5GHYA

Crystal structure of beta-lactamase penp mutant-e166h in complex with cephaloridine as "post-acylation" intermediate
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
256
structure length
256
Chain Sequence
b'DDFAKLEEQFDAKLGIFALDTGTNRTVAYRPDERFAFASTIKALTVGVLLQQKSIEDLNQRITYTRDDLVNYNPITEKHVDTGMTLKELADASLRYSDNAAQNLILKQIGGPESLKKELRKIGDEVTNPERFHPELNEVNPGETQDTSTARALVTSLRAFALEDKLPSEKRELLIDWMKRNTTGDALIRAGVPDGWEVADKTGAASYGTRNDIAIIWPPKGDPVVLAVLSSRDKKDAKYDDKLIAEATKVVMKALN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Crystallographic Snapshots of Class A beta-Lactamase Catalysis Reveal Structural Changes That Facilitate beta-Lactam Hydrolysis
pubmed doi rcsb
source organism Bacillus licheniformis
molecule tags Hydrolase
total genus 91
structure length 256
sequence length 256
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2016-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5ghyA00
3Q81A 5KMWA 5AQAA 3C4OA 1WYCA 1WYBA 4IVIA 1XXMA 4BL2A 1YLWA 3NDEA 1BSGA 1YLZA 3G35A 3M2JA 1VQQA 3UE0A 1ESIA 2IWCA 3G2ZA 5EVIA 2XDMA 1DJBA 4MBKA 2WKHA 4Q8IA 4ID4A 1G68A 2CC1A 5FQ9A 4KZAA 3PTEA 1ZKJA 1YLTA 3DTMA 5M18A 2WGWA 4Y0TA 3C7VA 4OKPA 5FQJA 3GQZA 5E43A 5EE8A 4WELA 3IXDA 4F94A 2Q9MA 1ES4A 3OZHA 4NETA 1H5XA 4GD8A 3ZG0A 4O7DA 1Y54A 3O3VA 4S2KA 5CHUA 2BG1A 3ZG8B 5EVIC 1KE0A 1TDGA 1ES3A 1RGYA 1ZG6A 2P74A 1L0DA 4UA9A 3ZG9B 4DE2A 1BULA 4IVKA 5CTNA 2G2WA 4X6TA 3GVBA 1K56D 5BOHA 3ZHHA 1K6SA 5DF9A 1PYYA 5CERA 4KZ5A 3HVFA 5HFOA 4PM6A 2WKIA 2HP6A 4OVDA 4A5RA 3ZVTA 4MEZA 4UHUA 5FI2A 2ZC4B 2Y2PA 3ZNTA 1N4OA 3M6HA 3NC8A 3MZEA 5CHJA 4Z9QA 4P87A 2A3UA 4FCFA 5DTSA 4U0TA 5HAQA 3Q7VB 3BYDA 4S2NA 1ERQA 3PBQA 1PW8A 2PU4A 4OQIA 1ES5A 4S2MA 1JTDA 1ZG4A 3C7UA 3VMAA 1ONGA 5KZHA 4FH4A 1QMFA 1W79A 1JWPA 2XD1A 1GCEA 2VGKA 1GA0A 3IHAA 4KG6A 4GN2A 3AGFA 4KZ9A 4WBGA 3UDFA 1YLPA 2HDSA 1PZOA 2GDNA 3N7WA 1NRFA 4OOMA 1ERMA 1PIOA 3IHBA 1L0EA 4K91A 2ZD8A 4R23A 5KSCA 3UPPA 3JYIA 2Y59A 3W4QA 4GOGA 4X69A 3GV9A 5CRFA 4E3LA 1XP4A 1E3UA 3PAEA 1JVJA 5FQIA 4S2NC 3MBZA 1L0FA 2G2UA 2BLSA 2ZQAA 1CEGA 4EWFA 2C6WB 3UPOA 2JCHA 3BFDA 1MKIA 2J9OA 4IBXA 4GD6A 1Z6FA 1HVBA 1L0GA 3FYZA 4WZ4A 4NK3A 5EVLA 1KE3A 1IKIA 4OPQA 5FSRA 2XH9A 4MNRA 5GHXA 2Y2NA 1YLJA 2WGWB 2OLUA 1BLCA 2C5WB 3VP4A 4LV1A 5F1GA 4DDSA 3MFDA 4EQIA 1EI5A 3SH9A 3M6BA 4OP8A 1GA9A 3IT9A 4LENA 2ZLYA 4N92A 4QB8A 1J9MA 2XQZA 3LO7A 3OPLA 4OOYA 2WYXA 2XEPA 3HLBA 4UAAA 1U60A 2XF3A 2Y55A 1ESUA 4M3KA 4QJGA 1BLSA 1DJAA 3SS3A 1Q2QA 5EPHA 1C3BA 3A3FA 2J9PA 3IH9A 3TOIA 4KENB 3NIAA 4PMAA 3SH7A 1DY6A 3QNCA 1GHMA 2X01A 4E3NA 4WEJA 1BT5A 2ZM2A 5JYPA 2EXBA 2WGVA 3Q7VA 4RYEA 1EROA 1WE4A 2OV5A 1K56A 5EOEA 3GMWA 2P9VA 3ITBA 1VM1A 5J8XA 1RGZA 1BZAA 2E8IA 3MKEA 3LY4A 1FOFA 2A49A 5F1FA 4OH0A 5CEDA 2Y2KA 2Y4AA 5DF8A 3ZG7B 1MY8A 1TEMA 3O86A 3MKFA 2WK0A 2Y2LA 5IHVA 2IWDA 4ZTKA 4L0LA 2WZZA 4Y0UA 3BRMA 3WRZA 4JF5A 3IWQA 2XGNA 3GSGA 3FZCA 3UE1A 3HLCA 3FV7A 3HREA 3G2YA 1ALQA 3OPHA 3C5AA 5FQKA 1LI9A 1M6KA 1FCMA 4KZ3A 4HBUA 4ZJ3A 3Q82A 5FAQA 1FR6A 4MLLA 5TFQA 4ZDXA 4RVAA 4S2OA 2Y2GA 4S2LA 1XGIA 5HL1A 1BUEA 2ZQ8A 2H5SA 3O88A 2V1ZA 3NCKA 4Y7PA 5FAPA 2ZQDA 4DDYA 3NBLA 2XFSA 4DE0A 3VP1A 4HESA 4H8RA 1K4FA 1HTZA 1S0WA 4P6BA 4BQMA 1ZC2A 3HL9A 4N9LA 4OLDA 4KQQA 1L2SA 2XFTA 3RJUA 2X02A 5CEBA 3ZVWA 1IKGA 4JPMA 2WUQA 1S6RA 2ZM8A 3CJMA 3ZGAB 5FQMA 3VOYA 5EECA 4GDBA 1MXOA 3MZFA 5E2GA 2XD5A 2EX9A 3N4IA 5CXWA 1SKFA 1TVFA 3IQAA 4HBTA 1YLYA 5U47A 2DCFA 1IYPA 2HDRA 3MXRA 3TG9A 2QPNA 4Y0OA 3I7JA 2P9VB 2Q9NA 1PI4A 1LHYA 3NDGA 2IWBA 4OLGA 5I94A 1I5QA 1GHIA 3VSLA 3HLGA 4EUZA 5M1AA 1XA1A 4D2OA 2EXAA 3W8KA 4CPKA 3ZDJA 2FFYA 3V50A 3HLDA 2H0TA 3OC2A 1O7EA 4WMCD 5EUAA 3LEZA 4QU3A 4KZ7A 4WM9A 4UA6A 5DTTA 1FQGA 3G34A 1O07A 4C6YA 3Q7ZA 3OPRA 4ZBEA 5DVAA 3A3EA 4S2JA 4R0QA 2XK1A 3TSGA 3BECA 4ZJ1A 1E4DA 3S22A 4DXCA 1IEMA 2ZQCA 2Y2IA 1QMEA 3OPPA 1LL5A 4LV2A 4OOLA 5CGWA 4KZ8A 4N9KA 4E6XA 4GDNA 4JBFA 1LI0A 2UWXA 4EV4A 4S2PA 1K6RA 1KVMA 2FFFB 2EFXA 4MBFA 4R3BA 2XLNA 1Q2PA 3HLEA 4OONA 4UA7A 1BLPA 1KVLA 1N9BA 1PWDA 3GTCA 1K25A 3DWKA 4C75A 4OPZA 1RP5A 1KDSA 5E2FA 1LLBA 2R9WA 2PU2A 1SCWA 4RX2A 1FSWA 2WGIA 1NY0A 2OLVA 4RX3A 2VGJA 1MWTA 1YM1A 4KQOA 3UO9A 3UY6A 5FI6A 3V3SA 3QNBA 1AXBA 1CI9A 1G6AA 3CZDA 3N6IA 2WADA 1XA7A 5CGXA 1ONHA 3OCLA 3SOIA 1KGEA 3HLWA 2HP9A 3ZFZA 1XX2A 4KZ4A 1NXYA 4JXGA 3V5MA 5GLCA 4WZ5A 4JF6A 4B4ZA 1CI8A 1IYQA 1W8YA 3BFCA 3ZCZA 4EBPA 1BTLA 4KQRA 3ZG5A 2JBFA 4JLFA 1I2SA 5EOOA 4E3IA 3WS4A 4N1XA 2HDQA 5TGFA 3N8SA 1IYOA 2EX2A 2DNSA 1FR1A 5AQ7A 3UN7A 4P85A 1MBLA 3E2LA 1XKZA 5G18A 1H8YA 1TDLA 3BM6A 3ISGA 4P0MA 1KDWA 4OPRA 2ZJ9A 4DE3A 4DF6A 4FSFA 4PM9A 5HAPA 1MWUA 1M40A 1BLHA 2B5RA 4WZ5C 4DKIA 3VP2A 5DTKA 4X53A 4GNUA 5HAIA 3HUMA 2ZQ9A 1RCJA 5FATA 1K57A 4LV3A 1W8QA 1MWRA 2Z2LB 1NYYA 3MZDA 3WRTA 3VOZA 1PW1A 3HLFA 1W5DA 3ZNYA 4WMCA 3WS1A 2X71A 3W4PA 3NY4A 5FA7A 1JWZA 5D3OA 2XR0A 2H10A 3RXWA 3BFEA 1E25A 1HZOA 3B3XA 4BENA 4DE1A 3MXSA 3HUNA 4QHCA 4R4SA 1OMEA 3PBSA 3SS5A 4E3MA 5AQ9A 5GLBA 3S1YA 4KG5A 4QY6A 1K57C 4N1HA 5CTMA 3FWLA 1HD8A 4PM5A 2J8YA 2V2FF 4JXSA 1MPLA 3BLSA 4U0XA 2WAEA 5FI7A 3BFFA 1K54A 2WKEA 4KZBA 2OSUA 1PI5A 3P98A 3A3JA 4E6WA 4GB7A 3Q1FA 4U3TA 1CEFA 3LY3A 4GKUA 1JWVA 2PBYA 1KGFA 1LL9A 2ZC6B 3SS4A 3G30A 4OP5A 2RCXA 3AGDA 5GLDA 4OQ0A 3EQVA 1YMSA 3D4FA 4K0XA 1SDEA 4K0WA 4X56A 3UDIA 3N8LA 5GL9A 4E3JA 2Y2QA 3G4PA 4X55A 2QMIA 1K54C 1PZPA 3WS2A 5GHYA 4B88A 4CJNA 5A90A 1H8ZA 4S2IA 4LCMA 1FSYA 4GZBA 3VFHA 3VP0A 2Y2JA 5HW3A 2ZC5B 4JXVA 3N8RA 3IF6B 5L2FA 3UPNA 4BLMA 3UE3A 4EBNA 2ZQ7A 5A93A 3IXGA 4E3OA 4EBLA 3UDXA 2HPBA 1FCOA 4LCLA 1K55A 2HDUA 3HUOA 5FQQA 5JYOA 1SHVA 1IELA 4R1GA 1PWCA 2HP5A 3HBRA 3FKVA 3ITAA 3NI9A 1KGGA 3LCEA 4HEFA 5E2HA 5F82A 3FKWA 2JC7A 5FAOA 2DRWA 2J7VA 5M19A 3SH8A 5AQBA 2Z2MB 3EQUA 3BFGA 2Y91A 1K4EA 4KZ6A 3W4OA 5CGSA 5EVID 2JE5A 4JXWA 5F83A 4YFMA 4R3JA 3AGEA 1K55C 2EX6A 4XUZA 4ZJ2A 1NYMA 2Y2OA 3V3RA 4LV0A 4B4XA 3Q07A 2H0YA 2WZXA 1JTGA 4OQGA 5EVIB 5TR7A 4KG2A 3V39A 1NZOA 4E3KA 4IEDA 3PBOA 4MBHA 3RXXA 3PBRA 5FDHA 4QD4A 4XUXA 3IXBA 3DWZA 2EFUA 4XXRA 3QHYA 3WS5A 3VP3A 2WAFA 3GR2A 4X68A 4BJPA 3PBNA 5E2EA 3UNWA 5A91A 2ZC7A 1GHPA 1NJ4A 1DJCA 2Y2MA 3WWXA 1EWZA 1YQSA 4FH2A 3IF5A 1PWGA 1W7FA 1ES2A 1XPBA 3IWOA 4YINA 5GHZA 4BD0A 4C3QA 1I2WA 5KSHA 4DXBA 2R9XA 1CK3A 5A92A 1IYSA 4OQHA 1YMXA 1XGJA 1SDNA 1YT4A 3CMZA 4FD8A 5FASA 3IF6A 2I72A 5CECA 3DW0A 3PAGA 2ZC3B 3S4XA 3E2KA 4RA7A 3P09A 3O87A 4OPYA 3IH8A 3OCNA 5HX9A 4DRTA 2ZMAA 2V20A 3G32A 3A3IA 4PPRA 4WYYA 3IWIA 1MWSA 3BEBA 3M2KA 3BLMA 4WEKA 3A3DA 2Y2HA 5HARA 2RL3A 4BD1A 5DF7A 4ZAMA 4PM7A 4QY5A 3PBTA 1E3UD 3IF6C 4IBRA 4R4RA 2ZM0A 3VSKA 3WS0A 1KE4A 2EX8A 4JKTA 5CHMA 3CG5A 3GRJA 3IXHA 5GLAA 3C4PA 3G31A 2QZ6A 4JF4A 4BL3A 1FCNA 1K38A 3VFFA 4PM8A 1NZUA
chains in the Genus database with same CATH superfamily
5KMWA 1LSWA 4IVIA 1YLWA 1BSGA 2IWCA 4MBKA 2WKHA 3MMHA 1G68A 1T1AA 5E43A 5EE8A 2L1MA 4LRZE 2Q9MA 1D1JA 3JPUA 5AVFA 3ICYA 2FZ0A 4O7DA 3O3VA 1KE0A 1TDGA 1ES3A 4EEPA 1RGYA 4UA9A 3ZG9B 4IVKA 2G2WA 5DF9A 5CERA 4KZ5A 2HP6A 1WA9A 3F1OB 4MEZA 2ZC4B 3ZNTA 5CHJA 4Z9QA 1OTDA 4U0TA 5HDSA 3Q7VB 3BYDA 3F1PA 1ONGA 1QMFA 2XD1A 1JWPA 4KZ9A 4P6ZM 2HDSA 1NRFA 2OAQ1 1VETB 4R23A 4I3IA 2LB5A 4GOGA 3QP4A 3C30A 4RQ9A 2VV7A 3CUEC 2MJ6A 4O01A 1FILA 2BLSA 4I38A 3UB9A 1MKIA 1S4SA 1HVBA 3FYZA 5EVLA 1KE3A 4MNRA 2OAP1 5GHXA 4L9FA 1YLJA 4R70A 3T1QB 2W3FA 3SH9A 2GNXA 4QB8A 4N92A 1J9MA 2XQZA 2WYXA 1U60A 2XF3A 3KSGA 4NXGA 3IH9A 3NIAA 4PMAA 3SH7A 2IA2A 1Z09A 2X01A 1NLYA 4EESA 1EROA 3GMWA 2P9VA 3LUQA 3HCYA 5J8XA 1RGZA 2INWA 3TE8A 2V8CA 2Y2KA 1PRQA 1MY8A 3O86A 2VKSA 4JF5A 3K3CA 3FZCA 2VJWA 3C5AA 3H7WA 2QJ7A 1F98A 4ZJ3A 4Y15A 3EGDC 3QP6A 2Y2GA 4S2LA 3CPTA 5FAPA 4GS9B 5J4EA 4FOFA 2QJ5A 3UB7A 2BASA 3BWLA 1HTZA 4LLOB 4OLDA 3NOTC 3UB8A 4CLCD 4DJ2A 4ZRRA 3CJMA 2ZM8A 3VOYA 5IS1A 4Q0HA 4HP4A 5E2GA 2XD5A 3N4IA 4HBTA 1YLYA 2HDRA 3MXRA 1P9RA 3I7JA 3PR6A 1V9ZA 2LB9A 1GHIA 4D2OA 2EXAA 3W8KA 4CPKA 3V50A 3OC2A 4WMCD 4UA6A 4NXEA 2ZMVA 3OPRA 5L8MA 5DVAA 3S7QA 1VEUB 1IEMA 4ETZA 2Y2IA 2G7UA 2ZOHA 5J7EA 2FFFB 4MBFA 2XSSA 1ZTUA 2HGVA 2JKGA 1Q2PA 1N9BA 2D01A 4OPZA 1FIKA 2ZOIA 2PU2A 1SCWA 2OLVA 2VGJA 1V9YA 1YM1A 4KQOA 3UO9A 3CZDA 1GSXA 5CGXA 3SOIA 3ZFZA 4B93A 2PT7A 5DKKA 4WZ5A 4JF6A 3IS2A 1IYQA 3BFCA 4EBPA 3CHWP 4GCZA 4E04A 3N8SA 2EX2A 4I5SA 4F3LA 2DNSA 1G28A 5AQ7A 3UN7A 4P85A 5EV0A 3ISGA 2M1CA 3EEAA 1BLHA 4DKIA 4GNUA 2A2LA 1MWRA 1NYYA 1PW1A 5F6AA 2B18A 4X1LA 3W4PA 5L09A 4HH2A 3RXWA 4NG2A 3B3XA 4DE1A 3HUNA 3T1XA 2HZ5A 4JXSA 2WAEA 3PYPA 1XJ6A 4U3TA 4JGPA 3LY3A 4GKUA 4YOFA 3L7HA 1Y28A 5IU1A 5HWTA 3EQVA 1T1BA 3BQ8A 2JN7A 3PXPA 3T12B 4E3JA 3BQAA 2QMIA 1K54C 1PZPA 3T4JA 3WS2A 4II7A 3KX0X 5HW3A 2ZMFA 4JXVA 4BLMA 4EBLA 3ULFA 2JKTM 4NKPA 2HDUA 1IELA 4R1GA 4M4XA 1PWCA 3HBRA 4HEFA 2DRWA 5AQBA 3RH8B 4KZ6A 3TJZC 5DKLA 4YFMA 3AGEA 1ACFA 4GHIA 4ZJ2A 3MR0A 4LV0A 3Q07A 2WZXA 1PNEA 5TR7A 3V39A 1NZOA 4MBHA 2P7JA 5FDHA 4K08A 4XUXA 3DWZA 3QHYA 3VP3A 1YAXA 2PD8A 3O5YA 3PBNA 3C8CA 2Y2MA 3WWXA 4FH2A 3IF5A 1PWGA 1W7FA 1I2WA 2W3GA 1CK3A 5A92A 2O0YA 5FL3A 4OQHA 4FD8A 3CMZA 3IF6A 5CECA 2CMNA 3PAGA 2O99A 3S4XA 1P97A 2V1BA 2V20A 4Y2FA 4MN7A 3A3IA 4PPRA 4WYYA 1GSWA 1MKMA 4BD1A 3F1PB 5DF7A 4R4RA 2ZM0A 3ZYTA 4JKTA 1H3QA 4IJGA 2QZ6A 3KYEA 1XXMA 2L0WA 1YLZA 3G35A 1VQQA 3UE0A 4D60A 2O9CA 2HJ9C 5FQ9A 4Y0TA 3IXDA 3OZHA 1Y54A 4JGOA 4S2KA 5FEGA 5HPIA 4O8GA 3DAVA 1OT9A 2P74A 1L0DA 4DE2A 4Q0JA 5BOHA 2EA9A 4PM6A 4UHUA 2Y2PA 1N4OA 3NC8A 2VV6A 4EW7A 4P87A 2A3UA 5DTSA 4S2NA 2WKRA 4FH4A 1GCEA 5F1FA 1GA0A 3UDFA 3AGFA 1BYWA 1YLPA 4OOMA 1ERMA 2Z6DA 3IHBA 5KSCA 2Y59A 3W4QA 1S4RA 3GV9A 5CRFA 3P01A 3QP1A 3T4TA 1E3UA 3KSHA 3MBZA 1L0FA 4HIAA 2ZQAA 3UPOA 2JCHA 3H7WB 1HLUP 4GD6A 1Z6FA 1L0GA 4NK3A 2A24A 1IKIA 4LRXC 2WGWB 2OLUA 4HY8A 5F1GA 3MFDA 4EQIA 3LO7A 4OOYA 3KSFA 4FUWA 2XEPA 2Y55A 1BLSA 1DJAA 3SS3A 4KENB 4E3NA 1TF1A 3IX3A 2EXBA 4RYEA 4CLCA 2PBDP 1K56A 3T4QA 2Z6CA 4IUKA 5F68A 3MSHA 1VM1A 3DTKA 2Y4AA 3ZG7B 2WK0A 3D3OA 2WZZA 3LIEA 1P9WA 3IWQA 2XGNA 3S7PA 5A8BA 3G2YA 5FQKA 1LI9A 1M6KA 1S1ZA 1FCMA 4KZ3A 5HL6A 5HZHA 5TFQA 4ZDXA 4RVAA 4S2OA 4DMZA 3BW6A 2ZQDA 4P6BA 4BQMA 3HL9A 1L2SA 3FPWA 3LIDA 2X02A 5CEBA 3ZVWA 3LI9A 4JPMA 2WKQA 1S6RA 1P0ZA 5FQMA 3IS2B 1MXOA 5U47A 4HOIA 3TG9A 2QPNA 1G6OA 2Q9NA 1PI4A 4F3LB 3VSLA 5M1AA 3ZDJA 4WM9A 4BMWA 1O07A 4R3AA 3Q7ZA 3A3EA 4WLAA 3TSGA 3BECA 3S22A 2PYRA 1NLZA 4OOLA 4B9OA 4N9KA 2B95A 2HJEA 2W3HA 4FTXA 1PWDA 1RP5A 5E2FA 1LLBA 3U2AA 1FSWA 4ESPA 3QNBA 1CI9A 2D02A 2HP9A 4KZ4A 5GLCA 1VB6A 4ARZA 4KQRA 2P08A 3B33A 3LIAA 3HJIA 5EOOA 4E3IA 2VEAA 2HDQA 4N1XA 1IYOA 1F9IA 2FH5A 1N9NA 1XKZA 1H8YA 1TDLA 4OPRA 2VGLM 4FSFA 1M40A 4WZ5C 3VP2A 5HAIA 1K57A 1W8QA 2Z2LB 3MZDA 4I3AA 1W5DA 2YKFA 3QP2A 3NY4A 2XR0A 2K2NA 3BFEA 3NECA 1E25A 1IFQA 3SS5A 1NWZA 3KO6A 5AQ9A 4KQDA 4QY6A 3UB6A 3E0YA 4PM5A 1HD8A 2J8YA 4GHIB 1MPLA 3BLSA 2J80A 4CLCE 3CITA 2WKEA 4KZBA 2OSUA 3P98A 4HQAA 4GB7A 1CEFA 1JWVA 1KGFA 1LL9A 2ZC6B 3UMDA 4IUHA 3NHQA 3AGDA 2NUTC 2PDRA 4K0XA 2YKHA 1SDEA 2Y2QA 5GHYA 1TS8A 3E98A 3A0VA 4Q0IA 3F1NA 4GZBA 3GDIA 3D72A 5IT5A 2Y2JA 3IF6B 5L2FA 2HF6A 2PYPA 3UDXA 1K55A 3MF0A 4LGWA 1SHVA 2HP5A 4PHTA 3NI9A 4EU0A 3FKWA 3A0RA 5FAOA 3SH8A 3K3DA 2Z2MB 4JXWA 3L9KA 3S7OA 4EETB 2H0YA 3DTEA 2ZL1A 1JTGA 4OQGA 4HJ6A 3RXXA 3PBRA 4QD4A 4XXRA 3FC7A 3G6OA 4X68A 4BJPA 4MDZA 3LIFA 5E2EA 5A91A 3LIBA 1DJCA 1DP9A 4EXOA 4YINA 3BY8A 1IYSA 1YMXA 1XGJA 5FASA 2I72A 3DW0A 1LSVA 3E2KA 3LR0A 3MQ0A 3P09A 4KUOA 4OPYA 5HX9A 3E4OA 3LEQA 3M2KA 3BLMA 3DBAA 1N9OA 5HARA 2RL3A 4BBVA 5EFWA 5MC7A 1TD5A 2HV1A 2GX5A 2PAVP 1VETA 4QY5A 3T4OA 3PBTA 2K31A 3IF6C 3VV4A 1KE4A 5CHMA 5DFXA 3G31A 2KX6A 3U4LP 4BL3A 1K38A 3VFFA 5F82A 3Q81A 5AQAA 1CQAA 3C4OA 4PKYA 1T18A 5EVIA 2ACGA 1ODVA 4Q8IA 3BY9A 4KZAA 3PTEA 1ZKJA 1YLTA 3DTMA 5M18A 4OKPA 3GQZA 2K7SA 5TJJA 3B47A 4F94A 5HWVA 4UQIS 4NXBA 1H5XA 2O9AA 3ZG8B 5CHUA 2V9AA 1BULA 2PRFA 1K6SA 3IBJA 1PYYA 4MCWA 2Y8HA 2AVXA 3M6HA 5HAQA 1ERQA 3PBQA 1PW8A 2PU4A 4OQIA 1ES5A 4S2MA 1JTDA 1ZG4A 3C7UA 1UWPX 5HDDA 1W79A 2VGKA 4KG6A 4GN2A 1PZOA 2GDNA 3LR3A 2J3WA 1PIOA 1L0EA 4K91A 4DN0A 3JYIA 1W63Q 4X69A 4E3LA 1XP4A 4XT2B 4S2NC 3LGOA 1CEGA 4EWFA 3FPVA 2J9OA 4PAUA 3NULA 4IBXA 4BBUA 1OJ5A 1T1CA 4EUVA 4OPQA 4L9GA 5FSRA 4GS9A 2C5WB 3VP4A 4LV1A 2M7UA 1EI5A 3TRCA 3M6BA 4OP8A 4QJGA 1Q2QA 5I5LA 1W63M 1C3BA 3A3FA 2J9PA 3TOIA 1N9LA 1LSXA 1GHMA 1OTEA 1STZA 4WEJA 1BT5A 4G3KA 1WE4A 2OV5A 3SW1A 3ITBA 2KLIA 3MKEA 3LY4A 1FOFA 2A49A 5CEDA 3LYXA 5HSQA 4LFUA 1TEMA 1K0KA 3MKFA 5IHVA 2IWDA 4ZTKA 5FEFA 4CLCC 3WRZA 1F2KA 3KYQA 3IBRA 3EGXC 4P6ZS 3FV7A 3OPHA 2WKPA 2ZBBA 4HBUA 2W3DA 3Q82A 5FAQA 4MLLA 5HL1A 1BUEA 2ZQ8A 3OLOA 2H5SA 3NCKA 2VX8A 3NBLA 2XFSA 3GECA 4DE0A 3VP1A 4HP9A 4HESA 1MC0A 3FG8A 1GSVA 4HH3A 3KYZA 4N9LA 2PR5A 3LR4A 1IKGA 2VZWA 4Z1WA 2WUQA 2W3EA 3MQOA 4UEYA 4GLQA 4ARZB 3MZFA 2EX9A 3CI6A 5CXWA 1TVFA 4H6JA 4Y13A 4HI4A 1IYPA 2M7VA 5J3WA 2P9VB 2IWBA 5I94A 4JGRA 2BTFP 4I3JA 1IOUA 4EUZA 1J3WA 5L10A 2FFYA 3HLDA 1O7EA 5EUAA 3LEZA 4QU3A 1SZVA 4C6YA 4ZBEA 4R0QA 2XK1A 1PFLA 2JKRI 2KDKA 5C5KA 2E8JA 5EVEA 1E4DA 2ZQCA 1QMEA 1LL5A 5CGWA 4KZ8A 4GDNA 3VE4A 4S2PA 1K6RA 4QWOA 1KVMA 4R3BA 3CPTB 3T4KA 1BLPA 1KVLA 3DWKA 4C75A 1XJ3A 4NEED 4NXFA 5DJTA 3QP5A 4RX2A 1TS7A 1H8MA 2WGIA 4RX3A 3R7WA 3UY6A 3V3SA 5FI6A 4EERA 1G6AA 2WADA 4O0PA 3OCLA 1KGEA 3HLWA 1XX2A 1NXYA 3MQQA 5F69A 1CI8A 3ZCZA 1BTLA 3ZG5A 1OTAA 5FDSA 4JLFA 1I2SA 2VV8A 3LFVA 3WS4A 5TGFA 1JNUA 1FR1A 1MBLA 4DE3A 3F1NB 4DF6A 1MWUA 3OOVA 4JGQA 3HUMA 2ZQ9A 5FATA 4LV3A 3WRTA 2JHEA 2QHKA 3HLFA 1VHMA 3HJKA 4WMCA 1YKDA 3WS1A 4EQ1A 2JKTI 4R38A 2DMWA 5FA7A 1JWZA 2H10A 4X25A 1DP8A 3JVVA 3H82A 3PBSA 4KG5A 1K57C 5CTMA 3FWLA 5DFYA 2V2FF 4QPRA 4HHDA 4U0XA 1S1YA 3B42A 4KUKA 4E6WA 1XFQA 2ZL1B 5TBMA 2PBYA 2J3TC 3DTIA 3IX8A 3SS4A 3G30A 4OP5A 5GLDA 2GJ3A 1YMSA 4X56A 3G4PA 1NRJA 2OOLA 4X55A 4B88A 4CJNA 5A90A 1H8ZA 4S2IA 3VFHA 2ZC5B 2H28A 3UPNA 3UE3A 2ZQ7A 3IXGA 4E3OA 2HPBA 1FCOA 1DRMA 2XA7M 3SZTA 2W0NA 3T1RA 3RFBA 1KGGA 3LCEA 3CAXA 5E2HA 5HD5A 2JC7A 5M19A 2J7VA 3EQUA 3IX4A 3VE3A 5CGSA 1SKOA 5F83A 4R3JA 1K55C 1NYMA 3V3RA 3QP8A 2NUPC 5EVIB 3MXQA 4HJ3A 4IEDA 3IXBA 3H9WA 5AJGA 4EEUA 3WS5A 2WAFA 3GR2A 1LT0A 3A0SA 4YWZA 1XJ4A 1NJ4A 1EWZA 1YQSA 5L07A 1ES2A 1XPBA 5GHZA 4BD0A 4C3QA 2R78A 5KSHA 4MN6A 4DXBA 2OWJA 1YT4A 1SDNA 5KIZA 5HPFA 2ZC3B 2W1TA 3O87A 3IH8A 3G32A 3IWIA 4WEKA 1X0OA 4G3VA 2P04A 4LRYC 2V8FA 2QWSA 4PM7A 4LPZA 1E3UD 3VSKA 2EX8A 3CG5A 3IXHA 2UV0E 4Y3IA 5GLAA 3C4PA 4CQHA 4JF4A 4PM8A 1NZUA 3W2ZA 1WYCA 1WYBA 2VLGA 4BL2A 5K5BA 3NDEA 3M2JA 1ESIA 3G2ZA 1A0KA 2XDMA 1DJBA 4ID4A 3UE6A 2CC1A 4GW9A 2WGWA 3C7VA 5FQJA 4WELA 1KOUA 3E4PA 1ES4A 4NETA 4GD8A 3ZG0A 4Y5FA 1L3LA 3OBFA 2BG1A 2V1AA 5EVIC 1OTIA 1ZG6A 3ZQ5A 5CTNA 4X6TA 3GVBA 1K56D 3ZHHA 1Y4OA 3HVFA 5HFOA 2WKIA 4OVDA 4A5RA 3ZVTA 5FI2A 3V67A 3MZEA 4BWIA 3CUEA 4FCFA 3D9YA 3VMAA 5KZHA 3T50A 4WBGA 4R6LA 3IHAA 1YPRA 3N7WA 4DJ3A 4WL9A 2ZD8A 1YSPA 3UPPA 5AVEA 3KSIA 3NJAA 3PAEA 3C2WA 1JVJA 5FQIA 2G2UA 3S7NA 1UWNX 2C6WB 3BFDA 4WZ4A 2XH9A 2Y2NA 1BLCA 3CWFA 4DDSA 1GA9A 3IT9A 4LENA 2ZLYA 1ZHHB 3OPLA 4UAAA 3HLBA 5F5YA 1ESUA 4HJ4A 4M3KA 5EPHA 3P7NA 3E4QA 1EW0A 2PHYA 1DY6A 2GZAA 3F1OA 3QNCA 2V0UA 2EWWA 2ZM2A 5JYPA 2WGVA 3Q7VA 5EOEA 4H6JB 1BZAA 2E8IA 4GJ4A 4OH0A 1S66L 2PR6A 3K2NA 1F5MA 2QKPA 5DF8A 2Y2LA 1S67L 2JKRM 4L0LA 4Y0UA 3BRMA 4YNRA 1TS0A 3GSGA 3UE1A 3HLCA 3HREA 3TW8A 1ALQA 1CF0A 1OT6A 1FR6A 3MFXA 3LI8A 1XGIA 5EM0A 2A24B 3O88A 2V1ZA 5HDCA 1AWIA 4Y7PA 4MMNA 4DDYA 2B02A 4H8RA 1K4FA 1S0WA 1ZC2A 3VOLA 4KQQA 2XFTA 3R7WB 3RJUA 4AFIA 4G3WA 2VK3A 3ZGAB 5EECA 4GDBA 1SKFA 3IQAA 5HD3A 4CLCB 2DCFA 2Q0OA 1OJGA 1OPXA 4Y0OA 3NDGA 1LHYA 4OLGA 1I5QA 3HLGA 3LICA 1XA1A 1DP6A 2H0TA 4KZ7A 5DTTA 1FQGA 1H0MA 3G34A 4S2JA 2I9VA 4ZJ1A 2J3TD 4DXCA 3OPPA 4LV2A 4E6XA 4JBFA 1LI0A 4PKYG 2UWXA 4EV4A 5HWWA 2EFXA 2XLNA 1UGUA 3H82B 3HLEA 3JVUA 4UA7A 4OONA 3GTCA 3T4SA 1K25A 2W1RA 3EOIA 1KDSA 2R9WA 4L9EA 1NY0A 2QYBA 5EM1A 1MWTA 3LR5A 1AXBA 3N6IA 1XA7A 1ONHA 5TBMB 4JXGA 3V5MA 4B4ZA 1W8YA 2JBFA 3EWKA 3E2LA 5G18A 3BM6A 2Y79A 4P0MA 1KDWA 2ZJ9A 4I39A 1G5UA 4PM9A 5HAPA 2B5RA 5DTKA 1D06A 4X53A 1RCJA 4Y17A 3ZNYA 4ME4A 3VOZA 1TS6A 1VEUA 2W27A 3UB5P 3RTYA 5LBRA 2X71A 3C38A 5D3OA 2L4RA 3MS6A 3EEHA 1HZOA 4BENA 2XA7S 3UMEA 3MXSA 4E3MA 4QHCA 4R4SA 1OMEA 1LL8A 1SKOB 5GLBA 3S1YA 4N1HA 5G4ZA 4IHQA 5FI7A 3BFFA 3PHYA 1K54A 5CX7A 4WF0A 1PI5A 3A3JA 3Q1FA 2OWHA 4HNBA 2XROA 2RCXA 1D7EA 4OQ0A 3D4FA 4K0WA 3UDIA 3N8LA 5GL9A 2JKFA 4LCMA 1FSYA 1MZUA 3VP0A 1XJ2A 3N8RA 3NOPC 4EBNA 5A93A 5G4YA 4LCLA 2W1TB 3HUOA 5FQQA 3NOUC 5JYOA 2KOIA 4X1MA 2VGLS 3ITAA 3FKVA 3T1SA 2EWVA 3BFGA 2Y91A 5DJUA 1K4EA 3W4OA 3CLOA 5EVID 2JE5A 2PD7A 3BJNA 4WN5A 2EX6A 4XUZA 2Y2OA 4B4XA 4UQIM 4BBTA 3R4KA 4KG2A 4E3KA 2O9BA 1T19A 3PBOA 2EFUA 4MN5A 2XRNA 1CJFA 3UNWA 2ZC7A 1GHPA 3IWOA 4ETXA 1OTBA 2R9XA 4RA7A 3OCNA 4DRTA 2ZMAA 1YSQA 1MWSA 3BEBA 3A3DA 1XFNA 2Y2HA 2V0WA 4ZAMA 4WUJA 4IBRA 3WS0A 3T4LA 3GRJA 3MJQA 4XT2A 1FCNA 2VA0A
chains in the Genus database with same CATH topology
3Q81A 5KMWA 5AQAA 3C4OA 1WYCA 1WYBA 4IVIA 1XXMA 4BL2A 1YLWA 3NDEA 1BSGA 1YLZA 3G35A 3M2JA 1VQQA 3UE0A 1ESIA 2IWCA 3G2ZA 5EVIA 2XDMA 1DJBA 4MBKA 2WKHA 4Q8IA 4ID4A 1G68A 2CC1A 5FQ9A 4KZAA 3PTEA 1ZKJA 1YLTA 3DTMA 5M18A 2WGWA 4Y0TA 3C7VA 4OKPA 5FQJA 3GQZA 5E43A 5EE8A 4WELA 3IXDA 4F94A 2Q9MA 1ES4A 3OZHA 4NETA 1H5XA 4GD8A 3ZG0A 4O7DA 1Y54A 3O3VA 4S2KA 5CHUA 2BG1A 3ZG8B 5EVIC 1KE0A 1TDGA 1ES3A 1RGYA 1ZG6A 2P74A 1L0DA 4UA9A 3ZG9B 4DE2A 1BULA 4IVKA 5CTNA 2G2WA 4X6TA 3GVBA 1K56D 5BOHA 3ZHHA 1K6SA 5DF9A 1PYYA 5CERA 4KZ5A 3HVFA 5HFOA 4PM6A 2WKIA 2HP6A 4OVDA 4A5RA 3ZVTA 4MEZA 4UHUA 5FI2A 2ZC4B 2Y2PA 3ZNTA 1N4OA 3M6HA 3NC8A 3MZEA 5CHJA 4Z9QA 4P87A 2A3UA 4FCFA 5DTSA 4U0TA 5HAQA 3Q7VB 3BYDA 4S2NA 1ERQA 3PBQA 1PW8A 2PU4A 4OQIA 1ES5A 4S2MA 1JTDA 1ZG4A 3C7UA 3VMAA 1ONGA 5KZHA 4FH4A 1QMFA 1W79A 1JWPA 2XD1A 1GCEA 2VGKA 1GA0A 3IHAA 4KG6A 4GN2A 3AGFA 4KZ9A 4WBGA 3UDFA 1YLPA 2HDSA 1PZOA 2GDNA 3N7WA 1NRFA 4OOMA 1ERMA 1PIOA 3IHBA 1L0EA 4K91A 2ZD8A 4R23A 5KSCA 3UPPA 3JYIA 2Y59A 3W4QA 4GOGA 4X69A 3GV9A 5CRFA 4E3LA 1XP4A 1E3UA 3PAEA 1JVJA 5FQIA 4S2NC 3MBZA 1L0FA 2G2UA 2BLSA 2ZQAA 1CEGA 4EWFA 2C6WB 3UPOA 2JCHA 3BFDA 1MKIA 2J9OA 4IBXA 4GD6A 1Z6FA 1HVBA 1L0GA 3FYZA 4WZ4A 4NK3A 5EVLA 1KE3A 1IKIA 4OPQA 5FSRA 2XH9A 4MNRA 5GHXA 2Y2NA 1YLJA 2WGWB 2OLUA 1BLCA 2C5WB 3VP4A 4LV1A 5F1GA 4DDSA 3MFDA 4EQIA 1EI5A 3SH9A 3M6BA 4OP8A 1GA9A 3IT9A 4LENA 2ZLYA 4N92A 4QB8A 1J9MA 2XQZA 3LO7A 3OPLA 4OOYA 2WYXA 2XEPA 3HLBA 4UAAA 1U60A 2XF3A 2Y55A 1ESUA 4M3KA 4QJGA 1BLSA 1DJAA 3SS3A 1Q2QA 5EPHA 1C3BA 3A3FA 2J9PA 3IH9A 3TOIA 4KENB 3NIAA 4PMAA 3SH7A 1DY6A 3QNCA 1GHMA 2X01A 4E3NA 4WEJA 1BT5A 2ZM2A 5JYPA 2EXBA 2WGVA 3Q7VA 4RYEA 1EROA 1WE4A 2OV5A 1K56A 5EOEA 3GMWA 2P9VA 3ITBA 1VM1A 5J8XA 1RGZA 1BZAA 2E8IA 3MKEA 3LY4A 1FOFA 2A49A 5F1FA 4OH0A 5CEDA 2Y2KA 2Y4AA 5DF8A 3ZG7B 1MY8A 1TEMA 3O86A 3MKFA 2WK0A 2Y2LA 5IHVA 2IWDA 4ZTKA 4L0LA 2WZZA 4Y0UA 3BRMA 3WRZA 4JF5A 3IWQA 2XGNA 3GSGA 3FZCA 3UE1A 3HLCA 3FV7A 3HREA 3G2YA 1ALQA 3OPHA 3C5AA 5FQKA 1LI9A 1M6KA 1FCMA 4KZ3A 4HBUA 4ZJ3A 3Q82A 5FAQA 1FR6A 4MLLA 5TFQA 4ZDXA 4RVAA 4S2OA 2Y2GA 4S2LA 1XGIA 5HL1A 1BUEA 2ZQ8A 2H5SA 3O88A 2V1ZA 3NCKA 4Y7PA 5FAPA 2ZQDA 4DDYA 3NBLA 2XFSA 4DE0A 3VP1A 4HESA 4H8RA 1K4FA 1HTZA 1S0WA 4P6BA 4BQMA 1ZC2A 3HL9A 4N9LA 4OLDA 4KQQA 1L2SA 2XFTA 3RJUA 2X02A 5CEBA 3ZVWA 1IKGA 4JPMA 2WUQA 1S6RA 2ZM8A 3CJMA 3ZGAB 5FQMA 3VOYA 5EECA 4GDBA 1MXOA 3MZFA 5E2GA 2XD5A 2EX9A 3N4IA 5CXWA 1SKFA 1TVFA 3IQAA 4HBTA 1YLYA 5U47A 2DCFA 1IYPA 2HDRA 3MXRA 3TG9A 2QPNA 4Y0OA 3I7JA 2P9VB 2Q9NA 1PI4A 1LHYA 3NDGA 2IWBA 4OLGA 5I94A 1I5QA 1GHIA 3VSLA 3HLGA 4EUZA 5M1AA 1XA1A 4D2OA 2EXAA 3W8KA 4CPKA 3ZDJA 2FFYA 3V50A 3HLDA 2H0TA 3OC2A 1O7EA 4WMCD 5EUAA 3LEZA 4QU3A 4KZ7A 4WM9A 4UA6A 5DTTA 1FQGA 3G34A 1O07A 4C6YA 3Q7ZA 3OPRA 4ZBEA 5DVAA 3A3EA 4S2JA 4R0QA 2XK1A 3TSGA 3BECA 4ZJ1A 1E4DA 3S22A 4DXCA 1IEMA 2ZQCA 2Y2IA 1QMEA 3OPPA 1LL5A 4LV2A 4OOLA 5CGWA 4KZ8A 4N9KA 4E6XA 4GDNA 4JBFA 1LI0A 2UWXA 4EV4A 4S2PA 1K6RA 1KVMA 2FFFB 2EFXA 4MBFA 4R3BA 2XLNA 1Q2PA 3HLEA 4OONA 4UA7A 1BLPA 1KVLA 1N9BA 1PWDA 3GTCA 1K25A 3DWKA 4C75A 4OPZA 1RP5A 1KDSA 5E2FA 1LLBA 2R9WA 2PU2A 1SCWA 4RX2A 1FSWA 2WGIA 1NY0A 2OLVA 4RX3A 2VGJA 1MWTA 1YM1A 4KQOA 3UO9A 3UY6A 5FI6A 3V3SA 3QNBA 1AXBA 1CI9A 1G6AA 3CZDA 3N6IA 2WADA 1XA7A 5CGXA 1ONHA 3OCLA 3SOIA 1KGEA 3HLWA 2HP9A 3ZFZA 1XX2A 4KZ4A 1NXYA 4JXGA 3V5MA 5GLCA 4WZ5A 4JF6A 4B4ZA 1CI8A 1IYQA 1W8YA 3BFCA 3ZCZA 4EBPA 1BTLA 4KQRA 3ZG5A 2JBFA 4JLFA 1I2SA 5EOOA 4E3IA 3WS4A 4N1XA 2HDQA 5TGFA 3N8SA 1IYOA 2EX2A 2DNSA 1FR1A 5AQ7A 3UN7A 4P85A 1MBLA 3E2LA 1XKZA 5G18A 1H8YA 1TDLA 3BM6A 3ISGA 4P0MA 1KDWA 4OPRA 2ZJ9A 4DE3A 4DF6A 4FSFA 4PM9A 5HAPA 1MWUA 1M40A 1BLHA 2B5RA 4WZ5C 4DKIA 3VP2A 5DTKA 4X53A 4GNUA 5HAIA 3HUMA 2ZQ9A 1RCJA 5FATA 1K57A 4LV3A 1W8QA 1MWRA 2Z2LB 1NYYA 3MZDA 3WRTA 3VOZA 1PW1A 3HLFA 1W5DA 3ZNYA 4WMCA 3WS1A 2X71A 3W4PA 3NY4A 5FA7A 1JWZA 5D3OA 2XR0A 2H10A 3RXWA 3BFEA 1E25A 1HZOA 3B3XA 4BENA 4DE1A 3MXSA 3HUNA 4QHCA 4R4SA 1OMEA 3PBSA 3SS5A 4E3MA 5AQ9A 5GLBA 3S1YA 4KG5A 4QY6A 1K57C 4N1HA 5CTMA 3FWLA 1HD8A 4PM5A 2J8YA 2V2FF 4JXSA 1MPLA 3BLSA 4U0XA 2WAEA 5FI7A 3BFFA 1K54A 2WKEA 4KZBA 2OSUA 1PI5A 3P98A 3A3JA 4E6WA 4GB7A 3Q1FA 4U3TA 1CEFA 3LY3A 4GKUA 1JWVA 2PBYA 1KGFA 1LL9A 2ZC6B 3SS4A 3G30A 4OP5A 2RCXA 3AGDA 5GLDA 4OQ0A 3EQVA 1YMSA 3D4FA 4K0XA 1SDEA 4K0WA 4X56A 3UDIA 3N8LA 5GL9A 4E3JA 2Y2QA 3G4PA 4X55A 2QMIA 1K54C 1PZPA 3WS2A 5GHYA 4B88A 4CJNA 5A90A 1H8ZA 4S2IA 4LCMA 1FSYA 4GZBA 3VFHA 3VP0A 2Y2JA 5HW3A 2ZC5B 4JXVA 3N8RA 3IF6B 5L2FA 3UPNA 4BLMA 3UE3A 4EBNA 2ZQ7A 5A93A 3IXGA 4E3OA 4EBLA 3UDXA 2HPBA 1FCOA 4LCLA 1K55A 2HDUA 3HUOA 5FQQA 5JYOA 1SHVA 1IELA 4R1GA 1PWCA 2HP5A 3HBRA 3FKVA 3ITAA 3NI9A 1KGGA 3LCEA 4HEFA 5E2HA 5F82A 3FKWA 2JC7A 5FAOA 2DRWA 2J7VA 5M19A 3SH8A 5AQBA 2Z2MB 3EQUA 3BFGA 2Y91A 1K4EA 4KZ6A 3W4OA 5CGSA 5EVID 2JE5A 4JXWA 5F83A 4YFMA 4R3JA 3AGEA 1K55C 2EX6A 4XUZA 4ZJ2A 1NYMA 2Y2OA 3V3RA 4LV0A 4B4XA 3Q07A 2H0YA 2WZXA 1JTGA 4OQGA 5EVIB 5TR7A 4KG2A 3V39A 1NZOA 4E3KA 4IEDA 3PBOA 4MBHA 3RXXA 3PBRA 5FDHA 4QD4A 4XUXA 3IXBA 3DWZA 2EFUA 4XXRA 3QHYA 3WS5A 3VP3A 2WAFA 3GR2A 4X68A 4BJPA 3PBNA 5E2EA 3UNWA 5A91A 2ZC7A 1GHPA 1NJ4A 1DJCA 2Y2MA 3WWXA 1EWZA 1YQSA 4FH2A 3IF5A 1PWGA 1W7FA 1ES2A 1XPBA 3IWOA 4YINA 5GHZA 4BD0A 4C3QA 1I2WA 5KSHA 4DXBA 2R9XA 1CK3A 5A92A 1IYSA 4OQHA 1YMXA 1XGJA 1SDNA 1YT4A 3CMZA 4FD8A 5FASA 3IF6A 2I72A 5CECA 3DW0A 3PAGA 2ZC3B 3S4XA 3E2KA 4RA7A 3P09A 3O87A 4OPYA 3IH8A 3OCNA 5HX9A 4DRTA 2ZMAA 2V20A 3G32A 3A3IA 4PPRA 4WYYA 3IWIA 1MWSA 3BEBA 3M2KA 3BLMA 4WEKA 3A3DA 2Y2HA 5HARA 2RL3A 4BD1A 5DF7A 4ZAMA 4PM7A 4QY5A 3PBTA 1E3UD 3IF6C 4IBRA 4R4RA 2ZM0A 3VSKA 3WS0A 1KE4A 2EX8A 4JKTA 5CHMA 3CG5A 3GRJA 3IXHA 5GLAA 3C4PA 3G31A 2QZ6A 4JF4A 4BL3A 1FCNA 1K38A 3VFFA 4PM8A 1NZUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q81 A;  5KMW A;  5AQA A;  3C4O A;  1WYC A;  1WYB A;  4IVI A;  1XXM A;  4BL2 A;  1YLW A;  3NDE A;  1BSG A;  1YLZ A;  3G35 A;  3M2J A;  1VQQ A;  3UE0 A;  1ESI A;  2IWC A;  3G2Z A;  5EVI A;  2XDM A;  1DJB A;  4MBK A;  2WKH A;  4Q8I A;  4ID4 A;  1G68 A;  2CC1 A;  5FQ9 A;  4KZA A;  3PTE A;  1ZKJ A;  1YLT A;  3DTM A;  5M18 A;  2WGW A;  4Y0T A;  3C7V A;  4OKP A;  5FQJ A;  3GQZ A;  5E43 A;  5EE8 A;  4WEL A;  3IXD A;  4F94 A;  2Q9M A;  1ES4 A;  3OZH A;  4NET A;  1H5X A;  4GD8 A;  3ZG0 A;  4O7D A;  1Y54 A;  3O3V A;  4S2K A;  5CHU A;  2BG1 A;  3ZG8 B;  5EVI C;  1KE0 A;  1TDG A;  1ES3 A;  1RGY A;  1ZG6 A;  2P74 A;  1L0D A;  4UA9 A;  3ZG9 B;  4DE2 A;  1BUL A;  4IVK A;  5CTN A;  2G2W A;  4X6T A;  3GVB A;  1K56 D;  5BOH A;  3ZHH A;  1K6S A;  5DF9 A;  1PYY A;  5CER A;  4KZ5 A;  3HVF A;  5HFO A;  4PM6 A;  2WKI A;  2HP6 A;  4OVD A;  4A5R A;  3ZVT A;  4MEZ A;  4UHU A;  5FI2 A;  2ZC4 B;  2Y2P A;  3ZNT A;  1N4O A;  3M6H A;  3NC8 A;  3MZE A;  5CHJ A;  4Z9Q A;  4P87 A;  2A3U A;  4FCF A;  5DTS A;  4U0T A;  5HAQ A;  3Q7V B;  3BYD A;  4S2N A;  1ERQ A;  3PBQ A;  1PW8 A;  2PU4 A;  4OQI A;  1ES5 A;  4S2M A;  1JTD A;  1ZG4 A;  3C7U A;  3VMA A;  1ONG A;  5KZH A;  4FH4 A;  1QMF A;  1W79 A;  1JWP A;  2XD1 A;  1GCE A;  2VGK A;  1GA0 A;  3IHA A;  4KG6 A;  4GN2 A;  3AGF A;  4KZ9 A;  4WBG A;  3UDF A;  1YLP A;  2HDS A;  1PZO A;  2GDN A;  3N7W A;  1NRF A;  4OOM A;  1ERM A;  1PIO A;  3IHB A;  1L0E A;  4K91 A;  2ZD8 A;  4R23 A;  5KSC A;  3UPP A;  3JYI A;  2Y59 A;  3W4Q A;  4GOG A;  4X69 A;  3GV9 A;  5CRF A;  4E3L A;  1XP4 A;  1E3U A;  3PAE A;  1JVJ A;  5FQI A;  4S2N C;  3MBZ A;  1L0F A;  2G2U A;  2BLS A;  2ZQA A;  1CEG A;  4EWF A;  2C6W B;  3UPO A;  2JCH A;  3BFD A;  1MKI A;  2J9O A;  4IBX A;  4GD6 A;  1Z6F A;  1HVB A;  1L0G A;  3FYZ A;  4WZ4 A;  4NK3 A;  5EVL A;  1KE3 A;  1IKI A;  4OPQ A;  5FSR A;  2XH9 A;  4MNR A;  5GHX A;  2Y2N A;  1YLJ A;  2WGW B;  2OLU A;  1BLC A;  2C5W B;  3VP4 A;  4LV1 A;  5F1G A;  4DDS A;  3MFD A;  4EQI A;  1EI5 A;  3SH9 A;  3M6B A;  4OP8 A;  1GA9 A;  3IT9 A;  4LEN A;  2ZLY A;  4N92 A;  4QB8 A;  1J9M A;  2XQZ A;  3LO7 A;  3OPL A;  4OOY A;  2WYX A;  2XEP A;  3HLB A;  4UAA A;  1U60 A;  2XF3 A;  2Y55 A;  1ESU A;  4M3K A;  4QJG A;  1BLS A;  1DJA A;  3SS3 A;  1Q2Q A;  5EPH A;  1C3B A;  3A3F A;  2J9P A;  3IH9 A;  3TOI A;  4KEN B;  3NIA A;  4PMA A;  3SH7 A;  1DY6 A;  3QNC A;  1GHM A;  2X01 A;  4E3N A;  4WEJ A;  1BT5 A;  2ZM2 A;  5JYP A;  2EXB A;  2WGV A;  3Q7V A;  4RYE A;  1ERO A;  1WE4 A;  2OV5 A;  1K56 A;  5EOE A;  3GMW A;  2P9V A;  3ITB A;  1VM1 A;  5J8X A;  1RGZ A;  1BZA A;  2E8I A;  3MKE A;  3LY4 A;  1FOF A;  2A49 A;  5F1F A;  4OH0 A;  5CED A;  2Y2K A;  2Y4A A;  5DF8 A;  3ZG7 B;  1MY8 A;  1TEM A;  3O86 A;  3MKF A;  2WK0 A;  2Y2L A;  5IHV A;  2IWD A;  4ZTK A;  4L0L A;  2WZZ A;  4Y0U A;  3BRM A;  3WRZ A;  4JF5 A;  3IWQ A;  2XGN A;  3GSG A;  3FZC A;  3UE1 A;  3HLC A;  3FV7 A;  3HRE A;  3G2Y A;  1ALQ A;  3OPH A;  3C5A A;  5FQK A;  1LI9 A;  1M6K A;  1FCM A;  4KZ3 A;  4HBU A;  4ZJ3 A;  3Q82 A;  5FAQ A;  1FR6 A;  4MLL A;  5TFQ A;  4ZDX A;  4RVA A;  4S2O A;  2Y2G A;  4S2L A;  1XGI A;  5HL1 A;  1BUE A;  2ZQ8 A;  2H5S A;  3O88 A;  2V1Z A;  3NCK A;  4Y7P A;  5FAP A;  2ZQD A;  4DDY A;  3NBL A;  2XFS A;  4DE0 A;  3VP1 A;  4HES A;  4H8R A;  1K4F A;  1HTZ A;  1S0W A;  4P6B A;  4BQM A;  1ZC2 A;  3HL9 A;  4N9L A;  4OLD A;  4KQQ A;  1L2S A;  2XFT A;  3RJU A;  2X02 A;  5CEB A;  3ZVW A;  1IKG A;  4JPM A;  2WUQ A;  1S6R A;  2ZM8 A;  3CJM A;  3ZGA B;  5FQM A;  3VOY A;  5EEC A;  4GDB A;  1MXO A;  3MZF A;  5E2G A;  2XD5 A;  2EX9 A;  3N4I A;  5CXW A;  1SKF A;  1TVF A;  3IQA A;  4HBT A;  1YLY A;  5U47 A;  2DCF A;  1IYP A;  2HDR A;  3MXR A;  3TG9 A;  2QPN A;  4Y0O A;  3I7J A;  2P9V B;  2Q9N A;  1PI4 A;  1LHY A;  3NDG A;  2IWB A;  4OLG A;  5I94 A;  1I5Q A;  1GHI A;  3VSL A;  3HLG A;  4EUZ A;  5M1A A;  1XA1 A;  4D2O A;  2EXA A;  3W8K A;  4CPK A;  3ZDJ A;  2FFY A;  3V50 A;  3HLD A;  2H0T A;  3OC2 A;  1O7E A;  4WMC D;  5EUA A;  3LEZ A;  4QU3 A;  4KZ7 A;  4WM9 A;  4UA6 A;  5DTT A;  1FQG A;  3G34 A;  1O07 A;  4C6Y A;  3Q7Z A;  3OPR A;  4ZBE A;  5DVA A;  3A3E A;  4S2J A;  4R0Q A;  2XK1 A;  3TSG A;  3BEC A;  4ZJ1 A;  1E4D A;  3S22 A;  4DXC A;  1IEM A;  2ZQC A;  2Y2I A;  1QME A;  3OPP A;  1LL5 A;  4LV2 A;  4OOL A;  5CGW A;  4KZ8 A;  4N9K A;  4E6X A;  4GDN A;  4JBF A;  1LI0 A;  2UWX A;  4EV4 A;  4S2P A;  1K6R A;  1KVM A;  2FFF B;  2EFX A;  4MBF A;  4R3B A;  2XLN A;  1Q2P A;  3HLE A;  4OON A;  4UA7 A;  1BLP A;  1KVL A;  1N9B A;  1PWD A;  3GTC A;  1K25 A;  3DWK A;  4C75 A;  4OPZ A;  1RP5 A;  1KDS A;  5E2F A;  1LLB A;  2R9W A;  2PU2 A;  1SCW A;  4RX2 A;  1FSW A;  2WGI A;  1NY0 A;  2OLV A;  4RX3 A;  2VGJ A;  1MWT A;  1YM1 A;  4KQO A;  3UO9 A;  3UY6 A;  5FI6 A;  3V3S A;  3QNB A;  1AXB A;  1CI9 A;  1G6A A;  3CZD A;  3N6I A;  2WAD A;  1XA7 A;  5CGX A;  1ONH A;  3OCL A;  3SOI A;  1KGE A;  3HLW A;  2HP9 A;  3ZFZ A;  1XX2 A;  4KZ4 A;  1NXY A;  4JXG A;  3V5M A;  5GLC A;  4WZ5 A;  4JF6 A;  4B4Z A;  1CI8 A;  1IYQ A;  1W8Y A;  3BFC A;  3ZCZ A;  4EBP A;  1BTL A;  4KQR A;  3ZG5 A;  2JBF A;  4JLF A;  1I2S A;  5EOO A;  4E3I A;  3WS4 A;  4N1X A;  2HDQ A;  5TGF A;  3N8S A;  1IYO A;  2EX2 A;  2DNS A;  1FR1 A;  5AQ7 A;  3UN7 A;  4P85 A;  1MBL A;  3E2L A;  1XKZ A;  5G18 A;  1H8Y A;  1TDL A;  3BM6 A;  3ISG A;  4P0M A;  1KDW A;  4OPR A;  2ZJ9 A;  4DE3 A;  4DF6 A;  4FSF A;  4PM9 A;  5HAP A;  1MWU A;  1M40 A;  1BLH A;  2B5R A;  4WZ5 C;  4DKI A;  3VP2 A;  5DTK A;  4X53 A;  4GNU A;  5HAI A;  3HUM A;  2ZQ9 A;  1RCJ A;  5FAT A;  1K57 A;  4LV3 A;  1W8Q A;  1MWR A;  2Z2L B;  1NYY A;  3MZD A;  3WRT A;  3VOZ A;  1PW1 A;  3HLF A;  1W5D A;  3ZNY A;  4WMC A;  3WS1 A;  2X71 A;  3W4P A;  3NY4 A;  5FA7 A;  1JWZ A;  5D3O A;  2XR0 A;  2H10 A;  3RXW A;  3BFE A;  1E25 A;  1HZO A;  3B3X A;  4BEN A;  4DE1 A;  3MXS A;  3HUN A;  4QHC A;  4R4S A;  1OME A;  3PBS A;  3SS5 A;  4E3M A;  5AQ9 A;  5GLB A;  3S1Y A;  4KG5 A;  4QY6 A;  1K57 C;  4N1H A;  5CTM A;  3FWL A;  1HD8 A;  4PM5 A;  2J8Y A;  2V2F F;  4JXS A;  1MPL A;  3BLS A;  4U0X A;  2WAE A;  5FI7 A;  3BFF A;  1K54 A;  2WKE A;  4KZB A;  2OSU A;  1PI5 A;  3P98 A;  3A3J A;  4E6W A;  4GB7 A;  3Q1F A;  4U3T A;  1CEF A;  3LY3 A;  4GKU A;  1JWV A;  2PBY A;  1KGF A;  1LL9 A;  2ZC6 B;  3SS4 A;  3G30 A;  4OP5 A;  2RCX A;  3AGD A;  5GLD A;  4OQ0 A;  3EQV A;  1YMS A;  3D4F A;  4K0X A;  1SDE A;  4K0W A;  4X56 A;  3UDI A;  3N8L A;  5GL9 A;  4E3J A;  2Y2Q A;  3G4P A;  4X55 A;  2QMI A;  1K54 C;  1PZP A;  3WS2 A;  5GHY A;  4B88 A;  4CJN A;  5A90 A;  1H8Z A;  4S2I A;  4LCM A;  1FSY A;  4GZB A;  3VFH A;  3VP0 A;  2Y2J A;  5HW3 A;  2ZC5 B;  4JXV A;  3N8R A;  3IF6 B;  5L2F A;  3UPN A;  4BLM A;  3UE3 A;  4EBN A;  2ZQ7 A;  5A93 A;  3IXG A;  4E3O A;  4EBL A;  3UDX A;  2HPB A;  1FCO A;  4LCL A;  1K55 A;  2HDU A;  3HUO A;  5FQQ A;  5JYO A;  1SHV A;  1IEL A;  4R1G A;  1PWC A;  2HP5 A;  3HBR A;  3FKV A;  3ITA A;  3NI9 A;  1KGG A;  3LCE A;  4HEF A;  5E2H A;  5F82 A;  3FKW A;  2JC7 A;  5FAO A;  2DRW A;  2J7V A;  5M19 A;  3SH8 A;  5AQB A;  2Z2M B;  3EQU A;  3BFG A;  2Y91 A;  1K4E A;  4KZ6 A;  3W4O A;  5CGS A;  5EVI D;  2JE5 A;  4JXW A;  5F83 A;  4YFM A;  4R3J A;  3AGE A;  1K55 C;  2EX6 A;  4XUZ A;  4ZJ2 A;  1NYM A;  2Y2O A;  3V3R A;  4LV0 A;  4B4X A;  3Q07 A;  2H0Y A;  2WZX A;  1JTG A;  4OQG A;  5EVI B;  5TR7 A;  4KG2 A;  3V39 A;  1NZO A;  4E3K A;  4IED A;  3PBO A;  4MBH A;  3RXX A;  3PBR A;  5FDH A;  4QD4 A;  4XUX A;  3IXB A;  3DWZ A;  2EFU A;  4XXR A;  3QHY A;  3WS5 A;  3VP3 A;  2WAF A;  3GR2 A;  4X68 A;  4BJP A;  3PBN A;  5E2E A;  3UNW A;  5A91 A;  2ZC7 A;  1GHP A;  1NJ4 A;  1DJC A;  2Y2M A;  3WWX A;  1EWZ A;  1YQS A;  4FH2 A;  3IF5 A;  1PWG A;  1W7F A;  1ES2 A;  1XPB A;  3IWO A;  4YIN A;  5GHZ A;  4BD0 A;  4C3Q A;  1I2W A;  5KSH A;  4DXB A;  2R9X A;  1CK3 A;  5A92 A;  1IYS A;  4OQH A;  1YMX A;  1XGJ A;  1SDN A;  1YT4 A;  3CMZ A;  4FD8 A;  5FAS A;  3IF6 A;  2I72 A;  5CEC A;  3DW0 A;  3PAG A;  2ZC3 B;  3S4X A;  3E2K A;  4RA7 A;  3P09 A;  3O87 A;  4OPY A;  3IH8 A;  3OCN A;  5HX9 A;  4DRT A;  2ZMA A;  2V20 A;  3G32 A;  3A3I A;  4PPR A;  4WYY A;  3IWI A;  1MWS A;  3BEB A;  3M2K A;  3BLM A;  4WEK A;  3A3D A;  2Y2H A;  5HAR A;  2RL3 A;  4BD1 A;  5DF7 A;  4ZAM A;  4PM7 A;  4QY5 A;  3PBT A;  1E3U D;  3IF6 C;  4IBR A;  4R4R A;  2ZM0 A;  3VSK A;  3WS0 A;  1KE4 A;  2EX8 A;  4JKT A;  5CHM A;  3CG5 A;  3GRJ A;  3IXH A;  5GLA A;  3C4P A;  3G31 A;  2QZ6 A;  4JF4 A;  4BL3 A;  1FCN A;  1K38 A;  3VFF A;  4PM8 A;  1NZU A; 
#chains in the Genus database with same CATH topology
 5KMW A;  1LSW A;  4IVI A;  1YLW A;  1BSG A;  2IWC A;  4MBK A;  2WKH A;  3MMH A;  1G68 A;  1T1A A;  5E43 A;  5EE8 A;  2L1M A;  4LRZ E;  2Q9M A;  1D1J A;  3JPU A;  5AVF A;  3ICY A;  2FZ0 A;  4O7D A;  3O3V A;  1KE0 A;  1TDG A;  1ES3 A;  4EEP A;  1RGY A;  4UA9 A;  3ZG9 B;  4IVK A;  2G2W A;  5DF9 A;  5CER A;  4KZ5 A;  2HP6 A;  1WA9 A;  3F1O B;  4MEZ A;  2ZC4 B;  3ZNT A;  5CHJ A;  4Z9Q A;  1OTD A;  4U0T A;  5HDS A;  3Q7V B;  3BYD A;  3F1P A;  1ONG A;  1QMF A;  2XD1 A;  1JWP A;  4KZ9 A;  4P6Z M;  2HDS A;  1NRF A;  2OAQ 1;  1VET B;  4R23 A;  4I3I A;  2LB5 A;  4GOG A;  3QP4 A;  3C30 A;  4RQ9 A;  2VV7 A;  3CUE C;  2MJ6 A;  4O01 A;  1FIL A;  2BLS A;  4I38 A;  3UB9 A;  1MKI A;  1S4S A;  1HVB A;  3FYZ A;  5EVL A;  1KE3 A;  4MNR A;  2OAP 1;  5GHX A;  4L9F A;  1YLJ A;  4R70 A;  3T1Q B;  2W3F A;  3SH9 A;  2GNX A;  4QB8 A;  4N92 A;  1J9M A;  2XQZ A;  2WYX A;  1U60 A;  2XF3 A;  3KSG A;  4NXG A;  3IH9 A;  3NIA A;  4PMA A;  3SH7 A;  2IA2 A;  1Z09 A;  2X01 A;  1NLY A;  4EES A;  1ERO A;  3GMW A;  2P9V A;  3LUQ A;  3HCY A;  5J8X A;  1RGZ A;  2INW A;  3TE8 A;  2V8C A;  2Y2K A;  1PRQ A;  1MY8 A;  3O86 A;  2VKS A;  4JF5 A;  3K3C A;  3FZC A;  2VJW A;  3C5A A;  3H7W A;  2QJ7 A;  1F98 A;  4ZJ3 A;  4Y15 A;  3EGD C;  3QP6 A;  2Y2G A;  4S2L A;  3CPT A;  5FAP A;  4GS9 B;  5J4E A;  4FOF A;  2QJ5 A;  3UB7 A;  2BAS A;  3BWL A;  1HTZ A;  4LLO B;  4OLD A;  3NOT C;  3UB8 A;  4CLC D;  4DJ2 A;  4ZRR A;  3CJM A;  2ZM8 A;  3VOY A;  5IS1 A;  4Q0H A;  4HP4 A;  5E2G A;  2XD5 A;  3N4I A;  4HBT A;  1YLY A;  2HDR A;  3MXR A;  1P9R A;  3I7J A;  3PR6 A;  1V9Z A;  2LB9 A;  1GHI A;  4D2O A;  2EXA A;  3W8K A;  4CPK A;  3V50 A;  3OC2 A;  4WMC D;  4UA6 A;  4NXE A;  2ZMV A;  3OPR A;  5L8M A;  5DVA A;  3S7Q A;  1VEU B;  1IEM A;  4ETZ A;  2Y2I A;  2G7U A;  2ZOH A;  5J7E A;  2FFF B;  4MBF A;  2XSS A;  1ZTU A;  2HGV A;  2JKG A;  1Q2P A;  1N9B A;  2D01 A;  4OPZ A;  1FIK A;  2ZOI A;  2PU2 A;  1SCW A;  2OLV A;  2VGJ A;  1V9Y A;  1YM1 A;  4KQO A;  3UO9 A;  3CZD A;  1GSX A;  5CGX A;  3SOI A;  3ZFZ A;  4B93 A;  2PT7 A;  5DKK A;  4WZ5 A;  4JF6 A;  3IS2 A;  1IYQ A;  3BFC A;  4EBP A;  3CHW P;  4GCZ A;  4E04 A;  3N8S A;  2EX2 A;  4I5S A;  4F3L A;  2DNS A;  1G28 A;  5AQ7 A;  3UN7 A;  4P85 A;  5EV0 A;  3ISG A;  2M1C A;  3EEA A;  1BLH A;  4DKI A;  4GNU A;  2A2L A;  1MWR A;  1NYY A;  1PW1 A;  5F6A A;  2B18 A;  4X1L A;  3W4P A;  5L09 A;  4HH2 A;  3RXW A;  4NG2 A;  3B3X A;  4DE1 A;  3HUN A;  3T1X A;  2HZ5 A;  4JXS A;  2WAE A;  3PYP A;  1XJ6 A;  4U3T A;  4JGP A;  3LY3 A;  4GKU A;  4YOF A;  3L7H A;  1Y28 A;  5IU1 A;  5HWT A;  3EQV A;  1T1B A;  3BQ8 A;  2JN7 A;  3PXP A;  3T12 B;  4E3J A;  3BQA A;  2QMI A;  1K54 C;  1PZP A;  3T4J A;  3WS2 A;  4II7 A;  3KX0 X;  5HW3 A;  2ZMF A;  4JXV A;  4BLM A;  4EBL A;  3ULF A;  2JKT M;  4NKP A;  2HDU A;  1IEL A;  4R1G A;  4M4X A;  1PWC A;  3HBR A;  4HEF A;  2DRW A;  5AQB A;  3RH8 B;  4KZ6 A;  3TJZ C;  5DKL A;  4YFM A;  3AGE A;  1ACF A;  4GHI A;  4ZJ2 A;  3MR0 A;  4LV0 A;  3Q07 A;  2WZX A;  1PNE A;  5TR7 A;  3V39 A;  1NZO A;  4MBH A;  2P7J A;  5FDH A;  4K08 A;  4XUX A;  3DWZ A;  3QHY A;  3VP3 A;  1YAX A;  2PD8 A;  3O5Y A;  3PBN A;  3C8C A;  2Y2M A;  3WWX A;  4FH2 A;  3IF5 A;  1PWG A;  1W7F A;  1I2W A;  2W3G A;  1CK3 A;  5A92 A;  2O0Y A;  5FL3 A;  4OQH A;  4FD8 A;  3CMZ A;  3IF6 A;  5CEC A;  2CMN A;  3PAG A;  2O99 A;  3S4X A;  1P97 A;  2V1B A;  2V20 A;  4Y2F A;  4MN7 A;  3A3I A;  4PPR A;  4WYY A;  1GSW A;  1MKM A;  4BD1 A;  3F1P B;  5DF7 A;  4R4R A;  2ZM0 A;  3ZYT A;  4JKT A;  1H3Q A;  4IJG A;  2QZ6 A;  3KYE A;  1XXM A;  2L0W A;  1YLZ A;  3G35 A;  1VQQ A;  3UE0 A;  4D60 A;  2O9C A;  2HJ9 C;  5FQ9 A;  4Y0T A;  3IXD A;  3OZH A;  1Y54 A;  4JGO A;  4S2K A;  5FEG A;  5HPI A;  4O8G A;  3DAV A;  1OT9 A;  2P74 A;  1L0D A;  4DE2 A;  4Q0J A;  5BOH A;  2EA9 A;  4PM6 A;  4UHU A;  2Y2P A;  1N4O A;  3NC8 A;  2VV6 A;  4EW7 A;  4P87 A;  2A3U A;  5DTS A;  4S2N A;  2WKR A;  4FH4 A;  1GCE A;  5F1F A;  1GA0 A;  3UDF A;  3AGF A;  1BYW A;  1YLP A;  4OOM A;  1ERM A;  2Z6D A;  3IHB A;  5KSC A;  2Y59 A;  3W4Q A;  1S4R A;  3GV9 A;  5CRF A;  3P01 A;  3QP1 A;  3T4T A;  1E3U A;  3KSH A;  3MBZ A;  1L0F A;  4HIA A;  2ZQA A;  3UPO A;  2JCH A;  3H7W B;  1HLU P;  4GD6 A;  1Z6F A;  1L0G A;  4NK3 A;  2A24 A;  1IKI A;  4LRX C;  2WGW B;  2OLU A;  4HY8 A;  5F1G A;  3MFD A;  4EQI A;  3LO7 A;  4OOY A;  3KSF A;  4FUW A;  2XEP A;  2Y55 A;  1BLS A;  1DJA A;  3SS3 A;  4KEN B;  4E3N A;  1TF1 A;  3IX3 A;  2EXB A;  4RYE A;  4CLC A;  2PBD P;  1K56 A;  3T4Q A;  2Z6C A;  4IUK A;  5F68 A;  3MSH A;  1VM1 A;  3DTK A;  2Y4A A;  3ZG7 B;  2WK0 A;  3D3O A;  2WZZ A;  3LIE A;  1P9W A;  3IWQ A;  2XGN A;  3S7P A;  5A8B A;  3G2Y A;  5FQK A;  1LI9 A;  1M6K A;  1S1Z A;  1FCM A;  4KZ3 A;  5HL6 A;  5HZH A;  5TFQ A;  4ZDX A;  4RVA A;  4S2O A;  4DMZ A;  3BW6 A;  2ZQD A;  4P6B A;  4BQM A;  3HL9 A;  1L2S A;  3FPW A;  3LID A;  2X02 A;  5CEB A;  3ZVW A;  3LI9 A;  4JPM A;  2WKQ A;  1S6R A;  1P0Z A;  5FQM A;  3IS2 B;  1MXO A;  5U47 A;  4HOI A;  3TG9 A;  2QPN A;  1G6O A;  2Q9N A;  1PI4 A;  4F3L B;  3VSL A;  5M1A A;  3ZDJ A;  4WM9 A;  4BMW A;  1O07 A;  4R3A A;  3Q7Z A;  3A3E A;  4WLA A;  3TSG A;  3BEC A;  3S22 A;  2PYR A;  1NLZ A;  4OOL A;  4B9O A;  4N9K A;  2B95 A;  2HJE A;  2W3H A;  4FTX A;  1PWD A;  1RP5 A;  5E2F A;  1LLB A;  3U2A A;  1FSW A;  4ESP A;  3QNB A;  1CI9 A;  2D02 A;  2HP9 A;  4KZ4 A;  5GLC A;  1VB6 A;  4ARZ A;  4KQR A;  2P08 A;  3B33 A;  3LIA A;  3HJI A;  5EOO A;  4E3I A;  2VEA A;  2HDQ A;  4N1X A;  1IYO A;  1F9I A;  2FH5 A;  1N9N A;  1XKZ A;  1H8Y A;  1TDL A;  4OPR A;  2VGL M;  4FSF A;  1M40 A;  4WZ5 C;  3VP2 A;  5HAI A;  1K57 A;  1W8Q A;  2Z2L B;  3MZD A;  4I3A A;  1W5D A;  2YKF A;  3QP2 A;  3NY4 A;  2XR0 A;  2K2N A;  3BFE A;  3NEC A;  1E25 A;  1IFQ A;  3SS5 A;  1NWZ A;  3KO6 A;  5AQ9 A;  4KQD A;  4QY6 A;  3UB6 A;  3E0Y A;  4PM5 A;  1HD8 A;  2J8Y A;  4GHI B;  1MPL A;  3BLS A;  2J80 A;  4CLC E;  3CIT A;  2WKE A;  4KZB A;  2OSU A;  3P98 A;  4HQA A;  4GB7 A;  1CEF A;  1JWV A;  1KGF A;  1LL9 A;  2ZC6 B;  3UMD A;  4IUH A;  3NHQ A;  3AGD A;  2NUT C;  2PDR A;  4K0X A;  2YKH A;  1SDE A;  2Y2Q A;  5GHY A;  1TS8 A;  3E98 A;  3A0V A;  4Q0I A;  3F1N A;  4GZB A;  3GDI A;  3D72 A;  5IT5 A;  2Y2J A;  3IF6 B;  5L2F A;  2HF6 A;  2PYP A;  3UDX A;  1K55 A;  3MF0 A;  4LGW A;  1SHV A;  2HP5 A;  4PHT A;  3NI9 A;  4EU0 A;  3FKW A;  3A0R A;  5FAO A;  3SH8 A;  3K3D A;  2Z2M B;  4JXW A;  3L9K A;  3S7O A;  4EET B;  2H0Y A;  3DTE A;  2ZL1 A;  1JTG A;  4OQG A;  4HJ6 A;  3RXX A;  3PBR A;  4QD4 A;  4XXR A;  3FC7 A;  3G6O A;  4X68 A;  4BJP A;  4MDZ A;  3LIF A;  5E2E A;  5A91 A;  3LIB A;  1DJC A;  1DP9 A;  4EXO A;  4YIN A;  3BY8 A;  1IYS A;  1YMX A;  1XGJ A;  5FAS A;  2I72 A;  3DW0 A;  1LSV A;  3E2K A;  3LR0 A;  3MQ0 A;  3P09 A;  4KUO A;  4OPY A;  5HX9 A;  3E4O A;  3LEQ A;  3M2K A;  3BLM A;  3DBA A;  1N9O A;  5HAR A;  2RL3 A;  4BBV A;  5EFW A;  5MC7 A;  1TD5 A;  2HV1 A;  2GX5 A;  2PAV P;  1VET A;  4QY5 A;  3T4O A;  3PBT A;  2K31 A;  3IF6 C;  3VV4 A;  1KE4 A;  5CHM A;  5DFX A;  3G31 A;  2KX6 A;  3U4L P;  4BL3 A;  1K38 A;  3VFF A;  5F82 A;  3Q81 A;  5AQA A;  1CQA A;  3C4O A;  4PKY A;  1T18 A;  5EVI A;  2ACG A;  1ODV A;  4Q8I A;  3BY9 A;  4KZA A;  3PTE A;  1ZKJ A;  1YLT A;  3DTM A;  5M18 A;  4OKP A;  3GQZ A;  2K7S A;  5TJJ A;  3B47 A;  4F94 A;  5HWV A;  4UQI S;  4NXB A;  1H5X A;  2O9A A;  3ZG8 B;  5CHU A;  2V9A A;  1BUL A;  2PRF A;  1K6S A;  3IBJ A;  1PYY A;  4MCW A;  2Y8H A;  2AVX A;  3M6H A;  5HAQ A;  1ERQ A;  3PBQ A;  1PW8 A;  2PU4 A;  4OQI A;  1ES5 A;  4S2M A;  1JTD A;  1ZG4 A;  3C7U A;  1UWP X;  5HDD A;  1W79 A;  2VGK A;  4KG6 A;  4GN2 A;  1PZO A;  2GDN A;  3LR3 A;  2J3W A;  1PIO A;  1L0E A;  4K91 A;  4DN0 A;  3JYI A;  1W63 Q;  4X69 A;  4E3L A;  1XP4 A;  4XT2 B;  4S2N C;  3LGO A;  1CEG A;  4EWF A;  3FPV A;  2J9O A;  4PAU A;  3NUL A;  4IBX A;  4BBU A;  1OJ5 A;  1T1C A;  4EUV A;  4OPQ A;  4L9G A;  5FSR A;  4GS9 A;  2C5W B;  3VP4 A;  4LV1 A;  2M7U A;  1EI5 A;  3TRC A;  3M6B A;  4OP8 A;  4QJG A;  1Q2Q A;  5I5L A;  1W63 M;  1C3B A;  3A3F A;  2J9P A;  3TOI A;  1N9L A;  1LSX A;  1GHM A;  1OTE A;  1STZ A;  4WEJ A;  1BT5 A;  4G3K A;  1WE4 A;  2OV5 A;  3SW1 A;  3ITB A;  2KLI A;  3MKE A;  3LY4 A;  1FOF A;  2A49 A;  5CED A;  3LYX A;  5HSQ A;  4LFU A;  1TEM A;  1K0K A;  3MKF A;  5IHV A;  2IWD A;  4ZTK A;  5FEF A;  4CLC C;  3WRZ A;  1F2K A;  3KYQ A;  3IBR A;  3EGX C;  4P6Z S;  3FV7 A;  3OPH A;  2WKP A;  2ZBB A;  4HBU A;  2W3D A;  3Q82 A;  5FAQ A;  4MLL A;  5HL1 A;  1BUE A;  2ZQ8 A;  3OLO A;  2H5S A;  3NCK A;  2VX8 A;  3NBL A;  2XFS A;  3GEC A;  4DE0 A;  3VP1 A;  4HP9 A;  4HES A;  1MC0 A;  3FG8 A;  1GSV A;  4HH3 A;  3KYZ A;  4N9L A;  2PR5 A;  3LR4 A;  1IKG A;  2VZW A;  4Z1W A;  2WUQ A;  2W3E A;  3MQO A;  4UEY A;  4GLQ A;  4ARZ B;  3MZF A;  2EX9 A;  3CI6 A;  5CXW A;  1TVF A;  4H6J A;  4Y13 A;  4HI4 A;  1IYP A;  2M7V A;  5J3W A;  2P9V B;  2IWB A;  5I94 A;  4JGR A;  2BTF P;  4I3J A;  1IOU A;  4EUZ A;  1J3W A;  5L10 A;  2FFY A;  3HLD A;  1O7E A;  5EUA A;  3LEZ A;  4QU3 A;  1SZV A;  4C6Y A;  4ZBE A;  4R0Q A;  2XK1 A;  1PFL A;  2JKR I;  2KDK A;  5C5K A;  2E8J A;  5EVE A;  1E4D A;  2ZQC A;  1QME A;  1LL5 A;  5CGW A;  4KZ8 A;  4GDN A;  3VE4 A;  4S2P A;  1K6R A;  4QWO A;  1KVM A;  4R3B A;  3CPT B;  3T4K A;  1BLP A;  1KVL A;  3DWK A;  4C75 A;  1XJ3 A;  4NEE D;  4NXF A;  5DJT A;  3QP5 A;  4RX2 A;  1TS7 A;  1H8M A;  2WGI A;  4RX3 A;  3R7W A;  3UY6 A;  3V3S A;  5FI6 A;  4EER A;  1G6A A;  2WAD A;  4O0P A;  3OCL A;  1KGE A;  3HLW A;  1XX2 A;  1NXY A;  3MQQ A;  5F69 A;  1CI8 A;  3ZCZ A;  1BTL A;  3ZG5 A;  1OTA A;  5FDS A;  4JLF A;  1I2S A;  2VV8 A;  3LFV A;  3WS4 A;  5TGF A;  1JNU A;  1FR1 A;  1MBL A;  4DE3 A;  3F1N B;  4DF6 A;  1MWU A;  3OOV A;  4JGQ A;  3HUM A;  2ZQ9 A;  5FAT A;  4LV3 A;  3WRT A;  2JHE A;  2QHK A;  3HLF A;  1VHM A;  3HJK A;  4WMC A;  1YKD A;  3WS1 A;  4EQ1 A;  2JKT I;  4R38 A;  2DMW A;  5FA7 A;  1JWZ A;  2H10 A;  4X25 A;  1DP8 A;  3JVV A;  3H82 A;  3PBS A;  4KG5 A;  1K57 C;  5CTM A;  3FWL A;  5DFY A;  2V2F F;  4QPR A;  4HHD A;  4U0X A;  1S1Y A;  3B42 A;  4KUK A;  4E6W A;  1XFQ A;  2ZL1 B;  5TBM A;  2PBY A;  2J3T C;  3DTI A;  3IX8 A;  3SS4 A;  3G30 A;  4OP5 A;  5GLD A;  2GJ3 A;  1YMS A;  4X56 A;  3G4P A;  1NRJ A;  2OOL A;  4X55 A;  4B88 A;  4CJN A;  5A90 A;  1H8Z A;  4S2I A;  3VFH A;  2ZC5 B;  2H28 A;  3UPN A;  3UE3 A;  2ZQ7 A;  3IXG A;  4E3O A;  2HPB A;  1FCO A;  1DRM A;  2XA7 M;  3SZT A;  2W0N A;  3T1R A;  3RFB A;  1KGG A;  3LCE A;  3CAX A;  5E2H A;  5HD5 A;  2JC7 A;  5M19 A;  2J7V A;  3EQU A;  3IX4 A;  3VE3 A;  5CGS A;  1SKO A;  5F83 A;  4R3J A;  1K55 C;  1NYM A;  3V3R A;  3QP8 A;  2NUP C;  5EVI B;  3MXQ A;  4HJ3 A;  4IED A;  3IXB A;  3H9W A;  5AJG A;  4EEU A;  3WS5 A;  2WAF A;  3GR2 A;  1LT0 A;  3A0S A;  4YWZ A;  1XJ4 A;  1NJ4 A;  1EWZ A;  1YQS A;  5L07 A;  1ES2 A;  1XPB A;  5GHZ A;  4BD0 A;  4C3Q A;  2R78 A;  5KSH A;  4MN6 A;  4DXB A;  2OWJ A;  1YT4 A;  1SDN A;  5KIZ A;  5HPF A;  2ZC3 B;  2W1T A;  3O87 A;  3IH8 A;  3G32 A;  3IWI A;  4WEK A;  1X0O A;  4G3V A;  2P04 A;  4LRY C;  2V8F A;  2QWS A;  4PM7 A;  4LPZ A;  1E3U D;  3VSK A;  2EX8 A;  3CG5 A;  3IXH A;  2UV0 E;  4Y3I A;  5GLA A;  3C4P A;  4CQH A;  4JF4 A;  4PM8 A;  1NZU A;  3W2Z A;  1WYC A;  1WYB A;  2VLG A;  4BL2 A;  5K5B A;  3NDE A;  3M2J A;  1ESI A;  3G2Z A;  1A0K A;  2XDM A;  1DJB A;  4ID4 A;  3UE6 A;  2CC1 A;  4GW9 A;  2WGW A;  3C7V A;  5FQJ A;  4WEL A;  1KOU A;  3E4P A;  1ES4 A;  4NET A;  4GD8 A;  3ZG0 A;  4Y5F A;  1L3L A;  3OBF A;  2BG1 A;  2V1A A;  5EVI C;  1OTI A;  1ZG6 A;  3ZQ5 A;  5CTN A;  4X6T A;  3GVB A;  1K56 D;  3ZHH A;  1Y4O A;  3HVF A;  5HFO A;  2WKI A;  4OVD A;  4A5R A;  3ZVT A;  5FI2 A;  3V67 A;  3MZE A;  4BWI A;  3CUE A;  4FCF A;  3D9Y A;  3VMA A;  5KZH A;  3T50 A;  4WBG A;  4R6L A;  3IHA A;  1YPR A;  3N7W A;  4DJ3 A;  4WL9 A;  2ZD8 A;  1YSP A;  3UPP A;  5AVE A;  3KSI A;  3NJA A;  3PAE A;  3C2W A;  1JVJ A;  5FQI A;  2G2U A;  3S7N A;  1UWN X;  2C6W B;  3BFD A;  4WZ4 A;  2XH9 A;  2Y2N A;  1BLC A;  3CWF A;  4DDS A;  1GA9 A;  3IT9 A;  4LEN A;  2ZLY A;  1ZHH B;  3OPL A;  4UAA A;  3HLB A;  5F5Y A;  1ESU A;  4HJ4 A;  4M3K A;  5EPH A;  3P7N A;  3E4Q A;  1EW0 A;  2PHY A;  1DY6 A;  2GZA A;  3F1O A;  3QNC A;  2V0U A;  2EWW A;  2ZM2 A;  5JYP A;  2WGV A;  3Q7V A;  5EOE A;  4H6J B;  1BZA A;  2E8I A;  4GJ4 A;  4OH0 A;  1S66 L;  2PR6 A;  3K2N A;  1F5M A;  2QKP A;  5DF8 A;  2Y2L A;  1S67 L;  2JKR M;  4L0L A;  4Y0U A;  3BRM A;  4YNR A;  1TS0 A;  3GSG A;  3UE1 A;  3HLC A;  3HRE A;  3TW8 A;  1ALQ A;  1CF0 A;  1OT6 A;  1FR6 A;  3MFX A;  3LI8 A;  1XGI A;  5EM0 A;  2A24 B;  3O88 A;  2V1Z A;  5HDC A;  1AWI A;  4Y7P A;  4MMN A;  4DDY A;  2B02 A;  4H8R A;  1K4F A;  1S0W A;  1ZC2 A;  3VOL A;  4KQQ A;  2XFT A;  3R7W B;  3RJU A;  4AFI A;  4G3W A;  2VK3 A;  3ZGA B;  5EEC A;  4GDB A;  1SKF A;  3IQA A;  5HD3 A;  4CLC B;  2DCF A;  2Q0O A;  1OJG A;  1OPX A;  4Y0O A;  3NDG A;  1LHY A;  4OLG A;  1I5Q A;  3HLG A;  3LIC A;  1XA1 A;  1DP6 A;  2H0T A;  4KZ7 A;  5DTT A;  1FQG A;  1H0M A;  3G34 A;  4S2J A;  2I9V A;  4ZJ1 A;  2J3T D;  4DXC A;  3OPP A;  4LV2 A;  4E6X A;  4JBF A;  1LI0 A;  4PKY G;  2UWX A;  4EV4 A;  5HWW A;  2EFX A;  2XLN A;  1UGU A;  3H82 B;  3HLE A;  3JVU A;  4UA7 A;  4OON A;  3GTC A;  3T4S A;  1K25 A;  2W1R A;  3EOI A;  1KDS A;  2R9W A;  4L9E A;  1NY0 A;  2QYB A;  5EM1 A;  1MWT A;  3LR5 A;  1AXB A;  3N6I A;  1XA7 A;  1ONH A;  5TBM B;  4JXG A;  3V5M A;  4B4Z A;  1W8Y A;  2JBF A;  3EWK A;  3E2L A;  5G18 A;  3BM6 A;  2Y79 A;  4P0M A;  1KDW A;  2ZJ9 A;  4I39 A;  1G5U A;  4PM9 A;  5HAP A;  2B5R A;  5DTK A;  1D06 A;  4X53 A;  1RCJ A;  4Y17 A;  3ZNY A;  4ME4 A;  3VOZ A;  1TS6 A;  1VEU A;  2W27 A;  3UB5 P;  3RTY A;  5LBR A;  2X71 A;  3C38 A;  5D3O A;  2L4R A;  3MS6 A;  3EEH A;  1HZO A;  4BEN A;  2XA7 S;  3UME A;  3MXS A;  4E3M A;  4QHC A;  4R4S A;  1OME A;  1LL8 A;  1SKO B;  5GLB A;  3S1Y A;  4N1H A;  5G4Z A;  4IHQ A;  5FI7 A;  3BFF A;  3PHY A;  1K54 A;  5CX7 A;  4WF0 A;  1PI5 A;  3A3J A;  3Q1F A;  2OWH A;  4HNB A;  2XRO A;  2RCX A;  1D7E A;  4OQ0 A;  3D4F A;  4K0W A;  3UDI A;  3N8L A;  5GL9 A;  2JKF A;  4LCM A;  1FSY A;  1MZU A;  3VP0 A;  1XJ2 A;  3N8R A;  3NOP C;  4EBN A;  5A93 A;  5G4Y A;  4LCL A;  2W1T B;  3HUO A;  5FQQ A;  3NOU C;  5JYO A;  2KOI A;  4X1M A;  2VGL S;  3ITA A;  3FKV A;  3T1S A;  2EWV A;  3BFG A;  2Y91 A;  5DJU A;  1K4E A;  3W4O A;  3CLO A;  5EVI D;  2JE5 A;  2PD7 A;  3BJN A;  4WN5 A;  2EX6 A;  4XUZ A;  2Y2O A;  4B4X A;  4UQI M;  4BBT A;  3R4K A;  4KG2 A;  4E3K A;  2O9B A;  1T19 A;  3PBO A;  2EFU A;  4MN5 A;  2XRN A;  1CJF A;  3UNW A;  2ZC7 A;  1GHP A;  3IWO A;  4ETX A;  1OTB A;  2R9X A;  4RA7 A;  3OCN A;  4DRT A;  2ZMA A;  1YSQ A;  1MWS A;  3BEB A;  3A3D A;  1XFN A;  2Y2H A;  2V0W A;  4ZAM A;  4WUJ A;  4IBR A;  3WS0 A;  3T4L A;  3GRJ A;  3MJQ A;  4XT2 A;  1FCN A;  2VA0 A; 
#chains in the Genus database with same CATH homology
 3Q81 A;  5KMW A;  5AQA A;  3C4O A;  1WYC A;  1WYB A;  4IVI A;  1XXM A;  4BL2 A;  1YLW A;  3NDE A;  1BSG A;  1YLZ A;  3G35 A;  3M2J A;  1VQQ A;  3UE0 A;  1ESI A;  2IWC A;  3G2Z A;  5EVI A;  2XDM A;  1DJB A;  4MBK A;  2WKH A;  4Q8I A;  4ID4 A;  1G68 A;  2CC1 A;  5FQ9 A;  4KZA A;  3PTE A;  1ZKJ A;  1YLT A;  3DTM A;  5M18 A;  2WGW A;  4Y0T A;  3C7V A;  4OKP A;  5FQJ A;  3GQZ A;  5E43 A;  5EE8 A;  4WEL A;  3IXD A;  4F94 A;  2Q9M A;  1ES4 A;  3OZH A;  4NET A;  1H5X A;  4GD8 A;  3ZG0 A;  4O7D A;  1Y54 A;  3O3V A;  4S2K A;  5CHU A;  2BG1 A;  3ZG8 B;  5EVI C;  1KE0 A;  1TDG A;  1ES3 A;  1RGY A;  1ZG6 A;  2P74 A;  1L0D A;  4UA9 A;  3ZG9 B;  4DE2 A;  1BUL A;  4IVK A;  5CTN A;  2G2W A;  4X6T A;  3GVB A;  1K56 D;  5BOH A;  3ZHH A;  1K6S A;  5DF9 A;  1PYY A;  5CER A;  4KZ5 A;  3HVF A;  5HFO A;  4PM6 A;  2WKI A;  2HP6 A;  4OVD A;  4A5R A;  3ZVT A;  4MEZ A;  4UHU A;  5FI2 A;  2ZC4 B;  2Y2P A;  3ZNT A;  1N4O A;  3M6H A;  3NC8 A;  3MZE A;  5CHJ A;  4Z9Q A;  4P87 A;  2A3U A;  4FCF A;  5DTS A;  4U0T A;  5HAQ A;  3Q7V B;  3BYD A;  4S2N A;  1ERQ A;  3PBQ A;  1PW8 A;  2PU4 A;  4OQI A;  1ES5 A;  4S2M A;  1JTD A;  1ZG4 A;  3C7U A;  3VMA A;  1ONG A;  5KZH A;  4FH4 A;  1QMF A;  1W79 A;  1JWP A;  2XD1 A;  1GCE A;  2VGK A;  1GA0 A;  3IHA A;  4KG6 A;  4GN2 A;  3AGF A;  4KZ9 A;  4WBG A;  3UDF A;  1YLP A;  2HDS A;  1PZO A;  2GDN A;  3N7W A;  1NRF A;  4OOM A;  1ERM A;  1PIO A;  3IHB A;  1L0E A;  4K91 A;  2ZD8 A;  4R23 A;  5KSC A;  3UPP A;  3JYI A;  2Y59 A;  3W4Q A;  4GOG A;  4X69 A;  3GV9 A;  5CRF A;  4E3L A;  1XP4 A;  1E3U A;  3PAE A;  1JVJ A;  5FQI A;  4S2N C;  3MBZ A;  1L0F A;  2G2U A;  2BLS A;  2ZQA A;  1CEG A;  4EWF A;  2C6W B;  3UPO A;  2JCH A;  3BFD A;  1MKI A;  2J9O A;  4IBX A;  4GD6 A;  1Z6F A;  1HVB A;  1L0G A;  3FYZ A;  4WZ4 A;  4NK3 A;  5EVL A;  1KE3 A;  1IKI A;  4OPQ A;  5FSR A;  2XH9 A;  4MNR A;  5GHX A;  2Y2N A;  1YLJ A;  2WGW B;  2OLU A;  1BLC A;  2C5W B;  3VP4 A;  4LV1 A;  5F1G A;  4DDS A;  3MFD A;  4EQI A;  1EI5 A;  3SH9 A;  3M6B A;  4OP8 A;  1GA9 A;  3IT9 A;  4LEN A;  2ZLY A;  4N92 A;  4QB8 A;  1J9M A;  2XQZ A;  3LO7 A;  3OPL A;  4OOY A;  2WYX A;  2XEP A;  3HLB A;  4UAA A;  1U60 A;  2XF3 A;  2Y55 A;  1ESU A;  4M3K A;  4QJG A;  1BLS A;  1DJA A;  3SS3 A;  1Q2Q A;  5EPH A;  1C3B A;  3A3F A;  2J9P A;  3IH9 A;  3TOI A;  4KEN B;  3NIA A;  4PMA A;  3SH7 A;  1DY6 A;  3QNC A;  1GHM A;  2X01 A;  4E3N A;  4WEJ A;  1BT5 A;  2ZM2 A;  5JYP A;  2EXB A;  2WGV A;  3Q7V A;  4RYE A;  1ERO A;  1WE4 A;  2OV5 A;  1K56 A;  5EOE A;  3GMW A;  2P9V A;  3ITB A;  1VM1 A;  5J8X A;  1RGZ A;  1BZA A;  2E8I A;  3MKE A;  3LY4 A;  1FOF A;  2A49 A;  5F1F A;  4OH0 A;  5CED A;  2Y2K A;  2Y4A A;  5DF8 A;  3ZG7 B;  1MY8 A;  1TEM A;  3O86 A;  3MKF A;  2WK0 A;  2Y2L A;  5IHV A;  2IWD A;  4ZTK A;  4L0L A;  2WZZ A;  4Y0U A;  3BRM A;  3WRZ A;  4JF5 A;  3IWQ A;  2XGN A;  3GSG A;  3FZC A;  3UE1 A;  3HLC A;  3FV7 A;  3HRE A;  3G2Y A;  1ALQ A;  3OPH A;  3C5A A;  5FQK A;  1LI9 A;  1M6K A;  1FCM A;  4KZ3 A;  4HBU A;  4ZJ3 A;  3Q82 A;  5FAQ A;  1FR6 A;  4MLL A;  5TFQ A;  4ZDX A;  4RVA A;  4S2O A;  2Y2G A;  4S2L A;  1XGI A;  5HL1 A;  1BUE A;  2ZQ8 A;  2H5S A;  3O88 A;  2V1Z A;  3NCK A;  4Y7P A;  5FAP A;  2ZQD A;  4DDY A;  3NBL A;  2XFS A;  4DE0 A;  3VP1 A;  4HES A;  4H8R A;  1K4F A;  1HTZ A;  1S0W A;  4P6B A;  4BQM A;  1ZC2 A;  3HL9 A;  4N9L A;  4OLD A;  4KQQ A;  1L2S A;  2XFT A;  3RJU A;  2X02 A;  5CEB A;  3ZVW A;  1IKG A;  4JPM A;  2WUQ A;  1S6R A;  2ZM8 A;  3CJM A;  3ZGA B;  5FQM A;  3VOY A;  5EEC A;  4GDB A;  1MXO A;  3MZF A;  5E2G A;  2XD5 A;  2EX9 A;  3N4I A;  5CXW A;  1SKF A;  1TVF A;  3IQA A;  4HBT A;  1YLY A;  5U47 A;  2DCF A;  1IYP A;  2HDR A;  3MXR A;  3TG9 A;  2QPN A;  4Y0O A;  3I7J A;  2P9V B;  2Q9N A;  1PI4 A;  1LHY A;  3NDG A;  2IWB A;  4OLG A;  5I94 A;  1I5Q A;  1GHI A;  3VSL A;  3HLG A;  4EUZ A;  5M1A A;  1XA1 A;  4D2O A;  2EXA A;  3W8K A;  4CPK A;  3ZDJ A;  2FFY A;  3V50 A;  3HLD A;  2H0T A;  3OC2 A;  1O7E A;  4WMC D;  5EUA A;  3LEZ A;  4QU3 A;  4KZ7 A;  4WM9 A;  4UA6 A;  5DTT A;  1FQG A;  3G34 A;  1O07 A;  4C6Y A;  3Q7Z A;  3OPR A;  4ZBE A;  5DVA A;  3A3E A;  4S2J A;  4R0Q A;  2XK1 A;  3TSG A;  3BEC A;  4ZJ1 A;  1E4D A;  3S22 A;  4DXC A;  1IEM A;  2ZQC A;  2Y2I A;  1QME A;  3OPP A;  1LL5 A;  4LV2 A;  4OOL A;  5CGW A;  4KZ8 A;  4N9K A;  4E6X A;  4GDN A;  4JBF A;  1LI0 A;  2UWX A;  4EV4 A;  4S2P A;  1K6R A;  1KVM A;  2FFF B;  2EFX A;  4MBF A;  4R3B A;  2XLN A;  1Q2P A;  3HLE A;  4OON A;  4UA7 A;  1BLP A;  1KVL A;  1N9B A;  1PWD A;  3GTC A;  1K25 A;  3DWK A;  4C75 A;  4OPZ A;  1RP5 A;  1KDS A;  5E2F A;  1LLB A;  2R9W A;  2PU2 A;  1SCW A;  4RX2 A;  1FSW A;  2WGI A;  1NY0 A;  2OLV A;  4RX3 A;  2VGJ A;  1MWT A;  1YM1 A;  4KQO A;  3UO9 A;  3UY6 A;  5FI6 A;  3V3S A;  3QNB A;  1AXB A;  1CI9 A;  1G6A A;  3CZD A;  3N6I A;  2WAD A;  1XA7 A;  5CGX A;  1ONH A;  3OCL A;  3SOI A;  1KGE A;  3HLW A;  2HP9 A;  3ZFZ A;  1XX2 A;  4KZ4 A;  1NXY A;  4JXG A;  3V5M A;  5GLC A;  4WZ5 A;  4JF6 A;  4B4Z A;  1CI8 A;  1IYQ A;  1W8Y A;  3BFC A;  3ZCZ A;  4EBP A;  1BTL A;  4KQR A;  3ZG5 A;  2JBF A;  4JLF A;  1I2S A;  5EOO A;  4E3I A;  3WS4 A;  4N1X A;  2HDQ A;  5TGF A;  3N8S A;  1IYO A;  2EX2 A;  2DNS A;  1FR1 A;  5AQ7 A;  3UN7 A;  4P85 A;  1MBL A;  3E2L A;  1XKZ A;  5G18 A;  1H8Y A;  1TDL A;  3BM6 A;  3ISG A;  4P0M A;  1KDW A;  4OPR A;  2ZJ9 A;  4DE3 A;  4DF6 A;  4FSF A;  4PM9 A;  5HAP A;  1MWU A;  1M40 A;  1BLH A;  2B5R A;  4WZ5 C;  4DKI A;  3VP2 A;  5DTK A;  4X53 A;  4GNU A;  5HAI A;  3HUM A;  2ZQ9 A;  1RCJ A;  5FAT A;  1K57 A;  4LV3 A;  1W8Q A;  1MWR A;  2Z2L B;  1NYY A;  3MZD A;  3WRT A;  3VOZ A;  1PW1 A;  3HLF A;  1W5D A;  3ZNY A;  4WMC A;  3WS1 A;  2X71 A;  3W4P A;  3NY4 A;  5FA7 A;  1JWZ A;  5D3O A;  2XR0 A;  2H10 A;  3RXW A;  3BFE A;  1E25 A;  1HZO A;  3B3X A;  4BEN A;  4DE1 A;  3MXS A;  3HUN A;  4QHC A;  4R4S A;  1OME A;  3PBS A;  3SS5 A;  4E3M A;  5AQ9 A;  5GLB A;  3S1Y A;  4KG5 A;  4QY6 A;  1K57 C;  4N1H A;  5CTM A;  3FWL A;  1HD8 A;  4PM5 A;  2J8Y A;  2V2F F;  4JXS A;  1MPL A;  3BLS A;  4U0X A;  2WAE A;  5FI7 A;  3BFF A;  1K54 A;  2WKE A;  4KZB A;  2OSU A;  1PI5 A;  3P98 A;  3A3J A;  4E6W A;  4GB7 A;  3Q1F A;  4U3T A;  1CEF A;  3LY3 A;  4GKU A;  1JWV A;  2PBY A;  1KGF A;  1LL9 A;  2ZC6 B;  3SS4 A;  3G30 A;  4OP5 A;  2RCX A;  3AGD A;  5GLD A;  4OQ0 A;  3EQV A;  1YMS A;  3D4F A;  4K0X A;  1SDE A;  4K0W A;  4X56 A;  3UDI A;  3N8L A;  5GL9 A;  4E3J A;  2Y2Q A;  3G4P A;  4X55 A;  2QMI A;  1K54 C;  1PZP A;  3WS2 A;  5GHY A;  4B88 A;  4CJN A;  5A90 A;  1H8Z A;  4S2I A;  4LCM A;  1FSY A;  4GZB A;  3VFH A;  3VP0 A;  2Y2J A;  5HW3 A;  2ZC5 B;  4JXV A;  3N8R A;  3IF6 B;  5L2F A;  3UPN A;  4BLM A;  3UE3 A;  4EBN A;  2ZQ7 A;  5A93 A;  3IXG A;  4E3O A;  4EBL A;  3UDX A;  2HPB A;  1FCO A;  4LCL A;  1K55 A;  2HDU A;  3HUO A;  5FQQ A;  5JYO A;  1SHV A;  1IEL A;  4R1G A;  1PWC A;  2HP5 A;  3HBR A;  3FKV A;  3ITA A;  3NI9 A;  1KGG A;  3LCE A;  4HEF A;  5E2H A;  5F82 A;  3FKW A;  2JC7 A;  5FAO A;  2DRW A;  2J7V A;  5M19 A;  3SH8 A;  5AQB A;  2Z2M B;  3EQU A;  3BFG A;  2Y91 A;  1K4E A;  4KZ6 A;  3W4O A;  5CGS A;  5EVI D;  2JE5 A;  4JXW A;  5F83 A;  4YFM A;  4R3J A;  3AGE A;  1K55 C;  2EX6 A;  4XUZ A;  4ZJ2 A;  1NYM A;  2Y2O A;  3V3R A;  4LV0 A;  4B4X A;  3Q07 A;  2H0Y A;  2WZX A;  1JTG A;  4OQG A;  5EVI B;  5TR7 A;  4KG2 A;  3V39 A;  1NZO A;  4E3K A;  4IED A;  3PBO A;  4MBH A;  3RXX A;  3PBR A;  5FDH A;  4QD4 A;  4XUX A;  3IXB A;  3DWZ A;  2EFU A;  4XXR A;  3QHY A;  3WS5 A;  3VP3 A;  2WAF A;  3GR2 A;  4X68 A;  4BJP A;  3PBN A;  5E2E A;  3UNW A;  5A91 A;  2ZC7 A;  1GHP A;  1NJ4 A;  1DJC A;  2Y2M A;  3WWX A;  1EWZ A;  1YQS A;  4FH2 A;  3IF5 A;  1PWG A;  1W7F A;  1ES2 A;  1XPB A;  3IWO A;  4YIN A;  5GHZ A;  4BD0 A;  4C3Q A;  1I2W A;  5KSH A;  4DXB A;  2R9X A;  1CK3 A;  5A92 A;  1IYS A;  4OQH A;  1YMX A;  1XGJ A;  1SDN A;  1YT4 A;  3CMZ A;  4FD8 A;  5FAS A;  3IF6 A;  2I72 A;  5CEC A;  3DW0 A;  3PAG A;  2ZC3 B;  3S4X A;  3E2K A;  4RA7 A;  3P09 A;  3O87 A;  4OPY A;  3IH8 A;  3OCN A;  5HX9 A;  4DRT A;  2ZMA A;  2V20 A;  3G32 A;  3A3I A;  4PPR A;  4WYY A;  3IWI A;  1MWS A;  3BEB A;  3M2K A;  3BLM A;  4WEK A;  3A3D A;  2Y2H A;  5HAR A;  2RL3 A;  4BD1 A;  5DF7 A;  4ZAM A;  4PM7 A;  4QY5 A;  3PBT A;  1E3U D;  3IF6 C;  4IBR A;  4R4R A;  2ZM0 A;  3VSK A;  3WS0 A;  1KE4 A;  2EX8 A;  4JKT A;  5CHM A;  3CG5 A;  3GRJ A;  3IXH A;  5GLA A;  3C4P A;  3G31 A;  2QZ6 A;  4JF4 A;  4BL3 A;  1FCN A;  1K38 A;  3VFF A;  4PM8 A;  1NZU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...