OGAD 4U3CA 3CSBA 3S35L 4DW2L 1REIA 1W0VB 1U8NB 5C07E 3CFEB 1F8TL 3OAYK 1OF2B 5D1ZD 5KVFL 1ZT4B 2DQUH 2DTMH 3EO0A 4OUOA 4NO0B 4LNRA 4XVUD 5E8PA 3I85A 4FXGB 1ZTXH 2DJUA 4NRYB 1NCCH 4HFUL 4QHNA 4E42B 3B6SA 2DBLH 3EYVA 5IESL 1KIUA 3CK0L 3U79A 3HE6A 4D9RE 3D25A 4R7DA 3T2NH 1DBML 4LLYA 5K33A 3U30C 2D7TL 4RMSA 1J0IA 3KPSD 4KRPB 4KMQA 4NFBA 4Q9RL 2XTJB 3SDXF 1CGSH 4NQCB 2X1PA 3D85B 2X4NA 4RGNC 3W0WB 2CLRA 3QXDA 1NUGA 5D1QB 2R0ZH 1KC5H 5SWSA 4OZIF 4O2FB 1I8MA 2H2PD 3VRIB 4X5WA 3I2CH 4ODWB 3WBDA 3F58H 3PNWB 3Q6GH 3LKSA 5T3ZL 4FQXB 1YPZB 4W4OC 3TBSA 1E4WL 3MRMB 1TNNA 1KEGH 3I02B 3V95A 3ES6B 3WHE1 4ZSOE 2DDQL 1P53A 2Z8WC 1ZLWH 3ROLA 3T0XA 1DQQB 5DEFB 5DHVB 2FO1A 4J3XA 2VXVL 2EE3A 2P8LA 1FNGA 2E7HA 1CYGA 2EDTA 3ZE2F 1F5WA 2F58L 3KYOA 3TA3A 3ZSTA 5C0GB 3TH3T 1MWAA 1OLLA 4EDXA 4L29B 3O9WB 4K3JH 1N2RB 4PFEA 1RUAL 5E6IA 3SKUD 1FVEA 3HPJA 4N0UE 4FTVA 1YEHH 4FQQA 1AXSA 3AREC 5E08H 5DC4B 3T2QA 2Y36H 5ILTH 1OP5K 3GRWH 4PRPB 3HMWL 1IILE 3OG6B 3MV9E 1U6AL 1KENL 1KLFA 4TSAH 5KBNC 3NOIA 4L8SC 4Y8AA 1FV1B 3IDIA 1GHFL 4K3DL 1YZZA 1LO4H 1CE1L 3BJLA 4EBQH 3WCYA 3PQYB 4LSUH 2IH1A 4HKZB 1Q1JL 3O3EB 4NO0D 3X11A 5B8CA 3TBVA 3W9EB 2ZSVA 4QOKE 2X10A 3MRRB 5D1XC 3RP1A 4DVBB 1CFVH 4C56E 3I6KA 3MJ7B 4KQ3L 4XNZC 4WTZG 3KXFA 4WCYH 2OMBA 3DUSA 3RWIB 3RWFA 2BY2A 5HHQB 1UZ6F 1JPGB 2PR4L 5FYJD 3MXVH 5EU6A 2BERA 4WI9A 3VD9A 2FCBA 2BSRB 2P45B 1DLFL 4QRTB 2BVQA 2MOVA 1IL1A 3FJTA 1RZGA 3E2HB 4ZOCA 2RCSL 4KRPD 1CXKA 3BKML 3SCMC 2XTJD 4XI5C 5T5NG 3UPAA 2DQJL 4R4NC 4NQCD 3D85D 3W0WD 3P2TA 1KG0B 2IANA 3K1KC 4OBSA 1I85C 3H0TB 4HH9A 5D1QD 4YHKH 3NZHH 2E9BA 1M6OB 2DL9A 4NKIL 1S7QA 1F2XK 1PKOA 5CZVL 3U46B 2KL6A 2R2HB 3MUGA 5C0FA 5HPOA 5TFSL 2Z93B 2HVJB 1P7KB 1IMHC 4G6AC 2VIRB 3JSSA 1EO8L 4FQXD 3S37X 3RWDA 1WBYA 2FYYB 5DURB 1MCIA 3FQUA 1JPTH 4U1NB 5IW1B 3RWEA 5HHXL 4JZJA 4PJIB 1XF4B 2ITCA 2APVA 1XZ0B 3N1FC 4DAGH 2ZJSH 2CK0L 4X7DC 3RPKA 2GCYA 4XWOC 3QDJA 2VDPL 3MOAL 1MFCH 2EKJA 1MNUH 3TBTB 3CXDL 4NQEE 3S9DB 5LWYH 5CMAA 2NTSP 5FK9A 2QSQA 1MH5A 2JJTA 5L2JB 4PB9L 3CDGB 5JOPE 3DBXB 3GM0A 2V5MA 4EZMA 4PG9A 3O9WD 4R26H 4JKLA 4WFFD 3BIKB 3D18A 4Z7UE 5E4EB 2DJSA 3S37L 3CFCL 1HHIB 4KK6D 4PRDA 4M6ML 1CXHA 5IV2B 3MRQA 5C86A 3VXNA 1L6ZA 2LAAA 1WUNT 3PJSA 1XF5A 4PRPD 4X6DE 1JGLH 3MRKB 5FO8A 4YDIH 4JRWA 3I50H 2YRLA 1CTOA 3IB4A 2EH8L 3PQYD 5GS0C 1WAAA 5JA8B 4MS8C 1FDLL 4BH7B 5JHLL 4PD4J 3AB0C 1RULH 1TETH 2V2WA 4XVTH 3ARBB 3NCYS 1MCKA 3U0WL 1P1ZB 1KV3A 3KPSE 1BWWA 2GSGB 1B3JA 4NNYA 2GUOB 1QLFB 3NFNB 3G5XB 1RHHB 3DARA 4MSWB 3KPQA 1BLNB 1WSST 1JZ3A 2V5SA 4X9IA 1PLGL 3GSUB 2AI0L 2HJLA 5BOZG 2HRPH 5DUBB 4CW1A 3WFCH 1QR4A 1DEDA 12E8H 3DI3B 4QHLA 3H3KA 3UTTE 3V0WH 3EHBC 3K8KA 5GZNC 3AM8C 4JM2B 4LSSH 2IAMC 4NQVA 4AENB 5AZ2L 2ZOKA 3TT1L 4RFNB 4G9DA 3WDJA 5CHNB 3MV7B 5KVGL 3ARDC 2ORBH 1U36A 5IEHB 3GBLA 2MCPL 1KPUA 5T3XH 4MGXA 4Q0XH 5I1EL 1JGDA 1RU9H 1UJ3B 5F44A 4ZO6A 1FO0A 4KVNL 5JIKA 5EG6C 3D39A 3MODH 5DURD 3C09B 4UT6H 3TFKC 1NLBH 1A3LL 2HTLC 5EBLA 3H9SB 3SKNB 2W9DH 3ULSA 1QRNA 4P4KC 5JHDA 1RZ8B 5EUKA 1KGCD 4QXTA 4ZAKB 3QI9A 1SYSB 4JPWL 1FORL 1KPRB 5ITFB 2A9NH 3QFJA 2NX5A 5T3XE 4JM4H 2X1QA 5AZEH 2VDRH 4YFLF 2IADA 3IJYA 4Y5XB 2J3SA 4LHUB 4YQXL 4LNVA 1D5IL 4WI3A 4Q6IA 4ODUB 3VFUA 3VMPA 1FIGL 4PRIE 2OJZL 1J05B 4TOYH 2BRRH 1QFPA 1KUMA 2X09A 3JUZA 3TT3H 4DN4H 1J1PH 5ITBL 4OF6A 5DO2C 5B38A 5HPMB 1FLRH 4XNQA 1KELH 3BUYB 4M5ZL 1GYAA 1NMBL 2QSTA 3SGDI 4RQQA 4YHIB 1AI1L 4WHTB 3FQTA 1SY6H 1LNUB 5HGBB 2EZ0C 2CKBH 3PP3H 4YPGB 3S3JA 2R9HC 4ZFZB 3ZT6A 1BFTA 4OD3H 3NZ8A 2ADIB 1OTTD 1CFNB 4WW2A 2LTQB 4JFQB 4FQIL 1MIEL 4R0LA 3KPPB 3UTQB 2UVFA 5C9JA 3MLYL 1JV5A 4UT7H 4KRLB 2EC9T 4Y4KB 1KN2L 4HLZG 4WGWB 2EYRA 1QSVA 1T04B 4YDKL 4XP9H 2FSEA 3ILQD 3AMLA 5FUCE 1PZ5B 3S5LG 3JVGC 1A7NL 3ARBD 3G6DL 3MO1A 3GO1H 4EI6A 2A6IB 5FECB 4QRUB 1T3FB 2YSSB 4JAMA 2BNUB 2X4RA 3OG4B 3ARQA 4ODSH 4I3SL 2JTDA 4WFEE 1MCCA 1QFWI 2C1PA 4KAQL 2F8OA 2ZUQB 3LSOB 1BQUA 3CFBB 4OAWB 4WHYH 3VGBA 4RISL 4UTAL 4C83A 3IU4H 1I4FB 4ZD3L 1WBXB 5DHVH 3QCTH 1R5WA 4MJ6A 4WY7H 2B20A 5I75B 2YEZB 2QSVA 1JHKL 1OW0A 2XQBH 1IAIH 4HEPG 4IJ3C 1NANH 4JM2D 5KSAC 1FNAA 3U82B 3PWLA 3OF6A 1Z3GL 4PJBA 3VFGH 3MV7D 4LCCB 4GAFB 1LD9A 4OFYD 32C2A 5AWNL 3BPOB 1SBBA 3RGVB 2J88H 3O3BA 5CSZA 1T1ZB 3KPRA 4HS8L 5BRZB 3GBNL 3LKPA 3QO1A 1HEZB 5C08B 5TF1L 4PY7B 1EGJH 4Z7OE 4RA3A 3DPBA 5AD0B 1T03L 4HWBH 4UTBH 1UWGH 3T65A 4RWYL 4K94C 3GJFK 2FIKB 2UY6A 2DWDA 1MJUL 1QFHA 3ZMRA 3WKNA 4LLWA 1CU4L 3H9SD 4YHOL 1LVEA 2EYSB 3W9DB 1XCTA 4WU5B 3OKYA 3QUXB 4XCYB 3WYRA 1WWBX 5E9DA 5CD5C 4P46C 5KN5B 2Q7YA 4ZAKD 3UJIL 2AV7A 3DXAE 3HAEA 1YEGH 5GZOC 3DO7B 4X6BB 2D9CA 3CSYA 1JWSB 4ONHA 1KNOB 3GI8L 1CQYA 4LHUD 5I1LB 4PJGA 4KVCL 3TBYA 1OAYH 2IBGA 4UMGA 4PJAA 2CDFB 4JVPA 4LSTH 1NGQH 1S5IH 3PWUA 4X6CF 1K2DB 1RIUL 4XH2B 4DZBA 2GFBB 5C92A 1T0NB 4GRWB 5DD1L 5AAWA 1ITCA 5FUZL 3LN9A 3ZL4H 2YPVL 5C0BB 2GHWB 3RFZC 4JE4B 4X7TB 4MMZC 3TNMA 1F6LL 1FL6A 1CLZH 1W72H 3WUWB 4U0RB 1R24A 1RHFA 1ZA3A 1U8JA 2CDEB 1OCWH 5DHXB 4MXQC 5GGRY 4LCUB 4YHPA 4MQ7A 3GMMB 2IPKA 3KR3L 4GAYA 5FUOL 2I60H 4CGTA 1WT5A 4WFGD 2VLJA 2ZCLL 3HZYB 4MX7B 3WLBA 3B9KA 3GHBL 2YHGA 1CFTB 2BDNH 4L4VE 1MQ8A 4Y4KD 4ZUSA 1MF2L 5IMKB 1OQXA 3VXPB 2BFVL 4Z7WA 4UU9B 3ROOA 1NFKA 1OQOA 2EEAA 2FB4L 3AGVA 2A6JB 3KJ4B 4I2XA 4Y19A 5D2LF 3MX0A 3MLZL 1N7MH 2W0FA 5JDSB 4GG6B 4AEIL 3EFFB 4QYOA 5F3BA 4JY4A 3CIQA 3M8OH 2R8SL 3D69B 2Q8AH 4NQDE 1S7VB 2DQUL 5I18L 3MRPA 5E2TH 2CXGA 2M2DA 2VQ1A 3ZZ1A 3UDWC 5HHOE 5C0CE 3ZE1E 1ZTXL 5SWZE 3BO8B 1JPFA 5T33L 1NCCL 2IQAB 4UQ2A 3QIUA 1NEZG 4UOW0 3ZDXE 5EU4A 2DBLL 1OARL 4U1JA 2G75B 5INDA 3RGVD 2YK1L 3RWJA 1P84K 5CBEB 1IEBA 5BRZD 5I1HH 5C08D 3GFUA 5GGQH 5GGSY 4QHMB 1CGSL 3UTPD 3BRDA 4JREC 2P7TA 3VMNA 2BCKB 5SWQA 4OIIH 1K5NB 1G7MB 5F9AC 1H3PH 1KC5L 3M1BB 3RVWD 1SQ2N 3LKRA 3QQ4B 4KJPC 3MMEB 3OHXA 3MLSL 1QBLH 3QUXD 1D5MA 1J0ZA 1EVUA 5TDPB 3I2CL 4HEME 4QCIA 3C5SB 3VFOB 2XPGB 2ICWA 4WV1B 3RHWK 1NL0H 3N9GH 4JVUA 3OAUH 3DETC 3VFPB 4Z7NE 4S0SD 4M7JH 4MYWB 1KEGL 2VDOH 1UM4H 4OI7A 4JFOA 2VKWA 2EE6A 1FE8H 2E5EA 2VO5A 1NCNA 5LGHL 1NCAH 3U36A 3UZQA 1FPTH 2MTPA 5I8CB 1JNLL 3BP4A 2J6EA 4ZOAA 3VGAC 1HXYB 5B4MD 2RAMA 5C0BD 1B2WH 4APQC 4I8DA 3SDAB 4NQXA 1HILB 1U8PA 5DQ9A 2NW2B 4EUPA 1U58A 4GKNB 2ZNWA 4V1DE 1AP2B 1FZKA 1S3KH 1PYWA 4A6YH 3WS3B 3NPSC 3MUY1 1HSAA 1U2HA 5GIRA 2DQFB 4X5XA 1YEHL 2VDKL 1BEYL 5MENA 4F15B 2VMFA 5E08L 5E4IA 1PKQB 1AGFB 1A3RH 4XRCA 4FMKA 5HGHA 1P6FA 3GRWL 1HDMB 2XWBA 4Y4FA 3LKQA 1JRHL 1VCAA 5BS0D 2XY1A 4G42A 1T0MB 1JZ4A 3WFBH 5C0RL 3O4OB 4TQEH 5ERWA 4KKAD 1L7TH 1LO4L 1G6RH 2VITA 1LP9F 4EBQL 5ESAB 4EN3A 5KVEH 1TTGA 2IALA 4L8DA 4WWID 1BD2B 1CT8A 1PGRB 1G7LA 4Z7VF 4KY1L 5D5MF 5DK2A 5LGJA 4C54A 2OXHA 4RBPK 2CSPA 3P4NB 4WCYL 4X6EA 1N4XH 2AEQH 3B8SA 5C2BH 4XPTH 2EYTA 2FZ3A 4HF5H 3QUMB 4OCMC 5F1SA 3QDAA 1WBZA 4F80A 1QSFE 1OAQL 3DJ9A 3L95A 3ARFB 4O2CB 1D5BB 5B39B 3HMXA 3IVKA 4P9HL 5DI8B 3WS6A 1RSFA 1SJEB 4HUMB 3RKPA 2IPTL 1QVOA 5DJ0A 2R2EB 4N8VA 2VL5A 1FO0L 5HYJA 1T5WA 3BVNA 4YHKL 3QIWC 4KQ4H 3GMPA 3IDNB 4XX1G 1KEMH 2VJXA 1U92A 3M17B 1MCHA 1SBSH 5IMOA 5IMLB 2VZ3A 1KOAA 3KPNA 1QD0A 2VH5L 1A4JB 3QXAB 4POUB 1SHMA 4Z8FL 1GZQB 4NM8H 1BFVH 3TPKA 5GRZA 2Q86A 5E8OB 3SKMB 4UDTB 2HG5B 4PRHB 5INCB 4CMHC 4X7CC 1E4KA 4NKOB 4EXKA 1UXWB 1DE4B 1OAZL 2PW2A 2BX5A 2X4TB 2AV1A 2X40A 2NNAA 1MPAL 3GJFB 4H0HB 4LHQB 1MNUL 2J4WL 1BIIA 5IB3B 3FZUD 3SDAD 1EHXA 5LWYL 4WHDA 3ARPA 3X14A 1IM3B 1H8NA 1K9TA 4Y2DA 5TDOA 4MAUH 3LEYH 1CK0H 4QT5B 4XTRC 4IIQB 2XZAH 4G8FB 4ZYKB 3A6CL 3TCLA 4NM4L 1QO3A 4R26L 4L1HA 4Y4HC 2IWGA 2XA3A 3AVEA 4M7ZB 1MJ7H 3VWJA 5EC1B 3RA7H 4H1LG 4JCLA 1QPXA 1NPUA 3V6OE 4HWUA 1UZ8A 4P2OC 5MI0C 1BREA 3WV0A 3FFCB 2VDMH 4DKEL 4NCC2 4HUXA 3LHPL 1S9VA 1RFDH 1X5YA 1ZHLA 3INUH 4KKBC 4WRLA 5IJVB 3C6SA 4YDIL 2F54E 2P42B 5H2BB 1RMFH 2O5YH 1C16B 3GSXA 3HLAA 3I50L 4OZGA 5CP3A 2VZ1A 3UAJC 5A3ID 2J8UA 4AIZA 2D03L 4NQSB 2KH2B 3V5KB 4BKLB 4JKMA 1XGUA 5DGRA 4J3TA 4P3DA 1KTDB 4YHZH 4UNVA 2ADFL 2A77H 1BD2D 1RULL 1TETL 1FRGH 2JIXB 3WLWC 4F58H 4ISVB 3PWPB 4NRXB 5C0JA 4ELMA 5DRZA 1QR1A 1A5FH 4G6KL 5E7BA 1CLYL 1KCKA 4NUJB 4OV5A 2BVEA 4RRPG 4JRXB 1JGEA 3NTCH 3ARFD 5HVHC 2R0WH 3FO2B 1VEPA 2HRPL 4K07A 3C8HA 3CH1B 4PJDA 12E8L 5CZXC 4UI2A 4OCYL 2B4CC 1M7DA 3QULA 4PJCA 1I7UA 1VKXA 4GRLB 5FOBB 5MEOB 3RVTD 4O2EB 1P7HL 3VGGA 3G6JF 2CLVA 1T1WB 3AXLB 1QUNA 3CU7A 3MNWA 5T3XL 1TFHA 1U8QA 5HYQA 2APFA 3IDUA 4ZUWA 1TDQA 1FG2B 2CRYA 2GJ6E 1PZUB 4X98B 2F8XC 3C8KB 2BNQE 3TIDB 3CJJA 1DBJH 3EYSH 4QTIH 5FDWA 3TJHD 4ACPA 4PGDB 4NRZA 3RY6C 3THML 7FABH 3FCTA 4AEFA 3CFJA 2P24B 3IDMB 5J3HC 4PRHD 2DM3A 5SX4I 3TZVC 3N85H 1BF8A 4U6XB 3QSKB 4L3CA 3DIFA 2BK8A 2WBJA 1IGTA 2P49B 5E00A 1FFOA 2A9NL 1JGVH 2P5WE 4OUUA 3T2OA 4P5MB 4JY5H 1NEUA 1MSPA 3EJZC 2ADJB 4XP5L 1E4JA 4K23L 3L5JA 1FFQA 2B39A 4FFWC 4X0KA 4GAGH 4HC1A 3S34H 3HRZB 2BRRL 3Q1SL 4F7MB 1DJSA 3FB6A 3HNSH 3VXSB 1T89A 4N0FA 5BS0E 1UCBH 1Q0XH 4POZC 2YPLB 3JWNC 1S7UA 1NFDE 3FOMB 2UYLA 4Z95H 4F37K 3G5YB 4CDHA 5J7CC 4Y89A 3FFCD 1SY6L 4M1DH 2CKBL 1ZT7B 4LU5H 1HSBA 3V5HA 4U3HA 2XXCB 4X4ME 1CD1A 5E2VH 4EJ1C 2WUCL 1YJDH 4UT7L 1X4YA 4P2YA 2ED7A 1VPOH 4F7EA 4Z76B 1S8DA 4BM7A 3F7RA 4XP9L 3WEXA 3EAKA 2FGWH 2B1HL 3PHSA 1XMWA 1CLCA 2JIXD 3LKOA 3IS0X 4NHCH 5F7UA 4GG8A 1U2CA 4WDIB 3PWPD 5IVXE 3LS5H 1P4BH 4GW4A 4JRXD 2DQCH 4TUOB 3VRLF 3IU4L 1BX2B 5MP6H 3O6FA 1Q9WA 1CGYA 4DOHB 5M94B 3QCTL 1IC7L 1YY9C 3CUPA 3BW9A 5JUEL 1U95A 5GSVA 5CGYD 2JB6B 5KSBB 1UH2A 1IAIL 4LIQL 4OCWH 3VFNB 2MPAH 3A0OA 4J4PD 3P30H 2BVUA 4M8QB 4JVWA 5JQ6L 4OLUL 4GRLD 4E0RB 1AD0A 3VFGL 2R39A 2FH8A 1OP3K 3WUZA 4Z78A 4YBLC 1X6LA 4MJ5A 1VACA 1G9NH 1XGYH 1ZS8B 4HS3B 2FR4B 2OLDA 4UIKL 2LAGB 2WWKT 2Q1EA 4OQTH 4HWBL 4UTBL 1A14H 1FNLA 4PJ5A 1KJMA 1PG7H 1P7QB 1T80A 2AJ3B 1CD8A 1N59A 5FV2A 3HZMA 2QJDA 1S7RB 1CVSC 3SDDB 3T8XB 3EOAB 4TNWF 1I3RB 1A64A 2X4PB 5DRXA 1OWWA 3B83A 5DVMA 5I15L 5BZWB 3F7YB 4IEFB 2CLZA 4MXWH 1N5YH 4LPWA 3SGJC 3I9GL 4RIRB 5GS1C 3FO1A 1HHHB 3MA7A 4DZ8B 3WD5H 2JCCF 3B2VH 1WZ1L 4V2CB 1HHJA 1XCQA 3MRCA 3H9ZA 3AMKA 3HE6C 2NLJA 3LQAL 4MD0A 1JGUH 3BZFA 5CEZH 3WXWL 1PKQE 3BZEB 2PTTB 4OKVA 3LPWA 4ORGA 1NGQL 5SX5H 2E7LA 2NY1C 2W91A 3VG9B 2XZZA 1Y6NR 5IB5B 3VXSD 3CC5A 2A83B 1LK2B 3VFSB 4HIHB 4MXVF 2YPLD 3QO0A 3ZL4L 4FNLH 5DWUH 3ZHLA 3O8XB 3R06B 1BD2E 1SEQL 2I60L 3RWCA 5CEZE 3ARGC 5BV7H 3AU1A 2EIEA 2NTFA 4PJ8C 5ENWB 1JN6B 1KCSL 2BDNL 4XMPL 3LD8B 4ZXBA 2EDRA 5JA9A 1BZ7A 4PJ7A 5T5FH 2R1XA 4JRYB 3AROA 3QEUA 3QRGL 1C08B 4MQXD 4F8QA 2PUQT 2ZNXA 4QO1A 3SGKA 4OJFH 3CZJA 4Z5RB 4Y16C 4PJEE 5I6XC 4Q7DA 4U49A 1AY1H 3TIEB 3CVHH 3H7LA 1MHHB 1VA9A 2AQ1A 5IB4A 3IS1X 1I8LA 25C8H 5I30H 4XPAH 4I9WE 1TTUA 1MIML 2VDQH 2GAZA 3SE3C 4DVRH 5FO7B 1FP5A 3ETBF 2V17H 5LG1A 4LCWA 4OT1H 3TPUA 4XB8A 2CR3A 2IC2A 1F3RB 4HIJB 5D2NA 3FQRA 4AMKH 5JW4M 2EDFA 5EOQH 1T21A 2HTKC 4PS4H 4GUPA 4EOWH 3G9AB 5EFIB 4PJFB 4PRHE 3MV8A 1IGCH 2HT2C 5T1KB 2WP3O 4W6XB 5EU5B 5FV1L 5I1HL 3HR5A 4B53A 3NFSH 4XCNA 4LVOB 2IMMA 1I7ZB 2VAAA 5JO5A 43CAA 1TZGH 1EH9A 1P6AB 1OPGL 2OTWB 1AQDA 3MRGB 3CDYA 1X4ZA 2HFEA 1JZ6A 1P7QD 2MNUA 1UADC 4P2RA 1H3PL 1LDSA 3SDDD 4ZFOA 4F9LC 2OI9B 2PTVA 1QBLL 3FO0L 4IM8A 1BQLL 4ALAH 3BKYH 3EO0B 1DUZB 4CU7A 3H2WA 1M7XA 4HIXL 4KJYA 5EU7C 3WIHH 1NL0L 1G7QA 1A2YB 3CZFA 4HZLB 4PJXE 3OAUL 1V3KA 5TE6H 3I75B 3VXRA 2AQ3A 4G9FE 2VDOL 5F7DA 1PEWA 5E2UH 1FE8L 1WFOA 2WLYA 4R7DB 2YA1A 4FMFA 5TQ0L 1XGPA 4O5LH 3S96B 1A0QH 1K8IB 3T3PE 3DRTA 2G5BA 4M93B 5DS8A 5KS9A 4B41A 3MFGB 3KWWA 1BVZA 3F5WA 1IE5A 1MQKH 3TV3H 3DUHA 3KLAA 5E8NA 1VEMA 3O8XD 5F9JA 2QHLA 5HYIA 4CVWA 3L5XH 3WE6B 3HUJB 4X5WB 4WFHD 3BSZL 4HPYH 4KUCD 4L4TB 4A6YL 2XY2A 4GXVL 2MCG1 2ADGB 2H8PB 2OTPA 3LKSB 3QWOA 5EUOE 1PQZB 4U31A 2FGZA 3VXMA 1B9ZA 1Y18B 3UMTA 5EORH 4CU8A 4JRYD 3REVA 3RWHB 1CDIA 4FQJH 4P23A 4NQUA 1AO7E 1YEIL 5IM7A 4OI9A 4DK6A 1QEWB 3HB3C 4R97C 3ZYIA 2GW5A 4TQEL 2EIDA 3ZE0E 1FNGB 1RUPL 4KGJA 1NJ9B 1QBBA 4PGEB 5KVEL 2DIJA 3RVXD 4NSKA 3H7BB 4MZ2A 3EO9H 4IOFC 1MWAB 1KJ3H 3JTSB 4JHBA 4RGNB 1YEFH 4IS6A 1FGNH 3LB6C 5LAXA 3Q6FA 3LEVH 1KACB 2WWMC 2HYMA 4JEGB 1G7HB 1KYOJ 5B38G 1FVEB 3FT2A 4XPTL 1I9JL 2G60L 3GUTB 3WN5A 4HF5L 2UWEA 4ZSOA 3G9VA 2HVKA 1UB5B 2CDGA 5T1KD 4HG4K 3CD4A 5F6IB 4G43B 4OLXL 4EEEA 3IKCA 1V05A 2A6DA 2V9QA 3NCMA 3QUZA 2VR9A 1BWMA 4KKLC 5HDQH 2HLAB 1XR9A 4HPOL 5EZJA 3LQMA 1J9CT 3VDAA 1FNSH 1KJ2A 5F21B 4WEBH 4M48H 1YYMH 4KQ4L 1G0XA 2OL3B 1NUDA 1KEML 3BEWA 1TTFA 2GJJA 2O5XH 4CVUA 3WHXB 3C9NB 1B88A 3TBVB 2L7UA 3VFRA 3DO3A 2ZSVB 2YS4A 4S0TD 3KDMB 4NHUA 2XKUA 4Z7UF 1BBJA 1T22B 3LZFH 4N0UA 3RWFB 3WIFB 1ZANH 3BYTA 5L2KA 3NFPB 3VFTA 5DMGD 3MJ9A 4A2MA 4CNIB 3UTZB 4HC1L 3DROB 4N1EA 5D6CA 5DYOB 4X6DF 3CPLA 3SDXB 2R2BA 2FL5A 3QUKA 1ACZA 2UY7A 3AREB 2R69H 2VL4A 4M9PA 2JELH 2MKLC 1IEHA 3EGSB 5BOPA 1HQRB 4TVPH 4BJLA 4PBWD 4OZIB 1BOGB 5ESQA 3MCLL 3EOBA 2IFGA 4MNQA 2XZAL 4PRBA 1T1XA 2CXKA 4L8SB 2W59A 3D5OF 3CFIC 1K4DB 4L4TD 1GIGH 2AK4E 3MJ8B 1T20A 2PW1A 3RA7L 3C5ZC 1SJHB 4OZFA 1XGTB 5DMIH 4HX1A 1F3JA 4F7TB 5C70A 2IH3A 2XNAB 2HLFC 3MGTA 3UBXG 2VDML 3U7YL 3P9LA 3LVEA 1QSEB 1YNTA 3MC0A 3INUL 4TVPE 5F3HB 4XNZB 3CVIH 2HWZL 1ZA6A 1BM3L 3HAEG 1TMCB 5E70A 1UA6L 2NQCA 1T83C 2I5YL 1TVDA 2BVPA 3TBWA 4P5TC 1J8HB 3LV3A 1GGUA 3R4DA 4YHZL 2XICA 1DQDH 1I9IH 5E24E 4FQ2H 3SCMB 3RIAK 1MEXH 2Z31A 4RGND 1JK8B 3DVIA 2EDDA 3X3GL 3DVNB 4H5SB 4X4YB 1A5FL 2FX7H 3MRHB 2E8ZA 4K8RD 1NAMH 5F1NB 4NFCA 1A4KB 2QL1A 3FQXB 4N9GB 4FQ1L 1ORSA 1TZIA 3F7QA 2R0WL 4KKCC 1X5KA 4UB0H 5D9SA 4M7KH 5CIPH 3VU2A 3MRNB 2BSED 4W6WB 3LAFA 3PGDA 1UT9A 3QXTA 1T2QL 2DL2A 4PY8J 4L8CA 3OAZH 5IG7A 1CDCA 5ESVA 3LKNA 2X7LA 1C12A 1ORQA 3BGAA 4OD1H 3JWDH 1N6VA 2ILLA 1CIDA 3HCVB 4GJTB 2BJML 1DQJA 3G6AA 3MLWL 1IGJB 1DBJL 5C8JB 5CD3A 2NZ9C 4WO4A 4DKFH 1U9KA 1VFUA 3C60A 1L0YA 5E7FA 1WC7A 3MFFB 4U6HB 4PLKC 3MA9H 2C3HA 1OGAA 1U3HC 4I5BB 2C26A 5F1IA 5FHBH 2D3VA 1D9KA 1H0DA 4CW1B 4AK1A 3GMRA 5D1ZA 3HR6A 2EE9A 4OM1H 3DGGA 1LK3H 4AM0A 1M71B 3ARED 1JGVL 1YEKH 4ODTH 1U8MA 2YUZA 4X8JA 2ZOKB 3H3BC 3VFWB 2HJKA 3SY0B 5I17A 2AEWA 5JIIA 3UPRA 3TN0C 2RGSA 2WUBH 3S34L 5BW7C 5I16B 1XEDA 3HNSL 1GAFH 1RK1A 4G6JL 4PTTA 1GGBH 1NBZA 4HMDA 1QZ1A 4ZPTA 1Q0XL 3HC0B 3KPSA 5D71H 1GGIH 3EOTH 2A6KB 4MAYC 4L3EE 4ODXA 4XWGH 1MREH 3RUGE 3BN9C 4LSRH 3AB0B 2C5DC 2JK5B 5EBLB 1DLHA 3GSRA 1QSED 2MHAA 4LU5L 1FCGA 3KHOA 4XP1H 5F7EL 3HI5H 5E2VL 2VQTA 1FAKT 1JFQL 2VLME 1E4XL 1JVKA 1NQBA 2DS4A 4KK8C 4IMLA 1WVZA 1MJ8H 1BZ9B 2H32A 1J8HD 2HFGH 2YKLH 3QH3A 3RNQB 5E2JA 3GSWB 4OV6F 1A6TA 3SCMD 3WSQH 1K6QH 2B1AH 4M6OL 4XI5D 5KVDH 2ICEA 3O3AB 3O6LH 2IAMB 4FQPA 3RX5A 1QYGL 4UAOC 5JXEA 2MWCA 3LS5L 4Z7OF 1VHPA 3MRLB 1PG7X 4PRNA 4XZUA 3ARDB 3WNPA 3JUYA 4I18C 1GC1L 5DR5H 1YEDB 2QR0B 2E9JA 1F4YH 4E5XB 4EUPG 3KLHC 2ZOLB 2I26N 4G6AD 3FQTB 4YHYC 2DIAA 4FABH 4OCWL 2MPAL 3V7AE 4R0LB 5FUCC 3DMMC 5C9JB 1LO0H 4MA3A 4LLDA 1FGVH 1CFQA 1KCUL 1ZGLB 1G7IA 4QKXB 3OKOB 4P4KB 5EN2B 2XN9E 3IGAB 2EYRB 4QTHB 2X1XR 4YR6A 4XWOD 1H3VA 3HZKA 3SO5A 4J12A 3U0PA 2ESVB 2X4RB 1FVCB 1A22B 1JUFB 1GL4B 1A14L 1OAUL 2APTA 3V4PL 1XGQB 1PG7L 3QDGE 1SYVB 2B2XH 3BP5B 1O5DT 4HJJH 2NY5L 3MLRH 5ALCH 5JR1H 1MFAL 1RZFL 1W0VA 1U8NA 1R5WB 3CFEA 1OF2A 2EICA 1P9MC 1ZT4A 5IW6A 3QA3A 3PP4H 4QRPE 3O6ML 4MXWL 4NO0A 2O61B 2M8XA 1OAKL 4FXGA 3WD5L 3B2VL 1YQ2A 4IRJA 1TVBA 4NRYA 1CD0A 4JFYA 3PWLB 5D7SH 3HNVL 1QP1A 2I24N 2R4SH 1NLDH 4E42A 4Z18A 4YUEH 5CEZL 5A2KH 4FXKB 3IJSB 5JDJA 3BMVA 4YLQT 1LO2H 5CSZB 3KPRB 4GS7C 4Y1AB 3U4BH 4DTGL 1UWEH 5GS0D 2FECL 2P43B 4N8VG 2QQLH 4MS8D 3TC9A 3D85A 3QZWA 3T65B 3W0WA 5FIEA 5D1QA 2MJWA 1MCSA 4UT9H 5EZOH 3P0VH 2R0KL 1A7PH 3QWQB 4O2FA 5E9DB 4QY8B 3VRIA 2EDBA 2XZCH 5GRYA 1JF5A 4ODWA 3ZE1F 3EZJB 2FX9H 1UVQB 3CSYB 3BISA 4KV5F 4JFEB 3KPMA 1WISA 3MRMA 4PJGB 1E0OB 3ZDZE 3HPLA 4JY6B 2DOCA 4BK5A 3ES6A 5GZND 5F9OH 5KSAB 1HIMH 4OJFL 4MJIE 2K7QA 3FN0H 1N6QL 2IAMD 1U8KB 2ZG3A 2C4XA 4JDZA 1DQQA 5DEFA 5DHVA 1I8KB 4HGKC 3ARDD 25C8L 1R3HB 5F72S 3TO2B 1RJYB 5I30L 4XPAL 1DANU 2VDQL 4OZHF 4OCRH 4Q2ZA 5C0GA 3HNTL 2V17L 4MA7L 1H15A 4OT1L 1A1NB 4U1GC 15C8H 1QLRB 1FZOB 2OBGA 4K55A 4GAYB 3U4EB 2O93L 2P8PB 4LSVH 4L29A 2NY6C 2NY2C 3O9WA 3TFKD 3DRQA 2HTLD 1N2RA 5EOQL 1MJJB 3WLBB 1KJ2L 4U6TA 3T0AA 3MOBL 4AH2B 4P4KD 5A2JH 1DDHB 2IFFH 3ZTJG 4P46B 5J56B 3ROOB 1VGKB 5CJOH 1IGCL 1UJTA 3LS4H 4DGVL 5IWLC 4Y19B 4BQ8A 4JG1H 4PRPA 2ESVD 1P2CB 4O00A 2JJVA 2E7MA 1HXMA 4KJWC 3C2SA 1BHGA 5CJXA 4LPVA 4TRPL 1JMXA 2P5EB 4QHUB 2AXHA 3PQYA 3TVMC 3GSNH 5DUPL 5DO2D 4GQ9L 4ALAL 3BKYL 1BECA 3D0VB 3EW3B 4R96B 3H42H 5BVJB 2VQ1B 3STLB 1HN1A 3T0EE 5I66B 3W9EA 1A7QH 4TSBH 3MRRA 4DVBA 4NBZB 3K0WA 1C1EL 3MJ7A 3SKOB 1HHKB 2EZ0D 2HAZA 3RWIA 2R9HD 4OB5L 3NPZB 1YMME 4U1JB 5E2UL 1JPGA 3VGFA 1EHAA 5JW4Q 2BSRA 4QRTA 4Y1AD 5FGBA 5EA0H 5HYSA 3SOBH 5FF6A 2W0LA 5IROA 2AK1L 3EYOB 4H20H 4ONGH 4QRRB 3RU8L 2P7TB 3ULVH 2BOCB 4KUZL 4RFEB 2XV6B 1KG0A 3P73B 3H0TA 3R0NA 4ENEC 1M6OA 1A47A 5FCUH 3TYGL 2GT9A 3V6ZB 3U46A 4P59H 3TM6A 2R2HA 4JPVH 4HPYL 2Z93A 2HVJA 4QCIB 5SWZA 1P7KA 4ZUTB 1J8KA 2VIRA 1KCRH 5CSBA 1T66C 4JFED 5EORL 5DVLA 3ULVE 2FYYA 4HAGA 4JFOB 4FQJL 2J5LC 4U1NA 5KSAD 5IW1A 2VLKE 4X6CB 4PJIA 1KB5H 1Q0YH 1XF4A 1MY5A 4X9BA 4YC2C 3U36B 1OP9A 4O02H 2ARWA 4RAVA 2DM2A 5AG8A 5L0QC 4XBEL 1FC1A 4XBGA 4Y2DC 4NQXB 3EO9L 3TBTA 4XHQA 3QJHB 2CIIB 4B0MM 2E6JA 1Q38A 1KJ3L 5L2JA 3QEQB 4JREB 3QG6B 3CDGA 1FGNL 4HBQA 3V4UL 4PJHE 1FFNB 4NOBA 3BIKA 4UV7L 5JPMB 1NMCC 1RUKH 4X5XB 1ZAGA 2GYSA 1HHIA 3G5ZB 3MLXH 5CD5D 4P46D 3NCJL 2X42A 2XXMB 5IV2A 1IEAB 2EIZB 4XRCB 5GZOD 1ULVA 1PSKL 4Y19D 3RX8A 2XWBB 5D2LB 5HDQL 3MRJB 4FFZL 2XWJB 4OGZA 4GSDL 1FNSL 4WEBL 4M48L 1YYML 1INDH 4HQQL 4C58B 2H6PB 1ZHNB 2P5ED 1NDMA 2DJ4A 5GSRA 2R23B 2AJUL 4BA8A 4D9LL 1F6AB 5B3NA 5DK2B 3VGAB 4PLJC 2YD4A 3ARBA 4APQB 1IKFH 2OK0H 1P1ZA 5ACZB 2GSGA 1Z0NA 2NYYC 4XPFH 2GUOA 3OB0K 1C5CH 1QLFA 1ZANL 3NFNA 4MXQD 4AQ1B 2DLIA 3G5XA 1RHHA 3GMQB 4IHOB 4MSWA 4JDTH 1NCUA 1BLNA 4ZQKA 3L95B 2DMCA 3FONA 2XG4A 3GSUA 2A1WH 1AXTL 1N64L 5DUBA 5TQ2H 2AJVL 3CLEH 5AYUH 5DJ0B 4QRRD 2R69L 2ZPKH 5D6DA 4HIIB 3LQZB 4JM2A 2JELL 3CGTA 2DYPB 2A73B 1T5WB 1QFWM 5KJRH 4AENA 5DTFB 3O0RH 4G7VH 4TVPL 1Z2KA 2DMKA 3MV7A 5IFAH 3NH7L 3ALPA 3KYNB 4OFYA 5IEHA 1S9KC 3MACH 5IMOB 5C0EB 3JV0A 3QFDA 5F97E 4B5EA 4IMKA 3IDGB 4O9HH 5DVOA 3GNML 4MD5B 1TVHB 1UJ3A 5D7IB 1BJ8A 4QRQB 4JDVB 3L3HB 1CF8H 2ZUVA 4FZEH 4WNQB 5DMJB 4U4BA 1A1OB 3H9SA 1IT9H 3K3QA 2FD6H 5CFHA 3SKNA 5GGUB 2CRZA 2HT3C 3P3YA 5A2IH 2X70B 4WUUB 4ZAKA 2NNAB 1SYSA 1KPRA 1BIIB 1LGVA 1I9IL 4FQ2L 4LHUA 5T1MB 1AGBB 1MEXL 2Y7QB 4ODUA 3QEQD 5IJKA 3V6OC 3KPOB 1J05A 4KHTH 1Z0MA 2FX7L 3QIWB 5MHSD 4KJPD 1NAML 3VWJB 3DURB 1X5LA 1DN2A 2JJUA 5HPMA 1M7IB 3FTGB 3FT3B 4LP5A 4NP4L 2V2XB 3BUYA 4X80H 1IC1A 5J89A 5DD6B 4XPBL 1B0GA 4YHIA 1CL7H 4WHTA 3Q3GB 5C3LD 2DQIH 2P4AB 5HGBA 1ZHLB 4YPGA 3DETD 4ZFZA 5ID1B 2JE8A 4QXWA 5C6TH 5TH2B 4XP4L 1CFNA 1J1XL 1ADQL 2YPKB 5GRJL 4JFQA 1AFVH 3KPPA 4MHHI 1LP9B 2AJSH 4Y4KA 4HCRA 4P3DB 3KVQA 5EOTB 2Q8BH 3FMGH 1PX4A 4NN5C 4OD1L 1G9EA 2OZ4H 4UBDC 3ZT7A 2IEPA 3BDBA 4Z7VB 3JWDL 5D5MB 1MFBH 1E27A 1PZ5A 1JYWA 4APQD 2A6IA 5FECA 4QRUA 1T3FA 2AGJH 5C0JB 4H25A 1BOYA 5DRZB 2BNUA 4O51B 2VLRB 4DKFL 1OSZA 5CEXB 5IBUB 3LSOA 3CFBA 4OAWA 5IB2A 3NAAH 1I4FA 5FYJL 2EO9A 2RB8A 4Y4HB 1WBXA 4TNWK 5CINL 4PG2C 5IQ7L 4NZRH 1X5HA 4J3UA 4BFBD 1LK3L 1N5AB 2YEZA 5CCKH 1YEKL 35C8L 4P2OB 5MI0B 2DYPD 1VKXB 4LP4A 2Q3ZA 4FS0A 1S78C 5F7FA 1PEZA 1FNEB 2Z35A 5FGCB 4OTXL 4IRSC 5T3ZD 4LCCA 1EO7A 3SE4A 1G0DA 3MNWB 1I1YB 3RGVA 3BWUC 1JMZA 2GKIA 2YD9A 2P44B 5C08A 1HEZA 5D71L 3EOTL 4PY7A 5IVXF 5AD0A 1F3DH 1MREL 2OS7A 5FDWB 1VADB 4LSRL 2OTUA 5HD8C 1C7TA 2FIKA 3RBGA 3W9DA 2EYSA 4WU5A 4J7RA 3QUXA 3HI5L 4NFDA 1JNNH 1YA5A 5KN5A 4WUUD 2ZCHH 1P84J 1MJ8L 1W8OA 1FFOB 2XACC 2HFGL 4OUUB 4X6BA 5HVHB 3LIZH 4D9QD 2AEIT 1JWSA 2HFFB 1XT5A 1KNOA 1IFHH 1SVCP 4D0BA 3WSQL 2B1AL 5I1LA 5KVDL 4X0KB 3CNKA 2CDFA 2B5IC 3O6LL 3E8UH 5CGMA 5CILH 4S11A 4S1SL 3QIWD 2LU7A 5ALBH 4XH2A 2GFBA 4PREA 1T0NA 1S7UB 3GDBA 4M3KB 2AABH 4XC1H 5DR5L 1MI5B 4X9HA 4N1CA 4X7TA 2ZCKL 1F4YL 2X4QB 2WLZA 1CE6B 3REWB 1OSPH 3QIBB 4O58H 3VXUE 3BKJH 1YQVH 4HLZH 2DN7A 5MEQB 4FABL 1WJ3A 1V7NH 5IMMB 4LCUA 2EDJA 5L88H 5E94B 3SDCC 1EEQA 4OF8A 1LO0L 3HZYA 4MX7A 4G8GB 3GSQB 4JB9H 2C3GA 4F7EB 3TZVB 1CFTA 3B5TA 3RJQB 1R5IB 1U0QA 3VXPA 4UU9A 2VUYA 4P3CL 3ZTNL 3BPNB 1R3IH 2A6JA 3N1GC 1YEEH 1FAIH 3V52H 1WICA 4OF3A 2DQDH 2Y5EA 5BS0A 2VLRD 4KI1A 5D8JH 2B2XL 2DLTA 5JDSA 4TVSa 4XTRD 4W70A 4YXHL 4HGMA 3EFFA 1ACYL 5ALCL 4Y4HD 3D69A 1BFOB 3TNNB 2X44D 4BQBA 1U95B 1S7VA 3PP4L 1X5XA 5EIIB 2OP4H 2OYPA 2AJYL 4P2OD 1OD9A 5GS2H 4K2UL 3BO8A 1BPVA 1MFEH 5D7SL 2IQAA 1NLDL 3Q5TA 4JKKA 1ZLWK 2H41A 4U6YA 5LVEA 2KBGA 4KKBD 4KK5C 3G6JB 4XVSH 2G75A 4X5LA 4JR9L 3UAJD 4YXLL 4OFIA 4X6CE 2DWEB 1U93B 3JZ7A 4NJ9H 2YN5A 2QQLL 2XA8L 4PJEF 4QHMA 1ZSDB 4XNUH 4MA1C 1L9MA 4NC0B 2BCKA 3VDBA 8FABB 1K5NA 4UT9L 1G9NC 5EZOL 3WLWD 3P0VL 3M1BA 1T0PB 1QLEL 3QQ4A 3MMEA 3NCBB 2V5TA 2Y06L 3MUHL 2BNRB 3PDOB 4M4RA 5DRXB 1A9EB 5TDPA 2VN4A 1WWCA 2CLZB 2XZCL 4MDIB 5IEKB 3C5SA 5CJ8A 3VFOA 1CFSB 1MELA 4WV1A 5KAQF 4K7PY 2Q20A 2NY5C 1XCQB 1IKNA 3MRCB 4HFUH 2E3VA 4KI5F 5CZXD 2BP3A 5F6HI 1MCPH 5IESH 1HIML 2JJWA 4JANB 2VWEE 1PD6A 5EO9B 1DBMH 5FB8B 5BJTB 5KSVB 1T4KB 2YUWA 3FHAA 1U3YA 1CDGA 4I0CC 4U2ZA 1F11A 4Q9RH 5C0ND 4CUCA 4YBLB 1HXYA 1CGVA 1MI5D 2QQKL 4H0IA 3RVUC 2GJZB 4L8BB 3SDAA 1HILA 4OCRL 2LQRA 3QIBD 1J10A 2NW2A 15C8L 4GKNA 1YMHB 3AS0A 1AP2A 3QHZL 5C09B 4LSVL 4PPTA 2BSTA 3RY4A 3ZYZA 4HUWB 2NCMA 4XCCL 3SQBA 5DRWB 4G8GD 3GSOB 4OZFG 3WS3A 4ZXBB 4PJXF 3TZVD 4Z9KB 2DQFA 4OGYL 4OQTA 3O6KH 4BQ6A 1KIPB 5ACLA 3B43A 5CJOL 1PKQA 2P46B 1F4HA 5BV7C 1AGFA 3MGOB 1Z6JT 3MV11 5HGAB 4LCYB 4YGVB 1G0YR 3UJTH 2YUXA 5HHVL 5FA4B 1T0MA 2BY1A 3WO3B 3EJZD 3T3PF 1NAKH 4M1GL 4WTWA 4FFWD 1H8OA 4QRSB 5HGDB 1AXIB 1W0WA 3WFEH 4KROC 2AQ2A 2BVOB 3BPLC 1FL5B 5ESAA 2F58H 1I75A 4ZNEE 4KI5C 1MCEA 4POZD 2IQ9H 1AKJB 4D8PB 1BD2A 3H42L 1V7ML 1PY9A 5DA0B 1QBML 2B7DT 1J87A 3SBWC 1A7QL 2HKFH 5FKAB 2W38A 3P4NA 2F5AL 2XRAL 5EUOF 4NBYB 4GH7B 2H3NB 4OFPA 1JTOA 3ARGB 5F96L 2K3TA 4PJ8B 3MV8B 4B7IA 4O2CA 3ARFA 1D5BA 1JL8A 5DEZA 5B39A 5E0QA 5IW3A 5DI8A 4QXGL 3SOBL 4XCNB 3V4VL 2RJMA 3HMWH 5JO5B 4H20L 1U6AH 3VRJB 2R2EA 2VRAA 4JHWH 5D7KE 1ETZB 4ZG1A 1GHFH 4QNPE 4WI8A 1J0JA 3O4LD 5FCUL 1CE1H 1EX0A 3IDNA 5I6XB 1F6FB 2BNRD 3M17A 4P99A 2X41A 4JPVL 1WEJL 4ZUUB 1XFPA 3E3QC 1ZLSH 1A4JA 3QXAA 4TNVF 4BUHA 4U6VH 4X4XA 1ZMYA 1GZQA 1YY9D 4NCDA 4KQ3H 4RA0C 5I8EB 3CVHA 1XF3A 3ARZA 4YX2H 2BXYA 3SKMA 1JYNA 4PRHA 1KB5L 1LDPL 4WJ5B 4NKOA 1XGPB 4O02L 1UXWA 3TP4A 1DLFH 5L9DH 4AIXA 3MROB 3BKMH 2GTWB 2X4TA 2J12B 3PG2A 3GJFA 1MHCB 3F5WB 4A2LA 2IPUK 2NMSA 5IB3A 1NCWH 3KLAB 4GBXA 5E8NB 4M5YH 5F70A 3AS2A 1MCQA 3A6OA 2OR7A 5C07B 1C5DB 4NKIH 4QT5A 5C09D 4IIQA 3MUZ1 4G8FA 5CZVH 4ZYKA 1Q9OB 4LQ1A 5J13C 2EDWA 4RX4D 4ZXBD 1CD9B 1OGTB 3B2UC 5EC1A 1I3GH 3MLXL 3EYUH 2MQ0A 2ED8A 3F12B 1J1OH 3FFCA 3S36H 5IM7B 5A2FA 1AHWC 5HHXH 4R8WL 4OI8A 4YDVB 4N1HB 2E6QA 5IJVA 3EIFA 4WWKC 5DA4A 2FEDC 1C16A 2CK0H 2VZVA 2ZSWB 5F88A 2IPUG 5ISZE 1T2XA 4NQSA 2VDPH 5I9QC 5KVMC 1FSKB 3V5KA 3WIHA 4NSKB 4BKLA 5FGCE 1XF2B 1F4WH 3CXDH 1KTDA 1IAKB 5FHAL 2FHFA 2AJZB 1AKJD 2P47B 4PB9H 2OK0L 4ISVA 1FG9C 2OCFD 4NRXA 4XPFL 1X5FA 3JXAA 1C5CL 3PF2A 5IGXH 5B21A 1NBYA 4NUJA 3CFCH 4RNRB 2ZKHH 4JDTL 1FN4B 3DHJA 3GSVB 3ARGD 4M6MH 4ZSOB 4PJ8D 4UUJB 1AO7A 2YXMA 3J7HA 2DQEH 3IKCB 1WV7T 3CH1A 7CGTA 3CLEL 2A6DB 4JQXC 5F71A 3C6LC 4N5EC 4BK4A 5EZJB 3D3VD 5KJRL 4J4PA 4U05A 4ONOA 3O0RL 5FOBA 5MEOA 4K71C 4MCYB 4R97B 4O2EA 3P0YL 1FDLH 4M62H 4JZOB 1T1WA 5JHLH 3AXLA 4EIZC 1SMAA 4ODBD 1FG2A 3LY6A 4XX1E 3EYFB 4NHUB 4X98A 2OQJB 1EEUA 1S7TB 1HI6A 3O45B 3TIDA 4BSVB 3PP3K 4N0UB 4D0CB 3GMOB 4FZEL 5EO0B 2RBLA 5FYLH 3IDMA 4MNGE 2X1OA 1PLGH 1QQDB 2AI0H 4U6XA 3MV9B 3CPLB 2HTKD 1G7JB 3CDCA 4S1QH 3T08A 2EEBA 2DICA 3WHE0 4MA8L 4UV4H 4Q97A 3DV4A 5AZ2H 4H1LH 4P5MA 1R6VA 5C07D 2ADJA 4MMXC 5KVGH 4DEPC 2VZTA 3KS0J 5GHWL 5FYLE 4F7MA 3GJEA 4QOKB 3VXSA 1SJXA 2PW1B 5IHBA 4C56B 4JO4L 1FYTE 4ESKA 5I1DB 2YPLA 2Q6WB 1NSNL 4KVNH 3FOMA 4X80L 1F3JB 2YMXH 3G5YA 2FO4B 3ZKSD 4D9RD 5EPMA 4KH2A 1TJIL 2DQIL 1DR9A 1ZT7A 3MV01 4LEOA 4OGXH 3W2DH 2BVPB 3FHQA 4LPXA 4JPWH 4XCEB 2YD8A 4Y5YC 1WTLA 2Q8BL 4Z76A 3I6LE 5FAAA 3ARXA 4LAQL 1MFBL 4JFFE 3MBXH 3B5HA 1FIGH 4QHKI 4WDIA 1LO5B 2ICCA 5ITBH 1HYSC 3V8OA 1Z5LB 4LRIC 3RUGF 3GBML 4TUOA 1AH1A 1HYRC 1BX2A 1NMBH 3O4LE 3AY4A 5BZDB 4G7YL 1RZKL 3ZHKA 2VAJA 3C5ZB 3I6GA 2JB6A 4L9LB 3Q48A 1LO3L 1INQB 3VFNA 1MIEH 3L3DB 4EDWL 3BZDA 1UM6L 4M8QA 1QPPA 1DANT 3MLYH 4E0RA 4NQEB 1MRFL 2DLFH 3HI1B 1KN2H 2AXJA 2X7LB 5BMFL 3EJJX 3P4LA 3PWJA 2OSLA 4ZO7A 1HCFX 4ZS7H 4P5TB 1A7NH 3G6DH 1CXLA 1DQJB 4LLVB 1YPZF 3QEGL 3T0WA 4Z7UB 3SGEI 5CD3B 1I3UA 2PYEE 3GI9L 4IOFD 3LDBB 1TZHB 1XAUA 1IGYB 2AJ3A 3WDIA 1NC4B 3JWDC 1KSRA 1S7RA 4YO0B 5CKGA 2R1WB 4RISH 3LB6D 3SDDA 4UTAH 3OL2A 2WWMD 5E95B 1T5XB 3EOAA 1I3RA 4ZD3H 2A38A 1D9KB 1H0DB 4X6DB 2X4PA 1UYWL 3GMRB 3MV9D 2YBRB 3OKLB 4PD4K 3DGGB 5BZWA 5KTEL 2NZIA 2ZCHL 2DB8A 1JHKH 4OLWH 1T2JA 3LIZL 4DZ8A 2R4RH 5K9OB 3UXFA 1Z3GH 5DT1L 4KKLD 5I2IB 3BZEA 2PTTA 4LLMA 5AWNH 4GKOA 2FRGP 2BRQA 3DYPA 4KU1A 4PTTB 4QOKD 5IB5A 3T0VA 4HS8H 3KPSB 4C56D 2A83A 3GBNH 1LK2A 3VFSA 4HIHA 3BP6B 5IHUL 4HK0B 1T03H 4TSCL 4XC1L 3VRLE 1OT2A 4FFYL 5K9KB 1CLOL 1M05B 1MJUH 1OSPL 1DLHB 3BKJL 3W39B 2EDYA 4M6NL 3QDMB 1CU4H 1RIVH 1H3GA 4YHOH 5F1OB 2X2YA 4RDQF 3UTTB 4LARL 5DQDL 5SWSE 1QKZH 3QPQC 3UJIH 3MRDA 4FQXC 5ENWA 1JN6A 4JB9L 3U6RB 2V9RA 2N7AA 4LDOB 4JRYA 4YWGH 1C08A 5DMKB 5DJCA 3V52L 1FVDB 1S5HB 4YE4L 1X44A 1D6VL 5GGVY 3P77B 1RIUH 3TN0B 3D3VE 3VA6A 4PJ9A 5FUZH 2AP2A 3QJFB 2YPVH 3MRIB 4J3VA 3RTQA 3MXWL 1GGCH 2D0HA 2W60B 3QUML 5FO7A 1RURH 1DFBH 3C5ZD 3IXTB 1E6OL 4NN6C 3ZYOA 4MAYB 2XFXA 1Y6KR 3KR3H 4PRAB 4HIJA 1Q94B 2HLFD 1MFEL 2DLEA 1N3NB 2JCCE 2ZCLH 3FB5B 2LV4A 3WNNA 3HZVB 1CFQB 4HBCH 3GHBH 4JQVA 4NQED 1LWRA 1XIWC 3RL1B 3V7MA 3ZYJA 4N0CC 5CBAB 4XVSL 4D2NA 2Y4SA 4UDUB 4IDJL 3ZDZF 5HGGS 2FJHB 1F13A 2ZUUA 4HH8A 4PJFA 5EFIA 4ZFFB 1U41A 5KW9L 4PRIB 4FTVE 5T1KA 4P5TD 5EU5A 4WI2A 2Y23A 4NJ9L 2DQTH 2PXYC 1I7ZA 3OB8A 4J2XA 3V6BR 2QQNH 1B6UA 3MLZH 3MRGA 1NC4D 3UC0H 4CAGA 5DK3A 4JCMA 1S9XB 2R8SH 4UAOB 1D9KD 1EO5A 3Q5OA 5I18H 3QA3B 4XVJH 4XXCA 5IW6B 1DUZA 4I18B 4HG4J 4KMLB 4KKCD 1A2YA 4HZLA 1TVBB 4IRJB 4JFYB 5T33H 3OX8B 3R8QA 3RVVC 3I75A 4YHYB 5A43C 2XN9A 1K3IA 1OARH 2W65B 1MCPL 4DUWA 3OJVC 1IC4L 4X6FA 5EU7E 3E2HC 3DMMB 4MD4B 1GSMA 2YK1H 1DBBH 1EBPA 4J8RB 3S96A 4RCAA 1YNLL 1K8IA 5EU6E 2CKBB 4KTEH 5F9WB 5I1JH 3QZWB 3PL6C 1A6AB 2C3VB 3ZDYE 3HRPA 4I0PC 3OKEB 1I8IB 3QDMD 3MLSH 2IANE 2NZ9D 2F19L 3VGEA 5SV4A 5T1DL 3UTTD 3WE6A 1CGTA 3HUJA 1EZVY 4PLKD 4L4TA 1AGCB 3DSNA 2ADGA 2H8PA 2HFTA 5H94B 1PQZA 5EZLB 3O6KL 3KPMB 1B0RB 1Y18A 3HPLB 3BEVB 4PB0L 3RWHA 3AUVA 4P2QE 1IQDA 5ADPH 4LDEB 4YIQB 4W4NA 3BX7C 5IIEB 3UJTL 5LGHH 3HN3A 3EO1B 1QEWA 1KTLB 4JDZB 5JXED 3TN0D 3OXRA 2DMBA 1NAKL 1DVFC 1JNLH 4EXPX 4R90L 3WFEL 1NJ9A 4PGEA 1B90A 3H7BA 4LHUG 3WNKA 3QDJE 2VZSA 4Q2ZB 2ZWLT 2IQ9L 1H15B 4FA8A 4MAYD 5H35A 2HKHH 3JTSA 3BN9D 3DXAB 2HKFL 5E4EC 2BHUA 3DRQB 2BHZA 1A6WH 3WMSA 4LDLB 5T3XD 3KYMB 1G7HA 5I8OL 4CMMB 1R3LA 3DLQR 3GUTA 3GK8L 5IQ9B 2VDKH 1BEYH 4R4FH 2AERT 3ULVF 4KDTC 2CR6A 2UZIL 4KK8D 3FFDB 4MQTB 1UB5A 4J23A 4PRID 3UJJL 1OTTC 4G43A 1UFUA 2XWTB 1MAJA 3WO4C 1JRHH 5DFVD 2IBBA 4RGOH 2HLAA 4W4OA 5C0RH 2PF6A 4JHWL 1HXMB 4NNXA 3T0DA 3T0EC 4YAQB 1RZJH 2HMIC 4GMSL 2OL3A 4P5KB 3VJ6B 3H9YA 5DZOA 5FYKU 3WHXA 5DDHB 3C9NA 4OD2B 1ZLSL 4KY1H 1WAAE 4U6VL 4PJHF 1ZLUH 3F6LA 4IRJD 3KDMA 4BZ2H 4JO2H 2HN7B 3F65A 4KTDL 4L4VB 1T22A 3WIFA 4N0RA 4HULB 1KIQB 4U1GB 4YX2L 5K93A 4FXLA 3NFPA 5DQJB 3NACL 3S36X 2NY6B 2NY2B 3ARTA 3DMMD 1OAQH 3UTZA 4CNIA 3DROA 1W72B 5L9DL 5HYSB 4P9HH 4LPUA 1MCDA 5DYOA 5FF6B 4XC3L 1JCKA 3SDXA 3K1DA 2IPTH 4JQIL 4GAJH 4WFED 3AREA 5CEYA 2D0GA 1FO0H 1NCWL 4EIGB 3O41B 3MLUL 3EGSA 4M5YL 4HWNA 5IVZB 1HQRA 4OZIA 1BOGA 3D2UB 2GT9B 4NQDB 3PXHA 1O0VA 4R2GC 1T7VA 3N06B 3OPZL 3ULVC 43C9B 4L8SA 4U7SA 5HHOB 1K4DA 5C0CB 5SWZB 2VH5H 3MJ8A 4Q9BA 1KIRB 4OFKA 3KYKH 3TVMB 3WFDL 1I3GL 4Z8FH 1SJHA 3EYUL 1XGTA 3UP1A 1I1CA 1NCDH 3LMJH 3ABZA 1EEZA 4F7TA 2NXYB 1EPFA 2ICWJ 3MRBB 1VFBB 1QFOA 3R1GH 1J1OL 3VI3E 2XNAA 3S36L 1V3MA 4XNYL 3WJJC 1ZVYA 5C6WH 5D1XA 3RAJH 1QSEA 3D39E 3TF7C 5F3HA 1WZKA 1OAZH 4NN7B 4RAVB 3W5NA 2L4OA 5I1GH 4XBGB 1QRNE 4LKXB 4PV9A 1MPAH 3BE1L 5JHDE 1J8HA 4Y5XC 2J4WH 5I76B 1GZPA 4BFEA 1F02I 1F4WL 1QACA 4OCSH 4XNMB 1CI5A 5C6PB 4MB5A 5IJKC 5T5NF 5LGKA 3SCMA 3T4YA 2NX5E 5CJQH 3DXAD 1JK8A 1KCVL 3A6CH 1C5BL 4NM4H 3DVNA 1X7QB 1I85A 4H5SA 4ZDHB 4X4YA 3ZO0A 1NGYA 3T2PA 3MRHA 5IGXL 3PUCA 5F1NA 2ZKHL 5E8EB 3L9RB 1A4KA 3FQXA 3GM8A 2UUDH 1AGDB 4N9GA 3WUWG 4KXZH 4NWUH 4HKBB 2DQEL 3EDEA 3NN8B 4DKEH 3MRNA 2O26U 1U8IB 3A6BL 3LHPH 2J8OA 2ARJB 1U3JA 4LPTA 5HXMA 5IP4A 4MJ2A 2J5LB 2D03H 4M02A 4X99B 5E5UB 2QADC 5E03A 1NDMB 3QNZB 4YC2B 5GSRB 5HI3C 1F4XL 2NXZC 2F15A 2ADFH 1Q9KB 2WIIB 4M62L 4V1DB 3PABB 5L0QB 3RL2B 3EFDL 5DF0A 3HCVA 1TNMA 5DJ6B 4OZ4B 3QWRD 1J0YA 3QRFM 1IGJA 5C8JA 1VEOA 4L4VD 1MLCB 4G6KH 1MRCL 1CLYH 1J7VR 3MFFA 2FX8L 4U6HA 5FYLL 1VGEH 4ZQKB 1EEYB 2NY6D 2NY2D 3FONB 4I5BA 3VW3H 1HHGB 3QDME 2W1NA 5C3TA 1NMCB 3MQIA 3P9WB 4S1QL 1RJLB 4UV4L 1M71A 4OCYH 4JFXB 3VXQB 3VFWA 2BXZA 1BQHB 4I4WA 3SY0A 4A6YB 3D2UD 4NQDD 3EDDA 3BESR 1A6UL 3GKWH 4Z0XA 1EBAA 4QXUL 5I16A 3QFDB 4KJWD 5HHOD 5C0CD 1BVKB 2VISB 5SWZD 1LE5B 5IFHH 1KULA 3HC0A 3HAEH 3TVMD 1R0AL 2A6KA 2RR3A 2YMXL 2NXYD 4AZ8A 3THMH 1QSFB 4MB3A 2JK5A 4M00A 1E28B 5IFJB 1G6RB 4U1HB 1NKRA 2CO6B 5GRUH 2DQHL 4GG6F 3VE0B 2WBWB 5ACMA 1DSFL 4CN4A 5ABDE 4OGXL 4BUGA 3EDFA 3W2DL 3OSKA 2OR9H 1KT2B 4S2SA 1BZ9A 2F9BT 3KNBB 5GRWA 3DVFA 5I74B 3RNQA 2Y6SC 3GSWA 4FN0A 1MFNA 3MNVB 3U9UB 2PKDA 4XP5H 1U8LB 3MBXL 4K23H 3AM8A 2IGFL 3O3AA 4LVHC 4KK9C 2Q87A 2IAMA 3Q1SH 3BQUC 4GMTL 4PJAE 1JYVA 1V3LA 3MRLA 3ARDA 3BPCB 4L5FH 4U0RC 5FCSH 1B0GB 1YEDA 1QSZA 2QR0A 4M3JA 4E5XA 2ZOLA 2MKWA 5EWIL 1WIUA 3WNOA 4HUUA 2WUCH 4NBXB 5SX5K 2VDLL 4PV8B 1L9NA 2BZDA 2DLFL 1ZGLA 3OKOA 4P4KA 5EN2A 3IGAA 2VLJE 1DQLL 1EJOL 4V1DD 4BYHA 2CUMA 2B1HH 4QTHA 3DHMA 1E27B 4ZS7L 3ARVA 3JWOL 1OWRM 1CN4A 2D2OA 2ATPA 4H25B 4Z7WE 2ESVA 1FVCA 1Z9MA 1JUFA 1OSZB 2BMKB 1XGQA 4I2XE 1HWGB 4TUKH 4BQCA 1SYVA 2KZWA 3BP5A 1T7YA 3O2DA 4MDJB 4MCZB 5IB2B 3C8DA 5SV3A 5DJ8A 4EQ2A 1KLUB 3T09A 2DD8L 1IGML 4C4KO 1IC7H 1ZWIB 5JUEH 2ZZUT 1EV2E 1UC6A 2F54B 1L4IA 2WANA 4OLWL 1WITA 2X6MA 4LIQH 2O61A 5EZIL 2R4RL 5JQ6H 3BIBX 3KPTA 4OLUH 2Z35B 3N0PB 2PO6C 2GY7B 1NANI 3FOLA 5DEGB 4GW5B 4FXKA 3IJSA 4TPRL 4HW6A 5B39G 2Y07H 4Y1AA 1TLKA 4LLQB 3VA2C 4UIKH 5JMOC 3FRPA 4NN5B 1TQBC 1X5GA 4UQ3B 5JNYB 2OTUB 3TYFB 3JVGA 4LIQE 4PLJD 1QSFD 4HJGB 1RIVL 2NYYD 2YOCA 3CXHJ 3IDXH 2EDEA 4QY8A 5I15H 1QKZL 2CPCA 1YUHB 5KANI 1NDGB 2J6EH 2DF3A 3BD5A 3I9GH 4JN2B 5J11B 1UVQA 4DFHA 1WZ1H 3DV6B 3O2VL 4JFEA 4D0BB 3LQAH 4JY6A 4YWGL 3WXWH 2WP3T 5KSAA 4EUPH 1MWAL 1U8KA 1X4XA 5JLZB 2GJ6B 3S3SA 4PREB 1B4JL 2BNQB 1EFXB 3RDTC 1I8KA 4IRSB 3G5VB 5FM8A 3OKKB 2FH6A 1JNJA 4K8RL 1R3HA 1X5JA 3TO2A 1RJYA 1YY8B 3ARUA 1GGCL 4LFHD 1LEKB 1VFMA 1GJIA 1QNZL 1RURL 3J8F7 2YD5A 5IBLC 1DFBL 5HVFB 1A1NA 1QLRA 4OSUL 1FZOA 4ZOBA 1SEQH 5GGTA 4LPYA 3U4EA 3HE7C 2P8PA 2QKIB 1GCFA 1OLZA 3H9HB 2P5WB 1KCSH 1MJJA 4HBCL 3L7EB 5DZNA 5FDYA 3WJLC 4XMPH 4LVNC 4AH2A 2HT3D 1DDHA 4P46A 4K3GA 1VGKA 3VGHA 4JFZL 2ITDB 2KDGA 3QRGH 3BDYL 4NJAL 5DSCB 5MENE 4ZTOH 2DQTL 3O4OC 1TENA 1P2CA 5BS0B 2QQNL 4QF1A 1MCWM 1ZLVH 1NFDB 3SE8H 1HCVA 4KZDH 1PJ9A 2ZUSA 3UC0L 5JW4R 2Y1VA 1WFNA 2P5EA 1MIMH 4QHUA 1MAKA 3OBAA 3VXUA 1JWUB 1OB1A 5D7LE 4XVJL 3D0VA 2F54D 2X89D 3HMXH 3N1QC 4R96A 5BVJA 2MMXA 3MLTB 3STLA 1FZJA 5I66A 4TNVK 2AEPH 3LCYA 4KV5E 3SKOA 1WQVT 1HHKA 4U6YB 2FHCA 2XZQL 4LL9A 4NUGH 3SDCB 2DKUA 4F2MB 1IGIH 1DBBL 4R4BB 2ED9A 5IVXB 5ICYB 4KTEL 3EYOA 4QRRA 5I1JL 1OPGH 3FB7B 3EDJA 1TITA 2BOCA 4RFEA 3ZKQD 3OKNB 3P73A 4G8EB 3SPVB 3DX6B 4Y5VC 2VYRE 4OZHE 4TULL 2EDQA 1ND0A 5D96B 3V6ZA 5HYJE 3FO0H 4RSVA 1BQLH 3MJGX 1H5BC 3P4OB 4D3CL 2VWEC 3QPXH 4HIXH 2R56H 4ZUTA 2AXFB 5J9PB 3WFHB 3BYYA 1A1MB 1BBDH 3MBEC 4XT1C 5ADPL 3O11B 4I3RH 5FYJU 2YN3A 3UDWA 1RI8A 4S1RL 1DEEB 4X6CA 1S78D 5TQ0H 2GJ6D 4XBPB 3TJEL 4E41B 3QUYC 2BNQD 1P4IL 1EFXD 4IRSD 1F11B 2GK0B 5DJDB 4JG0L 2VABB 5IHZB 3K4AA 2P8MB 2CRMA 1ZGLM 1UM5H 4QNPF 5DD3L 3QJHA 2CIIA 2G9HB 3DX7B 3ZTJH 2HKHL 3TH4T 3P40A 3QEQA 1JNHB 3MGAA 3QG6A 2BSTB 1ZVHA 1FFNA 3BSZH 1A6WL 4NNPH 2V7HB 2P5WD 4GXVH 3OR6B 5JPMA 4JGUA 5CP3H 4KKNA 3OKDA 3G5ZA 4R4FL 1UG9A 1AGEA 2XQYK 1IEAA 2EIZA 2Z8VC 5EO1B 1YEIH 2CUIA 5D2LA 3L6FA 4RGOL 3FKUS 3MRJA 2XWJA 5J06A 3VFVB 4X7FC 1RZJL 4XPGH 3M07A 1RUPH 3DECA 1W0WB 3JV5A 4DJMA 2H6PA 1ZHNA 4YH6A 4OZGE 4KJQD 3FRUB 2J8UE 2R23A 1NKOA 1F6AA 4F7PB 4NT6B 4IRZL 4WW1B 5H37G 3D87B 4PR5A 4APQA 4XAKE 4BZ2L 4JO2L 5ACZA 2D7OA 1UWXK 1NFIB 1I9JH 3BZ4B 1WGOA 2G60H 3GMQA 4GKSB 4IHOA 3SDCD 4ELME 2R1YA 3RWGB 3RHWF 3EUUA 2EDNA 2K1MA 4OLZH 2FHBA 2XKNB 4BSWA 1UB6A 1UACL 4OLXH 4PJEB 1UKSA 5DK0B 2DIBA 5LXGL 4GAJL 4GRLC 1J5OL 1KBGL 4HPOH 5BQ7B 4HIIA 3LQZA 5BV7B 2DYPA 2A73A 4PJDE 3KLSA 5DTFA 1FZMB 3V9FA 1D5XA 1IQWH 2ZUWA 4PJCE 1II4E 4ZNEA 3RZCC 1KB9K 3KYNA 3L5WA 3S8WA 2QSCL 5C0EA 4WEMB 4QWWC 3IDGA 4RMQA 5KZCB 3ESVF 4X4XB 4MD5A 4KROB 3KYKL 3BPLB 3IKKA 1TVHA 1MHEB 1T1YA 5D7IA 5FM4A 2VXTL 1RIHL 1NCDL 3CLFH 3LMJL 3QDHA 4JDVA 3CVHB 3L3HA 4QRQA 5CP7B 3X13A 4DWHA 3R1GL 1XF3B 3PXJA 4H88L 4WNQA 3BP7B 4RMWA 5A1AA 3RAJL 1A1OA 1OM3L 3OAZK 3GGWA 4HC1H 5GGUA 3QR2A 4E41D 2X70A 2NY3C 4WUUA 5I1GL 4KZEH 3GKZA 2FLRT 3VWKC 3VH8B 4C59B 1LMKA 4GBXB 4OCSL 5LCVH 3WFZA 5KSBF 1H3XA 4W81A 1WFUA 4EVNA 3IYLW 3MCLH 2NR6C 5T1MA 1AGBA 3ULUH 2Y7QA 5CJQL 4KRMB 4CVZB 1G9MH 4MJ4A 3L7FB 4MNHB 3S4SB 3KPOA 1YECH 3TEUA 4FQLH 2WINB 3QIWA 2FEEL 4PJXB 5ID0B 3DURA 1MCNA 3FT4B 3BXNB 4G9FB 4K3EH 4F9PC 1M7IA 3FTGA 3FT3A 2AXGB 2V2XA 3IU3B 1A02N 3SQOH 3UO1H 5DD6A 2QHRH 2FIRT 4NWUL 5D7JC 3U7YH 2EIBA 3Q3GA 4JFPB 3JBG7 4JPKL 3DTXB 2HWZH 5ID1A 3BRFA 5TH2A 1MUJB 4OLVH 3W11C 1BM3H 3ULUE 2YPKA 4DCQB 1A6ZB 5F88B 1UA6H 1NGZB 1K4CB 2I5YH 1HQ4B 1LP9A 3O2DL 2GTZB 4UIMB 4LLUB 1EAJA 5LBSH 3E1F1 5EOTA 5E1AB 2WMPA 3UEZA 4Z7VA 5D5MA 5CEZD 4GLRH 3SJVD 3BAEH 4YDJB 3X3GH 2W07A 4O51A 5EUOB 2VLRA 5CEXA 1NBYB 3NCEB 1H8SA 4I77L 3I3DA 1VGEL 2M1KA 5TGBB 4M43H 3LEXA 3VW3L 4JO1L 1AO7B 4FQ1H 3ET9F 4OFVA 1DQML 4Y4HA 5J13B 5DJZA 1NMAH 2YA0A 1N5AA 1AR1D 3ZKND 2D31B 4R7NA 4P2OA 1T2QH 3GB7B 4I9WD 1KYOK 1AHWB 1I1AC 1CICC 5J1AA 1FNEA 5D93B 4HWZB 2RHEA 3GKWL 4WWKB 5IB1B 3T4AB 1I1YA 2X4OB 5E6ZA 5I9QB 2E27H 5IFHL 5KZCD 3PGFH 4KROD 2BJMH 3QEHB 1HI6B 3MLWH 1JZ7A 4G6MH 3BDXA 1CDUA 5FM5M 1VADA 3OXSB 4FHBD 4HK3J 2F8VA 1J86A 2LE9A 4PJ5E 5GRUL 3SO3B 5DJAB 3WIIH 3V7AG 4XNXL 2OR9L 2GSIA 4TTDC 4ZFGL 3CMOH 4DK3A 4P57B 3DV4B 5IKCB 4XHJC 5H8DA 5JOEA 2FATH 4GBXD 1DQTA 2HFFA 1FH5L 3PV6B 3QXVA 1VFAB 3BT2L 2R0LL 3S7GA 4L4JA 1GVIA 3GJEB 4HXBH 4G6JH 4K94L 4K71B 3L3GB 4Y7MA 3BGFB 2Z8RA 3OGCB 4G9FD 4L5FL 4EI5B 9CGTA 3GEWB 3O8XC 1MI5A 5EPMB 3KPLB 2X4QA 4NOFA 1CE6A 3PHOB 3REWA 3P9MB 3QIBA 3QQ9C 1R5VB 5C7XH 5MEQA 4NYLB 5EBWA 4FG6C 5IMMA 3UPCA 5F7EH 2UZYB 5E99L 5E94A 4LEOB 3RY6A 1JFQH 3NCCB 1EJ6A 1E4XH 4G8GA 3GSQA 1MVUA 3TZVA 1R5IA 3VMOA 2GEEA 4M6OH 1PW3A 4JHAL 4LQFH 4DQOH 4PJ7E 2AK4B 3N50A 3B4NA 1QYGH 4K7PH 3Q0HA 1JPST 1TJHH 4ELKA 4TUKL 4DEPB 3R8BB 3DUUB 3NIGE 1GC1H 2NY4C 1AO7D 2MSPA 3TO4C 4HMCA 1BFOA 3TNNA 5I0DA 3FAXA 3I6GB 4RZCB 4YK4C 3ILPA 1JHTB 2B0SH 5EIIA 5C1MB 4LCWE 3D9AH 3CFKA 2KPNA 5JIPA 1KCUH 5D2NE 5DHYB 4G8IB 3G6JA 3PWJB 4WWKD 5JORB 2FEDD 2WNGA 1LEIB 2OSLB 2Y07L 5GRVL 2DWEA 2H9GB 3HTLX 4Y5YB 1U93A 3RQ3A 4E41E 1SEBB 1FIEA 1OAUH 1ZSDA 3OGOE 3V4PH 1FJ1B 2XG5A 8FABA 4PP1C 2C1OB 1MAMH 3O4LA 2NY5H 2KQMA 1IGFL 3IDXL 1MFAH 1RZFH 2BNRA 3PDOA 4JFDD 4P2RE 1A9EA 1QHPA 4RRPA 3O6MH 2CKNA 3ZKMC 4MDIA 3PGCA 2J6EL 5IEKA 5HJ3B 2Z9TA 1CFSA 1OAKH 1ONQB 5MEPB 5DMGC 4HKJB 3HNVH 3B9AA 3U1SL 2AS5M 1NAMB 4N5ED 4HWEL 4LLMB 5DJXB 4YXKH 4FQCL 4JANA 3B5GA 4OGAD 3RPIB 3VXRE 4ZTPL 5EO9A 4LOUD 5FB8A 5BJTA 1N8ZB 1T4KA 4LMQE 5KSVA 4DTGH 5HTSA 1U3ZA 2YD7A 5CIPB 1BIHA 3UTSE 4EI5D 1WZLA 4B50A 2PYFB 4ZS6D 1D6EB 2GJZA 4HS6B 4L8BA 2RFXB 3OKMB 2FECI 5F93C 5DFWH 2R0KH 5KS9E 1YC8A 1U42A 4FQHA 1YMHA 5C09A 1JHLL 3SJVE 1FCCA 3MRDB 4HUWA 1DP0A 3NABH 5DRWA 5BXFB 3G04B 3GSOA 4RX4A 4RAUB 1WK0A 5HDOA 2DQGL 2YD3A 4CBPA 1IJ9A 1B6DA 1KIPA 3MGOA 5HGAA 3SGJA 1NCBL 4AL8H 5DJCB 1OAXL 3DI2B 4LCYA 1M1SA 4YGVA 1TIUA 3VXME 4ZTOL 5GS1A 1N6QH 2AK4D 1NGPL 3EDKA 5FA4A 5A16B 1EMTL 4ONFL 3BWAB 4L3EB 3SE8L 1GXEA 4KZDL 4PJ9B 3RUGB 4DGIH 3TA3C 4QRSA 4RGMC 1FL3B 1UEYA 3FB8A 3ZDYF 5HGDA 3RTQB 2BVOA 1FL5A 2V7NB 1V5JA 4TVPD 4DGYL 2GITA 4LGSB 3AFLA 1I9RH 2ENSA 3HNTH 4MA7H 3HMXL 2QLVB 1AKJA 2XFXB 4D8PA 3HFML 4ETQB 2W92A 4AIOA 1EHLH 5E6IC 1NC2B 2H45A 5JW4N 2AEPL 4K8RC 2CRIA 5FKAA 5BVPH 4X7SL 1QOKA 2D9QB 3U4AA 1KJ2H 4KI5E 3MOBH 1UXSB 4NUGL 2H3NA 1CBVH 1DBAL 1IGIL 5F6IC 3ARGA 2NY7H 1J88A 2DM4A 5EC2B 4PJ8A 2X9XA 4LBEA 2F53D 3VCLB 4DGVH 2UWEE 1L6XA 3CSPA 4DN3L 3VRJA 1JIBA 3EJYC 2FJGB 3D3VA 6FABH 1ETZA 1EUTA 1EDQA 4QGYA 5I1KL 4TRPH 1MY7A 3FN9A 4Y16A 3MJ9H 3MCG1 3WKML 5B8CC 1HYSD 3MLPA 5DUPH 4U7MA 4GQ9H 1GOFA 2E6PA 4ZUUA 3NIDE 3QPXL 2A9MH 3GIZH 2R56L 5J6HA 1HH9A 3IAGC 2JCCA 4BSJA 1MOEA 2VLLB 3SE3A 1C1EH