5GHYA

Crystal structure of beta-lactamase penp mutant-e166h in complex with cephaloridine as "post-acylation" intermediate
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
256
structure length
256
Chain Sequence
DDFAKLEEQFDAKLGIFALDTGTNRTVAYRPDERFAFASTIKALTVGVLLQQKSIEDLNQRITYTRDDLVNYNPITEKHVDTGMTLKELADASLRYSDNAAQNLILKQIGGPESLKKELRKIGDEVTNPERFHPELNEVNPGETQDTSTARALVTSLRAFALEDKLPSEKRELLIDWMKRNTTGDALIRAGVPDGWEVADKTGAASYGTRNDIAIIWPPKGDPVVLAVLSSRDKKDAKYDDKLIAEATKVVMKALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Crystallographic Snapshots of Class A beta-Lactamase Catalysis Reveal Structural Changes That Facilitate beta-Lactam Hydrolysis
pubmed doi rcsb
source organism Bacillus licheniformis
molecule tags Hydrolase
total genus 91
structure length 256
sequence length 256
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2016-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5ghyA00
2V1ZA 3PAGA 4BQMA 4KZ9A 4C6YA 2Q9NA 1IKGA 3BYDA 4JLFA 4Q8IA 3WWXA 1WE4A 2ZJ9A 3MFDA 3SS5A 1W7FA 4KZ5A 5CGXA 3VP3A 5EVID 1XP4A 5A93A 1IELA 2UWXA 4QY6A 2WAFA 3A3DA 3AGEA 2PU4A 4RA7A 4R3JA 4LV0A 2WGWA 3HLEA 4C75A 2WZXA 4X55A 1XXMA 1FCMA 3SS4A 4FH2A 3G30A 1L0EA 1YMSA 1KDWA 5A92A 3IHBA 4JF5A 4K91A 4YINA 1BZAA 3UDFA 5DF9A 3VP0A 3VMAA 4OOMA 3EQUA 4FSFA 1DJCA 4DE3A 1FSYA 4JXGA 4KG2A 1S6RA 4R23A 5CGSA 5DTKA 4KQQA 4KZ8A 2ZQDA 2WKEA 1MBLA 2ZC3B 3BFFA 1QMFA 4UA9A 1K4FA 5CHMA 4DKIA 3BLMA 5HL1A 1O7EA 2E8IA 3W8KA 4MNRA 5J8XA 1H5XA 1I2SA 4Y0UA 1LLBA 4QB8A 1EI5A 1RGYA 3N4IA 5EUAA 3HBRA 3A3EA 4DXBA 3RXWA 4LV3A 5CGWA 1K6RA 1ALQA 1Z6FA 2ZMAA 5F83A 4IVKA 3NDGA 3G31A 1MWSA 3IF6B 4KZAA 1YLJA 5EPHA 5EOEA 4GDNA 4Z9QA 2VGKA 3MXRA 3LO7A 4N9LA 5F82A 1XPBA 3ZG7B 1TDLA 3CJMA 2WGVA 3BLSA 1MXOA 3Q7VB 3A3IA 3ZGAB 2ZLYA 3ZNTA 1QMEA 2HPBA 4KENB 2EFXA 3C4PA 5FQJA 3AGFA 3Q07A 4IBXA 4N9KA 4S2KA 4QHCA 1S0WA 2EX6A 3HUNA 3SH7A 2H0TA 2ZC5B 3G34A 5GLAA 3VOZA 1BULA 3G2YA 4P85A 2FFYA 2BLSA 5AQ7A 4JKTA 4XUXA 1ESUA 4ZJ2A 4C3QA 4GD8A 1NYMA 1PYYA 3OCNA 3JYIA 5HX9A 3BFCA 4OP8A 4GDBA 4DE1A 1E4DA 3VFHA 4FCFA 4JBFA 3IF6A 2J8YA 1TEMA 4N1XA 4S2IA 4GB7A 3M6HA 5FATA 4S2JA 3P98A 2X01A 3V39A 3IXDA 4PM9A 2WKHA 1IEMA 2HP6A 5FI7A 3ITAA 1W8QA 3SS3A 1YLYA 3RJUA 3Q7VA 3NCKA 3NDEA 2XF3A 3GRJA 3WS2A 2XQZA 3PBOA 3PBTA 3CMZA 1ERMA 3GTCA 4RX3A 1IYOA 4QY5A 2XR0A 3NC8A 3SH9A 4GN2A 5CEDA 4WEKA 4BJPA 1M40A 5FI6A 2OV5A 1ESIA 4GKUA 1KDSA 4QU3A 3UDXA 4KZ6A 1K6SA 1PWGA 4JXSA 5IHVA 4ZJ3A 1SDNA 1YLWA 2R9XA 2WGWB 2Y2JA 2WUQA 1GA9A 2XD1A 1I5QA 1MWUA 1H8YA 1CEGA 3IF6C 3ZG5A 1L2SA 3HLFA 5FQMA 1HTZA 5GLCA 3OPLA 4S2NA 1K38A 5DF8A 5DTTA 1LI9A 5AQ9A 2HDQA 1EWZA 4MBHA 4WEJA 1DJBA 1PWCA 2Y55A 1E3UD 1CK3A 3MXSA 3NIAA 2ZQAA 4JXVA 1DJAA 2Y2MA 3HUOA 3ZFZA 4PM7A 2Y59A 4A5RA 4OQHA 3ZVWA 1ZKJA 3BFDA 2EXAA 5EVIA 4EBNA 4EV4A 1PZPA 1FCNA 2JCHA 3D4FA 5HAQA 1PW1A 3DWKA 3IQAA 4DDSA 2XLNA 5E2FA 4JXWA 4UA7A 2WADA 1BLHA 4XUZA 2VGJA 1K4EA 3QHYA 3TSGA 5DVAA 4K0WA 5F1FA 4OH0A 1W8YA 1BLPA 1GA0A 2HP5A 3IXGA 5FAOA 2Y4AA 1GHPA 3HREA 5CEBA 1H8ZA 2IWCA 4K0XA 3VOYA 4CPKA 3IXBA 1K57C 4B88A 5I94A 1KE4A 3FKWA 3UPOA 2V2FF 1GHIA 1NYYA 3C5AA 4NK3A 5EOOA 4EWFA 1PI4A 2RL3A 5DF7A 4DE0A 2ZQCA 3G35A 1ES5A 4S2NC 2Z2MB 2XGNA 5CRFA 3W4OA 3ZG9B 4HESA 3MKFA 3UO9A 5U47A 2DRWA 1XA1A 3GSGA 4S2MA 3MZDA 5EE8A 3WRZA 1YLPA 5HW3A 3MZEA 3C7UA 4JF4A 5EVIC 4HBTA 2CC1A 5AQAA 1KE0A 5FAQA 5TGFA 1VM1A 4E3NA 2OLUA 4QD4A 1W5DA 3V3SA 3FWLA 1IYQA 1Q2QA 2H5SA 2H10A 2Y91A 2P9VA 5FASA 5TFQA 4EQIA 1OMEA 4OVDA 1PI5A 3QNCA 1LI0A 2JE5A 1KGEA 1M6KA 4BD1A 2PU2A 3P09A 1WYCA 4ZTKA 1GHMA 2ZQ9A 3OPPA 3UNWA 2XD5A 2ZM8A 1G68A 3IWQA 1BTLA 5L2FA 1I2WA 1JVJA 3OPRA 4PM8A 3CZDA 3HLWA 1LL5A 1RCJA 3V50A 2Y2PA 1IKIA 4WZ5C 1ONGA 3GQZA 4GZBA 3BFEA 4Y0OA 1XX2A 4CJNA 1L0DA 3HLGA 1N4OA 4R3BA 5FQQA 2Y2LA 2WAEA 1JWZA 3O86A 2PBYA 3V3RA 3PBQA 1U60A 3DW0A 3GV9A 1PIOA 3HLDA 2Y2GA 3VP2A 3HUMA 4RVAA 2XFTA 5CHUA 3B3XA 1ES4A 2EX9A 5KSHA 2OLVA 5HAIA 5CTMA 1N9BA 3PBNA 3HL9A 3TOIA 4E3KA 2R9WA 3UDIA 3WS0A 1FR6A 1L0FA 4KG5A 1K56D 1YMXA 4DE2A 3Q7ZA 1KE3A 3FZCA 2XK1A 4LENA 2Y2OA 3C4OA 3M6BA 1NJ4A 2GDNA 3G4PA 1MPLA 2B5RA 5EVIB 5HFOA 2I72A 4KZ3A 3NY4A 4KQOA 2QMIA 3MKEA 1PW8A 3UN7A 1KVLA 3LY3A 3VP1A 1IYSA 2HDRA 3IF5A 3PAEA 4Y7PA 4N92A 1PWDA 1TDGA 1JWPA 1K57A 1FOFA 1JTDA 1BT5A 1XKZA 3S4XA 3IH8A 4MLLA 1J9MA 2H0YA 3ZG8B 4DDYA 3ISGA 4WELA 5HARA 4OOYA 5FI2A 1HZOA 1E3UA 5E2HA 3OZHA 4WMCD 3ZCZA 1ERQA 4OLGA 3C7VA 4KZ7A 4DRTA 1NRFA 2WK0A 5CHJA 1MWRA 4LCLA 4BD0A 3ITBA 1DY6A 3PBSA 3V5MA 5JYOA 3LY4A 2BG1A 5DTSA 4N1HA 2J7VA 4H8RA 3HLCA 3WS5A 1NY0A 1YLZA 5CTNA 1ZG4A 4BL2A 4O7DA 4OLDA 3MZFA 1E25A 4Y0TA 3DTMA 5AQBA 1NZOA 3HVFA 4X56A 3UPNA 4R1GA 2P9VB 3Q81A 4GD6A 5FA7A 3I7JA 1PZOA 1RGZA 1ZG6A 1K54A 4S2PA 1YM1A 4E3LA 4ID4A 3W4PA 3BM6A 4X53A 3VP4A 4WYYA 4KQRA 4U3TA 2XFSA 5CECA 2DNSA 3MBZA 4ZBEA 3UE0A 1O07A 2A49A 2ZM0A 3O87A 4OONA 1K55A 5FDHA 3OC2A 4LCMA 4KZ4A 4OPQA 3VFFA 4BLMA 3DWZA 4P6BA 3O3VA 3G32A 3NBLA 4WZ5A 4OPRA 2QPNA 3LCEA 3BEBA 4S2OA 2Y2IA 3A3FA 4B4XA 4E3JA 5EECA 4MBFA 1JWVA 1LL9A 5M18A 1SKFA 2DCFA 2XH9A 4LV2A 4OQGA 5FAPA 4R4SA 4BL3A 5JYPA 4PMAA 4R0QA 4QJGA 1Q2PA 3Q82A 2EFUA 1SDEA 1CEFA 4L0LA 5FSRA 2ZC7A 3FKVA 4FD8A 4OOLA 5GHZA 3S1YA 3W4QA 2EX8A 4JF6A 3NI9A 1GCEA 5M19A 3G2ZA 5D3OA 2G2WA 2ZC6B 2J9OA 1LHYA 2HDSA 4RYEA 5KZHA 3O88A 4HBUA 1K54C 2XDMA 3PTEA 2XEPA 3UPPA 4ZDXA 4JPMA 3SH8A 2C6WB 4ZAMA 5GHYA 2Z2LB 1XGJA 4P87A 3IWIA 3RXXA 5BOHA 2FFFB 3PBRA 5GHXA 1XA7A 5FQKA 1AXBA 1ES3A 1XGIA 1Y54A 3BECA 1C3BA 1JTGA 1MKIA 5E2EA 5GLDA 4D2OA 1K55C 2WZZA 3N8RA 5FQIA 1HD8A 4YFMA 4E3MA 2ZC4B 2HDUA 2WYXA 2Y2NA 1YQSA 3IWOA 3OPHA 3SOIA 3M2JA 1CI8A 1MWTA 1KGGA 4UAAA 1NXYA 3LEZA 4UA6A 1CI9A 2Y2QA 2Y2KA 5KSCA 1BUEA 3FYZA 1YLTA 4OPYA 4PM6A 1FSWA 5EVLA 3AGDA 4FH4A 4GNUA 1IYPA 5CERA 3ZHHA 1FCOA 1K56A 3E2LA 2JBFA 1RP5A 2A3UA 1ZC2A 2JC7A 4WZ4A 1BLSA 3WS4A 2ZQ7A 4EBLA 1YT4A 3HLBA 5M1AA 3GVBA 2J9PA 1G6AA 3IH9A 5F1GA 4UHUA 4IEDA 4WM9A 3WRTA 1KGFA 1ONHA 3ZDJA 2X71A 3TG9A 3N8LA 1BLCA 3GR2A 4M3KA 4LV1A 4OQ0A 5E2GA 3Q1FA 4E3OA 4WBGA 1BSGA 4GOGA 1K25A 2G2UA 3CG5A 2WKIA 5GLBA 5TR7A 4F94A 2RCXA 3M2KA 1KVMA 2EX2A 3IT9A 1WYBA 1SHVA 3EQVA 1L0GA 3WS1A 3S22A 1ES2A 3FV7A 2P74A 2ZD8A 5E43A 5A91A 3BRMA 3E2KA 4EBPA 3VSLA 4E6XA 2IWDA 4WMCA 4OPZA 5CXWA 2HP9A 3IHAA 4U0XA 4XXRA 4IVIA 1FR1A 2IWBA 1MY8A 1TVFA 2EXBA 5G18A 4U0TA 2ZM2A 3UE1A 4PPRA 4E3IA 1NZUA 4R4RA 2Y2HA 4MBKA 4EUZA 3OCLA 4X68A 4X69A 2ZQ8A 4HEFA 4OQIA 4KG6A 4KZBA 3ZVTA 4B4ZA 3QNBA 4RX2A 4PM5A 2V20A 3BFGA 3GMWA 2X02A 2QZ6A 3IXHA 5GL9A 2WGIA 3A3JA 3ZG0A 5FQ9A 3UY6A 1FQGA 3N7WA 3N8SA 4IBRA 4NETA 3ZNYA 5A90A 1EROA 3VSKA 4BENA 2Q9MA 4E6WA 4DXCA 2C5WB 4MEZA 4OKPA 5HAPA 4X6TA 4ZJ1A 1HVBA 4OP5A 1VQQA 1SCWA 3N6IA 4DF6A 1W79A 2OSUA 4P0MA 5KMWA 4S2LA 3UE3A
chains in the Genus database with same CATH superfamily
3PAGA 4BQMA 2I9VA 2Q9NA 1IKGA 4Y3IA 1WE4A 4CQHA 3SS5A 3V67A 1XP4A 1IELA 3T4LA 2UWXA 4IUKA 4QY6A 4QPRA 2PU4A 3L7HA 2WGWA 3HLEA 5DFXA 1P0ZA 4HJ3A 1L0EA 1KDWA 4LRZE 3TW8A 3MMHA 1BZAA 4OOMA 4FSFA 4DE3A 4KG2A 5CGSA 3KYEA 4KZ8A 2OOLA 1MBLA 3GECA 3BFFA 1K4FA 4XT2B 3BLMA 1VEUA 4DJ2A 3KYQA 1RGYA 3A3EA 2Q0OA 3F1OA 1K6RA 5F83A 3B47A 5HWTA 2HJ9C 1MWSA 4Z9QA 2NUTC 4N9LA 1XPBA 3K3DA 3Q7VB 5LBRA 4KENB 5FQJA 2HGVA 1S0WA 2EX6A 4P85A 3KSHA 2BLSA 4C3QA 1PYYA 3CAXA 1NRJA 3JYIA 3R7WA 4DE1A 4I3IA 5HWVA 4JBFA 4N1XA 2W1TB 3M6HA 5FATA 2WKHA 2HP6A 4E04A 1YLYA 3NDEA 3H7WA 4HI4A 1W63Q 3PBTA 2GZAA 5IS1A 1ERMA 4QY5A 1ZTUA 1KDSA 4QU3A 1PWGA 4Y5FA 5IHVA 1YLWA 2V1AA 4UQIS 2WUQA 2R78A 5GLCA 1OJ5A 1K38A 2HDQA 4WEJA 1CK3A 3D9YA 2FZ0A 4JXVA 3E4PA 3ZFZA 5AVFA 3ZVWA 4EBNA 3BFDA 1PZPA 1FCNA 5HAQA 3IQAA 4YOFA 1G5UA 5E2FA 3RTYA 3QHYA 3IXGA 2OWHA 2Z6CA 3UPOA 3IX3A 1S4SA 1SKOB 2V2FF 5L07A 4NK3A 1DP9A 4HQAA 2ZQCA 3G35A 3MF0A 2XGNA 5CRFA 3S7QA 2PD8A 3ZG9B 3MKFA 5EE8A 5HW3A 2YKHA 5FAQA 2QJ7A 1W5DA 1ODVA 2P9VA 5TFQA 1PI5A 5J7EA 2ZMFA 2P7JA 2ZM8A 3VE3A 1BTLA 1IFQA 4CLCD 3KSFA 4WZ5C 3GQZA 4CJNA 4GZBA 2D01A 3DTIA 2PBYA 5L8MA 2KX6A 2EX9A 2OLVA 3S7PA 1VETA 2JKRM 3WS0A 1L0FA 3Q7ZA 3QP4A 3C30A 2XK1A 4LENA 2GDNA 1MPLA 3FG8A 4KQOA 3UN7A 3VP1A 4YWZA 5IT5A 1IYSA 3IF5A 4GLQA 5DJTA 1JWPA 1BT5A 3S4XA 1J9MA 3ISGA 5HD5A 2L1MA 1HZOA 3OZHA 3A0RA 3QP1A 4NEED 5CHJA 4LRXC 3G6OA 4BD0A 3T12B 1DY6A 3PBSA 2OAP1 5JYOA 5DTSA 1NY0A 4BL2A 1ZG4A 5HPIA 3MZFA 4Y0TA 2GNXA 3UPNA 4GD6A 5FA7A 1K54A 2GX5A 4E3LA 4X53A 2HJEA 4KQRA 2XFSA 5DFYA 1OPXA 1XFNA 1O07A 2ZM0A 2V1BA 4CLCB 4NG2A 4PHTA 3NECA 4LCMA 4KZ4A 3O3VA 4WZ5A 2Y2IA 3A3FA 2EA9A 4WLAA 3NOPC 5M18A 1SKFA 4R4SA 5JYPA 4PMAA 4QJGA 2PAVP 4FD8A 1YSQA 1LHYA 5KZHA 4HBUA 2XDMA 3PTEA 2K7SA 2Z2LB 2GJ3A 1AXBA 2J80A 2WZZA 5FQIA 1HD8A 3IWOA 3CPTA 3LEQA 3D3OA 4Y15A 1KGGA 2Z6DA 4UA6A 2Y2QA 5KSCA 5HL6A 1FIKA 3MFXA 3UB9A 2JN7A 5EM1A 1ACFA 1IYPA 3ZHHA 4PKYA 1FCOA 2JBFA 3IS2B 4K08A 2A3UA 1ZC2A 4NXBA 2NUPC 3UB6A 4UHUA 3WRTA 4D60A 2VA0A 3ZYTA 4YNRA 3T4OA 4CLCC 4WBGA 5GLBA 2G2UA 2WKIA 3CWFA 4LLOB 1WYBA 4X25A 1L0GA 3S22A 2P74A 4E6XA 5CXWA 4E3IA 4R4RA 4F3LA 4EUZA 3O5YA 3H9WA 4X69A 1F9IA 1YAXA 4KG6A 3UE6A 3QNBA 4PM5A 2V20A 3T50A 2X02A 2V0UA 3ZG0A 3A3JA 4NETA 5KIZA 4E6WA 3H82A 4O8GA 4HH2A 4QWOA 3E4QA 1MZUA 1VEUB 5J4EA 3BYDA 2G7UA 4JLFA 4P6ZM 3WWXA 2ZJ9A 4KZ5A 3HJIA 1A0KA 1ZHHB 5A93A 2L0WA 2WAFA 4C75A 1YMSA 4YINA 5DF9A 3VMAA 3VV4A 3EQUA 4JXGA 5DKKA 4R23A 2QWSA 4H6JB 4UA9A 1XFQA 5CHMA 4DKIA 3E98A 4MNRA 5J8XA 1I2SA 1KOUA 3N4IA 5AVEA 2ZL1B 3RXWA 4I3JA 2ZMAA 1Z6FA 5HDCA 3EWKA 3NDGA 5EPHA 4KZAA 4HH3A 4GDNA 2VGKA 3MXRA 5F82A 3ZG7B 1TDLA 2M7UA 2WGVA 3A3IA 4GW9A 2EFXA 3SW1A 4JGRA 3AGFA 3LI9A 4N9KA 4QHCA 3SH7A 5GLAA 1S67L 3VOZA 1BULA 3G2YA 5AQ7A 2LB9A 3OBFA 4XUXA 1ESUA 4ZJ2A 3OCNA 3MSHA 3BFCA 4GDBA 2WKRA 3IF6A 2VV7A 4G3KA 1Z09A 1T18A 1OT6A 2W3HA 2J3WA 1IEMA 5FI7A 1W8QA 4PKYG 2XF3A 3WS2A 4EQ1A 5CX7A 3LI8A 3PBOA 3CMZA 2OWJA 4RX3A 5EVEA 3SH9A 2XR0A 3NC8A 1LT0A 5CEDA 2O9BA 4FOFA 2ZOIA 1I5QA 1H8YA 3ZG5A 4GCZA 5DTTA 1LI9A 1DJBA 2Y55A 3MXSA 1DJAA 2Y2MA 2KLIA 4EETB 5HSQA 4OQHA 4HIAA 2VX8A 1ZKJA 5EVIA 4EV4A 1PW1A 2ZMVA 4XUZA 3F1PA 1K4EA 5DVAA 5F1FA 4OH0A 1W8YA 1GA0A 2PRFA 2HP5A 3EGXC 5HPFA 3HREA 3PR6A 2IWCA 4CPKA 2HV1A 1NYYA 5EOOA 5HWWA 5DF7A 4DE0A 1ES5A 4HESA 3UO9A 1X0OA 2DRWA 1XA1A 3GSGA 3ICYA 3WRZA 2UV0E 3TJZC 4HBTA 3EOIA 5TGFA 2PYRA 1T19A 2OLUA 3V3SA 3CI6A 1IYQA 1Q2QA 2H5SA 2Y91A 4WF0A 3KSGA 1OMEA 1TS7A 3QNCA 2W1RA 1KGEA 4BD1A 4Y13A 1GHMA 2ZQ9A 3OPPA 3T1QB 1W63M 2WKPA 1GSWA 4UEYA 1I2WA 5F69A 4ETXA 3V50A 2Y2PA 1IKIA 4Y0OA 1L0DA 2VJWA 3V3RA 5G4ZA 2A24B 3HLDA 3HUMA 2XFTA 5CHUA 3B3XA 2ZBBA 5HAIA 5CTMA 3EEAA 3MR0A 1J3WA 3HL9A 2R9WA 4NXGA 1YMXA 3JPUA 1D1JA 2O0YA 5HFOA 4O0PA 4KZ3A 3NY4A 3MKEA 3LY3A 1G6OA 3BQAA 3PAEA 4DN0A 4Y7PA 4R6LA 3BY8A 4WL9A 1FOFA 3IH8A 4DDYA 5HARA 3ZCZA 3E0YA 2B18A 4DRTA 4KZ7A 3LIAA 5F68A 3V5MA 1Y4OA 3LY4A 2BG1A 2J7VA 4H8RA 3A0VA 4O7DA 2H28A 1E25A 3DTMA 1NZOA 3HVFA 4X56A 5FDSA 1PZOA 3BM6A 4HY8A 1WA9A 3MBZA 2VGLM 2A49A 2XSSA 4II7A 3LIDA 5HD3A 4MN7A 4OPQA 3VFFA 4BLMA 3D72A 3NBLA 4OPRA 4S2OA 1G28A 5EECA 1P9WA 1PRQA 1UGUA 3KX0X 3KSIA 2DCFA 3LIBA 1TS0A 1UWNX 3P01A 1Q2PA 3F1NA 5FSRA 5GHZA 4HJ4A 4JF6A 3NI9A 4EEPA 5M19A 2G2WA 3JVVA 3DTKA 4FTXA 4ME4A 1K54C 5AJGA 1NWZA 4G3VA 3UPPA 2J3TD 4JPMA 3SH8A 2C6WB 4WN5A 3RXXA 1OTAA 2FFFB 2VLGA 3PBRA 4LFUA 1XJ6A 2B02A 1TF1A 4E3MA 2ZC4B 3MQ0A 1CI8A 1MWTA 1Y28A 1NXYA 3LEZA 3FYZA 4L9GA 4OPYA 1FSWA 3TE8A 1V9YA 5CERA 5TBMB 3E2LA 1RP5A 2P04A 4F3LB 2ZQ7A 3W2ZA 1YT4A 5M1AA 5FEFA 4WM9A 1ONHA 2X71A 1JNUA 3N8LA 2O9AA 4E3OA 4F94A 2BASA 1K25A 4GOGA 2RCXA 2EX2A 3T4TA 1CJFA 3EQVA 3H82B 5A91A 4EBPA 3VSLA 2K31A 4OPZA 3IHAA 4XXRA 2IWBA 1MY8A 2EXBA 5G18A 4U0TA 1DP8A 3UE1A 3CUEC 3LICA 4Y2FA 2PBDP 3OCLA 4KQDA 4X68A 2B95A 4HEFA 1K0KA 4OQIA 4RX2A 3CLOA 3GMWA 2VK3A 4ARZA 5GL9A 2W1TA 5FQ9A 3N8SA 4NXEA 4BENA 2C5WB 4OKPA 4X1LA 4X6TA 4ZJ1A 4OP5A 1VQQA 4DF6A 1W79A 2OSUA 4P0MA 3MQOA 4C6YA 2YKFA 3MFDA 1W7FA 5CGXA 3VP3A 5EVID 2OAQ1 2W0NA 3AGEA 4R3JA 5MC7A 4X55A 1XXMA 1FCMA 3SS4A 1H3QA 3G30A 2A2LA 3MJQA 1GSXA 1S1YA 2XROA 1FSYA 3BQ8A 4KQQA 2WKEA 2ZC3B 1O7EA 2E8IA 4Y0UA 2JKTI 3HBRA 4DXBA 4LV3A 1ALQA 2ZOHA 4BBTA 3G31A 3MQQA 3IF6B 1YLJA 3LO7A 1P97A 2VKSA 3CJMA 5G4YA 1SKOA 3Q07A 1OTIA 4S2KA 3CUEA 3HUNA 2H0TA 2ZC5B 2FFYA 2DMWA 2J3TC 5HX9A 2J8YA 1TEMA 4GB7A 4S2JA 3P98A 4PM9A 3ITAA 3SS3A 3RJUA 3NCKA 1XJ2A 3GRJA 2XQZA 2LB5A 1IYOA 3LIEA 2V0WA 1VB6A 3L9KA 1ESIA 5L09A 3UDXA 4EESA 1L3LA 4LRYC 1SDNA 1AWIA 1CF0A 2WGWB 2PDRA 1GA9A 2MJ6A 3IF6C 5F5YA 3OPLA 4S2NA 1LSXA 4MDZA 3FPWA 1PWCA 3NIAA 3HUOA 5DJUA 4PM7A 2W3FA 2HF6A 2JCHA 4DMZA 3F1OB 4UA7A 2WADA 1BLHA 3QP6A 2VGJA 1D06A 3NHQA 3TSGA 3B42A 4HNBA 4K0WA 1GHPA 4IUHA 3NOTC 4K0XA 1CQAA 1K57C 5I94A 4B9OA 1GHIA 3C5AA 2IA2A 4L9FA 5J3WA 3MXQA 2Z2MB 3W4OA 4BWIA 4NXFA 4S2MA 3MZDA 3C7UA 4I39A 3R7WB 4JF4A 5EVIC 4KUKA 1KE0A 3T1SA 1TS8A 1N9LA 1VM1A 4QD4A 4GJ4A 3FWLA 2H10A 5FASA 4BMWA 4OVDA 4HJ6A 2JE5A 1M6KA 3H7WB 1WYCA 3UNWA 2XD5A 2W3EA 1G68A 3IWQA 5L2FA 3OPRA 4PM8A 1UWPX 2FH5A 2HZ5A 1ONGA 3QP5A 3BFEA 1XX2A 4MN6A 3HLGA 1N4OA 3UMEA 5FQQA 4EERA 3O86A 4R3AA 3PBQA 1U60A 3DW0A 1PIOA 2Y2GA 4RVAA 3PBNA 4EUVA 3TOIA 4KG5A 4I5SA 3M6BA 3G4PA 3DTEA 2B5RA 2I72A 2EWWA 1PW8A 3U2AA 4N92A 1PWDA 3ULFA 5F6AA 3IBJA 1K57A 1JTDA 2PR6A 1XKZA 3KO6A 4PAUA 2H0YA 4WELA 5FI2A 1E3UA 2ACGA 5E2HA 3IS2A 2JKGA 4NKPA 2BTFP 1ERQA 1NRFA 2WK0A 4LCLA 5C5KA 1NLYA 4HHDA 4MMNA 4P6ZS 1YLZA 3DBAA 5AQBA 4IHQA 5HDDA 3LR4A 2P9VB 3Q81A 1RGZA 3LR0A 1ZG6A 1YM1A 3NOUC 4ID4A 3W4PA 3VP4A 1T1CA 4WYYA 4U3TA 3BW6A 5CECA 5EM0A 2VZWA 2VEAA 4OONA 1K55A 3DWZA 4P6BA 2QPNA 1XJ4A 1LL9A 4OQGA 3UMDA 2XH9A 5FAPA 4BL3A 3T1XA 2L4RA 3Q82A 4Y17A 4L0LA 3S1YA 2ZC7A 3FKVA 2HDSA 1VETB 2XEPA 1YPRA 3LGOA 5GHYA 4P87A 1LSWA 1ES3A 1XGIA 1D7EA 3BECA 5GLDA 3QP2A 3N8RA 2HDUA 2WYXA 1V9ZA 3SOIA 3M2JA 4L9EA 1IOUA 4GHIA 2Y2KA 4LGWA 1YLTA 2QJ5A 4PM6A 5EVLA 3AGDA 4GNUA 4Z1WA 1K56A 4H6JA 2JC7A 4WZ4A 1BLSA 3K2NA 1G6AA 3IH9A 4IEDA 3LFVA 1OTDA 2ZL1A 3ZDJA 1LSVA 3TG9A 1BLCA 3GR2A 4Q0HA 4OQ0A 3FPVA 3BJNA 3CG5A 4ARZB 3LYXA 2W3DA 3IT9A 4GS9A 1SHVA 4EW7A 3WS1A 3FV7A 2ZD8A 3BRMA 3E2KA 2D02A 5IU1A 1F5MA 4R70A 4WMCA 3T4KA 2HP9A 4U0XA 1FR1A 1TVFA 2ZM2A 4PPRA 4RQ9A 4MBKA 2ZQ8A 4B4ZA 1VHMA 4MCWA 3IXHA 2WGIA 3UY6A 1FQGA 4IBRA 1SZVA 3VOLA 3VSKA 2Q9MA 5HAPA 4MEZA 3OLOA 3T4QA 5KMWA 3UE3A 2V1ZA 1XJ3A 4KZ9A 4BBVA 4Q8IA 2PR5A 3KYZA 4Q0JA 3A3DA 4RA7A 3CPTB 4LV0A 2WZXA 1F98A 4FH2A 5A92A 3IHBA 4JF5A 4K91A 4BBUA 2O99A 3UDFA 3VP0A 4KUOA 2CMNA 1DJCA 1MC0A 4ETZA 5DTKA 1S6RA 2ZQDA 1QMFA 5HL1A 3W8KA 1H5XA 1LLBA 4QB8A 4I3AA 1EI5A 5EUAA 4ZRRA 5CGWA 1PNEA 4IVKA 4ESPA 5EOEA 2QKPA 2VV8A 2M1CA 3BLSA 1MXOA 3B33A 3ZGAB 3ZNTA 2ZLYA 1QMEA 2HPBA 4HOIA 3C4PA 3T1RA 4IBXA 3G34A 3ZQ5A 5EFWA 4XT2A 3LUQA 3PYPA 4JKTA 3DAVA 1YKDA 4GD8A 1NYMA 5I5LA 1T1AA 4OP8A 4O01A 1E4DA 3VFHA 4FCFA 2V8CA 3LIFA 4S2IA 3NULA 2X01A 3V39A 3IXDA 5HZHA 3VE4A 4MN5A 3Q7VA 2V9AA 3GTCA 3P7NA 3CHWP 4GN2A 4WEKA 4BJPA 1M40A 3GDIA 5FI6A 2OV5A 4CLCE 4GKUA 2JKTM 3C38A 4KZ6A 3SZTA 1K6SA 4JXSA 4ZJ3A 3UB8A 2R9XA 2Y2JA 2XD1A 1MWUA 2A24A 1CEGA 2P08A 1L2SA 3HLFA 5FQMA 1HTZA 5DF8A 5AQ9A 4MBHA 1EWZA 3HJKA 2KDKA 4AFIA 3UB5P 1E3UD 3EEHA 2ZQAA 3QP8A 3IX4A 2Y59A 3BWLA 4A5RA 5DKLA 2VGLS 2EXAA 3D4FA 3DWKA 4DDSA 2XLNA 4JXWA 3IX8A 1S66L 1BLPA 2JHEA 1OJGA 5FAOA 2Y4AA 4B93A 5CEBA 1H8ZA 3VOYA 2JKRI 3A0SA 3IXBA 4B88A 3LR5A 1KE4A 3FKWA 4EWFA 1PI4A 2RL3A 4S2NC 5K5BA 4EU0A 5U47A 2E8JA 3PHYA 2XA7M 5L10A 1YLPA 2KOIA 3MZEA 5AQAA 2CC1A 1OT9A 1N9NA 1NLZA 4JGOA 4E3NA 2QHKA 4WUJA 4EQIA 1FILA 1F2KA 1LI0A 1GSVA 2PU2A 3P09A 4ZTKA 1TS6A 4IJGA 2XRNA 1JVJA 3CZDA 3HLWA 1LL5A 4DJ3A 3TRCA 5TJJA 1RCJA 1STZA 3T4JA 4R3BA 2Y2LA 2WAEA 4I38A 1JWZA 2AVXA 3GV9A 1EW0A 3VP2A 2V8FA 3S7OA 1ES4A 5KSHA 1N9BA 4HP9A 2PYPA 4X1MA 4E3KA 2W27A 3UDIA 1FR6A 4DE2A 1K56D 1KE3A 3FC7A 3FZCA 2Y2OA 3C4OA 1NJ4A 2INWA 1DP6A 5EVIB 2K2NA 2QMIA 3MS6A 3C2WA 3F1PB 2PT7A 1KVLA 2M7VA 3K3CA 4G3WA 2HDRA 1TDGA 3RH8B 4MLLA 3ZG8B 3OOVA 4OOYA 3UB7A 1YSPA 1OTBA 5TBMA 4WMCD 4OLGA 3C7VA 3JVUA 1P9RA 1DRMA 3U4LP 1MWRA 3ITBA 3C8CA 5HDSA 4N1HA 3HLCA 3WS5A 4EXOA 1PFLA 1H0MA 1N9OA 5CTNA 2PHYA 1S1ZA 4OLDA 3T4SA 1MKMA 3BY9A 4R1GA 3I7JA 4S2PA 5A8BA 2DNSA 4ZBEA 3UE0A 1BYWA 4JGQA 3O87A 3LR3A 3PXPA 5FDHA 3OC2A 4LPZA 2EWVA 2XA7S 1OTEA 3G32A 3IBRA 3LCEA 4M4XA 3BEBA 4B4XA 4E3JA 1TD5A 1T1BA 4MBFA 4HP4A 2Y8HA 4GHIB 1JWVA 4LV2A 4R0QA 2EFUA 1SDEA 1CEFA 1LL8A 3W4QA 4OOLA 2EX8A 1GCEA 2Y79A 3G2ZA 5D3OA 2ZC6B 4EEUA 2J9OA 4RYEA 2JKFA 2PD7A 3O88A 4ZDXA 3R4KA 4ZAMA 1XGJA 2O9CA 3IWIA 5BOHA 4CLCA 5GHXA 1XA7A 5FQKA 1Y54A 5E2EA 1C3BA 1JTGA 1MKIA 4D2OA 1K55C 3NJAA 4R38A 4YFMA 2Y2NA 1YQSA 3OPHA 4GS9B 1H8MA 4UAAA 1CI9A 1BUEA 4FH4A 3WS4A 2VV6A 4EBLA 3HLBA 3GVBA 2J9PA 5F1GA 1KGFA 3RFBA 4JGPA 4M3KA 4LV1A 2QYBA 5E2GA 3Q1FA 1BSGA 5FL3A 5TR7A 1S4RA 3M2KA 1KVMA 1ES2A 5E43A 2IWDA 3HCYA 3S7NA 1HLUP 4IVIA 4FUWA 5EV0A 1NZUA 2Y2HA 3EGDC 4KZBA 3ZVTA 2WKQA 3BFGA 4Q0IA 5FEGA 2QZ6A 4UQIM 3N7WA 3ZNYA 5A90A 1EROA 3F1NB 2W3GA 4DXCA 3E4OA 1HVBA 1SCWA 3N6IA 4S2LA 3CITA
chains in the Genus database with same CATH topology
2V1ZA 3PAGA 4BQMA 4KZ9A 4C6YA 2Q9NA 1IKGA 3BYDA 4JLFA 4Q8IA 3WWXA 1WE4A 2ZJ9A 3MFDA 3SS5A 1W7FA 4KZ5A 5CGXA 3VP3A 5EVID 1XP4A 5A93A 1IELA 2UWXA 4QY6A 2WAFA 3A3DA 3AGEA 2PU4A 4RA7A 4R3JA 4LV0A 2WGWA 3HLEA 4C75A 2WZXA 4X55A 1XXMA 1FCMA 3SS4A 4FH2A 3G30A 1L0EA 1YMSA 1KDWA 5A92A 3IHBA 4JF5A 4K91A 4YINA 1BZAA 3UDFA 5DF9A 3VP0A 3VMAA 4OOMA 3EQUA 4FSFA 1DJCA 4DE3A 1FSYA 4JXGA 4KG2A 1S6RA 4R23A 5CGSA 5DTKA 4KQQA 4KZ8A 2ZQDA 2WKEA 1MBLA 2ZC3B 3BFFA 1QMFA 4UA9A 1K4FA 5CHMA 4DKIA 3BLMA 5HL1A 1O7EA 2E8IA 3W8KA 4MNRA 5J8XA 1H5XA 1I2SA 4Y0UA 1LLBA 4QB8A 1EI5A 1RGYA 3N4IA 5EUAA 3HBRA 3A3EA 4DXBA 3RXWA 4LV3A 5CGWA 1K6RA 1ALQA 1Z6FA 2ZMAA 5F83A 4IVKA 3NDGA 3G31A 1MWSA 3IF6B 4KZAA 1YLJA 5EPHA 5EOEA 4GDNA 4Z9QA 2VGKA 3MXRA 3LO7A 4N9LA 5F82A 1XPBA 3ZG7B 1TDLA 3CJMA 2WGVA 3BLSA 1MXOA 3Q7VB 3A3IA 3ZGAB 2ZLYA 3ZNTA 1QMEA 2HPBA 4KENB 2EFXA 3C4PA 5FQJA 3AGFA 3Q07A 4IBXA 4N9KA 4S2KA 4QHCA 1S0WA 2EX6A 3HUNA 3SH7A 2H0TA 2ZC5B 3G34A 5GLAA 3VOZA 1BULA 3G2YA 4P85A 2FFYA 2BLSA 5AQ7A 4JKTA 4XUXA 1ESUA 4ZJ2A 4C3QA 4GD8A 1NYMA 1PYYA 3OCNA 3JYIA 5HX9A 3BFCA 4OP8A 4GDBA 4DE1A 1E4DA 3VFHA 4FCFA 4JBFA 3IF6A 2J8YA 1TEMA 4N1XA 4S2IA 4GB7A 3M6HA 5FATA 4S2JA 3P98A 2X01A 3V39A 3IXDA 4PM9A 2WKHA 1IEMA 2HP6A 5FI7A 3ITAA 1W8QA 3SS3A 1YLYA 3RJUA 3Q7VA 3NCKA 3NDEA 2XF3A 3GRJA 3WS2A 2XQZA 3PBOA 3PBTA 3CMZA 1ERMA 3GTCA 4RX3A 1IYOA 4QY5A 2XR0A 3NC8A 3SH9A 4GN2A 5CEDA 4WEKA 4BJPA 1M40A 5FI6A 2OV5A 1ESIA 4GKUA 1KDSA 4QU3A 3UDXA 4KZ6A 1K6SA 1PWGA 4JXSA 5IHVA 4ZJ3A 1SDNA 1YLWA 2R9XA 2WGWB 2Y2JA 2WUQA 1GA9A 2XD1A 1I5QA 1MWUA 1H8YA 1CEGA 3IF6C 3ZG5A 1L2SA 3HLFA 5FQMA 1HTZA 5GLCA 3OPLA 4S2NA 1K38A 5DF8A 5DTTA 1LI9A 5AQ9A 2HDQA 1EWZA 4MBHA 4WEJA 1DJBA 1PWCA 2Y55A 1E3UD 1CK3A 3MXSA 3NIAA 2ZQAA 4JXVA 1DJAA 2Y2MA 3HUOA 3ZFZA 4PM7A 2Y59A 4A5RA 4OQHA 3ZVWA 1ZKJA 3BFDA 2EXAA 5EVIA 4EBNA 4EV4A 1PZPA 1FCNA 2JCHA 3D4FA 5HAQA 1PW1A 3DWKA 3IQAA 4DDSA 2XLNA 5E2FA 4JXWA 4UA7A 2WADA 1BLHA 4XUZA 2VGJA 1K4EA 3QHYA 3TSGA 5DVAA 4K0WA 5F1FA 4OH0A 1W8YA 1BLPA 1GA0A 2HP5A 3IXGA 5FAOA 2Y4AA 1GHPA 3HREA 5CEBA 1H8ZA 2IWCA 4K0XA 3VOYA 4CPKA 3IXBA 1K57C 4B88A 5I94A 1KE4A 3FKWA 3UPOA 2V2FF 1GHIA 1NYYA 3C5AA 4NK3A 5EOOA 4EWFA 1PI4A 2RL3A 5DF7A 4DE0A 2ZQCA 3G35A 1ES5A 4S2NC 2Z2MB 2XGNA 5CRFA 3W4OA 3ZG9B 4HESA 3MKFA 3UO9A 5U47A 2DRWA 1XA1A 3GSGA 4S2MA 3MZDA 5EE8A 3WRZA 1YLPA 5HW3A 3MZEA 3C7UA 4JF4A 5EVIC 4HBTA 2CC1A 5AQAA 1KE0A 5FAQA 5TGFA 1VM1A 4E3NA 2OLUA 4QD4A 1W5DA 3V3SA 3FWLA 1IYQA 1Q2QA 2H5SA 2H10A 2Y91A 2P9VA 5FASA 5TFQA 4EQIA 1OMEA 4OVDA 1PI5A 3QNCA 1LI0A 2JE5A 1KGEA 1M6KA 4BD1A 2PU2A 3P09A 1WYCA 4ZTKA 1GHMA 2ZQ9A 3OPPA 3UNWA 2XD5A 2ZM8A 1G68A 3IWQA 1BTLA 5L2FA 1I2WA 1JVJA 3OPRA 4PM8A 3CZDA 3HLWA 1LL5A 1RCJA 3V50A 2Y2PA 1IKIA 4WZ5C 1ONGA 3GQZA 4GZBA 3BFEA 4Y0OA 1XX2A 4CJNA 1L0DA 3HLGA 1N4OA 4R3BA 5FQQA 2Y2LA 2WAEA 1JWZA 3O86A 2PBYA 3V3RA 3PBQA 1U60A 3DW0A 3GV9A 1PIOA 3HLDA 2Y2GA 3VP2A 3HUMA 4RVAA 2XFTA 5CHUA 3B3XA 1ES4A 2EX9A 5KSHA 2OLVA 5HAIA 5CTMA 1N9BA 3PBNA 3HL9A 3TOIA 4E3KA 2R9WA 3UDIA 3WS0A 1FR6A 1L0FA 4KG5A 1K56D 1YMXA 4DE2A 3Q7ZA 1KE3A 3FZCA 2XK1A 4LENA 2Y2OA 3C4OA 3M6BA 1NJ4A 2GDNA 3G4PA 1MPLA 2B5RA 5EVIB 5HFOA 2I72A 4KZ3A 3NY4A 4KQOA 2QMIA 3MKEA 1PW8A 3UN7A 1KVLA 3LY3A 3VP1A 1IYSA 2HDRA 3IF5A 3PAEA 4Y7PA 4N92A 1PWDA 1TDGA 1JWPA 1K57A 1FOFA 1JTDA 1BT5A 1XKZA 3S4XA 3IH8A 4MLLA 1J9MA 2H0YA 3ZG8B 4DDYA 3ISGA 4WELA 5HARA 4OOYA 5FI2A 1HZOA 1E3UA 5E2HA 3OZHA 4WMCD 3ZCZA 1ERQA 4OLGA 3C7VA 4KZ7A 4DRTA 1NRFA 2WK0A 5CHJA 1MWRA 4LCLA 4BD0A 3ITBA 1DY6A 3PBSA 3V5MA 5JYOA 3LY4A 2BG1A 5DTSA 4N1HA 2J7VA 4H8RA 3HLCA 3WS5A 1NY0A 1YLZA 5CTNA 1ZG4A 4BL2A 4O7DA 4OLDA 3MZFA 1E25A 4Y0TA 3DTMA 5AQBA 1NZOA 3HVFA 4X56A 3UPNA 4R1GA 2P9VB 3Q81A 4GD6A 5FA7A 3I7JA 1PZOA 1RGZA 1ZG6A 1K54A 4S2PA 1YM1A 4E3LA 4ID4A 3W4PA 3BM6A 4X53A 3VP4A 4WYYA 4KQRA 4U3TA 2XFSA 5CECA 2DNSA 3MBZA 4ZBEA 3UE0A 1O07A 2A49A 2ZM0A 3O87A 4OONA 1K55A 5FDHA 3OC2A 4LCMA 4KZ4A 4OPQA 3VFFA 4BLMA 3DWZA 4P6BA 3O3VA 3G32A 3NBLA 4WZ5A 4OPRA 2QPNA 3LCEA 3BEBA 4S2OA 2Y2IA 3A3FA 4B4XA 4E3JA 5EECA 4MBFA 1JWVA 1LL9A 5M18A 1SKFA 2DCFA 2XH9A 4LV2A 4OQGA 5FAPA 4R4SA 4BL3A 5JYPA 4PMAA 4R0QA 4QJGA 1Q2PA 3Q82A 2EFUA 1SDEA 1CEFA 4L0LA 5FSRA 2ZC7A 3FKVA 4FD8A 4OOLA 5GHZA 3S1YA 3W4QA 2EX8A 4JF6A 3NI9A 1GCEA 5M19A 3G2ZA 5D3OA 2G2WA 2ZC6B 2J9OA 1LHYA 2HDSA 4RYEA 5KZHA 3O88A 4HBUA 1K54C 2XDMA 3PTEA 2XEPA 3UPPA 4ZDXA 4JPMA 3SH8A 2C6WB 4ZAMA 5GHYA 2Z2LB 1XGJA 4P87A 3IWIA 3RXXA 5BOHA 2FFFB 3PBRA 5GHXA 1XA7A 5FQKA 1AXBA 1ES3A 1XGIA 1Y54A 3BECA 1C3BA 1JTGA 1MKIA 5E2EA 5GLDA 4D2OA 1K55C 2WZZA 3N8RA 5FQIA 1HD8A 4YFMA 4E3MA 2ZC4B 2HDUA 2WYXA 2Y2NA 1YQSA 3IWOA 3OPHA 3SOIA 3M2JA 1CI8A 1MWTA 1KGGA 4UAAA 1NXYA 3LEZA 4UA6A 1CI9A 2Y2QA 2Y2KA 5KSCA 1BUEA 3FYZA 1YLTA 4OPYA 4PM6A 1FSWA 5EVLA 3AGDA 4FH4A 4GNUA 1IYPA 5CERA 3ZHHA 1FCOA 1K56A 3E2LA 2JBFA 1RP5A 2A3UA 1ZC2A 2JC7A 4WZ4A 1BLSA 3WS4A 2ZQ7A 4EBLA 1YT4A 3HLBA 5M1AA 3GVBA 2J9PA 1G6AA 3IH9A 5F1GA 4UHUA 4IEDA 4WM9A 3WRTA 1KGFA 1ONHA 3ZDJA 2X71A 3TG9A 3N8LA 1BLCA 3GR2A 4M3KA 4LV1A 4OQ0A 5E2GA 3Q1FA 4E3OA 4WBGA 1BSGA 4GOGA 1K25A 2G2UA 3CG5A 2WKIA 5GLBA 5TR7A 4F94A 2RCXA 3M2KA 1KVMA 2EX2A 3IT9A 1WYBA 1SHVA 3EQVA 1L0GA 3WS1A 3S22A 1ES2A 3FV7A 2P74A 2ZD8A 5E43A 5A91A 3BRMA 3E2KA 4EBPA 3VSLA 4E6XA 2IWDA 4WMCA 4OPZA 5CXWA 2HP9A 3IHAA 4U0XA 4XXRA 4IVIA 1FR1A 2IWBA 1MY8A 1TVFA 2EXBA 5G18A 4U0TA 2ZM2A 3UE1A 4PPRA 4E3IA 1NZUA 4R4RA 2Y2HA 4MBKA 4EUZA 3OCLA 4X68A 4X69A 2ZQ8A 4HEFA 4OQIA 4KG6A 4KZBA 3ZVTA 4B4ZA 3QNBA 4RX2A 4PM5A 2V20A 3BFGA 3GMWA 2X02A 2QZ6A 3IXHA 5GL9A 2WGIA 3A3JA 3ZG0A 5FQ9A 3UY6A 1FQGA 3N7WA 3N8SA 4IBRA 4NETA 3ZNYA 5A90A 1EROA 3VSKA 4BENA 2Q9MA 4E6WA 4DXCA 2C5WB 4MEZA 4OKPA 5HAPA 4X6TA 4ZJ1A 1HVBA 4OP5A 1VQQA 1SCWA 3N6IA 4DF6A 1W79A 2OSUA 4P0MA 5KMWA 4S2LA 3UE3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V1Z A;  3PAG A;  4BQM A;  4KZ9 A;  4C6Y A;  2Q9N A;  1IKG A;  3BYD A;  4JLF A;  4Q8I A;  3WWX A;  1WE4 A;  2ZJ9 A;  3MFD A;  3SS5 A;  1W7F A;  4KZ5 A;  5CGX A;  3VP3 A;  5EVI D;  1XP4 A;  5A93 A;  1IEL A;  2UWX A;  4QY6 A;  2WAF A;  3A3D A;  3AGE A;  2PU4 A;  4RA7 A;  4R3J A;  4LV0 A;  2WGW A;  3HLE A;  4C75 A;  2WZX A;  4X55 A;  1XXM A;  1FCM A;  3SS4 A;  4FH2 A;  3G30 A;  1L0E A;  1YMS A;  1KDW A;  5A92 A;  3IHB A;  4JF5 A;  4K91 A;  4YIN A;  1BZA A;  3UDF A;  5DF9 A;  3VP0 A;  3VMA A;  4OOM A;  3EQU A;  4FSF A;  1DJC A;  4DE3 A;  1FSY A;  4JXG A;  4KG2 A;  1S6R A;  4R23 A;  5CGS A;  5DTK A;  4KQQ A;  4KZ8 A;  2ZQD A;  2WKE A;  1MBL A;  2ZC3 B;  3BFF A;  1QMF A;  4UA9 A;  1K4F A;  5CHM A;  4DKI A;  3BLM A;  5HL1 A;  1O7E A;  2E8I A;  3W8K A;  4MNR A;  5J8X A;  1H5X A;  1I2S A;  4Y0U A;  1LLB A;  4QB8 A;  1EI5 A;  1RGY A;  3N4I A;  5EUA A;  3HBR A;  3A3E A;  4DXB A;  3RXW A;  4LV3 A;  5CGW A;  1K6R A;  1ALQ A;  1Z6F A;  2ZMA A;  5F83 A;  4IVK A;  3NDG A;  3G31 A;  1MWS A;  3IF6 B;  4KZA A;  1YLJ A;  5EPH A;  5EOE A;  4GDN A;  4Z9Q A;  2VGK A;  3MXR A;  3LO7 A;  4N9L A;  5F82 A;  1XPB A;  3ZG7 B;  1TDL A;  3CJM A;  2WGV A;  3BLS A;  1MXO A;  3Q7V B;  3A3I A;  3ZGA B;  2ZLY A;  3ZNT A;  1QME A;  2HPB A;  4KEN B;  2EFX A;  3C4P A;  5FQJ A;  3AGF A;  3Q07 A;  4IBX A;  4N9K A;  4S2K A;  4QHC A;  1S0W A;  2EX6 A;  3HUN A;  3SH7 A;  2H0T A;  2ZC5 B;  3G34 A;  5GLA A;  3VOZ A;  1BUL A;  3G2Y A;  4P85 A;  2FFY A;  2BLS A;  5AQ7 A;  4JKT A;  4XUX A;  1ESU A;  4ZJ2 A;  4C3Q A;  4GD8 A;  1NYM A;  1PYY A;  3OCN A;  3JYI A;  5HX9 A;  3BFC A;  4OP8 A;  4GDB A;  4DE1 A;  1E4D A;  3VFH A;  4FCF A;  4JBF A;  3IF6 A;  2J8Y A;  1TEM A;  4N1X A;  4S2I A;  4GB7 A;  3M6H A;  5FAT A;  4S2J A;  3P98 A;  2X01 A;  3V39 A;  3IXD A;  4PM9 A;  2WKH A;  1IEM A;  2HP6 A;  5FI7 A;  3ITA A;  1W8Q A;  3SS3 A;  1YLY A;  3RJU A;  3Q7V A;  3NCK A;  3NDE A;  2XF3 A;  3GRJ A;  3WS2 A;  2XQZ A;  3PBO A;  3PBT A;  3CMZ A;  1ERM A;  3GTC A;  4RX3 A;  1IYO A;  4QY5 A;  2XR0 A;  3NC8 A;  3SH9 A;  4GN2 A;  5CED A;  4WEK A;  4BJP A;  1M40 A;  5FI6 A;  2OV5 A;  1ESI A;  4GKU A;  1KDS A;  4QU3 A;  3UDX A;  4KZ6 A;  1K6S A;  1PWG A;  4JXS A;  5IHV A;  4ZJ3 A;  1SDN A;  1YLW A;  2R9X A;  2WGW B;  2Y2J A;  2WUQ A;  1GA9 A;  2XD1 A;  1I5Q A;  1MWU A;  1H8Y A;  1CEG A;  3IF6 C;  3ZG5 A;  1L2S A;  3HLF A;  5FQM A;  1HTZ A;  5GLC A;  3OPL A;  4S2N A;  1K38 A;  5DF8 A;  5DTT A;  1LI9 A;  5AQ9 A;  2HDQ A;  1EWZ A;  4MBH A;  4WEJ A;  1DJB A;  1PWC A;  2Y55 A;  1E3U D;  1CK3 A;  3MXS A;  3NIA A;  2ZQA A;  4JXV A;  1DJA A;  2Y2M A;  3HUO A;  3ZFZ A;  4PM7 A;  2Y59 A;  4A5R A;  4OQH A;  3ZVW A;  1ZKJ A;  3BFD A;  2EXA A;  5EVI A;  4EBN A;  4EV4 A;  1PZP A;  1FCN A;  2JCH A;  3D4F A;  5HAQ A;  1PW1 A;  3DWK A;  3IQA A;  4DDS A;  2XLN A;  5E2F A;  4JXW A;  4UA7 A;  2WAD A;  1BLH A;  4XUZ A;  2VGJ A;  1K4E A;  3QHY A;  3TSG A;  5DVA A;  4K0W A;  5F1F A;  4OH0 A;  1W8Y A;  1BLP A;  1GA0 A;  2HP5 A;  3IXG A;  5FAO A;  2Y4A A;  1GHP A;  3HRE A;  5CEB A;  1H8Z A;  2IWC A;  4K0X A;  3VOY A;  4CPK A;  3IXB A;  1K57 C;  4B88 A;  5I94 A;  1KE4 A;  3FKW A;  3UPO A;  2V2F F;  1GHI A;  1NYY A;  3C5A A;  4NK3 A;  5EOO A;  4EWF A;  1PI4 A;  2RL3 A;  5DF7 A;  4DE0 A;  2ZQC A;  3G35 A;  1ES5 A;  4S2N C;  2Z2M B;  2XGN A;  5CRF A;  3W4O A;  3ZG9 B;  4HES A;  3MKF A;  3UO9 A;  5U47 A;  2DRW A;  1XA1 A;  3GSG A;  4S2M A;  3MZD A;  5EE8 A;  3WRZ A;  1YLP A;  5HW3 A;  3MZE A;  3C7U A;  4JF4 A;  5EVI C;  4HBT A;  2CC1 A;  5AQA A;  1KE0 A;  5FAQ A;  5TGF A;  1VM1 A;  4E3N A;  2OLU A;  4QD4 A;  1W5D A;  3V3S A;  3FWL A;  1IYQ A;  1Q2Q A;  2H5S A;  2H10 A;  2Y91 A;  2P9V A;  5FAS A;  5TFQ A;  4EQI A;  1OME A;  4OVD A;  1PI5 A;  3QNC A;  1LI0 A;  2JE5 A;  1KGE A;  1M6K A;  4BD1 A;  2PU2 A;  3P09 A;  1WYC A;  4ZTK A;  1GHM A;  2ZQ9 A;  3OPP A;  3UNW A;  2XD5 A;  2ZM8 A;  1G68 A;  3IWQ A;  1BTL A;  5L2F A;  1I2W A;  1JVJ A;  3OPR A;  4PM8 A;  3CZD A;  3HLW A;  1LL5 A;  1RCJ A;  3V50 A;  2Y2P A;  1IKI A;  4WZ5 C;  1ONG A;  3GQZ A;  4GZB A;  3BFE A;  4Y0O A;  1XX2 A;  4CJN A;  1L0D A;  3HLG A;  1N4O A;  4R3B A;  5FQQ A;  2Y2L A;  2WAE A;  1JWZ A;  3O86 A;  2PBY A;  3V3R A;  3PBQ A;  1U60 A;  3DW0 A;  3GV9 A;  1PIO A;  3HLD A;  2Y2G A;  3VP2 A;  3HUM A;  4RVA A;  2XFT A;  5CHU A;  3B3X A;  1ES4 A;  2EX9 A;  5KSH A;  2OLV A;  5HAI A;  5CTM A;  1N9B A;  3PBN A;  3HL9 A;  3TOI A;  4E3K A;  2R9W A;  3UDI A;  3WS0 A;  1FR6 A;  1L0F A;  4KG5 A;  1K56 D;  1YMX A;  4DE2 A;  3Q7Z A;  1KE3 A;  3FZC A;  2XK1 A;  4LEN A;  2Y2O A;  3C4O A;  3M6B A;  1NJ4 A;  2GDN A;  3G4P A;  1MPL A;  2B5R A;  5EVI B;  5HFO A;  2I72 A;  4KZ3 A;  3NY4 A;  4KQO A;  2QMI A;  3MKE A;  1PW8 A;  3UN7 A;  1KVL A;  3LY3 A;  3VP1 A;  1IYS A;  2HDR A;  3IF5 A;  3PAE A;  4Y7P A;  4N92 A;  1PWD A;  1TDG A;  1JWP A;  1K57 A;  1FOF A;  1JTD A;  1BT5 A;  1XKZ A;  3S4X A;  3IH8 A;  4MLL A;  1J9M A;  2H0Y A;  3ZG8 B;  4DDY A;  3ISG A;  4WEL A;  5HAR A;  4OOY A;  5FI2 A;  1HZO A;  1E3U A;  5E2H A;  3OZH A;  4WMC D;  3ZCZ A;  1ERQ A;  4OLG A;  3C7V A;  4KZ7 A;  4DRT A;  1NRF A;  2WK0 A;  5CHJ A;  1MWR A;  4LCL A;  4BD0 A;  3ITB A;  1DY6 A;  3PBS A;  3V5M A;  5JYO A;  3LY4 A;  2BG1 A;  5DTS A;  4N1H A;  2J7V A;  4H8R A;  3HLC A;  3WS5 A;  1NY0 A;  1YLZ A;  5CTN A;  1ZG4 A;  4BL2 A;  4O7D A;  4OLD A;  3MZF A;  1E25 A;  4Y0T A;  3DTM A;  5AQB A;  1NZO A;  3HVF A;  4X56 A;  3UPN A;  4R1G A;  2P9V B;  3Q81 A;  4GD6 A;  5FA7 A;  3I7J A;  1PZO A;  1RGZ A;  1ZG6 A;  1K54 A;  4S2P A;  1YM1 A;  4E3L A;  4ID4 A;  3W4P A;  3BM6 A;  4X53 A;  3VP4 A;  4WYY A;  4KQR A;  4U3T A;  2XFS A;  5CEC A;  2DNS A;  3MBZ A;  4ZBE A;  3UE0 A;  1O07 A;  2A49 A;  2ZM0 A;  3O87 A;  4OON A;  1K55 A;  5FDH A;  3OC2 A;  4LCM A;  4KZ4 A;  4OPQ A;  3VFF A;  4BLM A;  3DWZ A;  4P6B A;  3O3V A;  3G32 A;  3NBL A;  4WZ5 A;  4OPR A;  2QPN A;  3LCE A;  3BEB A;  4S2O A;  2Y2I A;  3A3F A;  4B4X A;  4E3J A;  5EEC A;  4MBF A;  1JWV A;  1LL9 A;  5M18 A;  1SKF A;  2DCF A;  2XH9 A;  4LV2 A;  4OQG A;  5FAP A;  4R4S A;  4BL3 A;  5JYP A;  4PMA A;  4R0Q A;  4QJG A;  1Q2P A;  3Q82 A;  2EFU A;  1SDE A;  1CEF A;  4L0L A;  5FSR A;  2ZC7 A;  3FKV A;  4FD8 A;  4OOL A;  5GHZ A;  3S1Y A;  3W4Q A;  2EX8 A;  4JF6 A;  3NI9 A;  1GCE A;  5M19 A;  3G2Z A;  5D3O A;  2G2W A;  2ZC6 B;  2J9O A;  1LHY A;  2HDS A;  4RYE A;  5KZH A;  3O88 A;  4HBU A;  1K54 C;  2XDM A;  3PTE A;  2XEP A;  3UPP A;  4ZDX A;  4JPM A;  3SH8 A;  2C6W B;  4ZAM A;  5GHY A;  2Z2L B;  1XGJ A;  4P87 A;  3IWI A;  3RXX A;  5BOH A;  2FFF B;  3PBR A;  5GHX A;  1XA7 A;  5FQK A;  1AXB A;  1ES3 A;  1XGI A;  1Y54 A;  3BEC A;  1C3B A;  1JTG A;  1MKI A;  5E2E A;  5GLD A;  4D2O A;  1K55 C;  2WZZ A;  3N8R A;  5FQI A;  1HD8 A;  4YFM A;  4E3M A;  2ZC4 B;  2HDU A;  2WYX A;  2Y2N A;  1YQS A;  3IWO A;  3OPH A;  3SOI A;  3M2J A;  1CI8 A;  1MWT A;  1KGG A;  4UAA A;  1NXY A;  3LEZ A;  4UA6 A;  1CI9 A;  2Y2Q A;  2Y2K A;  5KSC A;  1BUE A;  3FYZ A;  1YLT A;  4OPY A;  4PM6 A;  1FSW A;  5EVL A;  3AGD A;  4FH4 A;  4GNU A;  1IYP A;  5CER A;  3ZHH A;  1FCO A;  1K56 A;  3E2L A;  2JBF A;  1RP5 A;  2A3U A;  1ZC2 A;  2JC7 A;  4WZ4 A;  1BLS A;  3WS4 A;  2ZQ7 A;  4EBL A;  1YT4 A;  3HLB A;  5M1A A;  3GVB A;  2J9P A;  1G6A A;  3IH9 A;  5F1G A;  4UHU A;  4IED A;  4WM9 A;  3WRT A;  1KGF A;  1ONH A;  3ZDJ A;  2X71 A;  3TG9 A;  3N8L A;  1BLC A;  3GR2 A;  4M3K A;  4LV1 A;  4OQ0 A;  5E2G A;  3Q1F A;  4E3O A;  4WBG A;  1BSG A;  4GOG A;  1K25 A;  2G2U A;  3CG5 A;  2WKI A;  5GLB A;  5TR7 A;  4F94 A;  2RCX A;  3M2K A;  1KVM A;  2EX2 A;  3IT9 A;  1WYB A;  1SHV A;  3EQV A;  1L0G A;  3WS1 A;  3S22 A;  1ES2 A;  3FV7 A;  2P74 A;  2ZD8 A;  5E43 A;  5A91 A;  3BRM A;  3E2K A;  4EBP A;  3VSL A;  4E6X A;  2IWD A;  4WMC A;  4OPZ A;  5CXW A;  2HP9 A;  3IHA A;  4U0X A;  4XXR A;  4IVI A;  1FR1 A;  2IWB A;  1MY8 A;  1TVF A;  2EXB A;  5G18 A;  4U0T A;  2ZM2 A;  3UE1 A;  4PPR A;  4E3I A;  1NZU A;  4R4R A;  2Y2H A;  4MBK A;  4EUZ A;  3OCL A;  4X68 A;  4X69 A;  2ZQ8 A;  4HEF A;  4OQI A;  4KG6 A;  4KZB A;  3ZVT A;  4B4Z A;  3QNB A;  4RX2 A;  4PM5 A;  2V20 A;  3BFG A;  3GMW A;  2X02 A;  2QZ6 A;  3IXH A;  5GL9 A;  2WGI A;  3A3J A;  3ZG0 A;  5FQ9 A;  3UY6 A;  1FQG A;  3N7W A;  3N8S A;  4IBR A;  4NET A;  3ZNY A;  5A90 A;  1ERO A;  3VSK A;  4BEN A;  2Q9M A;  4E6W A;  4DXC A;  2C5W B;  4MEZ A;  4OKP A;  5HAP A;  4X6T A;  4ZJ1 A;  1HVB A;  4OP5 A;  1VQQ A;  1SCW A;  3N6I A;  4DF6 A;  1W79 A;  2OSU A;  4P0M A;  5KMW A;  4S2L A;  3UE3 A; 
#chains in the Genus database with same CATH topology
 3PAG A;  4BQM A;  2I9V A;  2Q9N A;  1IKG A;  4Y3I A;  1WE4 A;  4CQH A;  3SS5 A;  3V67 A;  1XP4 A;  1IEL A;  3T4L A;  2UWX A;  4IUK A;  4QY6 A;  4QPR A;  2PU4 A;  3L7H A;  2WGW A;  3HLE A;  5DFX A;  1P0Z A;  4HJ3 A;  1L0E A;  1KDW A;  4LRZ E;  3TW8 A;  3MMH A;  1BZA A;  4OOM A;  4FSF A;  4DE3 A;  4KG2 A;  5CGS A;  3KYE A;  4KZ8 A;  2OOL A;  1MBL A;  3GEC A;  3BFF A;  1K4F A;  4XT2 B;  3BLM A;  1VEU A;  4DJ2 A;  3KYQ A;  1RGY A;  3A3E A;  2Q0O A;  3F1O A;  1K6R A;  5F83 A;  3B47 A;  5HWT A;  2HJ9 C;  1MWS A;  4Z9Q A;  2NUT C;  4N9L A;  1XPB A;  3K3D A;  3Q7V B;  5LBR A;  4KEN B;  5FQJ A;  2HGV A;  1S0W A;  2EX6 A;  4P85 A;  3KSH A;  2BLS A;  4C3Q A;  1PYY A;  3CAX A;  1NRJ A;  3JYI A;  3R7W A;  4DE1 A;  4I3I A;  5HWV A;  4JBF A;  4N1X A;  2W1T B;  3M6H A;  5FAT A;  2WKH A;  2HP6 A;  4E04 A;  1YLY A;  3NDE A;  3H7W A;  4HI4 A;  1W63 Q;  3PBT A;  2GZA A;  5IS1 A;  1ERM A;  4QY5 A;  1ZTU A;  1KDS A;  4QU3 A;  1PWG A;  4Y5F A;  5IHV A;  1YLW A;  2V1A A;  4UQI S;  2WUQ A;  2R78 A;  5GLC A;  1OJ5 A;  1K38 A;  2HDQ A;  4WEJ A;  1CK3 A;  3D9Y A;  2FZ0 A;  4JXV A;  3E4P A;  3ZFZ A;  5AVF A;  3ZVW A;  4EBN A;  3BFD A;  1PZP A;  1FCN A;  5HAQ A;  3IQA A;  4YOF A;  1G5U A;  5E2F A;  3RTY A;  3QHY A;  3IXG A;  2OWH A;  2Z6C A;  3UPO A;  3IX3 A;  1S4S A;  1SKO B;  2V2F F;  5L07 A;  4NK3 A;  1DP9 A;  4HQA A;  2ZQC A;  3G35 A;  3MF0 A;  2XGN A;  5CRF A;  3S7Q A;  2PD8 A;  3ZG9 B;  3MKF A;  5EE8 A;  5HW3 A;  2YKH A;  5FAQ A;  2QJ7 A;  1W5D A;  1ODV A;  2P9V A;  5TFQ A;  1PI5 A;  5J7E A;  2ZMF A;  2P7J A;  2ZM8 A;  3VE3 A;  1BTL A;  1IFQ A;  4CLC D;  3KSF A;  4WZ5 C;  3GQZ A;  4CJN A;  4GZB A;  2D01 A;  3DTI A;  2PBY A;  5L8M A;  2KX6 A;  2EX9 A;  2OLV A;  3S7P A;  1VET A;  2JKR M;  3WS0 A;  1L0F A;  3Q7Z A;  3QP4 A;  3C30 A;  2XK1 A;  4LEN A;  2GDN A;  1MPL A;  3FG8 A;  4KQO A;  3UN7 A;  3VP1 A;  4YWZ A;  5IT5 A;  1IYS A;  3IF5 A;  4GLQ A;  5DJT A;  1JWP A;  1BT5 A;  3S4X A;  1J9M A;  3ISG A;  5HD5 A;  2L1M A;  1HZO A;  3OZH A;  3A0R A;  3QP1 A;  4NEE D;  5CHJ A;  4LRX C;  3G6O A;  4BD0 A;  3T12 B;  1DY6 A;  3PBS A;  2OAP 1;  5JYO A;  5DTS A;  1NY0 A;  4BL2 A;  1ZG4 A;  5HPI A;  3MZF A;  4Y0T A;  2GNX A;  3UPN A;  4GD6 A;  5FA7 A;  1K54 A;  2GX5 A;  4E3L A;  4X53 A;  2HJE A;  4KQR A;  2XFS A;  5DFY A;  1OPX A;  1XFN A;  1O07 A;  2ZM0 A;  2V1B A;  4CLC B;  4NG2 A;  4PHT A;  3NEC A;  4LCM A;  4KZ4 A;  3O3V A;  4WZ5 A;  2Y2I A;  3A3F A;  2EA9 A;  4WLA A;  3NOP C;  5M18 A;  1SKF A;  4R4S A;  5JYP A;  4PMA A;  4QJG A;  2PAV P;  4FD8 A;  1YSQ A;  1LHY A;  5KZH A;  4HBU A;  2XDM A;  3PTE A;  2K7S A;  2Z2L B;  2GJ3 A;  1AXB A;  2J80 A;  2WZZ A;  5FQI A;  1HD8 A;  3IWO A;  3CPT A;  3LEQ A;  3D3O A;  4Y15 A;  1KGG A;  2Z6D A;  4UA6 A;  2Y2Q A;  5KSC A;  5HL6 A;  1FIK A;  3MFX A;  3UB9 A;  2JN7 A;  5EM1 A;  1ACF A;  1IYP A;  3ZHH A;  4PKY A;  1FCO A;  2JBF A;  3IS2 B;  4K08 A;  2A3U A;  1ZC2 A;  4NXB A;  2NUP C;  3UB6 A;  4UHU A;  3WRT A;  4D60 A;  2VA0 A;  3ZYT A;  4YNR A;  3T4O A;  4CLC C;  4WBG A;  5GLB A;  2G2U A;  2WKI A;  3CWF A;  4LLO B;  1WYB A;  4X25 A;  1L0G A;  3S22 A;  2P74 A;  4E6X A;  5CXW A;  4E3I A;  4R4R A;  4F3L A;  4EUZ A;  3O5Y A;  3H9W A;  4X69 A;  1F9I A;  1YAX A;  4KG6 A;  3UE6 A;  3QNB A;  4PM5 A;  2V20 A;  3T50 A;  2X02 A;  2V0U A;  3ZG0 A;  3A3J A;  4NET A;  5KIZ A;  4E6W A;  3H82 A;  4O8G A;  4HH2 A;  4QWO A;  3E4Q A;  1MZU A;  1VEU B;  5J4E A;  3BYD A;  2G7U A;  4JLF A;  4P6Z M;  3WWX A;  2ZJ9 A;  4KZ5 A;  3HJI A;  1A0K A;  1ZHH B;  5A93 A;  2L0W A;  2WAF A;  4C75 A;  1YMS A;  4YIN A;  5DF9 A;  3VMA A;  3VV4 A;  3EQU A;  4JXG A;  5DKK A;  4R23 A;  2QWS A;  4H6J B;  4UA9 A;  1XFQ A;  5CHM A;  4DKI A;  3E98 A;  4MNR A;  5J8X A;  1I2S A;  1KOU A;  3N4I A;  5AVE A;  2ZL1 B;  3RXW A;  4I3J A;  2ZMA A;  1Z6F A;  5HDC A;  3EWK A;  3NDG A;  5EPH A;  4KZA A;  4HH3 A;  4GDN A;  2VGK A;  3MXR A;  5F82 A;  3ZG7 B;  1TDL A;  2M7U A;  2WGV A;  3A3I A;  4GW9 A;  2EFX A;  3SW1 A;  4JGR A;  3AGF A;  3LI9 A;  4N9K A;  4QHC A;  3SH7 A;  5GLA A;  1S67 L;  3VOZ A;  1BUL A;  3G2Y A;  5AQ7 A;  2LB9 A;  3OBF A;  4XUX A;  1ESU A;  4ZJ2 A;  3OCN A;  3MSH A;  3BFC A;  4GDB A;  2WKR A;  3IF6 A;  2VV7 A;  4G3K A;  1Z09 A;  1T18 A;  1OT6 A;  2W3H A;  2J3W A;  1IEM A;  5FI7 A;  1W8Q A;  4PKY G;  2XF3 A;  3WS2 A;  4EQ1 A;  5CX7 A;  3LI8 A;  3PBO A;  3CMZ A;  2OWJ A;  4RX3 A;  5EVE A;  3SH9 A;  2XR0 A;  3NC8 A;  1LT0 A;  5CED A;  2O9B A;  4FOF A;  2ZOI A;  1I5Q A;  1H8Y A;  3ZG5 A;  4GCZ A;  5DTT A;  1LI9 A;  1DJB A;  2Y55 A;  3MXS A;  1DJA A;  2Y2M A;  2KLI A;  4EET B;  5HSQ A;  4OQH A;  4HIA A;  2VX8 A;  1ZKJ A;  5EVI A;  4EV4 A;  1PW1 A;  2ZMV A;  4XUZ A;  3F1P A;  1K4E A;  5DVA A;  5F1F A;  4OH0 A;  1W8Y A;  1GA0 A;  2PRF A;  2HP5 A;  3EGX C;  5HPF A;  3HRE A;  3PR6 A;  2IWC A;  4CPK A;  2HV1 A;  1NYY A;  5EOO A;  5HWW A;  5DF7 A;  4DE0 A;  1ES5 A;  4HES A;  3UO9 A;  1X0O A;  2DRW A;  1XA1 A;  3GSG A;  3ICY A;  3WRZ A;  2UV0 E;  3TJZ C;  4HBT A;  3EOI A;  5TGF A;  2PYR A;  1T19 A;  2OLU A;  3V3S A;  3CI6 A;  1IYQ A;  1Q2Q A;  2H5S A;  2Y91 A;  4WF0 A;  3KSG A;  1OME A;  1TS7 A;  3QNC A;  2W1R A;  1KGE A;  4BD1 A;  4Y13 A;  1GHM A;  2ZQ9 A;  3OPP A;  3T1Q B;  1W63 M;  2WKP A;  1GSW A;  4UEY A;  1I2W A;  5F69 A;  4ETX A;  3V50 A;  2Y2P A;  1IKI A;  4Y0O A;  1L0D A;  2VJW A;  3V3R A;  5G4Z A;  2A24 B;  3HLD A;  3HUM A;  2XFT A;  5CHU A;  3B3X A;  2ZBB A;  5HAI A;  5CTM A;  3EEA A;  3MR0 A;  1J3W A;  3HL9 A;  2R9W A;  4NXG A;  1YMX A;  3JPU A;  1D1J A;  2O0Y A;  5HFO A;  4O0P A;  4KZ3 A;  3NY4 A;  3MKE A;  3LY3 A;  1G6O A;  3BQA A;  3PAE A;  4DN0 A;  4Y7P A;  4R6L A;  3BY8 A;  4WL9 A;  1FOF A;  3IH8 A;  4DDY A;  5HAR A;  3ZCZ A;  3E0Y A;  2B18 A;  4DRT A;  4KZ7 A;  3LIA A;  5F68 A;  3V5M A;  1Y4O A;  3LY4 A;  2BG1 A;  2J7V A;  4H8R A;  3A0V A;  4O7D A;  2H28 A;  1E25 A;  3DTM A;  1NZO A;  3HVF A;  4X56 A;  5FDS A;  1PZO A;  3BM6 A;  4HY8 A;  1WA9 A;  3MBZ A;  2VGL M;  2A49 A;  2XSS A;  4II7 A;  3LID A;  5HD3 A;  4MN7 A;  4OPQ A;  3VFF A;  4BLM A;  3D72 A;  3NBL A;  4OPR A;  4S2O A;  1G28 A;  5EEC A;  1P9W A;  1PRQ A;  1UGU A;  3KX0 X;  3KSI A;  2DCF A;  3LIB A;  1TS0 A;  1UWN X;  3P01 A;  1Q2P A;  3F1N A;  5FSR A;  5GHZ A;  4HJ4 A;  4JF6 A;  3NI9 A;  4EEP A;  5M19 A;  2G2W A;  3JVV A;  3DTK A;  4FTX A;  4ME4 A;  1K54 C;  5AJG A;  1NWZ A;  4G3V A;  3UPP A;  2J3T D;  4JPM A;  3SH8 A;  2C6W B;  4WN5 A;  3RXX A;  1OTA A;  2FFF B;  2VLG A;  3PBR A;  4LFU A;  1XJ6 A;  2B02 A;  1TF1 A;  4E3M A;  2ZC4 B;  3MQ0 A;  1CI8 A;  1MWT A;  1Y28 A;  1NXY A;  3LEZ A;  3FYZ A;  4L9G A;  4OPY A;  1FSW A;  3TE8 A;  1V9Y A;  5CER A;  5TBM B;  3E2L A;  1RP5 A;  2P04 A;  4F3L B;  2ZQ7 A;  3W2Z A;  1YT4 A;  5M1A A;  5FEF A;  4WM9 A;  1ONH A;  2X71 A;  1JNU A;  3N8L A;  2O9A A;  4E3O A;  4F94 A;  2BAS A;  1K25 A;  4GOG A;  2RCX A;  2EX2 A;  3T4T A;  1CJF A;  3EQV A;  3H82 B;  5A91 A;  4EBP A;  3VSL A;  2K31 A;  4OPZ A;  3IHA A;  4XXR A;  2IWB A;  1MY8 A;  2EXB A;  5G18 A;  4U0T A;  1DP8 A;  3UE1 A;  3CUE C;  3LIC A;  4Y2F A;  2PBD P;  3OCL A;  4KQD A;  4X68 A;  2B95 A;  4HEF A;  1K0K A;  4OQI A;  4RX2 A;  3CLO A;  3GMW A;  2VK3 A;  4ARZ A;  5GL9 A;  2W1T A;  5FQ9 A;  3N8S A;  4NXE A;  4BEN A;  2C5W B;  4OKP A;  4X1L A;  4X6T A;  4ZJ1 A;  4OP5 A;  1VQQ A;  4DF6 A;  1W79 A;  2OSU A;  4P0M A;  3MQO A;  4C6Y A;  2YKF A;  3MFD A;  1W7F A;  5CGX A;  3VP3 A;  5EVI D;  2OAQ 1;  2W0N A;  3AGE A;  4R3J A;  5MC7 A;  4X55 A;  1XXM A;  1FCM A;  3SS4 A;  1H3Q A;  3G30 A;  2A2L A;  3MJQ A;  1GSX A;  1S1Y A;  2XRO A;  1FSY A;  3BQ8 A;  4KQQ A;  2WKE A;  2ZC3 B;  1O7E A;  2E8I A;  4Y0U A;  2JKT I;  3HBR A;  4DXB A;  4LV3 A;  1ALQ A;  2ZOH A;  4BBT A;  3G31 A;  3MQQ A;  3IF6 B;  1YLJ A;  3LO7 A;  1P97 A;  2VKS A;  3CJM A;  5G4Y A;  1SKO A;  3Q07 A;  1OTI A;  4S2K A;  3CUE A;  3HUN A;  2H0T A;  2ZC5 B;  2FFY A;  2DMW A;  2J3T C;  5HX9 A;  2J8Y A;  1TEM A;  4GB7 A;  4S2J A;  3P98 A;  4PM9 A;  3ITA A;  3SS3 A;  3RJU A;  3NCK A;  1XJ2 A;  3GRJ A;  2XQZ A;  2LB5 A;  1IYO A;  3LIE A;  2V0W A;  1VB6 A;  3L9K A;  1ESI A;  5L09 A;  3UDX A;  4EES A;  1L3L A;  4LRY C;  1SDN A;  1AWI A;  1CF0 A;  2WGW B;  2PDR A;  1GA9 A;  2MJ6 A;  3IF6 C;  5F5Y A;  3OPL A;  4S2N A;  1LSX A;  4MDZ A;  3FPW A;  1PWC A;  3NIA A;  3HUO A;  5DJU A;  4PM7 A;  2W3F A;  2HF6 A;  2JCH A;  4DMZ A;  3F1O B;  4UA7 A;  2WAD A;  1BLH A;  3QP6 A;  2VGJ A;  1D06 A;  3NHQ A;  3TSG A;  3B42 A;  4HNB A;  4K0W A;  1GHP A;  4IUH A;  3NOT C;  4K0X A;  1CQA A;  1K57 C;  5I94 A;  4B9O A;  1GHI A;  3C5A A;  2IA2 A;  4L9F A;  5J3W A;  3MXQ A;  2Z2M B;  3W4O A;  4BWI A;  4NXF A;  4S2M A;  3MZD A;  3C7U A;  4I39 A;  3R7W B;  4JF4 A;  5EVI C;  4KUK A;  1KE0 A;  3T1S A;  1TS8 A;  1N9L A;  1VM1 A;  4QD4 A;  4GJ4 A;  3FWL A;  2H10 A;  5FAS A;  4BMW A;  4OVD A;  4HJ6 A;  2JE5 A;  1M6K A;  3H7W B;  1WYC A;  3UNW A;  2XD5 A;  2W3E A;  1G68 A;  3IWQ A;  5L2F A;  3OPR A;  4PM8 A;  1UWP X;  2FH5 A;  2HZ5 A;  1ONG A;  3QP5 A;  3BFE A;  1XX2 A;  4MN6 A;  3HLG A;  1N4O A;  3UME A;  5FQQ A;  4EER A;  3O86 A;  4R3A A;  3PBQ A;  1U60 A;  3DW0 A;  1PIO A;  2Y2G A;  4RVA A;  3PBN A;  4EUV A;  3TOI A;  4KG5 A;  4I5S A;  3M6B A;  3G4P A;  3DTE A;  2B5R A;  2I72 A;  2EWW A;  1PW8 A;  3U2A A;  4N92 A;  1PWD A;  3ULF A;  5F6A A;  3IBJ A;  1K57 A;  1JTD A;  2PR6 A;  1XKZ A;  3KO6 A;  4PAU A;  2H0Y A;  4WEL A;  5FI2 A;  1E3U A;  2ACG A;  5E2H A;  3IS2 A;  2JKG A;  4NKP A;  2BTF P;  1ERQ A;  1NRF A;  2WK0 A;  4LCL A;  5C5K A;  1NLY A;  4HHD A;  4MMN A;  4P6Z S;  1YLZ A;  3DBA A;  5AQB A;  4IHQ A;  5HDD A;  3LR4 A;  2P9V B;  3Q81 A;  1RGZ A;  3LR0 A;  1ZG6 A;  1YM1 A;  3NOU C;  4ID4 A;  3W4P A;  3VP4 A;  1T1C A;  4WYY A;  4U3T A;  3BW6 A;  5CEC A;  5EM0 A;  2VZW A;  2VEA A;  4OON A;  1K55 A;  3DWZ A;  4P6B A;  2QPN A;  1XJ4 A;  1LL9 A;  4OQG A;  3UMD A;  2XH9 A;  5FAP A;  4BL3 A;  3T1X A;  2L4R A;  3Q82 A;  4Y17 A;  4L0L A;  3S1Y A;  2ZC7 A;  3FKV A;  2HDS A;  1VET B;  2XEP A;  1YPR A;  3LGO A;  5GHY A;  4P87 A;  1LSW A;  1ES3 A;  1XGI A;  1D7E A;  3BEC A;  5GLD A;  3QP2 A;  3N8R A;  2HDU A;  2WYX A;  1V9Z A;  3SOI A;  3M2J A;  4L9E A;  1IOU A;  4GHI A;  2Y2K A;  4LGW A;  1YLT A;  2QJ5 A;  4PM6 A;  5EVL A;  3AGD A;  4GNU A;  4Z1W A;  1K56 A;  4H6J A;  2JC7 A;  4WZ4 A;  1BLS A;  3K2N A;  1G6A A;  3IH9 A;  4IED A;  3LFV A;  1OTD A;  2ZL1 A;  3ZDJ A;  1LSV A;  3TG9 A;  1BLC A;  3GR2 A;  4Q0H A;  4OQ0 A;  3FPV A;  3BJN A;  3CG5 A;  4ARZ B;  3LYX A;  2W3D A;  3IT9 A;  4GS9 A;  1SHV A;  4EW7 A;  3WS1 A;  3FV7 A;  2ZD8 A;  3BRM A;  3E2K A;  2D02 A;  5IU1 A;  1F5M A;  4R70 A;  4WMC A;  3T4K A;  2HP9 A;  4U0X A;  1FR1 A;  1TVF A;  2ZM2 A;  4PPR A;  4RQ9 A;  4MBK A;  2ZQ8 A;  4B4Z A;  1VHM A;  4MCW A;  3IXH A;  2WGI A;  3UY6 A;  1FQG A;  4IBR A;  1SZV A;  3VOL A;  3VSK A;  2Q9M A;  5HAP A;  4MEZ A;  3OLO A;  3T4Q A;  5KMW A;  3UE3 A;  2V1Z A;  1XJ3 A;  4KZ9 A;  4BBV A;  4Q8I A;  2PR5 A;  3KYZ A;  4Q0J A;  3A3D A;  4RA7 A;  3CPT B;  4LV0 A;  2WZX A;  1F98 A;  4FH2 A;  5A92 A;  3IHB A;  4JF5 A;  4K91 A;  4BBU A;  2O99 A;  3UDF A;  3VP0 A;  4KUO A;  2CMN A;  1DJC A;  1MC0 A;  4ETZ A;  5DTK A;  1S6R A;  2ZQD A;  1QMF A;  5HL1 A;  3W8K A;  1H5X A;  1LLB A;  4QB8 A;  4I3A A;  1EI5 A;  5EUA A;  4ZRR A;  5CGW A;  1PNE A;  4IVK A;  4ESP A;  5EOE A;  2QKP A;  2VV8 A;  2M1C A;  3BLS A;  1MXO A;  3B33 A;  3ZGA B;  3ZNT A;  2ZLY A;  1QME A;  2HPB A;  4HOI A;  3C4P A;  3T1R A;  4IBX A;  3G34 A;  3ZQ5 A;  5EFW A;  4XT2 A;  3LUQ A;  3PYP A;  4JKT A;  3DAV A;  1YKD A;  4GD8 A;  1NYM A;  5I5L A;  1T1A A;  4OP8 A;  4O01 A;  1E4D A;  3VFH A;  4FCF A;  2V8C A;  3LIF A;  4S2I A;  3NUL A;  2X01 A;  3V39 A;  3IXD A;  5HZH A;  3VE4 A;  4MN5 A;  3Q7V A;  2V9A A;  3GTC A;  3P7N A;  3CHW P;  4GN2 A;  4WEK A;  4BJP A;  1M40 A;  3GDI A;  5FI6 A;  2OV5 A;  4CLC E;  4GKU A;  2JKT M;  3C38 A;  4KZ6 A;  3SZT A;  1K6S A;  4JXS A;  4ZJ3 A;  3UB8 A;  2R9X A;  2Y2J A;  2XD1 A;  1MWU A;  2A24 A;  1CEG A;  2P08 A;  1L2S A;  3HLF A;  5FQM A;  1HTZ A;  5DF8 A;  5AQ9 A;  4MBH A;  1EWZ A;  3HJK A;  2KDK A;  4AFI A;  3UB5 P;  1E3U D;  3EEH A;  2ZQA A;  3QP8 A;  3IX4 A;  2Y59 A;  3BWL A;  4A5R A;  5DKL A;  2VGL S;  2EXA A;  3D4F A;  3DWK A;  4DDS A;  2XLN A;  4JXW A;  3IX8 A;  1S66 L;  1BLP A;  2JHE A;  1OJG A;  5FAO A;  2Y4A A;  4B93 A;  5CEB A;  1H8Z A;  3VOY A;  2JKR I;  3A0S A;  3IXB A;  4B88 A;  3LR5 A;  1KE4 A;  3FKW A;  4EWF A;  1PI4 A;  2RL3 A;  4S2N C;  5K5B A;  4EU0 A;  5U47 A;  2E8J A;  3PHY A;  2XA7 M;  5L10 A;  1YLP A;  2KOI A;  3MZE A;  5AQA A;  2CC1 A;  1OT9 A;  1N9N A;  1NLZ A;  4JGO A;  4E3N A;  2QHK A;  4WUJ A;  4EQI A;  1FIL A;  1F2K A;  1LI0 A;  1GSV A;  2PU2 A;  3P09 A;  4ZTK A;  1TS6 A;  4IJG A;  2XRN A;  1JVJ A;  3CZD A;  3HLW A;  1LL5 A;  4DJ3 A;  3TRC A;  5TJJ A;  1RCJ A;  1STZ A;  3T4J A;  4R3B A;  2Y2L A;  2WAE A;  4I38 A;  1JWZ A;  2AVX A;  3GV9 A;  1EW0 A;  3VP2 A;  2V8F A;  3S7O A;  1ES4 A;  5KSH A;  1N9B A;  4HP9 A;  2PYP A;  4X1M A;  4E3K A;  2W27 A;  3UDI A;  1FR6 A;  4DE2 A;  1K56 D;  1KE3 A;  3FC7 A;  3FZC A;  2Y2O A;  3C4O A;  1NJ4 A;  2INW A;  1DP6 A;  5EVI B;  2K2N A;  2QMI A;  3MS6 A;  3C2W A;  3F1P B;  2PT7 A;  1KVL A;  2M7V A;  3K3C A;  4G3W A;  2HDR A;  1TDG A;  3RH8 B;  4MLL A;  3ZG8 B;  3OOV A;  4OOY A;  3UB7 A;  1YSP A;  1OTB A;  5TBM A;  4WMC D;  4OLG A;  3C7V A;  3JVU A;  1P9R A;  1DRM A;  3U4L P;  1MWR A;  3ITB A;  3C8C A;  5HDS A;  4N1H A;  3HLC A;  3WS5 A;  4EXO A;  1PFL A;  1H0M A;  1N9O A;  5CTN A;  2PHY A;  1S1Z A;  4OLD A;  3T4S A;  1MKM A;  3BY9 A;  4R1G A;  3I7J A;  4S2P A;  5A8B A;  2DNS A;  4ZBE A;  3UE0 A;  1BYW A;  4JGQ A;  3O87 A;  3LR3 A;  3PXP A;  5FDH A;  3OC2 A;  4LPZ A;  2EWV A;  2XA7 S;  1OTE A;  3G32 A;  3IBR A;  3LCE A;  4M4X A;  3BEB A;  4B4X A;  4E3J A;  1TD5 A;  1T1B A;  4MBF A;  4HP4 A;  2Y8H A;  4GHI B;  1JWV A;  4LV2 A;  4R0Q A;  2EFU A;  1SDE A;  1CEF A;  1LL8 A;  3W4Q A;  4OOL A;  2EX8 A;  1GCE A;  2Y79 A;  3G2Z A;  5D3O A;  2ZC6 B;  4EEU A;  2J9O A;  4RYE A;  2JKF A;  2PD7 A;  3O88 A;  4ZDX A;  3R4K A;  4ZAM A;  1XGJ A;  2O9C A;  3IWI A;  5BOH A;  4CLC A;  5GHX A;  1XA7 A;  5FQK A;  1Y54 A;  5E2E A;  1C3B A;  1JTG A;  1MKI A;  4D2O A;  1K55 C;  3NJA A;  4R38 A;  4YFM A;  2Y2N A;  1YQS A;  3OPH A;  4GS9 B;  1H8M A;  4UAA A;  1CI9 A;  1BUE A;  4FH4 A;  3WS4 A;  2VV6 A;  4EBL A;  3HLB A;  3GVB A;  2J9P A;  5F1G A;  1KGF A;  3RFB A;  4JGP A;  4M3K A;  4LV1 A;  2QYB A;  5E2G A;  3Q1F A;  1BSG A;  5FL3 A;  5TR7 A;  1S4R A;  3M2K A;  1KVM A;  1ES2 A;  5E43 A;  2IWD A;  3HCY A;  3S7N A;  1HLU P;  4IVI A;  4FUW A;  5EV0 A;  1NZU A;  2Y2H A;  3EGD C;  4KZB A;  3ZVT A;  2WKQ A;  3BFG A;  4Q0I A;  5FEG A;  2QZ6 A;  4UQI M;  3N7W A;  3ZNY A;  5A90 A;  1ERO A;  3F1N B;  2W3G A;  4DXC A;  3E4O A;  1HVB A;  1SCW A;  3N6I A;  4S2L A;  3CIT A; 
#chains in the Genus database with same CATH homology
 2V1Z A;  3PAG A;  4BQM A;  4KZ9 A;  4C6Y A;  2Q9N A;  1IKG A;  3BYD A;  4JLF A;  4Q8I A;  3WWX A;  1WE4 A;  2ZJ9 A;  3MFD A;  3SS5 A;  1W7F A;  4KZ5 A;  5CGX A;  3VP3 A;  5EVI D;  1XP4 A;  5A93 A;  1IEL A;  2UWX A;  4QY6 A;  2WAF A;  3A3D A;  3AGE A;  2PU4 A;  4RA7 A;  4R3J A;  4LV0 A;  2WGW A;  3HLE A;  4C75 A;  2WZX A;  4X55 A;  1XXM A;  1FCM A;  3SS4 A;  4FH2 A;  3G30 A;  1L0E A;  1YMS A;  1KDW A;  5A92 A;  3IHB A;  4JF5 A;  4K91 A;  4YIN A;  1BZA A;  3UDF A;  5DF9 A;  3VP0 A;  3VMA A;  4OOM A;  3EQU A;  4FSF A;  1DJC A;  4DE3 A;  1FSY A;  4JXG A;  4KG2 A;  1S6R A;  4R23 A;  5CGS A;  5DTK A;  4KQQ A;  4KZ8 A;  2ZQD A;  2WKE A;  1MBL A;  2ZC3 B;  3BFF A;  1QMF A;  4UA9 A;  1K4F A;  5CHM A;  4DKI A;  3BLM A;  5HL1 A;  1O7E A;  2E8I A;  3W8K A;  4MNR A;  5J8X A;  1H5X A;  1I2S A;  4Y0U A;  1LLB A;  4QB8 A;  1EI5 A;  1RGY A;  3N4I A;  5EUA A;  3HBR A;  3A3E A;  4DXB A;  3RXW A;  4LV3 A;  5CGW A;  1K6R A;  1ALQ A;  1Z6F A;  2ZMA A;  5F83 A;  4IVK A;  3NDG A;  3G31 A;  1MWS A;  3IF6 B;  4KZA A;  1YLJ A;  5EPH A;  5EOE A;  4GDN A;  4Z9Q A;  2VGK A;  3MXR A;  3LO7 A;  4N9L A;  5F82 A;  1XPB A;  3ZG7 B;  1TDL A;  3CJM A;  2WGV A;  3BLS A;  1MXO A;  3Q7V B;  3A3I A;  3ZGA B;  2ZLY A;  3ZNT A;  1QME A;  2HPB A;  4KEN B;  2EFX A;  3C4P A;  5FQJ A;  3AGF A;  3Q07 A;  4IBX A;  4N9K A;  4S2K A;  4QHC A;  1S0W A;  2EX6 A;  3HUN A;  3SH7 A;  2H0T A;  2ZC5 B;  3G34 A;  5GLA A;  3VOZ A;  1BUL A;  3G2Y A;  4P85 A;  2FFY A;  2BLS A;  5AQ7 A;  4JKT A;  4XUX A;  1ESU A;  4ZJ2 A;  4C3Q A;  4GD8 A;  1NYM A;  1PYY A;  3OCN A;  3JYI A;  5HX9 A;  3BFC A;  4OP8 A;  4GDB A;  4DE1 A;  1E4D A;  3VFH A;  4FCF A;  4JBF A;  3IF6 A;  2J8Y A;  1TEM A;  4N1X A;  4S2I A;  4GB7 A;  3M6H A;  5FAT A;  4S2J A;  3P98 A;  2X01 A;  3V39 A;  3IXD A;  4PM9 A;  2WKH A;  1IEM A;  2HP6 A;  5FI7 A;  3ITA A;  1W8Q A;  3SS3 A;  1YLY A;  3RJU A;  3Q7V A;  3NCK A;  3NDE A;  2XF3 A;  3GRJ A;  3WS2 A;  2XQZ A;  3PBO A;  3PBT A;  3CMZ A;  1ERM A;  3GTC A;  4RX3 A;  1IYO A;  4QY5 A;  2XR0 A;  3NC8 A;  3SH9 A;  4GN2 A;  5CED A;  4WEK A;  4BJP A;  1M40 A;  5FI6 A;  2OV5 A;  1ESI A;  4GKU A;  1KDS A;  4QU3 A;  3UDX A;  4KZ6 A;  1K6S A;  1PWG A;  4JXS A;  5IHV A;  4ZJ3 A;  1SDN A;  1YLW A;  2R9X A;  2WGW B;  2Y2J A;  2WUQ A;  1GA9 A;  2XD1 A;  1I5Q A;  1MWU A;  1H8Y A;  1CEG A;  3IF6 C;  3ZG5 A;  1L2S A;  3HLF A;  5FQM A;  1HTZ A;  5GLC A;  3OPL A;  4S2N A;  1K38 A;  5DF8 A;  5DTT A;  1LI9 A;  5AQ9 A;  2HDQ A;  1EWZ A;  4MBH A;  4WEJ A;  1DJB A;  1PWC A;  2Y55 A;  1E3U D;  1CK3 A;  3MXS A;  3NIA A;  2ZQA A;  4JXV A;  1DJA A;  2Y2M A;  3HUO A;  3ZFZ A;  4PM7 A;  2Y59 A;  4A5R A;  4OQH A;  3ZVW A;  1ZKJ A;  3BFD A;  2EXA A;  5EVI A;  4EBN A;  4EV4 A;  1PZP A;  1FCN A;  2JCH A;  3D4F A;  5HAQ A;  1PW1 A;  3DWK A;  3IQA A;  4DDS A;  2XLN A;  5E2F A;  4JXW A;  4UA7 A;  2WAD A;  1BLH A;  4XUZ A;  2VGJ A;  1K4E A;  3QHY A;  3TSG A;  5DVA A;  4K0W A;  5F1F A;  4OH0 A;  1W8Y A;  1BLP A;  1GA0 A;  2HP5 A;  3IXG A;  5FAO A;  2Y4A A;  1GHP A;  3HRE A;  5CEB A;  1H8Z A;  2IWC A;  4K0X A;  3VOY A;  4CPK A;  3IXB A;  1K57 C;  4B88 A;  5I94 A;  1KE4 A;  3FKW A;  3UPO A;  2V2F F;  1GHI A;  1NYY A;  3C5A A;  4NK3 A;  5EOO A;  4EWF A;  1PI4 A;  2RL3 A;  5DF7 A;  4DE0 A;  2ZQC A;  3G35 A;  1ES5 A;  4S2N C;  2Z2M B;  2XGN A;  5CRF A;  3W4O A;  3ZG9 B;  4HES A;  3MKF A;  3UO9 A;  5U47 A;  2DRW A;  1XA1 A;  3GSG A;  4S2M A;  3MZD A;  5EE8 A;  3WRZ A;  1YLP A;  5HW3 A;  3MZE A;  3C7U A;  4JF4 A;  5EVI C;  4HBT A;  2CC1 A;  5AQA A;  1KE0 A;  5FAQ A;  5TGF A;  1VM1 A;  4E3N A;  2OLU A;  4QD4 A;  1W5D A;  3V3S A;  3FWL A;  1IYQ A;  1Q2Q A;  2H5S A;  2H10 A;  2Y91 A;  2P9V A;  5FAS A;  5TFQ A;  4EQI A;  1OME A;  4OVD A;  1PI5 A;  3QNC A;  1LI0 A;  2JE5 A;  1KGE A;  1M6K A;  4BD1 A;  2PU2 A;  3P09 A;  1WYC A;  4ZTK A;  1GHM A;  2ZQ9 A;  3OPP A;  3UNW A;  2XD5 A;  2ZM8 A;  1G68 A;  3IWQ A;  1BTL A;  5L2F A;  1I2W A;  1JVJ A;  3OPR A;  4PM8 A;  3CZD A;  3HLW A;  1LL5 A;  1RCJ A;  3V50 A;  2Y2P A;  1IKI A;  4WZ5 C;  1ONG A;  3GQZ A;  4GZB A;  3BFE A;  4Y0O A;  1XX2 A;  4CJN A;  1L0D A;  3HLG A;  1N4O A;  4R3B A;  5FQQ A;  2Y2L A;  2WAE A;  1JWZ A;  3O86 A;  2PBY A;  3V3R A;  3PBQ A;  1U60 A;  3DW0 A;  3GV9 A;  1PIO A;  3HLD A;  2Y2G A;  3VP2 A;  3HUM A;  4RVA A;  2XFT A;  5CHU A;  3B3X A;  1ES4 A;  2EX9 A;  5KSH A;  2OLV A;  5HAI A;  5CTM A;  1N9B A;  3PBN A;  3HL9 A;  3TOI A;  4E3K A;  2R9W A;  3UDI A;  3WS0 A;  1FR6 A;  1L0F A;  4KG5 A;  1K56 D;  1YMX A;  4DE2 A;  3Q7Z A;  1KE3 A;  3FZC A;  2XK1 A;  4LEN A;  2Y2O A;  3C4O A;  3M6B A;  1NJ4 A;  2GDN A;  3G4P A;  1MPL A;  2B5R A;  5EVI B;  5HFO A;  2I72 A;  4KZ3 A;  3NY4 A;  4KQO A;  2QMI A;  3MKE A;  1PW8 A;  3UN7 A;  1KVL A;  3LY3 A;  3VP1 A;  1IYS A;  2HDR A;  3IF5 A;  3PAE A;  4Y7P A;  4N92 A;  1PWD A;  1TDG A;  1JWP A;  1K57 A;  1FOF A;  1JTD A;  1BT5 A;  1XKZ A;  3S4X A;  3IH8 A;  4MLL A;  1J9M A;  2H0Y A;  3ZG8 B;  4DDY A;  3ISG A;  4WEL A;  5HAR A;  4OOY A;  5FI2 A;  1HZO A;  1E3U A;  5E2H A;  3OZH A;  4WMC D;  3ZCZ A;  1ERQ A;  4OLG A;  3C7V A;  4KZ7 A;  4DRT A;  1NRF A;  2WK0 A;  5CHJ A;  1MWR A;  4LCL A;  4BD0 A;  3ITB A;  1DY6 A;  3PBS A;  3V5M A;  5JYO A;  3LY4 A;  2BG1 A;  5DTS A;  4N1H A;  2J7V A;  4H8R A;  3HLC A;  3WS5 A;  1NY0 A;  1YLZ A;  5CTN A;  1ZG4 A;  4BL2 A;  4O7D A;  4OLD A;  3MZF A;  1E25 A;  4Y0T A;  3DTM A;  5AQB A;  1NZO A;  3HVF A;  4X56 A;  3UPN A;  4R1G A;  2P9V B;  3Q81 A;  4GD6 A;  5FA7 A;  3I7J A;  1PZO A;  1RGZ A;  1ZG6 A;  1K54 A;  4S2P A;  1YM1 A;  4E3L A;  4ID4 A;  3W4P A;  3BM6 A;  4X53 A;  3VP4 A;  4WYY A;  4KQR A;  4U3T A;  2XFS A;  5CEC A;  2DNS A;  3MBZ A;  4ZBE A;  3UE0 A;  1O07 A;  2A49 A;  2ZM0 A;  3O87 A;  4OON A;  1K55 A;  5FDH A;  3OC2 A;  4LCM A;  4KZ4 A;  4OPQ A;  3VFF A;  4BLM A;  3DWZ A;  4P6B A;  3O3V A;  3G32 A;  3NBL A;  4WZ5 A;  4OPR A;  2QPN A;  3LCE A;  3BEB A;  4S2O A;  2Y2I A;  3A3F A;  4B4X A;  4E3J A;  5EEC A;  4MBF A;  1JWV A;  1LL9 A;  5M18 A;  1SKF A;  2DCF A;  2XH9 A;  4LV2 A;  4OQG A;  5FAP A;  4R4S A;  4BL3 A;  5JYP A;  4PMA A;  4R0Q A;  4QJG A;  1Q2P A;  3Q82 A;  2EFU A;  1SDE A;  1CEF A;  4L0L A;  5FSR A;  2ZC7 A;  3FKV A;  4FD8 A;  4OOL A;  5GHZ A;  3S1Y A;  3W4Q A;  2EX8 A;  4JF6 A;  3NI9 A;  1GCE A;  5M19 A;  3G2Z A;  5D3O A;  2G2W A;  2ZC6 B;  2J9O A;  1LHY A;  2HDS A;  4RYE A;  5KZH A;  3O88 A;  4HBU A;  1K54 C;  2XDM A;  3PTE A;  2XEP A;  3UPP A;  4ZDX A;  4JPM A;  3SH8 A;  2C6W B;  4ZAM A;  5GHY A;  2Z2L B;  1XGJ A;  4P87 A;  3IWI A;  3RXX A;  5BOH A;  2FFF B;  3PBR A;  5GHX A;  1XA7 A;  5FQK A;  1AXB A;  1ES3 A;  1XGI A;  1Y54 A;  3BEC A;  1C3B A;  1JTG A;  1MKI A;  5E2E A;  5GLD A;  4D2O A;  1K55 C;  2WZZ A;  3N8R A;  5FQI A;  1HD8 A;  4YFM A;  4E3M A;  2ZC4 B;  2HDU A;  2WYX A;  2Y2N A;  1YQS A;  3IWO A;  3OPH A;  3SOI A;  3M2J A;  1CI8 A;  1MWT A;  1KGG A;  4UAA A;  1NXY A;  3LEZ A;  4UA6 A;  1CI9 A;  2Y2Q A;  2Y2K A;  5KSC A;  1BUE A;  3FYZ A;  1YLT A;  4OPY A;  4PM6 A;  1FSW A;  5EVL A;  3AGD A;  4FH4 A;  4GNU A;  1IYP A;  5CER A;  3ZHH A;  1FCO A;  1K56 A;  3E2L A;  2JBF A;  1RP5 A;  2A3U A;  1ZC2 A;  2JC7 A;  4WZ4 A;  1BLS A;  3WS4 A;  2ZQ7 A;  4EBL A;  1YT4 A;  3HLB A;  5M1A A;  3GVB A;  2J9P A;  1G6A A;  3IH9 A;  5F1G A;  4UHU A;  4IED A;  4WM9 A;  3WRT A;  1KGF A;  1ONH A;  3ZDJ A;  2X71 A;  3TG9 A;  3N8L A;  1BLC A;  3GR2 A;  4M3K A;  4LV1 A;  4OQ0 A;  5E2G A;  3Q1F A;  4E3O A;  4WBG A;  1BSG A;  4GOG A;  1K25 A;  2G2U A;  3CG5 A;  2WKI A;  5GLB A;  5TR7 A;  4F94 A;  2RCX A;  3M2K A;  1KVM A;  2EX2 A;  3IT9 A;  1WYB A;  1SHV A;  3EQV A;  1L0G A;  3WS1 A;  3S22 A;  1ES2 A;  3FV7 A;  2P74 A;  2ZD8 A;  5E43 A;  5A91 A;  3BRM A;  3E2K A;  4EBP A;  3VSL A;  4E6X A;  2IWD A;  4WMC A;  4OPZ A;  5CXW A;  2HP9 A;  3IHA A;  4U0X A;  4XXR A;  4IVI A;  1FR1 A;  2IWB A;  1MY8 A;  1TVF A;  2EXB A;  5G18 A;  4U0T A;  2ZM2 A;  3UE1 A;  4PPR A;  4E3I A;  1NZU A;  4R4R A;  2Y2H A;  4MBK A;  4EUZ A;  3OCL A;  4X68 A;  4X69 A;  2ZQ8 A;  4HEF A;  4OQI A;  4KG6 A;  4KZB A;  3ZVT A;  4B4Z A;  3QNB A;  4RX2 A;  4PM5 A;  2V20 A;  3BFG A;  3GMW A;  2X02 A;  2QZ6 A;  3IXH A;  5GL9 A;  2WGI A;  3A3J A;  3ZG0 A;  5FQ9 A;  3UY6 A;  1FQG A;  3N7W A;  3N8S A;  4IBR A;  4NET A;  3ZNY A;  5A90 A;  1ERO A;  3VSK A;  4BEN A;  2Q9M A;  4E6W A;  4DXC A;  2C5W B;  4MEZ A;  4OKP A;  5HAP A;  4X6T A;  4ZJ1 A;  1HVB A;  4OP5 A;  1VQQ A;  1SCW A;  3N6I A;  4DF6 A;  1W79 A;  2OSU A;  4P0M A;  5KMW A;  4S2L A;  3UE3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...