5GHYA

Crystal structure of beta-lactamase penp mutant-e166h in complex with cephaloridine as "post-acylation" intermediate
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
256
structure length
256
Chain Sequence
DDFAKLEEQFDAKLGIFALDTGTNRTVAYRPDERFAFASTIKALTVGVLLQQKSIEDLNQRITYTRDDLVNYNPITEKHVDTGMTLKELADASLRYSDNAAQNLILKQIGGPESLKKELRKIGDEVTNPERFHPELNEVNPGETQDTSTARALVTSLRAFALEDKLPSEKRELLIDWMKRNTTGDALIRAGVPDGWEVADKTGAASYGTRNDIAIIWPPKGDPVVLAVLSSRDKKDAKYDDKLIAEATKVVMKALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic Snapshots of Class A beta-Lactamase Catalysis Reveal Structural Changes That Facilitate beta-Lactam Hydrolysis
pubmed doi rcsb
source organism Bacillus licheniformis
molecule tags Hydrolase
molecule keywords Beta-lactamase
total genus 91
structure length 256
sequence length 256
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2016-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5ghyA00
1ALQA 1K54A 3SS4A 1RCJA 4OQHA 3IH9A 5HARA 2JCHA 1WYBA 4RX3A 3CZDA 5HX9A 2WKHA 4U3TA 3PAEA 4WYYA 5CEDA 1XGJA 3GMWA 4EBLA 3V39A 2P9VB 5A92A 4PM8A 1L0EA 3RJUA 3ITAA 2R9XA 1W79A 3WS0A 2WK0A 1FCOA 4WEJA 1O7EA 3HUMA 2XR0A 3N8SA 3UDIA 2Y2MA 3FYZA 1PIOA 5EE8A 3DTMA 3A3DA 2Q9MA 5DF7A 2ZLYA 2DCFA 5E2EA 3VFHA 3MZEA 4JXGA 4N9KA 5EVIB 4P87A 4XXRA 2ZQ9A 2RCXA 3Q7VB 4N1HA 5EECA 3FWLA 3PTEA 1LL5A 2WAFA 1I2WA 2WKIA 1ESIA 2Y2QA 4LCMA 4MLLA 3MKEA 4UA9A 4F94A 2H0YA 1YLJA 2HDUA 5M1AA 3HLCA 3BFGA 3A3JA 2WZXA 5G18A 5HL1A 1KVLA 4MEZA 4Y0OA 3E2LA 2ZM0A 1K57A 4YINA 4DE1A 4S2LA 4EBPA 4E3OA 2ZQAA 1LLBA 3ZNYA 3GQZA 3P09A 4GN2A 5CGSA 5HAQA 1NYMA 5GLDA 3B3XA 1JWVA 1YQSA 3HREA 3C4PA 4PM6A 5D3OA 5E2FA 5KSHA 4M3KA 1K6SA 4MNRA 3V3RA 3BRMA 2Y59A 1YLPA 3VSLA 4S2PA 2XEPA 3JYIA 3IXHA 5DVAA 1MWUA 2Y2KA 4OOYA 5IHVA 1MY8A 2R9WA 4LV1A 4OP8A 3Q82A 1Z6FA 2PU4A 4BD0A 4KZAA 1PW8A 3GRJA 3VOYA 3NY4A 4DE2A 3FZCA 3MZFA 3QNCA 4NETA 5CERA 3O88A 3C7UA 3ZVWA 2H5SA 4EBNA 4R4SA 3ZDJA 5FQ9A 5KSCA 3WS2A 1IYQA 1L0FA 4P0MA 4DF6A 4E6XA 1N9BA 3S4XA 4BLMA 4B4ZA 3GV9A 4FD8A 3QHYA 2XF3A 3IH8A 2Y2HA 1H5XA 1W5DA 1BLHA 1NJ4A 4OQIA 3NDEA 1BULA 4UA6A 1ES2A 3Q81A 4Y0UA 5FI2A 4A5RA 1FCNA 1JVJA 4R1GA 3W4PA 4BQMA 4BL2A 1MPLA 5HW3A 1BTLA 2WYXA 1XP4A 4WM9A 1YLWA 2XK1A 3BYDA 3BECA 4UHUA 4UAAA 1CI8A 1HVBA 1BSGA 2Y55A 3PBOA 3MFDA 4JKTA 1CI9A 2Y2OA 1G6AA 5DF8A 4PM5A 1EROA 2FFYA 3SH9A 1YLYA 4HESA 3GVBA 2ZC6B 3LO7A 4QB8A 3S22A 4ZJ1A 5M18A 4ZAMA 2B5RA 1HTZA 3HLWA 2EXBA 4S2IA 1PYYA 3NC8A 2Y2IA 5DTSA 3WS1A 5L2FA 4OVDA 2ZC3B 1CEFA 4MBFA 4CPKA 2EX2A 2QPNA 4LCLA 5FQMA 1BT5A 3UPPA 4DDSA 5AQ7A 4WZ4A 5CHUA 4KG6A 4HBUA 1PWCA 1IKGA 4X68A 3RXWA 1NYYA 2WZZA 3E2KA 1PWDA 3I7JA 1FCMA 3IHAA 3PBSA 2ZMAA 5TGFA 1FSWA 4PMAA 3UE3A 3BEBA 5FAQA 5GHXA 3WRZA 2ZD8A 4KZ3A 4O7DA 3VP2A 5GLCA 5CHJA 2XFTA 1HD8A 4KZ9A 3O3VA 3M2KA 3VFFA 3A3FA 2X01A 1BUEA 4E3NA 5FQKA 3IT9A 5CXWA 2HPBA 3NIAA 1M6KA 3HBRA 4LV0A 1JTGA 3OZHA 4JF4A 1K55C 4OLGA 5GLBA 2WGIA 3UO9A 1WE4A 1FOFA 3G30A 3AGFA 5DTKA 3ZG5A 1TDGA 3IF5A 3GR2A 3FV7A 5JYPA 1RP5A 2H10A 2ZQ8A 4R3JA 4WMCD 4WZ5A 3BLMA 4B4XA 3AGDA 5HFOA 1KDSA 2OV5A 1IYSA 3ITBA 1N4OA 1W7FA 1SCWA 1RGZA 1L2SA 1U60A 2WGWA 2Y2GA 3PBTA 4FSFA 4QY5A 5AQBA 2Y2PA 4OLDA 4KQOA 3G4PA 1YMSA 5JYOA 4JF5A 4K0XA 1K57C 3CG5A 1W8YA 4H8RA 1DJCA 4IVKA 2P9VA 5BOHA 1ES4A 5GHYA 1XA1A 5CRFA 3Q07A 2WAEA 3SS5A 1KE3A 2UWXA 3BFDA 3N8RA 4QU3A 4E3MA 1MXOA 1MKIA 2V20A 2V1ZA 5AQAA 1SDNA 3A3IA 3NBLA 3ISGA 2OLVA 4JXVA 4X56A 5EVIA 2OSUA 3SOIA 2Z2MB 4OONA 5FATA 5TFQA 3P98A 4C3QA 3Q7VA 2ZQDA 4DKIA 4S2OA 5A90A 3A3EA 4QHCA 1H8ZA 5F82A 4S2NA 4KZBA 1PI4A 1MWTA 1S6RA 3Q7ZA 4GDBA 4DE0A 1Q2PA 1XXMA 3IWIA 4E3KA 1MWSA 5EOEA 3OPPA 1I5QA 5F1GA 5FI6A 3MZDA 3UY6A 4XUZA 1KE4A 4OQ0A 4E3IA 3BLSA 4N1XA 4IEDA 4X69A 1L0GA 2Y4AA 1DJAA 1OMEA 2XLNA 3UE1A 4R3BA 5FQQA 4DXBA 4FH2A 4U0TA 3OCNA 1XGIA 1E3UA 1DJBA 1FR6A 2EX6A 3PBRA 4OPZA 1K25A 1GA9A 3C7VA 2JE5A 1NY0A 3O87A 3M6BA 2HDRA 3G2ZA 3OPHA 5EOOA 1QMEA 5F1FA 2PBYA 2VGJA 4K0WA 2ZC4B 2ZC5B 3BFEA 4XUXA 2HDSA 1BLPA 5A91A 5DF9A 3ZG8B 2WUQA 3G34A 5CTNA 2HDQA 4N92A 4ZJ2A 1IEMA 4U0XA 3SH7A 5FQIA 2ZQ7A 1BLSA 2G2UA 4OPRA 4LV3A 5FAOA 1TVFA 4PPRA 5GL9A 2HP5A 1YLTA 5FSRA 3M6HA 4GKUA 4K91A 5GLAA 1K54C 2Y2LA 1XX2A 3V50A 4N9LA 1YMXA 1FSYA 4E3LA 3C5AA 1GHIA 1ONGA 4S2MA 2FFFB 1ZC2A 3IXDA 2Y2JA 3GSGA 4X53A 3LCEA 2V2FF 4MBKA 3IF6A 2XDMA 2XQZA 5FASA 4DE3A 2P74A 1VM1A 3DW0A 3IWQA 4EUZA 4C6YA 1GA0A 1LI0A 4KZ6A 4R23A 4OP5A 1EI5A 1Q2QA 1IKIA 4OPQA 2EXAA 1K4FA 3NI9A 4JPMA 3WS4A 1GHMA 3HLDA 3RXXA 1LL9A 2BG1A 4DXCA 2XD1A 2VGKA 3N6IA 2H0TA 3ZGAB 1GCEA 4GB7A 4OQGA 2J8YA 1K6RA 3IHBA 5FA7A 3UN7A 2JC7A 1K56A 1BLCA 1O07A 1IYOA 5TR7A 4PM9A 1WYCA 3VSKA 3VMAA 3HLBA 4WEKA 4EV4A 1RGYA 3UDXA 2G2WA 2QZ6A 2IWBA 3OC2A 4FH4A 3ZNTA 5CEBA 1YT4A 4EWFA 4D2OA 3G2YA 4OKPA 5HAPA 3EQVA 1ERQA 5CECA 3OPRA 4ID4A 1NRFA 4S2NC 1Y54A 5CTMA 5EVIC 1HZOA 1ZKJA 4GDNA 2OLUA 5FQJA 3HUOA 3HL9A 3PBNA 4RX2A 2Y91A 3VP0A 5J8XA 1CK3A 1VQQA 3IQAA 1S0WA 4WMCA 1JWPA 4RVAA 5I94A 2C5WB 1C3BA 4Q8IA 1J9MA 4QY6A 2GDNA 3MXRA 3PBQA 2WGWB 3NCKA 4R0QA 2IWDA 1KDWA 4C75A 2IWCA 4P6BA 1KGFA 3M2JA 1SKFA 2HP6A 3CMZA 5HAIA 1K4EA 2J9OA 5EUAA 5F83A 4EQIA 4KG2A 4GD6A 5AQ9A 3ZCZA 5KMWA 4BL3A 5EVLA 2QMIA 3ZVTA 4WBGA 4IBXA 4OOLA 2J9PA 4S2JA 4WZ5C 1NZUA 4QD4A 5FAPA 2A49A 3GTCA 1ES3A 3OPLA 2Z2LB 4X55A 4BD1A 3HUNA 4QJGA 2BLSA 4R4RA 3ZG0A 1YLZA 5E43A 2CC1A 4KZ7A 5U47A 3UNWA 4RA7A 1PZOA 3VP3A 5A93A 3UE0A 1BZAA 3N8LA 4KZ8A 2Y2NA 1EWZA 1KE0A 1FQGA 1M40A 3LEZA 3TSGA 3ZFZA 1JWZA 4Y7PA 1I2SA 2Q9NA 2HP9A 3IWOA 3OCLA 2ZQCA 4UA7A 2E8IA 2EFXA 1XPBA 1E3UD 1SHVA 2ZJ9A 3D4FA 1ES5A 3FKVA 3G31A 5FDHA 3G35A 3MKFA 3IXBA 5E2GA 3MXSA 3VP1A 4DRTA 4ZJ3A 1E4DA 2JBFA 4KZ5A 3WWXA 1XA7A 3W4OA 1YM1A 2X71A 3ZHHA 2EFUA 3HVFA 4LV2A 4GD8A 2DNSA 1ERMA 3VP4A 1IYPA 1E25A 4KQQA 1LI9A 1W8QA 1KGGA 4ZBEA 2DRWA 1K55A 4GZBA 1ZG6A 4Z9QA 2PU2A 3V3SA 3VOZA 3O86A 5DTTA 1PWGA 5KZHA 3PAGA 3BM6A 2A3UA 4BJPA 1FR1A 3W4QA 4HEFA 3ZG7B 3TOIA 3UDFA 4S2KA 4IVIA 1AXBA 1SDEA 3BFCA 3ZG9B 1KVMA 3QNBA 4ZDXA 1PZPA 2RL3A 2XH9A 3NDGA 3IF6C 2WKEA 4BENA 1K56D 5EPHA 1G68A 4E3JA 1JTDA 4OH0A 4DDYA 1LHYA 3C4OA 4IBRA 5EVID 3HLGA 3CJMA 5CGXA 4KQRA 4KENB 3WRTA 4JLFA 1IELA 1TEMA 1NXYA 3HLEA 4JBFA 3FKWA 2EX8A 1CEGA 1DY6A 5M19A 1MBLA 1TDLA 4NK3A 2J7VA 1MWRA 3HLFA 3Q1FA 2I72A 2ZC7A 2XGNA 4PM7A 3IF6B 4CJNA 4E6WA 2C6WB 3TG9A 2EX9A 2XD5A 3N7WA 5CGWA 5GHZA 3MBZA 2XFSA 1GHPA 2ZM8A 4ZTKA 4HBTA 4B88A 4JXWA 4GOGA 3G32A 3DWKA 4GNUA 1QMFA 3LY4A 1PI5A 4LENA 4OOMA 5FI7A 4Y0TA 1K38A 2X02A 3N4IA 4JXSA 4WELA 3WS5A 1H8YA 3SH8A 3LY3A 4OPYA 4RYEA 1PW1A 2WADA 4P85A 3UPNA 1KGEA 3EQUA 1ZG4A 2ZM2A 1XKZA 3V5MA 1NZOA 4KZ4A 4YFMA 1L0DA 3UPOA 4JF6A 4FCFA 4KG5A 1ONHA 1ESUA 4MBHA 3IXGA 4X6TA 3BFFA 3AGEA 4L0LA 5CHMA 5E2HA 3SS3A 3DWZA 3W8KA 3S1YA 2WGVA
chains in the Genus database with same CATH superfamily
3SS4A 1RCJA 3IH9A 3D9YA 1WYBA 2WKHA 4EBLA 3C30A 3RJUA 2PAVP 1W79A 4YWZA 2WK0A 3UMEA 1FCOA 2ZL1A 4WEJA 3N8SA 3FPVA 3FYZA 3QP8A 3A3DA 2Q9MA 2PHYA 3LR5A 3VFHA 4N9KA 4XXRA 3E0YA 2O9AA 2PT7A 3PTEA 4NXEA 5KIZA 2HDUA 2I9VA 5G18A 1KVLA 4Y0OA 3E2LA 3CAXA 4EESA 1CQAA 3BQAA 2OWHA 5CGSA 2PD7A 3HREA 2QWSA 4G3KA 4PM6A 5KSHA 4M3KA 1DRMA 2Y59A 4ESPA 1YLPA 3BJNA 4LV1A 4CLCD 1PW8A 3DBAA 4DE2A 3C7UA 2H5SA 2JKRI 4EBNA 4R4SA 5AVFA 2H28A 4M4XA 5FQ9A 3LR3A 3MR0A 1N9BA 3IX8A 3GV9A 2Y2HA 1W5DA 4UA6A 1ES2A 5FI2A 1BTLA 2WYXA 1YLWA 3BYDA 2JHEA 4JKTA 2W3HA 2Y2OA 1D1JA 3F1NB 3SH9A 3U2AA 5HSQA 3LO7A 4NXGA 3S22A 3B42A 3IX3A 1PYYA 2VX8A 1S1YA 3C8CA 1CEFA 2QPNA 5L10A 5AQ7A 3MSHA 4KG6A 4IHQA 3IHAA 2ZMAA 3BEBA 4KZ3A 4O7DA 5CHJA 2XFTA 1HD8A 3NOPC 3VFFA 4PKYG 1LSXA 3T1XA 3ZYTA 5A8BA 3OZHA 4BWIA 3FV7A 2VK3A 1G6OA 2ZQ8A 4WMCD 4WZ5A 5K5BA 1KDSA 2JKTI 1IYSA 1N4OA 4FSFA 3KSFA 4KQOA 4LRZE 1YMSA 3E4QA 5GHYA 1S1ZA 5CRFA 3BFDA 4QU3A 4E3MA 4F3LB 1MKIA 4ZRRA 1EW0A 3A3IA 1ZHHB 4X56A 5EVIA 3ULFA 4C3QA 3P98A 4DKIA 5A90A 1AWIA 1A0KA 5F82A 4S2NA 4KZBA 1PI4A 5AVEA 3IWIA 3H9WA 2P08A 3LIFA 4XT2A 5HWVA 3GDIA 4IEDA 1OMEA 4K08A 4GHIA 4R3BA 4DXBA 2VA0A 1E3UA 4OPZA 3NULA 1GA9A 3NECA 4E04A 3R4KA 4QPRA 4Y3IA 1XJ3A 1ODVA 3M6BA 2HDRA 3G2ZA 4K0WA 3RFBA 2ZC4B 1SZVA 2ZC5B 4G3WA 2HDSA 4IJGA 4QWOA 3IBJA 1Y4OA 4R38A 4ZJ2A 1OTEA 4U0XA 3RTYA 1TVFA 4PPRA 5FSRA 1X0OA 1K54C 1P0ZA 4YNRA 4X53A 3UB5P 2V2FF 3VE4A 4GLQA 5FASA 4DE3A 4NG2A 2OAP1 3IWQA 4C6YA 1Q2QA 4R6LA 3WS4A 4P6ZM 2BG1A 2NUPC 3P01A 1IYOA 1T1BA 1MKMA 4ARZB 1RGYA 3A0RA 4CQHA 2QZ6A 4EWFA 3EQVA 4EXOA 1ERQA 3T4TA 4S2NC 2E8JA 1V9ZA 1OTDA 3QP2A 2W1RA 3HUOA 4RX2A 1IFQA 3VP0A 3IQAA 1P9RA 1S0WA 3MXQA 3UB8A 3P7NA 4RVAA 2B18A 2IWDA 3T4QA 2HP6A 3T4JA 4KG2A 4GD6A 5EVLA 2J3WA 3T12B 3PR6A 4OOLA 4S2JA 4UQIS 4QD4A 4BD1A 4JGQA 4LPZA 4HJ6A 3UB7A 4QJGA 2BLSA 1F98A 3ZG0A 1YLZA 3UNWA 1PZOA 2DMWA 1BZAA 3N8LA 2B95A 2Y2NA 2JKTM 1M40A 4Y7PA 2E8IA 3SW1A 2Y8HA 1SHVA 4X1LA 5E2GA 4JGRA 3E98A 1H8MA 3GECA 3W4OA 1YM1A 2EFUA 3VP4A 3VV4A 3SZTA 4GZBA 2PU2A 1G28A 1HLUP 4S2KA 4IVIA 4EU0A 4ZDXA 2XH9A 3LI9A 2QJ7A 3PHYA 4KUKA 4E3JA 2VGLS 2VKSA 5EVID 2GX5A 4YOFA 4KENB 4BMWA 3IS2A 1MBLA 5M19A 2J7VA 1MWRA 5FEGA 4RQ9A 2QKPA 3TG9A 1VEUB 3KSHA 4JXWA 2R78A 1K38A 3BQ8A 1H8YA 3HCYA 3SH8A 1PW1A 4P85A 1KGEA 3EQUA 2W3DA 1NZOA 2B02A 3U4LP 3UPOA 4JF6A 4FCFA 5TBMB 3T1RA 4Q0JA 1V9YA 3CZDA 5CEDA 3GMWA 4DMZA 3V39A 2P9VB 5A92A 4PM8A 2CMNA 3WS0A 3QP5A 3HUMA 1XFQA 4LLOB 4F3LA 1PIOA 3KYEA 5EE8A 4HY8A 4I3IA 5DF7A 2DCFA 3MZEA 2RCXA 3Q7VB 5EECA 1LL5A 2PR6A 4GCZA 2WKIA 1ESIA 4MLLA 2ZBBA 2H0YA 5M1AA 3HLCA 4UQIM 3BFGA 4GW9A 4MEZA 1D7EA 4DE1A 3MMHA 3MFXA 3ZNYA 3P09A 4GN2A 2Z6DA 1SKOA 1PRQA 3ZQ5A 5D3OA 4MNRA 1K6SA 3V3RA 3OBFA 2XEPA 3JYIA 3IXHA 5DVAA 2Y2KA 3JVUA 1TS7A 2K2NA 2J3TD 2WKPA 3GRJA 3PYPA 5HZHA 4NETA 5DFXA 1OJGA 1NWZA 5MC7A 3WS2A 4E6XA 4BLMA 2JKFA 2PYRA 1BULA 3ICYA 3HJKA 3W4PA 4PAUA 4BQMA 5HW3A 4BBVA 2W0NA 4UHUA 1CI8A 1W63Q 1HVBA 1BSGA 4HHDA 2Y55A 3PBOA 1CI9A 4PM5A 1EROA 2FFYA 4HESA 3GVBA 5M18A 2EXBA 4S2IA 3NC8A 2Y2IA 5L2FA 4HP9A 4O8GA 4OVDA 5HPIA 4MBFA 1BT5A 4DDSA 4WZ4A 1PWCA 3E2KA 3PBSA 4ARZA 3HJIA 1UWPX 4HJ4A 5FAQA 2YKHA 5GHXA 3DTKA 4KZ9A 5C5KA 3A3FA 2X01A 3IT9A 5CXWA 3EOIA 3HBRA 4JF4A 1H3QA 3UO9A 1VHMA 3GR2A 3FG8A 3R7WA 4LRYC 4B4XA 5HFOA 1FILA 2OV5A 3MQOA 3ITBA 1W7FA 2WGWA 1L2SA 5AQBA 3G4PA 5JYOA 4JF5A 1DJCA 2LB9A 3UB6A 1G5UA 2O9CA 2UWXA 3FPWA 3S7NA 2V1ZA 1SDNA 5DJTA 1T18A 4JXVA 2OSUA 1LL8A 2HV1A 4OONA 3A3EA 1S6RA 1OTBA 3CITA 1Q2PA 1XXMA 1MWSA 4MCWA 3T1SA 2XRNA 4G3VA 5F1GA 5L09A 2G7UA 4WL9A 3F1OB 4OQ0A 4E3IA 1FIKA 1BYWA 1LT0A 1DJAA 1SKOB 5FQQA 4D60A 4FH2A 1D06A 3MS6A 3PBRA 1K25A 3C7VA 1LSVA 1OTIA 1GSWA 4FOFA 5EOOA 1QMEA 3T1QB 3E4PA 5F1FA 2VGJA 5HPFA 4XUXA 5DF9A 2WUQA 1BLSA 5FAOA 4ETZA 5GL9A 5EVEA 3M6HA 4GKUA 5GLAA 3V50A 2KOIA 1FSYA 2O9BA 3IS2B 2Q0OA 2PRFA 4MBKA 1VETA 3IF6A 3LGOA 1W63M 2P74A 5DFYA 1VM1A 4I5SA 1PFLA 3OOVA 4KZ6A 1EI5A 1IKIA 3KO6A 2EXAA 1K4FA 3UMDA 1GHMA 1LL9A 4DXCA 2VGKA 2H0TA 1DP9A 1GCEA 1NRJA 2J8YA 3UN7A 2K7SA 1O07A 3E4OA 3KSIA 1WYCA 3MF0A 3VSKA 3CLOA 4FH4A 4PHTA 4D2OA 3G2YA 5HAPA 1F2KA 2W3GA 1NRFA 2O99A 1Y54A 5EVIC 2JKRM 2ZOIA 2OLUA 5FQJA 5DJUA 3HL9A 1VQQA 1JWPA 4LFUA 3CUEC 2C5WB 4Q8IA 1YPRA 4R3AA 4QY6A 2GDNA 3W2ZA 1KOUA 1K4EA 5F83A 2V8FA 5AQ9A 5KMWA 4BL3A 2QMIA 3ZVTA 2J9PA 1YKDA 2VEAA 4WZ5C 3GTCA 1ES3A 2Z2LB 4WLAA 4GS9B 4P6ZS 5E43A 2CC1A 2W1TA 5U47A 3VP3A 5A93A 3F1PB 1EWZA 1FQGA 3TSGA 3ZFZA 3LEZA 1I2SA 2ZQCA 2WKQA 1ES5A 5FDHA 3G35A 3MKFA 3F1OA 3IXBA 3VP1A 4ZJ3A 2XSSA 3ZHHA 4LV2A 2HF6A 3MQ0A 1ERMA 4HQAA 1E25A 4KQQA 1LI9A 1KGGA 4ZBEA 1T19A 2A24A 4Z9QA 3V3SA 2A3UA 1FR1A 4HEFA 4HH3A 1UWNX 2FZ0A 3ZG9B 4NXBA 2RL3A 3OLOA 2KDKA 2WKEA 5FL3A 4BENA 5EPHA 1G68A 3C38A 1JTDA 1LHYA 2VJWA 3C4OA 4R70A 3CJMA 2ZMVA 5CGXA 4KQRA 3WRTA 4MN7A 4Y2FA 4JBFA 3FKWA 2EX8A 5LBRA 3HLFA 5EM0A 1TS0A 3LUQA 1VETB 4CJNA 4E6WA 2C6WB 3N7WA 5CGWA 2VZWA 2XFSA 1GHPA 4LENA 3S7PA 4OOMA 5I5LA 2X02A 2UV0E 1GSVA 1TS8A 3WS5A 4RYEA 3KYQA 4KZ4A 1L0DA 4EETB 5J3WA 5E2HA 3SS3A 2VV8A 4OQHA 1DP6A 1F9IA 4U3TA 3CPTB 5EFWA 4WYYA 1PNEA 1XGJA 4WF0A 3ITAA 1JNUA 2XR0A 5J4EA 1K0KA 1J3WA 4JXGA 5EVIB 5IU1A 3TRCA 2V8CA 3NHQA 3FWLA 2WAFA 2Y2QA 1TF1A 3EGDC 4I3AA 3A3JA 2WZXA 2ZM0A 1K57A 4XT2B 4YINA 4S2LA 3GQZA 3L9KA 2NUTC 5DKLA 5GLDA 3B3XA 5HWTA 1YQSA 5E2FA 1CJFA 3VSLA 4S2PA 5IHVA 4OOYA 3IBRA 3Q82A 4H6JB 2PU4A 4BD0A 5EV0A 3FZCA 5CERA 3O88A 3ZVWA 2D01A 4GJ4A 1IYQA 2J3TC 4FD8A 2A24B 3QHYA 2XF3A 1NJ4A 2K31A 3H7WB 4A5RA 4R1GA 4BL2A 1MPLA 1XP4A 4KQDA 2XK1A 3CI6A 4EQ1A 5F68A 3MFDA 2Z6CA 1G6AA 5DF8A 2FH5A 4ZJ1A 1OT6A 4ZAMA 1HTZA 3HLWA 5L8MA 4B93A 2ZC3B 4CPKA 3UPPA 2HGVA 2V0WA 1VEUA 4Y13A 4HBUA 4HI4A 1IKGA 2EWWA 3QP1A 3I7JA 1FCMA 3V67A 1FSWA 2ZD8A 1LSWA 1S66L 2INWA 3VP2A 5HDSA 1BUEA 5FQKA 1M6KA 4LV0A 4OLGA 1JTGA 1K55C 1L3LA 1MC0A 5G4YA 4L9EA 1WE4A 1FOFA 3G30A 3AGFA 3IF5A 3NOUC 5F69A 1RP5A 3BLMA 1N9LA 3V5MA 1RGZA 2Y2GA 4QY5A 3O5YA 4OLDA 5F5YA 4K0XA 3MJQA 3CG5A 4IVKA 2GZAA 1XA1A 3B47A 5F6AA 3LIEA 3SS5A 2ZL1B 3JPUA 3N8RA 1N9OA 1MXOA 3K3CA 3NBLA 1DP8A 2AVXA 3ISGA 4GS9A 2D02A 2W1TB 1OTAA 3Q7VA 2ZQDA 3F1PA 3LEQA 1MWTA 5IS1A 4O0PA 4GDBA 3NOTC 4I39A 4FTXA 1I5QA 3UY6A 1KE4A 3KSGA 1NLZA 3T4OA 4X69A 2ZMFA 3UE1A 3KYZA 4L9GA 4O01A 3OPHA 4LRXC 1BLPA 5A91A 3ZG8B 3G34A 4MDZA 2HDQA 1IEMA 2O0YA 4LV3A 4X1MA 2J80A 1H0MA 3CWFA 2W3FA 2PBDP 3H7WA 1YMXA 4E3LA 3IX4A 5HD5A 3C5AA 1ONGA 2FFFB 1ZC2A 3IXDA 3GSGA 3LCEA 4PKYA 4DJ2A 3UE6A 4HJ3A 4EUZA 2M7UA 1GA0A 1LI0A 4OP5A 4OPQA 4JPMA 4B9OA 3LICA 4GB7A 4MN5A 1K6RA 2JC7A 3K3DA 5TR7A 4PM9A 2MJ6A 1T1AA 3UDXA 2IWBA 3OC2A 4ME4A 1YT4A 4WUJA 4HIAA 4I3JA 1OPXA 4CLCC 1VB6A 1HZOA 5J8XA 5I94A 1C3BA 2XA7S 1J9MA 3MXRA 2V9AA 2WGWB 4R0QA 2IWCA 1KGFA 3M2JA 4MMNA 2J9OA 5EUAA 4EQIA 2XROA 5AJGA 4HP4A 4WBGA 1NZUA 4X55A 3OPLA 3C2WA 3HUNA 1TD5A 3TE8A 3UE0A 3T50A 1S4RA 2Q9NA 3IWOA 3OCLA 1XPBA 2W27A 2ZJ9A 3FKVA 3G31A 2L0WA 2P04A 2P7JA 4DRTA 1E4DA 2JBFA 4KZ5A 2X71A 3HVFA 2DNSA 1IYPA 1P9WA 1PWGA 2VV7A 3TW8A 3PXPA 3W4QA 3ZG7B 3UDFA 3BFCA 1SDEA 1OJ5A 3QNBA 3NDGA 2IA2A 3IF6C 3RH8B 1K56D 3LIAA 3T4SA 2OWJA 4WN5A 4OH0A 4JLFA 4Y5FA 1NXYA 1CEGA 1DY6A 2I72A 5EM1A 2XGNA 2EX9A 2L4RA 4ETXA 4HNBA 5IT5A 3MBZA 3BY8A 3LIBA 3QP4A 4GOGA 3G32A 1QMFA 1PI5A 1XJ6A 4JXSA 3LY3A 2WADA 4CLCA 1XKZA 4EW7A 4YFMA 1P97A 1ONHA 2LB5A 1ESUA 4MBHA 4X6TA 3A0VA 3AGEA 5CHMA 3W8KA 3BECA 2WGVA 1ALQA 1K54A 1Y28A 5HARA 2JCHA 4FUWA 4RX3A 5HX9A 3PAEA 2M7VA 1L0EA 2R9XA 3JVVA 1O7EA 3UDIA 2Y2MA 5DKKA 3BWLA 2XA7M 4AFIA 1WA9A 3DTMA 2ZLYA 5E2EA 4P87A 3DAVA 2ZQ9A 4N1HA 3VE3A 1I2WA 2EWVA 3EGXC 4LCMA 1CF0A 1YSQA 3MKEA 4UA9A 4F94A 1YLJA 5J7EA 5HL1A 3DTEA 5G4ZA 3LR0A 4EBPA 1ACFA 4E3OA 2ZQAA 1LLBA 1S4SA 4CLCE 5HAQA 1NYMA 1JWVA 3C4PA 4GHIB 1YAXA 2V1AA 3BRMA 1MWUA 1MY8A 2R9WA 3H82B 4OP8A 1Z6FA 5FEFA 4KZAA 2ZOHA 2HJEA 3VOYA 3NY4A 3MZFA 3QNCA 3LR4A 3ZDJA 5KSCA 1STZA 1L0FA 4P0MA 2PD8A 4DF6A 4EEUA 3S4XA 5L07A 4B4ZA 3IH8A 1H5XA 1BLHA 4OQIA 3NDEA 4Y0UA 3Q81A 2V0UA 1FCNA 1JVJA 4HH2A 4WM9A 2GJ3A 4UAAA 4X25A 3K2NA 1IOUA 3LIDA 1YLYA 2ZC6B 3BW6A 4QB8A 2VGLM 2QYBA 3DTIA 4DJ3A 2B5RA 1TS6A 5DTSA 3WS1A 5FDSA 2EX2A 4II7A 4Q0HA 4LCLA 5FQMA 3T4KA 5CHUA 4X68A 3RXWA 1NYYA 2WZZA 1PWDA 5TGFA 4PMAA 3UE3A 3WRZA 5GLCA 2L1MA 4LGWA 3O3VA 3M2KA 4E3NA 4EEPA 1UGUA 1YSPA 4IUKA 2HPBA 3NIAA 3A0SA 5GLBA 2WGIA 5TBMA 2WKRA 3QP6A 5DTKA 3ZG5A 1TDGA 4BBUA 5JYPA 2H10A 4R3JA 3AGDA 1N9NA 4EERA 1SCWA 1U60A 3PBTA 2Y2PA 1K57C 3CPTA 1W8YA 4H8RA 3L7HA 2P9VA 3D3OA 5BOHA 1ES4A 5HWWA 3Q07A 1GSXA 2WAEA 5CX7A 1KE3A 5AQAA 2V20A 1XFNA 2YKFA 2OLVA 4L9FA 3SOIA 2Z2MB 5FATA 5TFQA 4S2OA 4QHCA 2PDRA 1H8ZA 1F5MA 3Q7ZA 1XJ4A 4DE0A 2JN7A 2OAQ1 4E3KA 5EOEA 3OPPA 5FI6A 1MZUA 3MZDA 4XUZA 3BLSA 4N1XA 4NEED 1L0GA 2Y4AA 1ZTUA 2XLNA 4U0TA 2PR5A 3OCNA 1XGIA 1FR6A 1DJBA 4KUOA 2EX6A 2JE5A 1NLYA 1NY0A 3O87A 3CHWP 2BASA 2EA9A 3B33A 2PBYA 2A2LA 3BFEA 5CTNA 4N92A 3EWKA 5HDDA 3SH7A 5FQIA 3G6OA 2G2UA 2ZQ7A 4OPRA 2HP5A 1YLTA 4K91A 2Y2LA 1T1CA 1XX2A 4N9LA 2HJ9C 1GHIA 2OOLA 4S2MA 2Y2JA 2XDMA 2XQZA 3F1NA 3DW0A 4JGOA 4EUVA 2KX6A 4NKPA 4R23A 2V1BA 3NI9A 3HLDA 3RXXA 2HZ5A 3EEAA 2XD1A 3N6IA 4NXFA 3ZGAB 5TJJA 4OQGA 3IHBA 5FA7A 4CLCB 1K56A 1BLCA 3VMAA 3HLBA 5HL6A 4WEKA 4IUHA 4EV4A 2G2WA 3CUEA 3ZNTA 5CEBA 3BY9A 4OKPA 2VLGA 2KLIA 5CECA 3OPRA 4ID4A 5CTMA 1ZKJA 4Y17A 4GDNA 2BTFP 3PBNA 2Y91A 3R7WB 1CK3A 4WMCA 3PBQA 3NCKA 1KDWA 4C75A 4P6BA 1SKFA 3CMZA 5HAIA 1XJ2A 4UEYA 3ZCZA 2M1CA 4IBXA 5FAPA 2A49A 4I38A 1S67L 4R4RA 4KZ7A 4RA7A 5HDCA 4KZ8A 4JGPA 1KE0A 1JWZA 5HD3A 2HP9A 4Q0IA 4UA7A 2EFXA 3S7OA 1E3UD 3D4FA 3H82A 4H6JA 1OT9A 3LI8A 3MQQA 3LYXA 3MXSA 3WWXA 1XA7A 3KX0X 3UB9A 4GD8A 4DN0A 3EEHA 1W8QA 2DRWA 1K55A 1ZG6A 3VOZA 5KZHA 3O86A 5DTTA 3PAGA 4Y15A 3BM6A 4BJPA 3TOIA 1AXBA 1KVMA 1PZPA 2QHKA 3T4LA 4DDYA 4IBRA 4Z1WA 3HLGA 2Y79A 2ACGA 1IELA 1TEMA 3HLEA 3S7QA 2GNXA 1TDLA 4NK3A 3Q1FA 3LFVA 2ZC7A 4PM7A 3IF6B 2W3EA 2XD5A 5GHZA 4BBTA 4ZTKA 2ZM8A 4HBTA 4B88A 4HOIA 3NJAA 4GNUA 5FI7A 3DWKA 2QJ5A 3LY4A 4Y0TA 3N4IA 4WELA 4OPYA 3UPNA 2JKGA 1ZG4A 2ZM2A 3D72A 3FC7A 4KG5A 2PYPA 3IXGA 3VOLA 1Z09A 2VV6A 4MN6A 3BFFA 3TJZC 4L0LA 3DWZA 3S1YA
chains in the Genus database with same CATH topology
1ALQA 1K54A 3SS4A 1RCJA 4OQHA 3IH9A 5HARA 2JCHA 1WYBA 4RX3A 3CZDA 5HX9A 2WKHA 4U3TA 3PAEA 4WYYA 5CEDA 1XGJA 3GMWA 4EBLA 3V39A 2P9VB 5A92A 4PM8A 1L0EA 3RJUA 3ITAA 2R9XA 1W79A 3WS0A 2WK0A 1FCOA 4WEJA 1O7EA 3HUMA 2XR0A 3N8SA 3UDIA 2Y2MA 3FYZA 1PIOA 5EE8A 3DTMA 3A3DA 2Q9MA 5DF7A 2ZLYA 2DCFA 5E2EA 3VFHA 3MZEA 4JXGA 4N9KA 5EVIB 4P87A 4XXRA 2ZQ9A 2RCXA 3Q7VB 4N1HA 5EECA 3FWLA 3PTEA 1LL5A 2WAFA 1I2WA 2WKIA 1ESIA 2Y2QA 4LCMA 4MLLA 3MKEA 4UA9A 4F94A 2H0YA 1YLJA 2HDUA 5M1AA 3HLCA 3BFGA 3A3JA 2WZXA 5G18A 5HL1A 1KVLA 4MEZA 4Y0OA 3E2LA 2ZM0A 1K57A 4YINA 4DE1A 4S2LA 4EBPA 4E3OA 2ZQAA 1LLBA 3ZNYA 3GQZA 3P09A 4GN2A 5CGSA 5HAQA 1NYMA 5GLDA 3B3XA 1JWVA 1YQSA 3HREA 3C4PA 4PM6A 5D3OA 5E2FA 5KSHA 4M3KA 1K6SA 4MNRA 3V3RA 3BRMA 2Y59A 1YLPA 3VSLA 4S2PA 2XEPA 3JYIA 3IXHA 5DVAA 1MWUA 2Y2KA 4OOYA 5IHVA 1MY8A 2R9WA 4LV1A 4OP8A 3Q82A 1Z6FA 2PU4A 4BD0A 4KZAA 1PW8A 3GRJA 3VOYA 3NY4A 4DE2A 3FZCA 3MZFA 3QNCA 4NETA 5CERA 3O88A 3C7UA 3ZVWA 2H5SA 4EBNA 4R4SA 3ZDJA 5FQ9A 5KSCA 3WS2A 1IYQA 1L0FA 4P0MA 4DF6A 4E6XA 1N9BA 3S4XA 4BLMA 4B4ZA 3GV9A 4FD8A 3QHYA 2XF3A 3IH8A 2Y2HA 1H5XA 1W5DA 1BLHA 1NJ4A 4OQIA 3NDEA 1BULA 4UA6A 1ES2A 3Q81A 4Y0UA 5FI2A 4A5RA 1FCNA 1JVJA 4R1GA 3W4PA 4BQMA 4BL2A 1MPLA 5HW3A 1BTLA 2WYXA 1XP4A 4WM9A 1YLWA 2XK1A 3BYDA 3BECA 4UHUA 4UAAA 1CI8A 1HVBA 1BSGA 2Y55A 3PBOA 3MFDA 4JKTA 1CI9A 2Y2OA 1G6AA 5DF8A 4PM5A 1EROA 2FFYA 3SH9A 1YLYA 4HESA 3GVBA 2ZC6B 3LO7A 4QB8A 3S22A 4ZJ1A 5M18A 4ZAMA 2B5RA 1HTZA 3HLWA 2EXBA 4S2IA 1PYYA 3NC8A 2Y2IA 5DTSA 3WS1A 5L2FA 4OVDA 2ZC3B 1CEFA 4MBFA 4CPKA 2EX2A 2QPNA 4LCLA 5FQMA 1BT5A 3UPPA 4DDSA 5AQ7A 4WZ4A 5CHUA 4KG6A 4HBUA 1PWCA 1IKGA 4X68A 3RXWA 1NYYA 2WZZA 3E2KA 1PWDA 3I7JA 1FCMA 3IHAA 3PBSA 2ZMAA 5TGFA 1FSWA 4PMAA 3UE3A 3BEBA 5FAQA 5GHXA 3WRZA 2ZD8A 4KZ3A 4O7DA 3VP2A 5GLCA 5CHJA 2XFTA 1HD8A 4KZ9A 3O3VA 3M2KA 3VFFA 3A3FA 2X01A 1BUEA 4E3NA 5FQKA 3IT9A 5CXWA 2HPBA 3NIAA 1M6KA 3HBRA 4LV0A 1JTGA 3OZHA 4JF4A 1K55C 4OLGA 5GLBA 2WGIA 3UO9A 1WE4A 1FOFA 3G30A 3AGFA 5DTKA 3ZG5A 1TDGA 3IF5A 3GR2A 3FV7A 5JYPA 1RP5A 2H10A 2ZQ8A 4R3JA 4WMCD 4WZ5A 3BLMA 4B4XA 3AGDA 5HFOA 1KDSA 2OV5A 1IYSA 3ITBA 1N4OA 1W7FA 1SCWA 1RGZA 1L2SA 1U60A 2WGWA 2Y2GA 3PBTA 4FSFA 4QY5A 5AQBA 2Y2PA 4OLDA 4KQOA 3G4PA 1YMSA 5JYOA 4JF5A 4K0XA 1K57C 3CG5A 1W8YA 4H8RA 1DJCA 4IVKA 2P9VA 5BOHA 1ES4A 5GHYA 1XA1A 5CRFA 3Q07A 2WAEA 3SS5A 1KE3A 2UWXA 3BFDA 3N8RA 4QU3A 4E3MA 1MXOA 1MKIA 2V20A 2V1ZA 5AQAA 1SDNA 3A3IA 3NBLA 3ISGA 2OLVA 4JXVA 4X56A 5EVIA 2OSUA 3SOIA 2Z2MB 4OONA 5FATA 5TFQA 3P98A 4C3QA 3Q7VA 2ZQDA 4DKIA 4S2OA 5A90A 3A3EA 4QHCA 1H8ZA 5F82A 4S2NA 4KZBA 1PI4A 1MWTA 1S6RA 3Q7ZA 4GDBA 4DE0A 1Q2PA 1XXMA 3IWIA 4E3KA 1MWSA 5EOEA 3OPPA 1I5QA 5F1GA 5FI6A 3MZDA 3UY6A 4XUZA 1KE4A 4OQ0A 4E3IA 3BLSA 4N1XA 4IEDA 4X69A 1L0GA 2Y4AA 1DJAA 1OMEA 2XLNA 3UE1A 4R3BA 5FQQA 4DXBA 4FH2A 4U0TA 3OCNA 1XGIA 1E3UA 1DJBA 1FR6A 2EX6A 3PBRA 4OPZA 1K25A 1GA9A 3C7VA 2JE5A 1NY0A 3O87A 3M6BA 2HDRA 3G2ZA 3OPHA 5EOOA 1QMEA 5F1FA 2PBYA 2VGJA 4K0WA 2ZC4B 2ZC5B 3BFEA 4XUXA 2HDSA 1BLPA 5A91A 5DF9A 3ZG8B 2WUQA 3G34A 5CTNA 2HDQA 4N92A 4ZJ2A 1IEMA 4U0XA 3SH7A 5FQIA 2ZQ7A 1BLSA 2G2UA 4OPRA 4LV3A 5FAOA 1TVFA 4PPRA 5GL9A 2HP5A 1YLTA 5FSRA 3M6HA 4GKUA 4K91A 5GLAA 1K54C 2Y2LA 1XX2A 3V50A 4N9LA 1YMXA 1FSYA 4E3LA 3C5AA 1GHIA 1ONGA 4S2MA 2FFFB 1ZC2A 3IXDA 2Y2JA 3GSGA 4X53A 3LCEA 2V2FF 4MBKA 3IF6A 2XDMA 2XQZA 5FASA 4DE3A 2P74A 1VM1A 3DW0A 3IWQA 4EUZA 4C6YA 1GA0A 1LI0A 4KZ6A 4R23A 4OP5A 1EI5A 1Q2QA 1IKIA 4OPQA 2EXAA 1K4FA 3NI9A 4JPMA 3WS4A 1GHMA 3HLDA 3RXXA 1LL9A 2BG1A 4DXCA 2XD1A 2VGKA 3N6IA 2H0TA 3ZGAB 1GCEA 4GB7A 4OQGA 2J8YA 1K6RA 3IHBA 5FA7A 3UN7A 2JC7A 1K56A 1BLCA 1O07A 1IYOA 5TR7A 4PM9A 1WYCA 3VSKA 3VMAA 3HLBA 4WEKA 4EV4A 1RGYA 3UDXA 2G2WA 2QZ6A 2IWBA 3OC2A 4FH4A 3ZNTA 5CEBA 1YT4A 4EWFA 4D2OA 3G2YA 4OKPA 5HAPA 3EQVA 1ERQA 5CECA 3OPRA 4ID4A 1NRFA 4S2NC 1Y54A 5CTMA 5EVIC 1HZOA 1ZKJA 4GDNA 2OLUA 5FQJA 3HUOA 3HL9A 3PBNA 4RX2A 2Y91A 3VP0A 5J8XA 1CK3A 1VQQA 3IQAA 1S0WA 4WMCA 1JWPA 4RVAA 5I94A 2C5WB 1C3BA 4Q8IA 1J9MA 4QY6A 2GDNA 3MXRA 3PBQA 2WGWB 3NCKA 4R0QA 2IWDA 1KDWA 4C75A 2IWCA 4P6BA 1KGFA 3M2JA 1SKFA 2HP6A 3CMZA 5HAIA 1K4EA 2J9OA 5EUAA 5F83A 4EQIA 4KG2A 4GD6A 5AQ9A 3ZCZA 5KMWA 4BL3A 5EVLA 2QMIA 3ZVTA 4WBGA 4IBXA 4OOLA 2J9PA 4S2JA 4WZ5C 1NZUA 4QD4A 5FAPA 2A49A 3GTCA 1ES3A 3OPLA 2Z2LB 4X55A 4BD1A 3HUNA 4QJGA 2BLSA 4R4RA 3ZG0A 1YLZA 5E43A 2CC1A 4KZ7A 5U47A 3UNWA 4RA7A 1PZOA 3VP3A 5A93A 3UE0A 1BZAA 3N8LA 4KZ8A 2Y2NA 1EWZA 1KE0A 1FQGA 1M40A 3LEZA 3TSGA 3ZFZA 1JWZA 4Y7PA 1I2SA 2Q9NA 2HP9A 3IWOA 3OCLA 2ZQCA 4UA7A 2E8IA 2EFXA 1XPBA 1E3UD 1SHVA 2ZJ9A 3D4FA 1ES5A 3FKVA 3G31A 5FDHA 3G35A 3MKFA 3IXBA 5E2GA 3MXSA 3VP1A 4DRTA 4ZJ3A 1E4DA 2JBFA 4KZ5A 3WWXA 1XA7A 3W4OA 1YM1A 2X71A 3ZHHA 2EFUA 3HVFA 4LV2A 4GD8A 2DNSA 1ERMA 3VP4A 1IYPA 1E25A 4KQQA 1LI9A 1W8QA 1KGGA 4ZBEA 2DRWA 1K55A 4GZBA 1ZG6A 4Z9QA 2PU2A 3V3SA 3VOZA 3O86A 5DTTA 1PWGA 5KZHA 3PAGA 3BM6A 2A3UA 4BJPA 1FR1A 3W4QA 4HEFA 3ZG7B 3TOIA 3UDFA 4S2KA 4IVIA 1AXBA 1SDEA 3BFCA 3ZG9B 1KVMA 3QNBA 4ZDXA 1PZPA 2RL3A 2XH9A 3NDGA 3IF6C 2WKEA 4BENA 1K56D 5EPHA 1G68A 4E3JA 1JTDA 4OH0A 4DDYA 1LHYA 3C4OA 4IBRA 5EVID 3HLGA 3CJMA 5CGXA 4KQRA 4KENB 3WRTA 4JLFA 1IELA 1TEMA 1NXYA 3HLEA 4JBFA 3FKWA 2EX8A 1CEGA 1DY6A 5M19A 1MBLA 1TDLA 4NK3A 2J7VA 1MWRA 3HLFA 3Q1FA 2I72A 2ZC7A 2XGNA 4PM7A 3IF6B 4CJNA 4E6WA 2C6WB 3TG9A 2EX9A 2XD5A 3N7WA 5CGWA 5GHZA 3MBZA 2XFSA 1GHPA 2ZM8A 4ZTKA 4HBTA 4B88A 4JXWA 4GOGA 3G32A 3DWKA 4GNUA 1QMFA 3LY4A 1PI5A 4LENA 4OOMA 5FI7A 4Y0TA 1K38A 2X02A 3N4IA 4JXSA 4WELA 3WS5A 1H8YA 3SH8A 3LY3A 4OPYA 4RYEA 1PW1A 2WADA 4P85A 3UPNA 1KGEA 3EQUA 1ZG4A 2ZM2A 1XKZA 3V5MA 1NZOA 4KZ4A 4YFMA 1L0DA 3UPOA 4JF6A 4FCFA 4KG5A 1ONHA 1ESUA 4MBHA 3IXGA 4X6TA 3BFFA 3AGEA 4L0LA 5CHMA 5E2HA 3SS3A 3DWZA 3W8KA 3S1YA 2WGVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ALQ A;  1K54 A;  3SS4 A;  1RCJ A;  4OQH A;  3IH9 A;  5HAR A;  2JCH A;  1WYB A;  4RX3 A;  3CZD A;  5HX9 A;  2WKH A;  4U3T A;  3PAE A;  4WYY A;  5CED A;  1XGJ A;  3GMW A;  4EBL A;  3V39 A;  2P9V B;  5A92 A;  4PM8 A;  1L0E A;  3RJU A;  3ITA A;  2R9X A;  1W79 A;  3WS0 A;  2WK0 A;  1FCO A;  4WEJ A;  1O7E A;  3HUM A;  2XR0 A;  3N8S A;  3UDI A;  2Y2M A;  3FYZ A;  1PIO A;  5EE8 A;  3DTM A;  3A3D A;  2Q9M A;  5DF7 A;  2ZLY A;  2DCF A;  5E2E A;  3VFH A;  3MZE A;  4JXG A;  4N9K A;  5EVI B;  4P87 A;  4XXR A;  2ZQ9 A;  2RCX A;  3Q7V B;  4N1H A;  5EEC A;  3FWL A;  3PTE A;  1LL5 A;  2WAF A;  1I2W A;  2WKI A;  1ESI A;  2Y2Q A;  4LCM A;  4MLL A;  3MKE A;  4UA9 A;  4F94 A;  2H0Y A;  1YLJ A;  2HDU A;  5M1A A;  3HLC A;  3BFG A;  3A3J A;  2WZX A;  5G18 A;  5HL1 A;  1KVL A;  4MEZ A;  4Y0O A;  3E2L A;  2ZM0 A;  1K57 A;  4YIN A;  4DE1 A;  4S2L A;  4EBP A;  4E3O A;  2ZQA A;  1LLB A;  3ZNY A;  3GQZ A;  3P09 A;  4GN2 A;  5CGS A;  5HAQ A;  1NYM A;  5GLD A;  3B3X A;  1JWV A;  1YQS A;  3HRE A;  3C4P A;  4PM6 A;  5D3O A;  5E2F A;  5KSH A;  4M3K A;  1K6S A;  4MNR A;  3V3R A;  3BRM A;  2Y59 A;  1YLP A;  3VSL A;  4S2P A;  2XEP A;  3JYI A;  3IXH A;  5DVA A;  1MWU A;  2Y2K A;  4OOY A;  5IHV A;  1MY8 A;  2R9W A;  4LV1 A;  4OP8 A;  3Q82 A;  1Z6F A;  2PU4 A;  4BD0 A;  4KZA A;  1PW8 A;  3GRJ A;  3VOY A;  3NY4 A;  4DE2 A;  3FZC A;  3MZF A;  3QNC A;  4NET A;  5CER A;  3O88 A;  3C7U A;  3ZVW A;  2H5S A;  4EBN A;  4R4S A;  3ZDJ A;  5FQ9 A;  5KSC A;  3WS2 A;  1IYQ A;  1L0F A;  4P0M A;  4DF6 A;  4E6X A;  1N9B A;  3S4X A;  4BLM A;  4B4Z A;  3GV9 A;  4FD8 A;  3QHY A;  2XF3 A;  3IH8 A;  2Y2H A;  1H5X A;  1W5D A;  1BLH A;  1NJ4 A;  4OQI A;  3NDE A;  1BUL A;  4UA6 A;  1ES2 A;  3Q81 A;  4Y0U A;  5FI2 A;  4A5R A;  1FCN A;  1JVJ A;  4R1G A;  3W4P A;  4BQM A;  4BL2 A;  1MPL A;  5HW3 A;  1BTL A;  2WYX A;  1XP4 A;  4WM9 A;  1YLW A;  2XK1 A;  3BYD A;  3BEC A;  4UHU A;  4UAA A;  1CI8 A;  1HVB A;  1BSG A;  2Y55 A;  3PBO A;  3MFD A;  4JKT A;  1CI9 A;  2Y2O A;  1G6A A;  5DF8 A;  4PM5 A;  1ERO A;  2FFY A;  3SH9 A;  1YLY A;  4HES A;  3GVB A;  2ZC6 B;  3LO7 A;  4QB8 A;  3S22 A;  4ZJ1 A;  5M18 A;  4ZAM A;  2B5R A;  1HTZ A;  3HLW A;  2EXB A;  4S2I A;  1PYY A;  3NC8 A;  2Y2I A;  5DTS A;  3WS1 A;  5L2F A;  4OVD A;  2ZC3 B;  1CEF A;  4MBF A;  4CPK A;  2EX2 A;  2QPN A;  4LCL A;  5FQM A;  1BT5 A;  3UPP A;  4DDS A;  5AQ7 A;  4WZ4 A;  5CHU A;  4KG6 A;  4HBU A;  1PWC A;  1IKG A;  4X68 A;  3RXW A;  1NYY A;  2WZZ A;  3E2K A;  1PWD A;  3I7J A;  1FCM A;  3IHA A;  3PBS A;  2ZMA A;  5TGF A;  1FSW A;  4PMA A;  3UE3 A;  3BEB A;  5FAQ A;  5GHX A;  3WRZ A;  2ZD8 A;  4KZ3 A;  4O7D A;  3VP2 A;  5GLC A;  5CHJ A;  2XFT A;  1HD8 A;  4KZ9 A;  3O3V A;  3M2K A;  3VFF A;  3A3F A;  2X01 A;  1BUE A;  4E3N A;  5FQK A;  3IT9 A;  5CXW A;  2HPB A;  3NIA A;  1M6K A;  3HBR A;  4LV0 A;  1JTG A;  3OZH A;  4JF4 A;  1K55 C;  4OLG A;  5GLB A;  2WGI A;  3UO9 A;  1WE4 A;  1FOF A;  3G30 A;  3AGF A;  5DTK A;  3ZG5 A;  1TDG A;  3IF5 A;  3GR2 A;  3FV7 A;  5JYP A;  1RP5 A;  2H10 A;  2ZQ8 A;  4R3J A;  4WMC D;  4WZ5 A;  3BLM A;  4B4X A;  3AGD A;  5HFO A;  1KDS A;  2OV5 A;  1IYS A;  3ITB A;  1N4O A;  1W7F A;  1SCW A;  1RGZ A;  1L2S A;  1U60 A;  2WGW A;  2Y2G A;  3PBT A;  4FSF A;  4QY5 A;  5AQB A;  2Y2P A;  4OLD A;  4KQO A;  3G4P A;  1YMS A;  5JYO A;  4JF5 A;  4K0X A;  1K57 C;  3CG5 A;  1W8Y A;  4H8R A;  1DJC A;  4IVK A;  2P9V A;  5BOH A;  1ES4 A;  5GHY A;  1XA1 A;  5CRF A;  3Q07 A;  2WAE A;  3SS5 A;  1KE3 A;  2UWX A;  3BFD A;  3N8R A;  4QU3 A;  4E3M A;  1MXO A;  1MKI A;  2V20 A;  2V1Z A;  5AQA A;  1SDN A;  3A3I A;  3NBL A;  3ISG A;  2OLV A;  4JXV A;  4X56 A;  5EVI A;  2OSU A;  3SOI A;  2Z2M B;  4OON A;  5FAT A;  5TFQ A;  3P98 A;  4C3Q A;  3Q7V A;  2ZQD A;  4DKI A;  4S2O A;  5A90 A;  3A3E A;  4QHC A;  1H8Z A;  5F82 A;  4S2N A;  4KZB A;  1PI4 A;  1MWT A;  1S6R A;  3Q7Z A;  4GDB A;  4DE0 A;  1Q2P A;  1XXM A;  3IWI A;  4E3K A;  1MWS A;  5EOE A;  3OPP A;  1I5Q A;  5F1G A;  5FI6 A;  3MZD A;  3UY6 A;  4XUZ A;  1KE4 A;  4OQ0 A;  4E3I A;  3BLS A;  4N1X A;  4IED A;  4X69 A;  1L0G A;  2Y4A A;  1DJA A;  1OME A;  2XLN A;  3UE1 A;  4R3B A;  5FQQ A;  4DXB A;  4FH2 A;  4U0T A;  3OCN A;  1XGI A;  1E3U A;  1DJB A;  1FR6 A;  2EX6 A;  3PBR A;  4OPZ A;  1K25 A;  1GA9 A;  3C7V A;  2JE5 A;  1NY0 A;  3O87 A;  3M6B A;  2HDR A;  3G2Z A;  3OPH A;  5EOO A;  1QME A;  5F1F A;  2PBY A;  2VGJ A;  4K0W A;  2ZC4 B;  2ZC5 B;  3BFE A;  4XUX A;  2HDS A;  1BLP A;  5A91 A;  5DF9 A;  3ZG8 B;  2WUQ A;  3G34 A;  5CTN A;  2HDQ A;  4N92 A;  4ZJ2 A;  1IEM A;  4U0X A;  3SH7 A;  5FQI A;  2ZQ7 A;  1BLS A;  2G2U A;  4OPR A;  4LV3 A;  5FAO A;  1TVF A;  4PPR A;  5GL9 A;  2HP5 A;  1YLT A;  5FSR A;  3M6H A;  4GKU A;  4K91 A;  5GLA A;  1K54 C;  2Y2L A;  1XX2 A;  3V50 A;  4N9L A;  1YMX A;  1FSY A;  4E3L A;  3C5A A;  1GHI A;  1ONG A;  4S2M A;  2FFF B;  1ZC2 A;  3IXD A;  2Y2J A;  3GSG A;  4X53 A;  3LCE A;  2V2F F;  4MBK A;  3IF6 A;  2XDM A;  2XQZ A;  5FAS A;  4DE3 A;  2P74 A;  1VM1 A;  3DW0 A;  3IWQ A;  4EUZ A;  4C6Y A;  1GA0 A;  1LI0 A;  4KZ6 A;  4R23 A;  4OP5 A;  1EI5 A;  1Q2Q A;  1IKI A;  4OPQ A;  2EXA A;  1K4F A;  3NI9 A;  4JPM A;  3WS4 A;  1GHM A;  3HLD A;  3RXX A;  1LL9 A;  2BG1 A;  4DXC A;  2XD1 A;  2VGK A;  3N6I A;  2H0T A;  3ZGA B;  1GCE A;  4GB7 A;  4OQG A;  2J8Y A;  1K6R A;  3IHB A;  5FA7 A;  3UN7 A;  2JC7 A;  1K56 A;  1BLC A;  1O07 A;  1IYO A;  5TR7 A;  4PM9 A;  1WYC A;  3VSK A;  3VMA A;  3HLB A;  4WEK A;  4EV4 A;  1RGY A;  3UDX A;  2G2W A;  2QZ6 A;  2IWB A;  3OC2 A;  4FH4 A;  3ZNT A;  5CEB A;  1YT4 A;  4EWF A;  4D2O A;  3G2Y A;  4OKP A;  5HAP A;  3EQV A;  1ERQ A;  5CEC A;  3OPR A;  4ID4 A;  1NRF A;  4S2N C;  1Y54 A;  5CTM A;  5EVI C;  1HZO A;  1ZKJ A;  4GDN A;  2OLU A;  5FQJ A;  3HUO A;  3HL9 A;  3PBN A;  4RX2 A;  2Y91 A;  3VP0 A;  5J8X A;  1CK3 A;  1VQQ A;  3IQA A;  1S0W A;  4WMC A;  1JWP A;  4RVA A;  5I94 A;  2C5W B;  1C3B A;  4Q8I A;  1J9M A;  4QY6 A;  2GDN A;  3MXR A;  3PBQ A;  2WGW B;  3NCK A;  4R0Q A;  2IWD A;  1KDW A;  4C75 A;  2IWC A;  4P6B A;  1KGF A;  3M2J A;  1SKF A;  2HP6 A;  3CMZ A;  5HAI A;  1K4E A;  2J9O A;  5EUA A;  5F83 A;  4EQI A;  4KG2 A;  4GD6 A;  5AQ9 A;  3ZCZ A;  5KMW A;  4BL3 A;  5EVL A;  2QMI A;  3ZVT A;  4WBG A;  4IBX A;  4OOL A;  2J9P A;  4S2J A;  4WZ5 C;  1NZU A;  4QD4 A;  5FAP A;  2A49 A;  3GTC A;  1ES3 A;  3OPL A;  2Z2L B;  4X55 A;  4BD1 A;  3HUN A;  4QJG A;  2BLS A;  4R4R A;  3ZG0 A;  1YLZ A;  5E43 A;  2CC1 A;  4KZ7 A;  5U47 A;  3UNW A;  4RA7 A;  1PZO A;  3VP3 A;  5A93 A;  3UE0 A;  1BZA A;  3N8L A;  4KZ8 A;  2Y2N A;  1EWZ A;  1KE0 A;  1FQG A;  1M40 A;  3LEZ A;  3TSG A;  3ZFZ A;  1JWZ A;  4Y7P A;  1I2S A;  2Q9N A;  2HP9 A;  3IWO A;  3OCL A;  2ZQC A;  4UA7 A;  2E8I A;  2EFX A;  1XPB A;  1E3U D;  1SHV A;  2ZJ9 A;  3D4F A;  1ES5 A;  3FKV A;  3G31 A;  5FDH A;  3G35 A;  3MKF A;  3IXB A;  5E2G A;  3MXS A;  3VP1 A;  4DRT A;  4ZJ3 A;  1E4D A;  2JBF A;  4KZ5 A;  3WWX A;  1XA7 A;  3W4O A;  1YM1 A;  2X71 A;  3ZHH A;  2EFU A;  3HVF A;  4LV2 A;  4GD8 A;  2DNS A;  1ERM A;  3VP4 A;  1IYP A;  1E25 A;  4KQQ A;  1LI9 A;  1W8Q A;  1KGG A;  4ZBE A;  2DRW A;  1K55 A;  4GZB A;  1ZG6 A;  4Z9Q A;  2PU2 A;  3V3S A;  3VOZ A;  3O86 A;  5DTT A;  1PWG A;  5KZH A;  3PAG A;  3BM6 A;  2A3U A;  4BJP A;  1FR1 A;  3W4Q A;  4HEF A;  3ZG7 B;  3TOI A;  3UDF A;  4S2K A;  4IVI A;  1AXB A;  1SDE A;  3BFC A;  3ZG9 B;  1KVM A;  3QNB A;  4ZDX A;  1PZP A;  2RL3 A;  2XH9 A;  3NDG A;  3IF6 C;  2WKE A;  4BEN A;  1K56 D;  5EPH A;  1G68 A;  4E3J A;  1JTD A;  4OH0 A;  4DDY A;  1LHY A;  3C4O A;  4IBR A;  5EVI D;  3HLG A;  3CJM A;  5CGX A;  4KQR A;  4KEN B;  3WRT A;  4JLF A;  1IEL A;  1TEM A;  1NXY A;  3HLE A;  4JBF A;  3FKW A;  2EX8 A;  1CEG A;  1DY6 A;  5M19 A;  1MBL A;  1TDL A;  4NK3 A;  2J7V A;  1MWR A;  3HLF A;  3Q1F A;  2I72 A;  2ZC7 A;  2XGN A;  4PM7 A;  3IF6 B;  4CJN A;  4E6W A;  2C6W B;  3TG9 A;  2EX9 A;  2XD5 A;  3N7W A;  5CGW A;  5GHZ A;  3MBZ A;  2XFS A;  1GHP A;  2ZM8 A;  4ZTK A;  4HBT A;  4B88 A;  4JXW A;  4GOG A;  3G32 A;  3DWK A;  4GNU A;  1QMF A;  3LY4 A;  1PI5 A;  4LEN A;  4OOM A;  5FI7 A;  4Y0T A;  1K38 A;  2X02 A;  3N4I A;  4JXS A;  4WEL A;  3WS5 A;  1H8Y A;  3SH8 A;  3LY3 A;  4OPY A;  4RYE A;  1PW1 A;  2WAD A;  4P85 A;  3UPN A;  1KGE A;  3EQU A;  1ZG4 A;  2ZM2 A;  1XKZ A;  3V5M A;  1NZO A;  4KZ4 A;  4YFM A;  1L0D A;  3UPO A;  4JF6 A;  4FCF A;  4KG5 A;  1ONH A;  1ESU A;  4MBH A;  3IXG A;  4X6T A;  3BFF A;  3AGE A;  4L0L A;  5CHM A;  5E2H A;  3SS3 A;  3DWZ A;  3W8K A;  3S1Y A;  2WGV A; 
#chains in the Genus database with same CATH topology
 3SS4 A;  1RCJ A;  3IH9 A;  3D9Y A;  1WYB A;  2WKH A;  4EBL A;  3C30 A;  3RJU A;  2PAV P;  1W79 A;  4YWZ A;  2WK0 A;  3UME A;  1FCO A;  2ZL1 A;  4WEJ A;  3N8S A;  3FPV A;  3FYZ A;  3QP8 A;  3A3D A;  2Q9M A;  2PHY A;  3LR5 A;  3VFH A;  4N9K A;  4XXR A;  3E0Y A;  2O9A A;  2PT7 A;  3PTE A;  4NXE A;  5KIZ A;  2HDU A;  2I9V A;  5G18 A;  1KVL A;  4Y0O A;  3E2L A;  3CAX A;  4EES A;  1CQA A;  3BQA A;  2OWH A;  5CGS A;  2PD7 A;  3HRE A;  2QWS A;  4G3K A;  4PM6 A;  5KSH A;  4M3K A;  1DRM A;  2Y59 A;  4ESP A;  1YLP A;  3BJN A;  4LV1 A;  4CLC D;  1PW8 A;  3DBA A;  4DE2 A;  3C7U A;  2H5S A;  2JKR I;  4EBN A;  4R4S A;  5AVF A;  2H28 A;  4M4X A;  5FQ9 A;  3LR3 A;  3MR0 A;  1N9B A;  3IX8 A;  3GV9 A;  2Y2H A;  1W5D A;  4UA6 A;  1ES2 A;  5FI2 A;  1BTL A;  2WYX A;  1YLW A;  3BYD A;  2JHE A;  4JKT A;  2W3H A;  2Y2O A;  1D1J A;  3F1N B;  3SH9 A;  3U2A A;  5HSQ A;  3LO7 A;  4NXG A;  3S22 A;  3B42 A;  3IX3 A;  1PYY A;  2VX8 A;  1S1Y A;  3C8C A;  1CEF A;  2QPN A;  5L10 A;  5AQ7 A;  3MSH A;  4KG6 A;  4IHQ A;  3IHA A;  2ZMA A;  3BEB A;  4KZ3 A;  4O7D A;  5CHJ A;  2XFT A;  1HD8 A;  3NOP C;  3VFF A;  4PKY G;  1LSX A;  3T1X A;  3ZYT A;  5A8B A;  3OZH A;  4BWI A;  3FV7 A;  2VK3 A;  1G6O A;  2ZQ8 A;  4WMC D;  4WZ5 A;  5K5B A;  1KDS A;  2JKT I;  1IYS A;  1N4O A;  4FSF A;  3KSF A;  4KQO A;  4LRZ E;  1YMS A;  3E4Q A;  5GHY A;  1S1Z A;  5CRF A;  3BFD A;  4QU3 A;  4E3M A;  4F3L B;  1MKI A;  4ZRR A;  1EW0 A;  3A3I A;  1ZHH B;  4X56 A;  5EVI A;  3ULF A;  4C3Q A;  3P98 A;  4DKI A;  5A90 A;  1AWI A;  1A0K A;  5F82 A;  4S2N A;  4KZB A;  1PI4 A;  5AVE A;  3IWI A;  3H9W A;  2P08 A;  3LIF A;  4XT2 A;  5HWV A;  3GDI A;  4IED A;  1OME A;  4K08 A;  4GHI A;  4R3B A;  4DXB A;  2VA0 A;  1E3U A;  4OPZ A;  3NUL A;  1GA9 A;  3NEC A;  4E04 A;  3R4K A;  4QPR A;  4Y3I A;  1XJ3 A;  1ODV A;  3M6B A;  2HDR A;  3G2Z A;  4K0W A;  3RFB A;  2ZC4 B;  1SZV A;  2ZC5 B;  4G3W A;  2HDS A;  4IJG A;  4QWO A;  3IBJ A;  1Y4O A;  4R38 A;  4ZJ2 A;  1OTE A;  4U0X A;  3RTY A;  1TVF A;  4PPR A;  5FSR A;  1X0O A;  1K54 C;  1P0Z A;  4YNR A;  4X53 A;  3UB5 P;  2V2F F;  3VE4 A;  4GLQ A;  5FAS A;  4DE3 A;  4NG2 A;  2OAP 1;  3IWQ A;  4C6Y A;  1Q2Q A;  4R6L A;  3WS4 A;  4P6Z M;  2BG1 A;  2NUP C;  3P01 A;  1IYO A;  1T1B A;  1MKM A;  4ARZ B;  1RGY A;  3A0R A;  4CQH A;  2QZ6 A;  4EWF A;  3EQV A;  4EXO A;  1ERQ A;  3T4T A;  4S2N C;  2E8J A;  1V9Z A;  1OTD A;  3QP2 A;  2W1R A;  3HUO A;  4RX2 A;  1IFQ A;  3VP0 A;  3IQA A;  1P9R A;  1S0W A;  3MXQ A;  3UB8 A;  3P7N A;  4RVA A;  2B18 A;  2IWD A;  3T4Q A;  2HP6 A;  3T4J A;  4KG2 A;  4GD6 A;  5EVL A;  2J3W A;  3T12 B;  3PR6 A;  4OOL A;  4S2J A;  4UQI S;  4QD4 A;  4BD1 A;  4JGQ A;  4LPZ A;  4HJ6 A;  3UB7 A;  4QJG A;  2BLS A;  1F98 A;  3ZG0 A;  1YLZ A;  3UNW A;  1PZO A;  2DMW A;  1BZA A;  3N8L A;  2B95 A;  2Y2N A;  2JKT M;  1M40 A;  4Y7P A;  2E8I A;  3SW1 A;  2Y8H A;  1SHV A;  4X1L A;  5E2G A;  4JGR A;  3E98 A;  1H8M A;  3GEC A;  3W4O A;  1YM1 A;  2EFU A;  3VP4 A;  3VV4 A;  3SZT A;  4GZB A;  2PU2 A;  1G28 A;  1HLU P;  4S2K A;  4IVI A;  4EU0 A;  4ZDX A;  2XH9 A;  3LI9 A;  2QJ7 A;  3PHY A;  4KUK A;  4E3J A;  2VGL S;  2VKS A;  5EVI D;  2GX5 A;  4YOF A;  4KEN B;  4BMW A;  3IS2 A;  1MBL A;  5M19 A;  2J7V A;  1MWR A;  5FEG A;  4RQ9 A;  2QKP A;  3TG9 A;  1VEU B;  3KSH A;  4JXW A;  2R78 A;  1K38 A;  3BQ8 A;  1H8Y A;  3HCY A;  3SH8 A;  1PW1 A;  4P85 A;  1KGE A;  3EQU A;  2W3D A;  1NZO A;  2B02 A;  3U4L P;  3UPO A;  4JF6 A;  4FCF A;  5TBM B;  3T1R A;  4Q0J A;  1V9Y A;  3CZD A;  5CED A;  3GMW A;  4DMZ A;  3V39 A;  2P9V B;  5A92 A;  4PM8 A;  2CMN A;  3WS0 A;  3QP5 A;  3HUM A;  1XFQ A;  4LLO B;  4F3L A;  1PIO A;  3KYE A;  5EE8 A;  4HY8 A;  4I3I A;  5DF7 A;  2DCF A;  3MZE A;  2RCX A;  3Q7V B;  5EEC A;  1LL5 A;  2PR6 A;  4GCZ A;  2WKI A;  1ESI A;  4MLL A;  2ZBB A;  2H0Y A;  5M1A A;  3HLC A;  4UQI M;  3BFG A;  4GW9 A;  4MEZ A;  1D7E A;  4DE1 A;  3MMH A;  3MFX A;  3ZNY A;  3P09 A;  4GN2 A;  2Z6D A;  1SKO A;  1PRQ A;  3ZQ5 A;  5D3O A;  4MNR A;  1K6S A;  3V3R A;  3OBF A;  2XEP A;  3JYI A;  3IXH A;  5DVA A;  2Y2K A;  3JVU A;  1TS7 A;  2K2N A;  2J3T D;  2WKP A;  3GRJ A;  3PYP A;  5HZH A;  4NET A;  5DFX A;  1OJG A;  1NWZ A;  5MC7 A;  3WS2 A;  4E6X A;  4BLM A;  2JKF A;  2PYR A;  1BUL A;  3ICY A;  3HJK A;  3W4P A;  4PAU A;  4BQM A;  5HW3 A;  4BBV A;  2W0N A;  4UHU A;  1CI8 A;  1W63 Q;  1HVB A;  1BSG A;  4HHD A;  2Y55 A;  3PBO A;  1CI9 A;  4PM5 A;  1ERO A;  2FFY A;  4HES A;  3GVB A;  5M18 A;  2EXB A;  4S2I A;  3NC8 A;  2Y2I A;  5L2F A;  4HP9 A;  4O8G A;  4OVD A;  5HPI A;  4MBF A;  1BT5 A;  4DDS A;  4WZ4 A;  1PWC A;  3E2K A;  3PBS A;  4ARZ A;  3HJI A;  1UWP X;  4HJ4 A;  5FAQ A;  2YKH A;  5GHX A;  3DTK A;  4KZ9 A;  5C5K A;  3A3F A;  2X01 A;  3IT9 A;  5CXW A;  3EOI A;  3HBR A;  4JF4 A;  1H3Q A;  3UO9 A;  1VHM A;  3GR2 A;  3FG8 A;  3R7W A;  4LRY C;  4B4X A;  5HFO A;  1FIL A;  2OV5 A;  3MQO A;  3ITB A;  1W7F A;  2WGW A;  1L2S A;  5AQB A;  3G4P A;  5JYO A;  4JF5 A;  1DJC A;  2LB9 A;  3UB6 A;  1G5U A;  2O9C A;  2UWX A;  3FPW A;  3S7N A;  2V1Z A;  1SDN A;  5DJT A;  1T18 A;  4JXV A;  2OSU A;  1LL8 A;  2HV1 A;  4OON A;  3A3E A;  1S6R A;  1OTB A;  3CIT A;  1Q2P A;  1XXM A;  1MWS A;  4MCW A;  3T1S A;  2XRN A;  4G3V A;  5F1G A;  5L09 A;  2G7U A;  4WL9 A;  3F1O B;  4OQ0 A;  4E3I A;  1FIK A;  1BYW A;  1LT0 A;  1DJA A;  1SKO B;  5FQQ A;  4D60 A;  4FH2 A;  1D06 A;  3MS6 A;  3PBR A;  1K25 A;  3C7V A;  1LSV A;  1OTI A;  1GSW A;  4FOF A;  5EOO A;  1QME A;  3T1Q B;  3E4P A;  5F1F A;  2VGJ A;  5HPF A;  4XUX A;  5DF9 A;  2WUQ A;  1BLS A;  5FAO A;  4ETZ A;  5GL9 A;  5EVE A;  3M6H A;  4GKU A;  5GLA A;  3V50 A;  2KOI A;  1FSY A;  2O9B A;  3IS2 B;  2Q0O A;  2PRF A;  4MBK A;  1VET A;  3IF6 A;  3LGO A;  1W63 M;  2P74 A;  5DFY A;  1VM1 A;  4I5S A;  1PFL A;  3OOV A;  4KZ6 A;  1EI5 A;  1IKI A;  3KO6 A;  2EXA A;  1K4F A;  3UMD A;  1GHM A;  1LL9 A;  4DXC A;  2VGK A;  2H0T A;  1DP9 A;  1GCE A;  1NRJ A;  2J8Y A;  3UN7 A;  2K7S A;  1O07 A;  3E4O A;  3KSI A;  1WYC A;  3MF0 A;  3VSK A;  3CLO A;  4FH4 A;  4PHT A;  4D2O A;  3G2Y A;  5HAP A;  1F2K A;  2W3G A;  1NRF A;  2O99 A;  1Y54 A;  5EVI C;  2JKR M;  2ZOI A;  2OLU A;  5FQJ A;  5DJU A;  3HL9 A;  1VQQ A;  1JWP A;  4LFU A;  3CUE C;  2C5W B;  4Q8I A;  1YPR A;  4R3A A;  4QY6 A;  2GDN A;  3W2Z A;  1KOU A;  1K4E A;  5F83 A;  2V8F A;  5AQ9 A;  5KMW A;  4BL3 A;  2QMI A;  3ZVT A;  2J9P A;  1YKD A;  2VEA A;  4WZ5 C;  3GTC A;  1ES3 A;  2Z2L B;  4WLA A;  4GS9 B;  4P6Z S;  5E43 A;  2CC1 A;  2W1T A;  5U47 A;  3VP3 A;  5A93 A;  3F1P B;  1EWZ A;  1FQG A;  3TSG A;  3ZFZ A;  3LEZ A;  1I2S A;  2ZQC A;  2WKQ A;  1ES5 A;  5FDH A;  3G35 A;  3MKF A;  3F1O A;  3IXB A;  3VP1 A;  4ZJ3 A;  2XSS A;  3ZHH A;  4LV2 A;  2HF6 A;  3MQ0 A;  1ERM A;  4HQA A;  1E25 A;  4KQQ A;  1LI9 A;  1KGG A;  4ZBE A;  1T19 A;  2A24 A;  4Z9Q A;  3V3S A;  2A3U A;  1FR1 A;  4HEF A;  4HH3 A;  1UWN X;  2FZ0 A;  3ZG9 B;  4NXB A;  2RL3 A;  3OLO A;  2KDK A;  2WKE A;  5FL3 A;  4BEN A;  5EPH A;  1G68 A;  3C38 A;  1JTD A;  1LHY A;  2VJW A;  3C4O A;  4R70 A;  3CJM A;  2ZMV A;  5CGX A;  4KQR A;  3WRT A;  4MN7 A;  4Y2F A;  4JBF A;  3FKW A;  2EX8 A;  5LBR A;  3HLF A;  5EM0 A;  1TS0 A;  3LUQ A;  1VET B;  4CJN A;  4E6W A;  2C6W B;  3N7W A;  5CGW A;  2VZW A;  2XFS A;  1GHP A;  4LEN A;  3S7P A;  4OOM A;  5I5L A;  2X02 A;  2UV0 E;  1GSV A;  1TS8 A;  3WS5 A;  4RYE A;  3KYQ A;  4KZ4 A;  1L0D A;  4EET B;  5J3W A;  5E2H A;  3SS3 A;  2VV8 A;  4OQH A;  1DP6 A;  1F9I A;  4U3T A;  3CPT B;  5EFW A;  4WYY A;  1PNE A;  1XGJ A;  4WF0 A;  3ITA A;  1JNU A;  2XR0 A;  5J4E A;  1K0K A;  1J3W A;  4JXG A;  5EVI B;  5IU1 A;  3TRC A;  2V8C A;  3NHQ A;  3FWL A;  2WAF A;  2Y2Q A;  1TF1 A;  3EGD C;  4I3A A;  3A3J A;  2WZX A;  2ZM0 A;  1K57 A;  4XT2 B;  4YIN A;  4S2L A;  3GQZ A;  3L9K A;  2NUT C;  5DKL A;  5GLD A;  3B3X A;  5HWT A;  1YQS A;  5E2F A;  1CJF A;  3VSL A;  4S2P A;  5IHV A;  4OOY A;  3IBR A;  3Q82 A;  4H6J B;  2PU4 A;  4BD0 A;  5EV0 A;  3FZC A;  5CER A;  3O88 A;  3ZVW A;  2D01 A;  4GJ4 A;  1IYQ A;  2J3T C;  4FD8 A;  2A24 B;  3QHY A;  2XF3 A;  1NJ4 A;  2K31 A;  3H7W B;  4A5R A;  4R1G A;  4BL2 A;  1MPL A;  1XP4 A;  4KQD A;  2XK1 A;  3CI6 A;  4EQ1 A;  5F68 A;  3MFD A;  2Z6C A;  1G6A A;  5DF8 A;  2FH5 A;  4ZJ1 A;  1OT6 A;  4ZAM A;  1HTZ A;  3HLW A;  5L8M A;  4B93 A;  2ZC3 B;  4CPK A;  3UPP A;  2HGV A;  2V0W A;  1VEU A;  4Y13 A;  4HBU A;  4HI4 A;  1IKG A;  2EWW A;  3QP1 A;  3I7J A;  1FCM A;  3V67 A;  1FSW A;  2ZD8 A;  1LSW A;  1S66 L;  2INW A;  3VP2 A;  5HDS A;  1BUE A;  5FQK A;  1M6K A;  4LV0 A;  4OLG A;  1JTG A;  1K55 C;  1L3L A;  1MC0 A;  5G4Y A;  4L9E A;  1WE4 A;  1FOF A;  3G30 A;  3AGF A;  3IF5 A;  3NOU C;  5F69 A;  1RP5 A;  3BLM A;  1N9L A;  3V5M A;  1RGZ A;  2Y2G A;  4QY5 A;  3O5Y A;  4OLD A;  5F5Y A;  4K0X A;  3MJQ A;  3CG5 A;  4IVK A;  2GZA A;  1XA1 A;  3B47 A;  5F6A A;  3LIE A;  3SS5 A;  2ZL1 B;  3JPU A;  3N8R A;  1N9O A;  1MXO A;  3K3C A;  3NBL A;  1DP8 A;  2AVX A;  3ISG A;  4GS9 A;  2D02 A;  2W1T B;  1OTA A;  3Q7V A;  2ZQD A;  3F1P A;  3LEQ A;  1MWT A;  5IS1 A;  4O0P A;  4GDB A;  3NOT C;  4I39 A;  4FTX A;  1I5Q A;  3UY6 A;  1KE4 A;  3KSG A;  1NLZ A;  3T4O A;  4X69 A;  2ZMF A;  3UE1 A;  3KYZ A;  4L9G A;  4O01 A;  3OPH A;  4LRX C;  1BLP A;  5A91 A;  3ZG8 B;  3G34 A;  4MDZ A;  2HDQ A;  1IEM A;  2O0Y A;  4LV3 A;  4X1M A;  2J80 A;  1H0M A;  3CWF A;  2W3F A;  2PBD P;  3H7W A;  1YMX A;  4E3L A;  3IX4 A;  5HD5 A;  3C5A A;  1ONG A;  2FFF B;  1ZC2 A;  3IXD A;  3GSG A;  3LCE A;  4PKY A;  4DJ2 A;  3UE6 A;  4HJ3 A;  4EUZ A;  2M7U A;  1GA0 A;  1LI0 A;  4OP5 A;  4OPQ A;  4JPM A;  4B9O A;  3LIC A;  4GB7 A;  4MN5 A;  1K6R A;  2JC7 A;  3K3D A;  5TR7 A;  4PM9 A;  2MJ6 A;  1T1A A;  3UDX A;  2IWB A;  3OC2 A;  4ME4 A;  1YT4 A;  4WUJ A;  4HIA A;  4I3J A;  1OPX A;  4CLC C;  1VB6 A;  1HZO A;  5J8X A;  5I94 A;  1C3B A;  2XA7 S;  1J9M A;  3MXR A;  2V9A A;  2WGW B;  4R0Q A;  2IWC A;  1KGF A;  3M2J A;  4MMN A;  2J9O A;  5EUA A;  4EQI A;  2XRO A;  5AJG A;  4HP4 A;  4WBG A;  1NZU A;  4X55 A;  3OPL A;  3C2W A;  3HUN A;  1TD5 A;  3TE8 A;  3UE0 A;  3T50 A;  1S4R A;  2Q9N A;  3IWO A;  3OCL A;  1XPB A;  2W27 A;  2ZJ9 A;  3FKV A;  3G31 A;  2L0W A;  2P04 A;  2P7J A;  4DRT A;  1E4D A;  2JBF A;  4KZ5 A;  2X71 A;  3HVF A;  2DNS A;  1IYP A;  1P9W A;  1PWG A;  2VV7 A;  3TW8 A;  3PXP A;  3W4Q A;  3ZG7 B;  3UDF A;  3BFC A;  1SDE A;  1OJ5 A;  3QNB A;  3NDG A;  2IA2 A;  3IF6 C;  3RH8 B;  1K56 D;  3LIA A;  3T4S A;  2OWJ A;  4WN5 A;  4OH0 A;  4JLF A;  4Y5F A;  1NXY A;  1CEG A;  1DY6 A;  2I72 A;  5EM1 A;  2XGN A;  2EX9 A;  2L4R A;  4ETX A;  4HNB A;  5IT5 A;  3MBZ A;  3BY8 A;  3LIB A;  3QP4 A;  4GOG A;  3G32 A;  1QMF A;  1PI5 A;  1XJ6 A;  4JXS A;  3LY3 A;  2WAD A;  4CLC A;  1XKZ A;  4EW7 A;  4YFM A;  1P97 A;  1ONH A;  2LB5 A;  1ESU A;  4MBH A;  4X6T A;  3A0V A;  3AGE A;  5CHM A;  3W8K A;  3BEC A;  2WGV A;  1ALQ A;  1K54 A;  1Y28 A;  5HAR A;  2JCH A;  4FUW A;  4RX3 A;  5HX9 A;  3PAE A;  2M7V A;  1L0E A;  2R9X A;  3JVV A;  1O7E A;  3UDI A;  2Y2M A;  5DKK A;  3BWL A;  2XA7 M;  4AFI A;  1WA9 A;  3DTM A;  2ZLY A;  5E2E A;  4P87 A;  3DAV A;  2ZQ9 A;  4N1H A;  3VE3 A;  1I2W A;  2EWV A;  3EGX C;  4LCM A;  1CF0 A;  1YSQ A;  3MKE A;  4UA9 A;  4F94 A;  1YLJ A;  5J7E A;  5HL1 A;  3DTE A;  5G4Z A;  3LR0 A;  4EBP A;  1ACF A;  4E3O A;  2ZQA A;  1LLB A;  1S4S A;  4CLC E;  5HAQ A;  1NYM A;  1JWV A;  3C4P A;  4GHI B;  1YAX A;  2V1A A;  3BRM A;  1MWU A;  1MY8 A;  2R9W A;  3H82 B;  4OP8 A;  1Z6F A;  5FEF A;  4KZA A;  2ZOH A;  2HJE A;  3VOY A;  3NY4 A;  3MZF A;  3QNC A;  3LR4 A;  3ZDJ A;  5KSC A;  1STZ A;  1L0F A;  4P0M A;  2PD8 A;  4DF6 A;  4EEU A;  3S4X A;  5L07 A;  4B4Z A;  3IH8 A;  1H5X A;  1BLH A;  4OQI A;  3NDE A;  4Y0U A;  3Q81 A;  2V0U A;  1FCN A;  1JVJ A;  4HH2 A;  4WM9 A;  2GJ3 A;  4UAA A;  4X25 A;  3K2N A;  1IOU A;  3LID A;  1YLY A;  2ZC6 B;  3BW6 A;  4QB8 A;  2VGL M;  2QYB A;  3DTI A;  4DJ3 A;  2B5R A;  1TS6 A;  5DTS A;  3WS1 A;  5FDS A;  2EX2 A;  4II7 A;  4Q0H A;  4LCL A;  5FQM A;  3T4K A;  5CHU A;  4X68 A;  3RXW A;  1NYY A;  2WZZ A;  1PWD A;  5TGF A;  4PMA A;  3UE3 A;  3WRZ A;  5GLC A;  2L1M A;  4LGW A;  3O3V A;  3M2K A;  4E3N A;  4EEP A;  1UGU A;  1YSP A;  4IUK A;  2HPB A;  3NIA A;  3A0S A;  5GLB A;  2WGI A;  5TBM A;  2WKR A;  3QP6 A;  5DTK A;  3ZG5 A;  1TDG A;  4BBU A;  5JYP A;  2H10 A;  4R3J A;  3AGD A;  1N9N A;  4EER A;  1SCW A;  1U60 A;  3PBT A;  2Y2P A;  1K57 C;  3CPT A;  1W8Y A;  4H8R A;  3L7H A;  2P9V A;  3D3O A;  5BOH A;  1ES4 A;  5HWW A;  3Q07 A;  1GSX A;  2WAE A;  5CX7 A;  1KE3 A;  5AQA A;  2V20 A;  1XFN A;  2YKF A;  2OLV A;  4L9F A;  3SOI A;  2Z2M B;  5FAT A;  5TFQ A;  4S2O A;  4QHC A;  2PDR A;  1H8Z A;  1F5M A;  3Q7Z A;  1XJ4 A;  4DE0 A;  2JN7 A;  2OAQ 1;  4E3K A;  5EOE A;  3OPP A;  5FI6 A;  1MZU A;  3MZD A;  4XUZ A;  3BLS A;  4N1X A;  4NEE D;  1L0G A;  2Y4A A;  1ZTU A;  2XLN A;  4U0T A;  2PR5 A;  3OCN A;  1XGI A;  1FR6 A;  1DJB A;  4KUO A;  2EX6 A;  2JE5 A;  1NLY A;  1NY0 A;  3O87 A;  3CHW P;  2BAS A;  2EA9 A;  3B33 A;  2PBY A;  2A2L A;  3BFE A;  5CTN A;  4N92 A;  3EWK A;  5HDD A;  3SH7 A;  5FQI A;  3G6O A;  2G2U A;  2ZQ7 A;  4OPR A;  2HP5 A;  1YLT A;  4K91 A;  2Y2L A;  1T1C A;  1XX2 A;  4N9L A;  2HJ9 C;  1GHI A;  2OOL A;  4S2M A;  2Y2J A;  2XDM A;  2XQZ A;  3F1N A;  3DW0 A;  4JGO A;  4EUV A;  2KX6 A;  4NKP A;  4R23 A;  2V1B A;  3NI9 A;  3HLD A;  3RXX A;  2HZ5 A;  3EEA A;  2XD1 A;  3N6I A;  4NXF A;  3ZGA B;  5TJJ A;  4OQG A;  3IHB A;  5FA7 A;  4CLC B;  1K56 A;  1BLC A;  3VMA A;  3HLB A;  5HL6 A;  4WEK A;  4IUH A;  4EV4 A;  2G2W A;  3CUE A;  3ZNT A;  5CEB A;  3BY9 A;  4OKP A;  2VLG A;  2KLI A;  5CEC A;  3OPR A;  4ID4 A;  5CTM A;  1ZKJ A;  4Y17 A;  4GDN A;  2BTF P;  3PBN A;  2Y91 A;  3R7W B;  1CK3 A;  4WMC A;  3PBQ A;  3NCK A;  1KDW A;  4C75 A;  4P6B A;  1SKF A;  3CMZ A;  5HAI A;  1XJ2 A;  4UEY A;  3ZCZ A;  2M1C A;  4IBX A;  5FAP A;  2A49 A;  4I38 A;  1S67 L;  4R4R A;  4KZ7 A;  4RA7 A;  5HDC A;  4KZ8 A;  4JGP A;  1KE0 A;  1JWZ A;  5HD3 A;  2HP9 A;  4Q0I A;  4UA7 A;  2EFX A;  3S7O A;  1E3U D;  3D4F A;  3H82 A;  4H6J A;  1OT9 A;  3LI8 A;  3MQQ A;  3LYX A;  3MXS A;  3WWX A;  1XA7 A;  3KX0 X;  3UB9 A;  4GD8 A;  4DN0 A;  3EEH A;  1W8Q A;  2DRW A;  1K55 A;  1ZG6 A;  3VOZ A;  5KZH A;  3O86 A;  5DTT A;  3PAG A;  4Y15 A;  3BM6 A;  4BJP A;  3TOI A;  1AXB A;  1KVM A;  1PZP A;  2QHK A;  3T4L A;  4DDY A;  4IBR A;  4Z1W A;  3HLG A;  2Y79 A;  2ACG A;  1IEL A;  1TEM A;  3HLE A;  3S7Q A;  2GNX A;  1TDL A;  4NK3 A;  3Q1F A;  3LFV A;  2ZC7 A;  4PM7 A;  3IF6 B;  2W3E A;  2XD5 A;  5GHZ A;  4BBT A;  4ZTK A;  2ZM8 A;  4HBT A;  4B88 A;  4HOI A;  3NJA A;  4GNU A;  5FI7 A;  3DWK A;  2QJ5 A;  3LY4 A;  4Y0T A;  3N4I A;  4WEL A;  4OPY A;  3UPN A;  2JKG A;  1ZG4 A;  2ZM2 A;  3D72 A;  3FC7 A;  4KG5 A;  2PYP A;  3IXG A;  3VOL A;  1Z09 A;  2VV6 A;  4MN6 A;  3BFF A;  3TJZ C;  4L0L A;  3DWZ A;  3S1Y A; 
#chains in the Genus database with same CATH homology
 1ALQ A;  1K54 A;  3SS4 A;  1RCJ A;  4OQH A;  3IH9 A;  5HAR A;  2JCH A;  1WYB A;  4RX3 A;  3CZD A;  5HX9 A;  2WKH A;  4U3T A;  3PAE A;  4WYY A;  5CED A;  1XGJ A;  3GMW A;  4EBL A;  3V39 A;  2P9V B;  5A92 A;  4PM8 A;  1L0E A;  3RJU A;  3ITA A;  2R9X A;  1W79 A;  3WS0 A;  2WK0 A;  1FCO A;  4WEJ A;  1O7E A;  3HUM A;  2XR0 A;  3N8S A;  3UDI A;  2Y2M A;  3FYZ A;  1PIO A;  5EE8 A;  3DTM A;  3A3D A;  2Q9M A;  5DF7 A;  2ZLY A;  2DCF A;  5E2E A;  3VFH A;  3MZE A;  4JXG A;  4N9K A;  5EVI B;  4P87 A;  4XXR A;  2ZQ9 A;  2RCX A;  3Q7V B;  4N1H A;  5EEC A;  3FWL A;  3PTE A;  1LL5 A;  2WAF A;  1I2W A;  2WKI A;  1ESI A;  2Y2Q A;  4LCM A;  4MLL A;  3MKE A;  4UA9 A;  4F94 A;  2H0Y A;  1YLJ A;  2HDU A;  5M1A A;  3HLC A;  3BFG A;  3A3J A;  2WZX A;  5G18 A;  5HL1 A;  1KVL A;  4MEZ A;  4Y0O A;  3E2L A;  2ZM0 A;  1K57 A;  4YIN A;  4DE1 A;  4S2L A;  4EBP A;  4E3O A;  2ZQA A;  1LLB A;  3ZNY A;  3GQZ A;  3P09 A;  4GN2 A;  5CGS A;  5HAQ A;  1NYM A;  5GLD A;  3B3X A;  1JWV A;  1YQS A;  3HRE A;  3C4P A;  4PM6 A;  5D3O A;  5E2F A;  5KSH A;  4M3K A;  1K6S A;  4MNR A;  3V3R A;  3BRM A;  2Y59 A;  1YLP A;  3VSL A;  4S2P A;  2XEP A;  3JYI A;  3IXH A;  5DVA A;  1MWU A;  2Y2K A;  4OOY A;  5IHV A;  1MY8 A;  2R9W A;  4LV1 A;  4OP8 A;  3Q82 A;  1Z6F A;  2PU4 A;  4BD0 A;  4KZA A;  1PW8 A;  3GRJ A;  3VOY A;  3NY4 A;  4DE2 A;  3FZC A;  3MZF A;  3QNC A;  4NET A;  5CER A;  3O88 A;  3C7U A;  3ZVW A;  2H5S A;  4EBN A;  4R4S A;  3ZDJ A;  5FQ9 A;  5KSC A;  3WS2 A;  1IYQ A;  1L0F A;  4P0M A;  4DF6 A;  4E6X A;  1N9B A;  3S4X A;  4BLM A;  4B4Z A;  3GV9 A;  4FD8 A;  3QHY A;  2XF3 A;  3IH8 A;  2Y2H A;  1H5X A;  1W5D A;  1BLH A;  1NJ4 A;  4OQI A;  3NDE A;  1BUL A;  4UA6 A;  1ES2 A;  3Q81 A;  4Y0U A;  5FI2 A;  4A5R A;  1FCN A;  1JVJ A;  4R1G A;  3W4P A;  4BQM A;  4BL2 A;  1MPL A;  5HW3 A;  1BTL A;  2WYX A;  1XP4 A;  4WM9 A;  1YLW A;  2XK1 A;  3BYD A;  3BEC A;  4UHU A;  4UAA A;  1CI8 A;  1HVB A;  1BSG A;  2Y55 A;  3PBO A;  3MFD A;  4JKT A;  1CI9 A;  2Y2O A;  1G6A A;  5DF8 A;  4PM5 A;  1ERO A;  2FFY A;  3SH9 A;  1YLY A;  4HES A;  3GVB A;  2ZC6 B;  3LO7 A;  4QB8 A;  3S22 A;  4ZJ1 A;  5M18 A;  4ZAM A;  2B5R A;  1HTZ A;  3HLW A;  2EXB A;  4S2I A;  1PYY A;  3NC8 A;  2Y2I A;  5DTS A;  3WS1 A;  5L2F A;  4OVD A;  2ZC3 B;  1CEF A;  4MBF A;  4CPK A;  2EX2 A;  2QPN A;  4LCL A;  5FQM A;  1BT5 A;  3UPP A;  4DDS A;  5AQ7 A;  4WZ4 A;  5CHU A;  4KG6 A;  4HBU A;  1PWC A;  1IKG A;  4X68 A;  3RXW A;  1NYY A;  2WZZ A;  3E2K A;  1PWD A;  3I7J A;  1FCM A;  3IHA A;  3PBS A;  2ZMA A;  5TGF A;  1FSW A;  4PMA A;  3UE3 A;  3BEB A;  5FAQ A;  5GHX A;  3WRZ A;  2ZD8 A;  4KZ3 A;  4O7D A;  3VP2 A;  5GLC A;  5CHJ A;  2XFT A;  1HD8 A;  4KZ9 A;  3O3V A;  3M2K A;  3VFF A;  3A3F A;  2X01 A;  1BUE A;  4E3N A;  5FQK A;  3IT9 A;  5CXW A;  2HPB A;  3NIA A;  1M6K A;  3HBR A;  4LV0 A;  1JTG A;  3OZH A;  4JF4 A;  1K55 C;  4OLG A;  5GLB A;  2WGI A;  3UO9 A;  1WE4 A;  1FOF A;  3G30 A;  3AGF A;  5DTK A;  3ZG5 A;  1TDG A;  3IF5 A;  3GR2 A;  3FV7 A;  5JYP A;  1RP5 A;  2H10 A;  2ZQ8 A;  4R3J A;  4WMC D;  4WZ5 A;  3BLM A;  4B4X A;  3AGD A;  5HFO A;  1KDS A;  2OV5 A;  1IYS A;  3ITB A;  1N4O A;  1W7F A;  1SCW A;  1RGZ A;  1L2S A;  1U60 A;  2WGW A;  2Y2G A;  3PBT A;  4FSF A;  4QY5 A;  5AQB A;  2Y2P A;  4OLD A;  4KQO A;  3G4P A;  1YMS A;  5JYO A;  4JF5 A;  4K0X A;  1K57 C;  3CG5 A;  1W8Y A;  4H8R A;  1DJC A;  4IVK A;  2P9V A;  5BOH A;  1ES4 A;  5GHY A;  1XA1 A;  5CRF A;  3Q07 A;  2WAE A;  3SS5 A;  1KE3 A;  2UWX A;  3BFD A;  3N8R A;  4QU3 A;  4E3M A;  1MXO A;  1MKI A;  2V20 A;  2V1Z A;  5AQA A;  1SDN A;  3A3I A;  3NBL A;  3ISG A;  2OLV A;  4JXV A;  4X56 A;  5EVI A;  2OSU A;  3SOI A;  2Z2M B;  4OON A;  5FAT A;  5TFQ A;  3P98 A;  4C3Q A;  3Q7V A;  2ZQD A;  4DKI A;  4S2O A;  5A90 A;  3A3E A;  4QHC A;  1H8Z A;  5F82 A;  4S2N A;  4KZB A;  1PI4 A;  1MWT A;  1S6R A;  3Q7Z A;  4GDB A;  4DE0 A;  1Q2P A;  1XXM A;  3IWI A;  4E3K A;  1MWS A;  5EOE A;  3OPP A;  1I5Q A;  5F1G A;  5FI6 A;  3MZD A;  3UY6 A;  4XUZ A;  1KE4 A;  4OQ0 A;  4E3I A;  3BLS A;  4N1X A;  4IED A;  4X69 A;  1L0G A;  2Y4A A;  1DJA A;  1OME A;  2XLN A;  3UE1 A;  4R3B A;  5FQQ A;  4DXB A;  4FH2 A;  4U0T A;  3OCN A;  1XGI A;  1E3U A;  1DJB A;  1FR6 A;  2EX6 A;  3PBR A;  4OPZ A;  1K25 A;  1GA9 A;  3C7V A;  2JE5 A;  1NY0 A;  3O87 A;  3M6B A;  2HDR A;  3G2Z A;  3OPH A;  5EOO A;  1QME A;  5F1F A;  2PBY A;  2VGJ A;  4K0W A;  2ZC4 B;  2ZC5 B;  3BFE A;  4XUX A;  2HDS A;  1BLP A;  5A91 A;  5DF9 A;  3ZG8 B;  2WUQ A;  3G34 A;  5CTN A;  2HDQ A;  4N92 A;  4ZJ2 A;  1IEM A;  4U0X A;  3SH7 A;  5FQI A;  2ZQ7 A;  1BLS A;  2G2U A;  4OPR A;  4LV3 A;  5FAO A;  1TVF A;  4PPR A;  5GL9 A;  2HP5 A;  1YLT A;  5FSR A;  3M6H A;  4GKU A;  4K91 A;  5GLA A;  1K54 C;  2Y2L A;  1XX2 A;  3V50 A;  4N9L A;  1YMX A;  1FSY A;  4E3L A;  3C5A A;  1GHI A;  1ONG A;  4S2M A;  2FFF B;  1ZC2 A;  3IXD A;  2Y2J A;  3GSG A;  4X53 A;  3LCE A;  2V2F F;  4MBK A;  3IF6 A;  2XDM A;  2XQZ A;  5FAS A;  4DE3 A;  2P74 A;  1VM1 A;  3DW0 A;  3IWQ A;  4EUZ A;  4C6Y A;  1GA0 A;  1LI0 A;  4KZ6 A;  4R23 A;  4OP5 A;  1EI5 A;  1Q2Q A;  1IKI A;  4OPQ A;  2EXA A;  1K4F A;  3NI9 A;  4JPM A;  3WS4 A;  1GHM A;  3HLD A;  3RXX A;  1LL9 A;  2BG1 A;  4DXC A;  2XD1 A;  2VGK A;  3N6I A;  2H0T A;  3ZGA B;  1GCE A;  4GB7 A;  4OQG A;  2J8Y A;  1K6R A;  3IHB A;  5FA7 A;  3UN7 A;  2JC7 A;  1K56 A;  1BLC A;  1O07 A;  1IYO A;  5TR7 A;  4PM9 A;  1WYC A;  3VSK A;  3VMA A;  3HLB A;  4WEK A;  4EV4 A;  1RGY A;  3UDX A;  2G2W A;  2QZ6 A;  2IWB A;  3OC2 A;  4FH4 A;  3ZNT A;  5CEB A;  1YT4 A;  4EWF A;  4D2O A;  3G2Y A;  4OKP A;  5HAP A;  3EQV A;  1ERQ A;  5CEC A;  3OPR A;  4ID4 A;  1NRF A;  4S2N C;  1Y54 A;  5CTM A;  5EVI C;  1HZO A;  1ZKJ A;  4GDN A;  2OLU A;  5FQJ A;  3HUO A;  3HL9 A;  3PBN A;  4RX2 A;  2Y91 A;  3VP0 A;  5J8X A;  1CK3 A;  1VQQ A;  3IQA A;  1S0W A;  4WMC A;  1JWP A;  4RVA A;  5I94 A;  2C5W B;  1C3B A;  4Q8I A;  1J9M A;  4QY6 A;  2GDN A;  3MXR A;  3PBQ A;  2WGW B;  3NCK A;  4R0Q A;  2IWD A;  1KDW A;  4C75 A;  2IWC A;  4P6B A;  1KGF A;  3M2J A;  1SKF A;  2HP6 A;  3CMZ A;  5HAI A;  1K4E A;  2J9O A;  5EUA A;  5F83 A;  4EQI A;  4KG2 A;  4GD6 A;  5AQ9 A;  3ZCZ A;  5KMW A;  4BL3 A;  5EVL A;  2QMI A;  3ZVT A;  4WBG A;  4IBX A;  4OOL A;  2J9P A;  4S2J A;  4WZ5 C;  1NZU A;  4QD4 A;  5FAP A;  2A49 A;  3GTC A;  1ES3 A;  3OPL A;  2Z2L B;  4X55 A;  4BD1 A;  3HUN A;  4QJG A;  2BLS A;  4R4R A;  3ZG0 A;  1YLZ A;  5E43 A;  2CC1 A;  4KZ7 A;  5U47 A;  3UNW A;  4RA7 A;  1PZO A;  3VP3 A;  5A93 A;  3UE0 A;  1BZA A;  3N8L A;  4KZ8 A;  2Y2N A;  1EWZ A;  1KE0 A;  1FQG A;  1M40 A;  3LEZ A;  3TSG A;  3ZFZ A;  1JWZ A;  4Y7P A;  1I2S A;  2Q9N A;  2HP9 A;  3IWO A;  3OCL A;  2ZQC A;  4UA7 A;  2E8I A;  2EFX A;  1XPB A;  1E3U D;  1SHV A;  2ZJ9 A;  3D4F A;  1ES5 A;  3FKV A;  3G31 A;  5FDH A;  3G35 A;  3MKF A;  3IXB A;  5E2G A;  3MXS A;  3VP1 A;  4DRT A;  4ZJ3 A;  1E4D A;  2JBF A;  4KZ5 A;  3WWX A;  1XA7 A;  3W4O A;  1YM1 A;  2X71 A;  3ZHH A;  2EFU A;  3HVF A;  4LV2 A;  4GD8 A;  2DNS A;  1ERM A;  3VP4 A;  1IYP A;  1E25 A;  4KQQ A;  1LI9 A;  1W8Q A;  1KGG A;  4ZBE A;  2DRW A;  1K55 A;  4GZB A;  1ZG6 A;  4Z9Q A;  2PU2 A;  3V3S A;  3VOZ A;  3O86 A;  5DTT A;  1PWG A;  5KZH A;  3PAG A;  3BM6 A;  2A3U A;  4BJP A;  1FR1 A;  3W4Q A;  4HEF A;  3ZG7 B;  3TOI A;  3UDF A;  4S2K A;  4IVI A;  1AXB A;  1SDE A;  3BFC A;  3ZG9 B;  1KVM A;  3QNB A;  4ZDX A;  1PZP A;  2RL3 A;  2XH9 A;  3NDG A;  3IF6 C;  2WKE A;  4BEN A;  1K56 D;  5EPH A;  1G68 A;  4E3J A;  1JTD A;  4OH0 A;  4DDY A;  1LHY A;  3C4O A;  4IBR A;  5EVI D;  3HLG A;  3CJM A;  5CGX A;  4KQR A;  4KEN B;  3WRT A;  4JLF A;  1IEL A;  1TEM A;  1NXY A;  3HLE A;  4JBF A;  3FKW A;  2EX8 A;  1CEG A;  1DY6 A;  5M19 A;  1MBL A;  1TDL A;  4NK3 A;  2J7V A;  1MWR A;  3HLF A;  3Q1F A;  2I72 A;  2ZC7 A;  2XGN A;  4PM7 A;  3IF6 B;  4CJN A;  4E6W A;  2C6W B;  3TG9 A;  2EX9 A;  2XD5 A;  3N7W A;  5CGW A;  5GHZ A;  3MBZ A;  2XFS A;  1GHP A;  2ZM8 A;  4ZTK A;  4HBT A;  4B88 A;  4JXW A;  4GOG A;  3G32 A;  3DWK A;  4GNU A;  1QMF A;  3LY4 A;  1PI5 A;  4LEN A;  4OOM A;  5FI7 A;  4Y0T A;  1K38 A;  2X02 A;  3N4I A;  4JXS A;  4WEL A;  3WS5 A;  1H8Y A;  3SH8 A;  3LY3 A;  4OPY A;  4RYE A;  1PW1 A;  2WAD A;  4P85 A;  3UPN A;  1KGE A;  3EQU A;  1ZG4 A;  2ZM2 A;  1XKZ A;  3V5M A;  1NZO A;  4KZ4 A;  4YFM A;  1L0D A;  3UPO A;  4JF6 A;  4FCF A;  4KG5 A;  1ONH A;  1ESU A;  4MBH A;  3IXG A;  4X6T A;  3BFF A;  3AGE A;  4L0L A;  5CHM A;  5E2H A;  3SS3 A;  3DWZ A;  3W8K A;  3S1Y A;  2WGV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...