5GIBA

Succinic acid bound trypsin crystallized as dimer
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
223
structure length
218
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Trypsin bound with Succinic acid
rcsb
molecule keywords Cationic trypsin
molecule tags Hydrolase
total genus 52
structure length 218
sequence length 223
chains with identical sequence B
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2016-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5gibA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5gibA02
2ZC9H 3SUGA 2A5IA 1AB9B 1O0DH 2Z9GA 1QURH 3SU3A 4I33A 4ESTE 1CT0E 1DSTA 1O2MA 2F9BH 2PGQB 2SGFE 3OX7U 2VIQA 4TPYA 3A7ZA 3T29A 3VB4A 2BQWB 1THPB 1ZHMA 1KXAA 3S9CA 1XKBC 1Q31A 1GBDA 1G2LA 3RXBA 4WMEA 1KXDA 2H1UA 4K2YA 1QBVH 4GPGA 2FXRA 3RC6A 2Q1JA 1YF4A 4GCHF 1Y3WA 4DIHH 3PMAB 4E7RG 1MCTA 1QBOA 4GSOA 2ZFQH 1HLTH 5HMAA 2OXSA 2BDAA 3PROA 2ZTZA 2A7JA 2VWLA 1RTFB 4R8TB 1OP2A 2FOMB 3TH4H 2VIOA 3E3TA 5FCKA 3MH7A 4X2VA 4CRFA 1PPHE 1V2OT 5PTPA 1SG8B 3QWCH 4TY6A 5K7RA 1K1MA 1ZPCA 1O2KA 4A1VA 2HALA 2P8OB 3LDXH 3FP8E 2STAE 1W11U 2ZWLH 3M3SA 5L2ZH 1ZLRA 2ZNKH 2D2DA 3SGQE 3U8TH 3SUDA 1O5DH 1GJ4H 3SV6A 1YCPM 3K6ZA 3RXUA 3TJVA 1FAXA 2VINA 2BD3A 2SGDE 1V2VT 1LHEH 1WU1A 1VCWA 3BTGE 2FS9A 2BYAX 2AH4X 4AYYB 2LNCA 2D8WA 1GCDA 3SNCA 1O31A 3AW1A 4M7GA 1BITA 4VGCC 1ZSLA 3UNQA 3QO6A 4B71A 4CRGA 3O8RA 3L33A 4Z6AH 4O97A 1HJ9A 3BG4B 5JBAS 1LDTT 1AKSA 1JXPA 2ZEBA 2B5TB 4BAKB 2OC0A 4YOJA 2BY6X 1HCGA 2FTLE 4HZHA 2QCYA 3TK9A 2Z6BD 2EI8A 3LJJA 5TCCA 2A45B 4TYDA 1O2PA 1SR5C 4OGYA 1A0HB 2JETC 2VIVA 4AGKA 2OBQA 4NFFA 4Q7YA 1FY1A 1MMJN 3Q00A 5ESBA 3R0FA 4K60A 2FI5E 3M36A 1GI3A 2QGRA 4XFQA 1SGTA 2QN5T 1LPKB 3BTTE 3FZZA 1CA0B 3NWUA 4HFPB 4HI3A 1C5QA 1P2IA 1G2MA 2ZHWH 1GVLA 1A3BH 2XC5A 2EI6A 1J17T 5FXLA 1RJXB 1XUFA 1FY8E 1KLIH 2BDBA 3ZZ7A 5T3HA 5C1XA 1O5FH 4FUEA 3P17H 4NIYA 1C9TA 1ZGIA 3VGCC 2BOKA 4MTBA 1QB1A 3IWMA 1G32B 1MAXA 2D1JA 3E6PH 5AFYH 5DG6A 2F9OA 1TMBH 2AGEX 3ZZ5A 3UNSA 1CHOF 1PPGE 4GUXA 2BLQA 1GBFA 1TBZH 2RG3A 3ATKA 4BXSA 1Y5BT 2V0BA 1KIGH 2ZQ1A 1N6XA 5GDSH 4XBDA 1EX3A 3H7OA 1KTSB 3D23A 4HTCH 1ZSJA 1YGCH 1DY8A 4DY7B 3URDA 1MKWK 4KP0A 4X6NA 3T28A 5DPAA 1DLKB 4RKOB 1O3EA 2DUCA 3MNBA 1W12U 4JYVH 5FHTA 1P05A 1EP6A 1XVOA 2FIRH 4KELA 3O8CA 1IQKA 3MOCA 3HK3B 4K8YA 1PYTD 3V0XA 3ZVEA 3PLBA 1GHAG 3A8BA 1K22H 1HAGE 1Q3XA 1P0SH 3U8RH 3LOXA 1GMCF 1Z1JA 5AVDA 2WUBA 4ISLA 3RXHA 1UTMA 2WPHS 3D62A 3E0PB 4NWKA 1V2ST 4YESB 3BTKE 1O2SA 4A1TA 3AAVA 1BA8B 2W3IA 3DUXH 2GCTB 1Z8IB 3PMJA 3SUEA 4Y0YE 2B7DH 3NCLA 2LPRA 2EEKA 4D7GA 2PWXA 1V3XA 1F2SE 1ARBA 1JRSA 1P3EA 1H9LB 2HNTE 1FUJA 3RLWH 2CF9H 4X1SU 1YCPK 2AFQB 1P2NA 1O2IA 3ZVDA 3PO1C 3BV9B 1ELEE 1D3PB 1OPHB 3SV2H 1SQOA 4MPUA 1VGCC 1IQMA 8LPRA 4X2XA 1AKSB 5DP6A 1BMLA 1GHYH 4ZHLU 2ZHEH 1UTOA 3SN8A 3TGIE 4ASHA 2FOAA 4BANB 1NRNH 1Z8JB 4KTCA 5EXMA 1ETSH 1TRYA 4NFEA 2OD3B 1F5LA 2BXTH 2UUJB 3TH3H 1C1WH 2F3CE 1XUHA 3SNEA 2V35A 2M5TA 1TNHA 3K9XB 1ZJKA 1P8VC 4OS7A 1IQIA 2GDDA 3BSQA 3KQCA 4WMFA 1QNJA 2ZFPH 3QN7A 1IQHA 1QRZA 1ZJDA 2BVXH 1TNGA 1DX5M 5EQQA 1CU1A 3JZ2B 2OTVA 1E34B 3BTEE 4ZXXH 3EAJA 1GHBF 4D8NA 1MCVA 2AERH 1XUKA 1UK4A 1G30B 2GMTB 1BDAA 1TBRH 5B6OA 4IBLH 4LK4A 1CGIE 2ZTXA 4D76A 1HRTH 5ABWA 1VITG 2ZI2H 3T26A 1NPMA 1O2ZA 1WBGB 1A5GH 4IGDA 2BDCA 1Y5UT 3VB5A 1SGEE 1W7GH 2W7SA 3PLPA 2O8LA 2VIPA 4H6TA 1G9IE 1G3BA 1SGRE 2GCHG 1W3CA 2BY7X 1RS0A 3BTHE 4X1QU 2GV7A 1TOMH 2QIQA 4NIWA 3ZVFA 2BM2A 2IOTA 1MZDA 1YPLH 2GP9B 1OP8A 2G81E 3PMBB 2R2MB 1PJPA 2P95A 3NK8A 2J95A 2BLOA 4AORA 3O8BA 5K0HA 3UWIA 4ZROA 2WUCA 1ZTJA 1UVUH 6CHAB 2ILNA 4FUJA 3GCTG 1C5MD 1EP5A 1HV7A 3MYWA 2P3TB 4O3UA 1EAXA 5DP9A 1NC6A 1QA0A 2VVVA 5DKMA 5ETXA 1Q2WA 4AFZA 7GCHG 2A4GA 2H5CA 4I8HA 1GI1A 3BN9A 1FI8A 1C5VA 1TX7A 3TITA 4GAWA 4I8GA 4CRCA 4BNRA 3A83A 1ELVA 3M7UA 1IQLA 2WV5A 4GHTA 5FPYA 4UFFH 4XE4A 4ABDA 1AE5A 2O8UA 4MQAA 1ESBA 4DURA 1O37A 1TQ0B 3GY2A 1G37A 3DD2H 2Y80A 1TFXA 2ZFRH 4RN6A 1ELDE 4IN2A 4D9QA 1O3NA 1QFKH 4H6SB 1LVYA 1QQ4A 4NA7A 4RSPA 5AHGH 4K1EA 3ZV8A 1A61H 1OYTH 3RC4A 1SMFE 4DOQA 2RCEA 4FVBA 1N8OB 2AIPA 3IG6B 1UTPA 4F4OC 2FOEA 6GCHG 1GJ9B 1K1OA 1NRQH 1QRXA 3RXAA 4ABFA 1TE0A 1Y3VA 4WH8A 1W8BH 3V7TA 1WV7H 2ZG0H 3VB3A 4INHA 2ZCHP 3FANA 1F5RA 3MO3A 2FO9A 4X1RU 2XWBI 4B2CA 5FX6A 3SNAA 1V2RT 1U6QA 2GGVB 3IITA 1L4DA 5FPSA 3E0NB 1GDNA 3GYLB 1P06A 1T32A 2Y5HA 1RFNA 2ANKH 3U8OH 1D6RA 1GG6B 1UTNA 2A2QH 2FTMA 1TONA 1D3DB 1SLVB 2PHBA 3GY8A 2VJ1A 3OY6U 2ZTYA 3ELAH 1CA8B 4DCDA 3I77A 1HAPH 3GICB 3A87A 3SU6A 3TGJE 1CBWB 1SI5H 1A7SA 2F83A 1V2LT 1GJ8B 4A92A 2F9UA 1NROH 3SHAH 1AQ7A 2J34A 1S82A 2P93A 2F9PA 1IQEA 2O8TA 1JBUH 1NO9H 1C1NA 4WH6A 2ZCLP 3SU4A 4WXIA 3E8LA 1LVOA 3R3GB 5AFZH 5I25A 1Y3UA 1GBIA 4A1XA 1K21H 5EQRA 4ABBA 3MNSA 2QXGA 2Z3CA 4JCNA 4FUDA 1EQ9A 2B9LA 3BTWE 3GDVA 1H8IH 3VXEH 2ZGJA 1AWHB 2FOGA 1LVMA 2C3SA 1QL9A 3T5FH 5JBCS 1C5ZB 3KCGH 1NFYA 2HLCA 4BAHB 1BJUA 2FOBA 3P8FA 1YPEH 1SGIB 3KIDU 1VJAU 1AUJA 3B9FH 3M3VA 1LTOA 2F91A 1K1PA 4INLA 1GBEA 1GMHG 1N8OC 1O3OA 3RXVA 2BDYA 4SGAE 4XSKU 1INCA 5EQSA 2STBE 3HGPA 2GCHF 4IMZA 1FQ3A 3G01A 1MQ5A 4AGJA 1EZUC 2P59A 1RGQA 3QDZB 1H9IE 1B7XB 2BB4A 1VCQA 1GI5A 3KN2A 2SNVA 4U30A 3NPSA 3ZZ4A 3BEIB 1F7ZA 5DP4A 4KGAA 2C8YB 2VIWA 1TMTH 1NTPA 2VH0A 3E1XB 4INKA 2XBWA 3HKIB 4WY3A 1DM4B 1GBJA 1TX8A 3UREA 2V6NA 1IHSH 4DT7B 1W10U 2BD7A 3TNSA 4D7FA 1W14U 5HXFA 4ABAA 3SUFA 1GJ6A 1TX6A 3RXLA 1BRUP 1BOQA 1CO7E 1XMNB 3TNTA 3VB6A 2ZFTA 2JH0D 2ZDMA 3UTUH 2W7UA 4KTSA 3SQHE 2G00A 3LKWA 3O8DA 3GCHC 2TIOA 1O3JA 4X0WU 3V12A 2ZECA 3RXOA 1BBRE 2VB0A 1TNKA 3DHKH 1GBHA 4ZUHA 4K1SA 3QLPH 4B75A 1HAZB 1ETRH 1GI6A 5DP5A 4IW4E 5T6FA 1SLXB 3RXRA 2A4QA 2JETB 3PWBA 1TMUH 3HATH 3RMOH 1NFWA 1TYNA 2PKSB 3ESTA 3GOVB 1GBCA 4IC6A 4DVAU 4ABHA 1QB9A 3EDXB 3M61U 4AB8A 3H7TA 1QL7A 3GYMA 2XBVA 1LQEA 1FY5A 2W3KA 1E38B 1GJBB 1QTFA 1XUGA 1ZMLA 6GCHF 2ZDVH 2NU1E 3ZV9A 1DDJA 2JH6D 1LO6A 1OSSA 3SZNA 3VGCB 3TGKE 4F49A 1C2LA 4B1TA 1QQUA 1V2TT 2RA3A 1ETTH 1BRBE 3A8CA 3BTQE 2ALVA 2CGAA 1HAYB 2QYIA 3UQVA 1WAYB 1KDQB 3UWJH 1SHYA 3PM3A 1V2MT 1EJNA 3MO9A 1OXGA 1YPMH 5EGMA 1O2OA 1GBAA 3MHWU 1K2I1 5E0JA 1HFDA 3MH6A 1FZZA 2I6QA 2P94A 2ZZUH 1DUEA 2PUQH 5JDUB 3MNXA 1C1PA 3ZVCA 1ELCA 2PKAA 1A46H 2ZPRA 2F9NA 2GD4B 2P3UB 2VGCB 1SGFG 1IQFA 5TJXA 3SNDA 1W0ZU 1DUAA 3SJ8A 1PPFE 2Q6FA 4JZ1A 3ZVGA 1FN6A 5LPEA 1TQ7B 4KTUA 2BX4A 2WYJA 1HAIH 1A4WH 3BTME 3BG8A 1BBRK 1BTXA 2SGEE 4Y79A 3TJUA 1KXCA 2FDAA 3ZYDA 2Y81A 1YP9A 4A5TS 2C93B 4K8BA 1IOEA 3KNXA 4WMDA 2SGPE 2THFB 3I78A 1OS8A 1Y3YA 4I31A 1BTZA 3SU1A 1C2MA 4YT7H 3SU0A 1C9PA 1YC0A 3SV8A 2XWAA 1O2VA 1IQGA 1SGFA 2FYQA 1O5BB 1RTLA 2HPPH 2YNAA 4K5ZA 3SOSA 1AO5A 1UVPA 3ZVBA 1ABJH 2V3OH 1RRKA 1PQAA 4Q7XA 3BF6H 4TPIZ 3SJKA 3L6PA 1WQVH 3TK5A 1HJAC 2PKSC 2BVRH 2FI4E 1EB1H 2A5KA 4ABGA 5I46H 1XXFA 2W26A 1P2KA 1H8DH 3BTFE 5AF9H 4XBCA 3EE0B 4WVPE 2ZGXH 3PO1B 1O3BA 5DK1A 4Y7AA 1UVSH 1V2PT 1VGCB 1SSXA 1C5XB 3MH5A 1O2UA 4ABJA 2BD8A 2A5AA 2AGIX 3ZYEA 5JYIA 1JOUB 2EA3A 1Z6EA 1ANBA 2B0FA 4NSYA 2BD5A 2Z9KA 3F68H 5C5OA 1O2WA 5A2MH 3P70B 1K1NA 1OWHA 3A7VA 3H5CB 2CMYA 3ZZ6A 5FBIA 1BTPA 2ZGBH 1T4UH 2V3HH 1MKXH 2GVFA 3VB7A 5JBTA 1P9SA 3N7OA 3RMMH 4X6MA 1O3LA 3LH3A 1MH0A 4DW2U 1BTYA 1GGDC 1O3DA 1K1LA 8ESTE 2B8OH 1GCTC 1MBMA 3SI3H 4ABIA 2VGCC 5EW1H 5GJ4B 1J9CH 1DWCH 1XX9A 3EYDA 1WCZA 4ZKOU 1S0QA 2TPIZ 1PQ8A 3OU0A 5GIBA 1O38A 2GKVE 3U1IB 5E0HA 1DWBH 1QR3E 2AMDA 1LHFH 2Q6GA 3OTJE 1MTNB 5LPRA 1RIWC 1QJ6B 3W95A 1GDQA 3LC3A 2A7CA 2G4TA 1C1QA 3BEFB 1C2GA 1FPHH 4ZAEA 1MD7A 1B0EA 3RU4E 1C1TA 2ZIQH 4K1TA 1C5RA 1GMDG 3EA7A 4DJZB 2PKAB 1SHHB 4RKJB 4NGAH 1SPJA 1O3GA 4JK6A 4IMQA 4BAOB 1OWKA 2FI3E 1CE5A 2HNTF 3HKJB 1P03A 5ESTE 4AYVB 4WWYA 1WOFA 1D3QB 2ZP0H 2PFEA 1T4VH 3MU8A 3TH2H 4CR9A 1G3EA 3S9BA 4NIVA 4NCYA 1P12E 4Y8ZA 2O8MA 1LKBA 4OS4A 1MTUA 4YT6H 1P2MA 1ZMNA 1IQNA 1EAIA 5DP8A 1UCYH 1RD3B 2JH5D 5LGOA 1ACBE 1AD8H 4X2YA 1PPCE 1O2YA 1O3MA 2Z7FE 3A7XA 4NZQA 1Z8RA 3MNCA 4U2WA 4LZ4B 4UONA 3ATMA 3RXTA 3M35A 2GZ9A 1GDUA 1MU8B 3SGAE 3MMGA 4ISHH 2UWLA 2UUYA 3MH4A 1EOLA 1TAWA 1QIXB 3ZVAA 2P16A 1PPBH 3S7HB 1ANCA 1HIAA 1ZOMA 4X2WA 3D65E 1A1RA 5JB9S 1G36A 3F6UH 1AMHA 1SGCA 5GXPA 3A85A 2PR3A 1TGNA 1AFQB 2G4UA 3TIUA 1DWDH 2OINA 1IQJA 3ODFA 3OYPA 4Y71A 1TALA 1TABE 1WUNH 2ZDNA 1FJSA 2OUAA 2R0LA 3SW2B 3FP6E 1TWXB 1V2QT 3UOUA 1NM6A 2PTCE 3VPKA 1UMAH 1K9OE 1SGDE 1F5KU 1YLDA 5L6NH 3A88A 2BQ6B 3S9AA 2AEIH 1P11E 1C5WB 1MTNC 1Z1IA 3MU0A 2TRMA 3CS7A 4FUBA 4TWYA 3SHCH 1NY22 4FXGH 1C2KA 1GL1A 2RA0A 1O3PB 3FVFB 1B5GH 1TIOA 1FN8A 3QK1A 2H9EH 2ZU1A 3SORA 2HGTH 1F0UA 4K69A 1ZPBA 1EZQA 1PFXC 1ELGA 1UO6A 4LXBH 3MTYA 4Y10E 1FAKH 1HAVA 3PTBA 4JYTA 1C5NH 5E2OA 1GI9B 2WPJS 1SGPE 3RXCA 3A82A 1W13U 1UHBB 1S0RA 3PWCA 4O03A 1C5PA 1SGYE 2R3YA 1TNJA 2ZDKA 4I8JA 1EUFA 1O2NA 1SB1H 2AMPA 1PQ7A 1EOJA 2GZ8A 1D3TB 4WF8A 1EASA 1S84A 2Q6DA 6ESTA 4JK5A 1LHCH 1HXEH 3GY6A 1TGTA 1Y5AT 2H5DA 1GI7B 1C2HA 1SBWA 2ZF0H 3QTOH 3S69A 1NU7B 1T8NA 1E35B 5LPFA 2XBXA 4FUHA 1S83A 2K1QA 4NA9H 4ZKRU 2TGDA 2QF0A 2R2WU 3MFJA 1VCPA 1M9UA 2PSXA 1BTWA 2VWMA 5EU8A 4BOHA 2NWNA 2BDIA 1QBNA 1A0JA 1ESAA 1XVMA 3PB1E 1XUJA 1LCYA 3AVZA 1AVXA 1BZXE 1LMWB 3M37A 3QUMP 5J4SA 1J14A 1BB0B 1NFXA 1AFQC 4AFQA 4CHAC 2OC8A 1EKBB 1GHAF 1C5SA 2FS8A 2SGAA 4AX9H 1P2OA 2VWNA 2J92A 3RDZA 1S6FA 3STIA 5A8YA 1QB6A 1GBBA 1SGQE 3TJOA 2UUKB 4YTAA 3LGVA 1Z7KA 2ESTE 4XBBA 1S5SA 4XOJA 1AVWA 1DPOA 4WXVA 5E0GA 3TJNA 4MVNA 5CMXH 3LU9B 4NA8A 4OS6A 1O2JA 2BLVA 1HIAB 1ARCA 1TBQH 1DLEA 1FY4A 2C4FH 1D6WA 3SJIA 3A84A 1BRCE 1LQDB 5C1YA 4MNYA 3NUMA 1THSH 2SFAA 3LONA 2GX4A 3AW0A 2CV3A 4MLFB 4MDSA 1BT7A 5A8ZA 3ZZDA 3SBKA 1HXFH 1C5UA 4DIIH 1BMMH 3F9EA 2H9TH 3ZZ8A 1O2XA 3M7TA 3ITIA 4I32A 1FV9A 1X7AC 3GCHB 3QTVH 1QJ1B 1VR1H 1UK2A 3RXIA 1PPZA 4AZ2B 2NU3E 4NG9H 3K65B 2XXLA 1TPSA 1AN1E 1H9HE 2R0KA 3SJ9A 3F1SB 3M5MA 3Q3XA 2WPMS 3UIRA 4FU9A 2VNTA 1BTHH 1O5AB 3VFEA 1D9IA 4Y0ZE 1TPPA 1YKTA 1KDQA 4NWLA 5BPEA 3UFAA 2FOCA 3T2NA 1LKAA 2Z3EA 3P8GA 4FVDA 3T25A 2BZAA 1J15A 2J9NA 1HAVB 4YOIA 4FU7A 3EQ0H 3F9FA 3VXFH 1LPGB 4X8SH 3A86A 1O5EH 1UTKA 2FPZA 3E91A 4Y76A 5L2YH 2DE9A 4D9RA 1SGNE 2BQ7B 5H4IB 2DE8A 1AGJA 1CQQA 1VITF 1P57B 1ESTA 4H4FA 5CHAC 3SV7A 2BOHB 2FYRA 1KTTB 2KAIB 1OWEA 3ATWA 1OWDA 3C1KA 4CBOA 2ZDAH 1ZSKA 2XYAA 4OS2A 3I29A 2QA9E 3A7YA 5F8XA 1EPTC 1T7CA 1TNIA 1TPAE 2BXUH 2A7HA 1QY6A 2BD9A 1XKAC 4B2BA 5EXNA 2AS9A 1O2GH 1YPKH 3MU1A 1W0YH 2AYWA 5HGGA 3MWIU 4OS5A 3UR6A 2A1DB 6LPRA 5FPTA 2CN0H 4YZUA 4CRBA 2C8WB 4YO9A 3FFGA 4Y11E 1F92A 2C8ZB 1HAOH 1Y8TA 2JKHA 2BVSH 3A8DA 2ZDLA 3GCTF 3MO6A 2QC2A 4Z0KA 1J8AA 3RXJA 1F0TA 1PQ5A 1C4V2 1KXBA 1MZAA 5A8XA 2FZZA 2IPHA 1GI8B 1TLDA 3A8AA 4B73A 3B23B 3A80A 3Q77A 7GCHF 1NT1A 1ABIH 1OYQA 2Y5FA 3SU2A 2NU0E 2PLXA 2A32A 1LVBA 1QHRB 1IAUA 4AFSA 5E8EH 2F9VA 5TCAA 1O39A 1IHTH 1O3IA 4NSVA 1HAXB 2Z9LA 1LHGH 1WTHD 3SV9A 1TA6A 3SGBE 1O32A 5FCRA 3LT3A 1AZZA 1EAWA 2CXVA 5A0CA 2HRVA 3TLOA 4DGJA 1GVKB 4UD9H 2HPQH 2ULLA 9ESTA 3GDSA 1V2WT 2QXJA 2A0QB 1HJAB 4TWWA 3KGPA 1C4Y2 2CHAB 1H4WA 1ELTA 3GY7A 5HM9A 1T8LA 2OLGA 4UE7H 1O36A 2OCVB 1XM1A 1BMAA 4K3JA 1MUEB 1P10A 2HOBA 1A5IA 1ORFA 1GMCG 1O5CB 3QZRA 1P3CA 3GCNA 3QZQA 5DJ7A 3T27A 1EZSC 2OC7A 1GHXH 3UQOA 2A4OA 1NS3A 2IN2A 1G3DA 1QL8A 1HNEE 2FOHA 2QF3A 2SNWA 1C5OH 2XC4A 4ZMAH 1UTJA 1ZPZA 5J4QA 3ZZ3A 1A2CH 1YPHE 3M5NA 4JZIA 3BEUA 2VVUA 2ODQA 8KME2 2FX6A 4Q2KA 2GT8A 1T31A 1Y3XA 3M5LA 3AASA 2FEQH 3K2UA 3UUZA 3VEQB 1GGDB 2HVXA 3LGYA 3KL6A 1P04A 1UTQA 3T62A 1GCTB 2VIDA 3FZDA 3STJA 2OP9A 1FPCH 4IN1A 2BMGB 3M7QA 1C2JA 1MKWH 2BY5X 3RXFA 4A6LA 1SVPA 4UEHH 4BXWA 1GJ7B 5DP7A 3RM2H 3WY8A 4ISOA 4I8KA 1QJ7B 4H42U 4X8VH 2TGPZ 2PV9B 1JWTA 3TPIZ 1RIWB 4J2YB 2Y7ZA 1KXFA 1AHTH 1MTSA 2G5VA 2C90B 2H9HA 2OQUA 7KMEH 1ANEA 2PSYA 4NIXA 1NRSH 3ENSB 2QV1A 2FOFA 2ZPQA 1MU6B 1DVAH 4GLYA 1LPZB 1SQTA 2PTNA 3P8OA 4DG4A 1QGFA 4QT8C 1AZ8A 4CH8B 1S6HA 2XC0A 5L30H 1L1GA 1ANDA 2C8XB 1UVOA 3GY3A 2BY8X 1GHBG 3GCOA 4R0IA 4JZEH 5C2ZA 2A31A 2VVCA 1F0SA 3P6ZB 3S7KB 3BTDE 1ZTKA 2CHAC 5T6DA 2G52A 3KQDA 3RXPA 1GMHF 1AB9C 1YBWA 1EJMA 3W94A 1GHZA 1KYNA 1NZQH 5F8TA 1W2KH 1N1LA 1Z71A 1JRTA 4IC5A 1YCPH 2FP7B 1YLCA 2YNBA 1FIWA 1YPHC 2TGAA 2TBSA 2D26C 4Y7BA 5C1UA 1O2HA 2G51A 4AOQA 4MPXA 1C1OA 1AUTC 1P01A 2FWWA 4ISNA 4ZHMU 4CRAA 2BLWA 5HM2A 1YPJH 3E90B 2HWLB 1SLWB 1D4PB 3HK6B 1BHXB 2ANWA 7LPRA 1C2IA 1L0ZA 4GVUA 3SJOA 1DE7H 1CT4E 1BHXF 4YLUA 3ZZCA 4LZ1H 2G5NA 4HGCA 1TB6H 1FONA 1O35A 1DS2E 3HPTB 1O3FA 2QXHA 1ZR0A 4THNH 1WTGH 4J1YA 1AWFH 1AY6H 4MNWA 1H1BA 1HBTH 1L4ZA 2UUFB 1C5YB 1GJDB 3F9HA 2P8OC 3DFLA 1NU9A 1ZZZA 1GJCB 3KHVA 4X1PU 1RTKA 5C3NA 1HDTH 1T8MA 1WSSH 1HPGA 1UHBA 1A5HA 1DANH 1XXDA 2A4RA 3ATLA 3OSYA 3OY5U 1BJVA 4ZH8A 2Y6TA 2QAAA 2XCNA 1K1IA 3RXKA 2XNIA 3RU4T 1FLEE 2GV6A 2Z9IA 1V6DA 1P9UA 1MQ6A 1FMGA 1OKXA 2AIQA 4CH2B 4CREA 2R3UA 1DSUA 2G8TA 1UVTH 2XCFA 3FP7E 4I8LA 3RP2A 1TOCB 1UJ1A 2TGTA 2WPKS 2BY9X 1P02A 3A7TA 1TGBA 2PW8H 2ZO3H 1EXFA 5T6GA 3V13A 1V2KT 1YYY1 3BG4C 7ESTE 1YM0A 4B2AA 2ZGCA 5A09A 2W5EA 1EAUA 1JMOH 2UWOA 5E2PA 3RU4D 4E7NA 3C27B 3TK6A 5EPNA 3ZZ9A 5C67A 1L2EA 2WPIS 2ZKSA 1NN6A 3RUOA 1ZHPA 5GWZA 5F03A 4UFDH 1AFEH 3CP7A 4NZLA 1AIXH 4KKDA 3U1JB 3UNRA 2XTTB 5F8ZA 4UDWH 1GHWH 1W7XH 1EPTA 1MBQA 1C1RA 2Z9JA 2ZU2A 4AG2A 5F6MA 4E06H 2FODA 1CA0C 3E16B 4PROA 1A0LA 1C5TA 2RDLA 3U9AH 1DFPA 1O3CA 1GVZA 1OOKB 1G3CA 5EXLA 1Z8GA 5SGAE 1QCPA 2H6MA 1UTLM 1EB2A 1F0RA 1DICA 1ZGVA 4FUIA 2J38A 5EODA 2PGBB 5EPYA 1UCYE 5EW2H 1CT2E 4YLQH 3UOPA 3PTNA 2Y7XA 1CHGA 4A7IB 1CGJE 2Z3DA 1TPOA 1DWEH 2OQ5A 2BDHA 1HGTH 1MKXK 2BHGA 1QRWA 1SFIA 3A89A 3M5OA 4AG1A 4CHAB 1GJAB 8GCHG 1PYTC 2O9QA 4WJG2 2ZHDA 4O9VA 1C2EA 3RMLH 2ZU5A 3A7WA 1V2JT 1HJ8A 1SFQB 1VZQH 4SGBE 1C4U2 2CJIA 1KY9A 1TNLA 3RXMA 2BTCE 2ODYB 3GY4A 3AAUA 1Y59T 1BTUA 1AVGH 2XBYA 2BD4A 2BD2A 4AFUA 5A0BA 2GT7A 3CS0A 5GCHG 2SGQE 4FUFA 1BUIA 3A81A 5BRRE 5JB8S 1DXWA 3MU5A 4BAMB 2NU2E 3MU4A 5JPMH 1O3KA 3LJOA 5GPIB 3U69H 2QY0B 4Q80A 2NU4E 1ZRBA 1N6YA 1E36B 1BIOA 2ZA5A 4MPVA 3QGNB 1EZXC 3SI4H 3RXSA 1E0FD 2FM2A 2UWPA 1O30A 3RXEA 1C1MA 1BRAA 3CENA 2GCTC 2GZ7A 2HNTC 2ZFSA 1FIZA 3TU7H 3BIUH 4MNXA 3P95A 2KAIA 3LGTA 2BDGA 2ZCKP 1A3EH 2ALPA 3ATIA 1O3HA 4YM9A 3URCA 4BTTB 1DY9A 4GHQA 1L1NA 3LGUA 2VH6A 3SNBA 1UCYK 5FX5A 3RXQA 3L3TA 1HB0B 1GI2A 4X6OA 1UK3A 1GBLA 2ZFFH 1EJAA 1O2QA 3GISB 2EC9H 1C1VH 1SQAA 3DFJA 1O2RA 5DO4H 1DOJA 5IYTA 5C5NA 3UR9A 1BMNH 2I6SA 1BCUH 2FLBH 1DXPA 4X1NU 2PUXB 3QX5H 4X6PA 4B74A 5EOKA 1SL3A 1ZYOA 1S81A 1NFUA 3GY5A 1CVWH 4ZKSU 1C2DA 3Q3YA 3LIWA 2AGGX 5CHAB 1ZMJA 2ZHQH 1K28D 2FX4A 2WV4A 2R9PA 4JMYA 2G55A 1AE8H 1ZTLA 2ODPA 1DT2A 1O2TA 1EPTB 3RXGA 3UPEA 2WINI 3LC5A 3LH1A 1SOZA 4Y6DA 4U32A 4BAQB 2A2XH 1GMDF 1THRH 2OBOA 5LH8A 4ZHAA 3S0NA 3FAOA 3QGJA 4ZXYH 3U98H 2WYGA 1MAYA 1B0FA 3RXDA 3UY9A 4FUGA 4GCHG 1FXYA 4CR5A 4ZKNU 1LHDH 1ZRKA 2GMTC 1BQYA 2ASUB 3EA8A 3ODDA 3ZZBA 1P09A 1OX1A 3HGNA 2GTBA 3KQBA 3LGIA 1P2JA 1TA2A 2BX3A 1CSOE 1HAHH 3KF2A 2ZGHA 1TGSZ 2O8WA 1JIMA 1GBMA 5CE1A 5G4BA 2GDEH 5FBEA 3BIVH 1ELFA 3MI4A 1WQSA 1SLUB 3D49H 3KQEA 1CGHA 1ELBA 1FNIA 3M3TA 4FUCA 2Y5GA 4MPWA 1VJ9U 1AI8H 5A0AE 1HUTH 3Q76A 3RMNH 3EGKH 2ZQ2A 1GHVH 6CHAC 1FY3A 2ZPSA 4YOGA 1YPGH 4JZFH 3SO3A 3DA9B 1NESE 3P8NA 1E37B 1GI0A 8GCHF 1GWAA 2XW9A 1OWJA 1C1UH 1RXPA 1J16A 1P2QA 1PPEE 4B76A 4IS5A 4CRDA 3K6YA 1NRRH 1SOTA 1GL0E 4Q7ZA 1VITH 1TRMA 2J4IA 3SQEE 1QA7A 5C20A 4XDEA 1JIRA 2FLRH 2QXIA 1TGCA 1OP0A 1TRNA 1WYKA 3PV4A 1O5GH 5JBBS 4Y8XA 3RM0H 1S85A 3GDUA 3V3MA 1C1SA 1NRPH 2ZU4A 4AB9A 1C2FA 4E05H 1ELAA 2FESH 1OWIA 5GCHF 5IDKA 1KLTA 2ZHFH 1FDPA 1Z6JH 1K1JA 4CBNA 2BZ6H 2FMJA 2XRCA 3LPRA 4I7YH 1T8OA 1HYLA 4OGXA 4Y8YA 4TY7A 1SC8U 3TVJB 3PYHA 1V2UT 1V2NT 4BTUB 2IJOB 3P92A 1L1JA 3NZIA 3SU5A 1ZHRA 4FU8A 1O3AA 5DP3A 2CF8H 4LOYH 1XUIA 1O34A 2VU8E 1MTWA 2P3FH 2Z94A 4BTIB 3KEEA 1EATA 1KLJH 3JZ1B 5DGJA 2EI7A 2AMQA 4MNVA 1KXEA 9LPRA 1CHOG 4MG3A 3PMHB 2Y82A 2H2ZA 2YOLA 4ISIH 1MD8A 4O3TA 3F9GA 4JZDH 3B8JA 1BBRH 2ANMH 4X8UH 3RC5A 2WPLS 2VWOA 3RLYH 4U01A 1GBKA 4ABEA 1GBTA 1GG6C 3NKKA 3Q3KA 1O33A 4X8TH 2ZU3A 4UFEH 3ZZAA 4AN7A 5FAHA 4VGCB 1C5LH 2OC1A 3PLKA 3LGWA 3NXPA 2J2UA 1KSNA 1AU8A 3DT0H 1MTVA 2ANYA 1GJ5H 1O2LA 1CBWC 5EG4A 1DITH 4JYUH 4OS1A 3EA9A 1GPZA 5HYOA 4UFGH 1GI4A 1ID5H 2J94A
chains in the Genus database with same CATH superfamily
4TT3D 2ZC9H 3SUGA 2A5IA 1BMFD 1AB9B 1O0DH 2Z9GA 1QURH 3SU3A 4I33A 4ESTE 1CT0E 1DSTA 1O2MA 2F9BH 2PGQB 2SGFE 3OX7U 2VIQA 4TPYA 3A7ZA 3T29A 3VB4A 2BQWB 2KR7A 1THPB 1ZHMA 1KXAA 3NRLA 3S9CA 1XKBC 1Q31A 1GBDA 1G2LA 3RXBA 4WMEA 1KXDA 2H1UA 4K2YA 1QBVH 4GPGA 2FXRA 3RC6A 2Q1JA 4RT1A 1YF4A 4GCHF 1Y3WA 4DIHH 3PMAB 4E7RG 1MCTA 1QBOA 4GSOA 2ZFQH 1HLTH 5HMAA 2OXSA 2BDAA 3PROA 2ZTZA 2OK5A 3SZEA 2A7JA 2VWLA 1RTFB 4R8TB 1OP2A 2FOMB 3TH4H 2VIOA 3E3TA 5FCKA 3MH7A 4X2VA 4CRFA 1PPHE 1V2OT 5PTPA 1SG8B 3QWCH 4TY6A 5K7RA 1K1MA 1ZPCA 1O2KA 4A1VA 2HALA 2P8OB 3LDXH 3FP8E 2STAE 1W11U 2ZWLH 3M3SA 2RFKC 5L2ZH 1ZLRA 2ZNKH 2D2DA 3SGQE 3U8TH 4ASUD 3SUDA 1O5DH 1GJ4H 3SV6A 1YCPM 3K6ZA 3RXUA 3TJVA 1FAXA 2VINA 2BD3A 2SGDE 1V2VT 1LHEH 1WU1A 1VCWA 3BTGE 2FS9A 2BYAX 2AH4X 4AYYB 2LNCA 2D8WA 1GCDA 3SNCA 3N99A 1O31A 3AW1A 4M7GA 4HG6A 1BITA 4VGCC 1ZSLA 3UNQA 3QO6A 4B71A 4CRGA 3O8RA 3L33A 4Z6AH 4O97A 1HJ9A 3BG4B 5JBAS 1LDTT 1AKSA 1JXPA 2ZEBA 2B5TB 4BAKB 5EJ1A 2OC0A 4YOJA 2BY6X 1HCGA 2FTLE 4HZHA 2QCYA 3TK9A 2Z6BD 2EI8A 3LJJA 5TCCA 2A45B 4TYDA 1O2PA 1SR5C 4OGYA 4YXWD 1A0HB 2JETC 2VIVA 4AGKA 2OBQA 4NFFA 4Q7YA 1FY1A 1MMJN 3Q00A 5ESBA 3R0FA 4K60A 2FI5E 3M36A 1GI3A 2QGRA 4XFQA 1SGTA 1W0JD 2QN5T 1LPKB 3BTTE 3FZZA 1CA0B 3NWUA 4HFPB 4HI3A 1C5QA 1P2IA 1G2MA 2ZHWH 1GVLA 1A3BH 2XC5A 2EI6A 1J17T 1H8HD 5FXLA 1RJXB 1XUFA 1FY8E 1KLIH 2BDBA 3ZZ7A 5T3HA 5C1XA 1O5FH 4FUEA 3P17H 4NIYA 1C9TA 3OEED 1ZGIA 3VGCC 2BOKA 4MTBA 1QB1A 3IWMA 1G32B 1MAXA 2D1JA 3E6PH 5AFYH 5DG6A 2F9OA 1TMBH 2AGEX 3ZZ5A 3UNSA 1CHOF 1PPGE 4GUXA 1YY3A 2L6OA 2BLQA 1GBFA 1TBZH 2RG3A 3ATKA 4BXSA 1Y5BT 2V0BA 1KIGH 2ZQ1A 1N6XA 5GDSH 4XBDA 4ACBA 1EX3A 3H7OA 1KTSB 3D23A 4HTCH 1YLNA 1ZSJA 1YGCH 2CK3D 3OEHD 1DY8A 4DY7B 3URDA 1MKWK 4KP0A 4X6NA 3T28A 5DPAA 1DLKB 4RKOB 1O3EA 5DSFA 2DUCA 3MNBA 1W12U 4JYVH 4AC9A 5FHTA 1P05A 1EP6A 1XVOA 2FIRH 4KELA 3O8CA 1IQKA 3MOCA 3HK3B 4K8YA 1PYTD 3V0XA 3ZVEA 3PLBA 1GHAG 3A8BA 3OTPA 1K22H 1HAGE 1Q3XA 1P0SH 3U8RH 3LOXA 1GMCF 1Z1JA 5AVDA 2WUBA 4P00A 4ISLA 3RXHA 1UTMA 2WPHS 3D62A 3E0PB 4NWKA 1V2ST 4YESB 3BTKE 1O2SA 4A1TA 3AAVA 1BA8B 2W3IA 3DUXH 2GCTB 3UB0A 1Z8IB 3PMJA 3SUEA 4Y0YE 2B7DH 3NCLA 2LPRA 3UAIC 2EEKA 4D7GA 2PWXA 1V3XA 1F2SE 3F0PA 1ARBA 1JRSA 1P3EA 1H9LB 2HNTE 1FUJA 3RLWH 2CF9H 4X1SU 1YCPK 2AFQB 1P2NA 1O2IA 3ZVDA 5EJLA 3PO1C 3FOAA 3BV9B 1ELEE 1D3PB 1OPHB 3SV2H 1SQOA 4MPUA 1VGCC 4ZCNA 2IJD1 1IQMA 8LPRA 4X2XA 1AKSB 2KCAA 2RDEA 1BMLA 5DP6A 1GHYH 4ZHLU 2ZHEH 1UTOA 3PV5A 3SN8A 3TGIE 4ASHA 2FOAA 4BANB 1NRNH 1Z8JB 4KTCA 5EXMA 1ETSH 1TRYA 4NFEA 2OD3B 5FL7D 1F5LA 2BXTH 2UUJB 3WW7A 3TH3H 1C1WH 2F3CE 2PP6A 1XUHA 3SNEA 2V35A 2M5TA 1TNHA 3K9XB 1ZJKA 1P8VC 4OS7A 2K0QA 1IQIA 2GDDA 3BSQA 3MQKC 3KQCA 4WMFA 1QNJA 2ZFPH 3QN7A 1IQHA 1QRZA 1ZJDA 2BVXH 1TNGA 1DX5M 5EQQA 1CU1A 3JZ2B 2OTVA 1E34B 3BTEE 4ZXXH 3EAJA 1GHBF 4D8NA 1MCVA 2AERH 1XUKA 1UK4A 1G30B 2GMTB 1BDAA 1TBRH 5B6OA 4IBLH 4LK4A 1CGIE 2ZTXA 4D76A 1HRTH 5ABWA 1VITG 2ZI2H 3T26A 1NPMA 1O2ZA 1WBGB 1A5GH 4IGDA 2BDCA 1Y5UT 3VB5A 1SGEE 1W7GH 2W7SA 2YMSD 3KQ5A 3PLPA 2O8LA 2VIPA 4H6TA 1G9IE 1G3BA 1SGRE 2GCHG 1W3CA 2BY7X 1RS0A 3BTHE 4X1QU 2GV7A 1TOMH 2QIQA 4NIWA 3ZVFA 2BM2A 2IOTA 1MZDA 1YPLH 2GP9B 1OP8A 2G81E 3PMBB 2R2MB 1PJPA 2P95A 3NK8A 2J95A 2BLOA 4AORA 3O8BA 5K0HA 3UWIA 4ZROA 2WUCA 1W0KD 1ZTJA 1UVUH 6CHAB 2ILNA 4FUJA 3GCTG 1C5MD 1EP5A 1HV7A 3MYWA 2P3TB 4O3UA 1EAXA 5DP9A 1NC6A 1QA0A 2VVVA 5DKMA 5ETXA 1Q2WA 4AFZA 7GCHG 2A4GA 2H5CA 4I8HA 1GI1A 3BN9A 1FI8A 1C5VA 1TX7A 3TITA 4GAWA 4I8GA 4CRCA 3PRBA 4BNRA 3A83A 3GS9A 1ELVA 3M7UA 1IQLA 3U28C 2WV5A 4GHTA 5FPYA 4UFFH 4XE4A 4ABDA 1AE5A 2O8UA 4MQAA 1ESBA 4DURA 1O37A 1TQ0B 3GY2A 1G37A 3DD2H 2Y80A 1TFXA 2ZFRH 4RN6A 1ELDE 4IN2A 4D9QA 1O3NA 1QFKH 4H6SB 1LVYA 1QQ4A 4NA7A 4RSPA 5AHGH 4K1EA 3ZV8A 1A61H 1OYTH 3RC4A 1SMFE 4DOQA 2RCEA 4FVBA 1N8OB 2AIPA 3IG6B 1UTPA 4F4OC 2FOEA 6GCHG 1GJ9B 1K1OA 1NRQH 1QRXA 3RXAA 4TSFD 4ABFA 1TE0A 1Y3VA 4WH8A 1W8BH 3V7TA 1WV7H 2ZG0H 3VB3A 4INHA 2ZCHP 3FANA 1F5RA 3MO3A 2FO9A 4X1RU 2XWBI 4B2CA 5FX6A 1E1RD 3SNAA 1V2RT 1U6QA 2GGVB 2JDID 3OAAD 3IITA 1L4DA 4P02A 2F4LA 5FPSA 3E0NB 1GDNA 3GYLB 1P06A 1T32A 2Y5HA 1RFNA 2ANKH 3U8OH 1D6RA 1GG6B 1UTNA 2A2QH 2FTMA 1TONA 1D3DB 1SLVB 2PHBA 3GY8A 2VJ1A 3OY6U 2ZTYA 3ELAH 1CA8B 4DCDA 3I77A 1HAPH 3GICB 3A87A 3SU6A 3TGJE 1CBWB 1SI5H 1A7SA 2F83A 1V2LT 1GJ8B 4A92A 2F9UA 1NROH 3SHAH 1AQ7A 2J34A 1S82A 2P93A 2F9PA 1IQEA 2O8TA 1JBUH 1NO9H 1C1NA 4WH6A 2ZCLP 3SU4A 4WXIA 3E8LA 1LVOA 3R3GB 5AFZH 5I25A 1Y3UA 1GBIA 4A1XA 1K21H 5EQRA 4ABBA 3MNSA 2QXGA 2Z3CA 4JCNA 4FUDA 1EQ9A 2B9LA 3BTWE 3GDVA 1H8IH 3VXEH 2ZGJA 1AWHB 2FOGA 1LVMA 2C3SA 2KFWA 1QL9A 3T5FH 5JBCS 1C5ZB 3KCGH 1NFYA 2HLCA 1E1QD 4BAHB 1BJUA 2FOBA 3P8FA 1YPEH 1SGIB 3KIDU 1VJAU 1AUJA 3B9FH 3M3VA 1LTOA 2F91A 1K1PA 4INLA 1GBEA 1GMHG 1N8OC 1O3OA 3RXVA 2BDYA 4SGAE 4XSKU 1INCA 5EQSA 2STBE 3HGPA 2LP6A 2GCHF 1QZ8A 4IMZA 1FQ3A 3G01A 1MQ5A 4AGJA 1EZUC 2P59A 1RGQA 3QDZB 1H9IE 1B7XB 2BB4A 1VCQA 1GI5A 3KN2A 2SNVA 4U30A 5KECA 3NPSA 3ZZ4A 1H8ED 3BEIB 1F7ZA 5DP4A 4KGAA 1KMHB 2C8YB 2VIWA 1TMTH 1NTPA 2VH0A 3E1XB 4INKA 3DSOA 2XBWA 3HKIB 4WY3A 1DM4B 1GBJA 1TX8A 3UREA 2V6NA 1IHSH 4DT7B 1W10U 2BD7A 3TNSA 4D7FA 1W14U 5HXFA 4ABAA 3SUFA 1GJ6A 1WXRA 1TX6A 3RXLA 1BRUP 1BOQA 1CO7E 1XMNB 3TNTA 3VB6A 2ZFTA 2JH0D 2ZDMA 3UTUH 2W7UA 4KTSA 3SQHE 1OHHD 2G00A 2WZQA 3LKWA 3O8DA 3GCHC 2TIOA 1O3JA 4X0WU 3V12A 2ZECA 3RXOA 1BBRE 2VB0A 1TNKA 3DHKH 1GBHA 4ZUHA 4K1SA 3QLPH 4B75A 1HAZB 1ETRH 1GI6A 5DP5A 4IW4E 5T6FA 1SLXB 3DSPA 3RXRA 2A4QA 2JETB 3PWBA 1TMUH 3HATH 3RMOH 1NFWA 1TYNA 2PKSB 3ESTA 3GOVB 1GBCA 4IC6A 4DVAU 4ABHA 1QB9A 3EDXB 3M61U 4AB8A 3H7TA 1QL7A 3GYMA 2XBVA 1LQEA 1FY5A 2W3KA 1E38B 1GJBB 1QTFA 1XUGA 1ZMLA 6GCHF 2ZDVH 2NU1E 3ZV9A 1DDJA 2JH6D 1LO6A 3FKSD 1OSSA 3PV2A 3SZNA 3VGCB 3TGKE 4F49A 1C2LA 4B1TA 1QQUA 4B6EA 1V2TT 2RA3A 1ETTH 1BRBE 3A8CA 3BTQE 2ALVA 2CGAA 1HAYB 2QYIA 3UQVA 1WAYB 1KDQB 5F53A 3UWJH 1SHYA 3PM3A 1V2MT 1EJNA 3MO9A 1OXGA 1YPMH 5EGMA 1O2OA 1GBAA 3MHWU 1K2I1 5E0JA 1HFDA 3MH6A 1FZZA 2I6QA 2P94A 5C17A 2ZZUH 1DUEA 2PUQH 5JDUB 3MNXA 1C1PA 3ZVCA 1ELCA 2PKAA 1A46H 2ZPRA 2F9NA 2GD4B 2P3UB 2VGCB 1SGFG 1IQFA 5TJXA 3SNDA 1W0ZU 1DUAA 3SJ8A 1PPFE 2Q6FA 4JZ1A 3ZVGA 1FN6A 5LPEA 1TQ7B 4KTUA 2BX4A 2WYJA 1HAIH 1A4WH 3BTME 3BG8A 1BBRK 1BTXA 2SGEE 4Y79A 3TJUA 1KXCA 2FDAA 3ZYDA 2Y81A 1YP9A 4A5TS 2C93B 4K8BA 1IOEA 3KNXA 4WMDA 2SGPE 5EIYA 2THFB 3I78A 1OS8A 1Y3YA 4I31A 1BTZA 3SU1A 1C2MA 4YT7H 3SU0A 1C9PA 1YC0A 3SV8A 2XWAA 1O2VA 1IQGA 1SGFA 2FYQA 5C0TA 1O5BB 1RTLA 2HPPH 2YNAA 4K5ZA 3SOSA 1AO5A 1UVPA 3ZVBA 1ABJH 2V3OH 1RRKA 1PQAA 4Q7XA 3BF6H 4TPIZ 3SJKA 3L6PA 1WQVH 3TK5A 1HJAC 2PKSC 1COWD 2BVRH 1EB1H 2FI4E 2A5KA 4ABGA 5B6LA 5I46H 1XXFA 2W26A 1P2KA 1H8DH 3BTFE 5AF9H 4XBCA 3EE0B 4WVPE 2ZGXH 3PO1B 1O3BA 5DK1A 4Y7AA 1UVSH 4Q63A 1V2PT 1VGCB 1SSXA 1C5XB 3MH5A 1O2UA 4ABJA 2BD8A 2A5AA 2AGIX 3ZYEA 5JYIA 1JOUB 2EA3A 3H09A 1Z6EA 1ANBA 2B0FA 4NSYA 2BD5A 2Z9KA 3F68H 5C5OA 1O2WA 5A2MH 3P70B 2HVYB 1K1NA 1OWHA 3A7VA 3H5CB 2CMYA 3ZZ6A 5FBIA 1BTPA 2ZGBH 1T4UH 2V3HH 1MKXH 2GVFA 3VB7A 5JBTA 1P9SA 3N7OA 3RMMH 4X6MA 1O3LA 3LH3A 1MH0A 4OM9A 4DW2U 1BTYA 3WWFA 1GGDC 1O3DA 1K1LA 8ESTE 2B8OH 1GCTC 1MBMA 3SI3H 4ABIA 2VGCC 5EW1H 5GJ4B 1J9CH 1DWCH 1XX9A 2L74A 3EYDA 1WCZA 4ZKOU 1S0QA 2TPIZ 1PQ8A 3OU0A 5GIBA 1O38A 2GKVE 3U1IB 5E0HA 1DWBH 1QR3E 2AMDA 1LHFH 2Q6GA 3OTJE 1MTNB 2XOKD 5LPRA 1RIWC 1QJ6B 3W95A 1GDQA 3LC3A 2A7CA 2G4TA 1C1QA 3BEFB 1C2GA 1FPHH 5KEDA 4ZAEA 1MD7A 1B0EA 3RU4E 1C1TA 2ZIQH 4K1TA 1C5RA 1GMDG 3EA7A 4DJZB 2PKAB 1SHHB 4RKJB 4NGAH 2KCPA 1SPJA 1O3GA 4JK6A 4IMQA 4BAOB 5HKKD 1OWKA 2FI3E 1CE5A 2HNTF 3HKJB 1P03A 5ESTE 4AYVB 4WWYA 1WOFA 1D3QB 2ZP0H 2PFEA 1T4VH 3MU8A 3TH2H 4CR9A 1G3EA 3S9BA 4NIVA 4NCYA 1P12E 4Y8ZA 2O8MA 1LKBA 4OS4A 1MTUA 4YT6H 1P2MA 1ZMNA 3EE7A 1IQNA 1EAIA 5DP8A 1UCYH 1RD3B 2JH5D 5LGOA 1ACBE 1AD8H 4X2YA 1PPCE 1O2YA 1O3MA 2Z7FE 3A7XA 4NZQA 1Z8RA 3MNCA 4U2WA 4LZ4B 4UONA 3ATMA 3RXTA 3M35A 2GZ9A 1GDUA 1MU8B 3SGAE 3MMGA 4ISHH 2UWLA 2UUYA 3MH4A 1EOLA 1TAWA 1QIXB 3ZVAA 2P16A 1PPBH 3S7HB 1ANCA 1HIAA 1ZOMA 4X2WA 3D65E 3OFND 1A1RA 5JB9S 1G36A 5KGOA 3F6UH 3F3BA 1AMHA 1SGCA 5GXPA 3A85A 2PR3A 1TGNA 1AFQB 2G4UA 3TIUA 1DWDH 2OINA 1IQJA 3ODFA 3OYPA 4Y71A 1TALA 1TABE 1WUNH 2ZDNA 1FJSA 2OUAA 2R0LA 3SW2B 3FP6E 5CHBA 2KX4A 1TWXB 1V2QT 3UOUA 1NM6A 2PTCE 3VPKA 1UMAH 1K9OE 5HIYA 1SGDE 1F5KU 1YLDA 5L6NH 3A88A 2BQ6B 3S9AA 2AEIH 1P11E 1C5WB 1MTNC 1Z1IA 3MU0A 2TRMA 3CS7A 4FUBA 4TWYA 3SHCH 1NY22 1K0HA 2JIZD 4FXGH 1C2KA 1GL1A 3DSGA 2RA0A 1O3PB 3FVFB 2M2AA 1B5GH 1TIOA 1FN8A 3QK1A 2H9EH 2ZU1A 3SORA 2HGTH 1F0UA 4K69A 1ZPBA 1EZQA 1PFXC 1ELGA 1UO6A 4LXBH 3MTYA 4Y10E 1FAKH 1HAVA 3PTBA 4JYTA 1C5NH 5E2OA 1GI9B 2WPJS 1SGPE 3RXCA 3A82A 1W13U 1UHBB 1S0RA 3PWCA 4O03A 1C5PA 1SGYE 2R3YA 1TNJA 2ZDKA 2XNDD 4I8JA 1EUFA 1O2NA 1SB1H 2AMPA 1PQ7A 1EOJA 2GZ8A 1D3TB 4WF8A 1EASA 1S84A 2Q6DA 6ESTA 4JK5A 1LHCH 1HXEH 3GY6A 1TGTA 1Y5AT 2H5DA 1GI7B 1C2HA 1SBWA 2ZF0H 3QTOH 3S69A 1NU7B 1T8NA 1E35B 5LPFA 2XBXA 4FUHA 1S83A 2K1QA 4NA9H 4ZKRU 2TGDA 2QF0A 2R2WU 3MFJA 1VCPA 5DN6D 1M9UA 2PSXA 1BTWA 2VWMA 5EU8A 4BOHA 2NWNA 2BDIA 1QBNA 1A0JA 1ESAA 1XVMA 3PB1E 5HIZA 1XUJA 1LCYA 3AVZA 1AVXA 1BZXE 1LMWB 3M37A 3QUMP 5J4SA 1J14A 1BB0B 1NFXA 1AFQC 4AFQA 4CHAC 2OC8A 1EKBB 1GHAF 1C5SA 4Z1MD 2FS8A 2SGAA 4AX9H 1P2OA 2VWNA 2J92A 5CDFE 3RDZA 1S6FA 3STIA 5A8YA 1QB6A 2YMSC 1GBBA 1SGQE 4DT4A 3TJOA 2UUKB 4YTAA 3LGVA 1Z7KA 2ESTE 4XBBA 1S5SA 4XOJA 1AVWA 1DPOA 2LELA 4WXVA 5E0GA 3TJNA 4MVNA 5CMXH 3LU9B 4NA8A 4OS6A 1O2JA 2BLVA 1HIAB 1ARCA 1TBQH 1DLEA 1FY4A 2C4FH 1D6WA 3SJIA 3A84A 1BRCE 1LQDB 5C1YA 4MNYA 3NUMA 1THSH 2SFAA 3F2GA 3LONA 1NBME 2GX4A 3AW0A 2CV3A 4MLFB 4MDSA 2EQNA 1BT7A 5A8ZA 3ZZDA 3SBKA 1HXFH 1C5UA 4DIIH 1BMMH 2W6ID 3F9EA 2H9TH 3ZZ8A 1O2XA 3M7TA 3ITIA 4I32A 1FV9A 1X7AC 3GCHB 3QTVH 1QJ1B 1VR1H 3VG8A 1UK2A 3RXIA 1PPZA 4AZ2B 2NU3E 3AK5A 4NG9H 3K65B 2XXLA 1TPSA 1AN1E 1H9HE 2F43B 2R0KA 3SJ9A 3F1SB 3M5MA 3Q3XA 2WPMS 3UIRA 4FU9A 2VNTA 1BTHH 1O5AB 3VFEA 1D9IA 4Y0ZE 1TPPA 1YKTA 1KDQA 4NWLA 5BPEA 3UFAA 2FOCA 3T2NA 1LKAA 2Z3EA 3P8GA 4FVDA 3T25A 2BZAA 1J15A 2J9NA 4M9FA 1HAVB 4YOIA 4FU7A 3EQ0H 3F9FA 3VXFH 1LPGB 4X8SH 3A86A 1O5EH 1UTKA 2FPZA 3E91A 4Y76A 5L2YH 2DE9A 4D9RA 1SGNE 2BQ7B 5H4IB 4B6FA 2DE8A 1AGJA 2KM0A 1CQQA 1VITF 1P57B 1ESTA 4H4FA 5CHAC 3SV7A 2BOHB 2FYRA 1KTTB 2KAIB 1OWEA 3ATWA 1OWDA 3C1KA 4CBOA 2ZDAH 1ZSKA 2XYAA 4OS2A 3I29A 2QA9E 3A7YA 5F8XA 1EPTC 1T7CA 3DCLA 1TNIA 1TPAE 2BXUH 2A7HA 1QY6A 2BD9A 1XKAC 4B2BA 4F48B 5EXNA 2AS9A 1O2GH 1YPKH 3MU1A 1W0YH 2AYWA 5HGGA 3MWIU 4OS5A 3UR6A 2A1DB 6LPRA 5FPTA 2CN0H 4YZUA 4CRBA 2C8WB 4YO9A 3FFGA 4Y11E 1F92A 2C8ZB 1HAOH 1Y8TA 2JKHA 3F2FA 2BVSH 1WDIA 2ZDLA 3A8DA 3GCTF 3MO6A 2QC2A 4Z0KA 1J8AA 3RXJA 1F0TA 1PQ5A 1C4V2 1KXBA 1MZAA 5A8XA 2FZZA 2IPHA 1GI8B 1TLDA 3A8AA 4B73A 3B23B 3A80A 3Q77A 7GCHF 1NT1A 1ABIH 1OYQA 2Y5FA 3SU2A 1SQRA 2NU0E 2PLXA 2A32A 1LVBA 1QHRB 1IAUA 4I86A 4AFSA 2V7QD 5E8EH 2F9VA 5TCAA 1O39A 1IHTH 1O3IA 4NSVA 1HAXB 2Z9LA 1LHGH 1WTHD 3SV9A 1TA6A 3SGBE 1O32A 5FCRA 3LT3A 1SKYE 1AZZA 1EAWA 2CXVA 3KYGA 5A0CA 4FOUC 2HRVA 3TLOA 4DGJA 1GVKB 4UD9H 2HPQH 1FX0B 2ULLA 9ESTA 3GDSA 1V2WT 2KZ4A 2QXJA 2A0QB 4ACAA 5T1VA 1HJAB 4TWWA 3KGPA 1C4Y2 2CHAB 1H4WA 1ELTA 3GY7A 5HM9A 1T8LA 2OLGA 4UE7H 1O36A 2OCVB 1XM1A 1BMAA 4K3JA 1MUEB 1P10A 2HOBA 2KCOA 1A5IA 1ORFA 1GMCG 1O5CB 3QZRA 1P3CA 3GCNA 3QZQA 5DJ7A 3T27A 1EZSC 2OC7A 1GHXH 3UQOA 2A4OA 1NS3A 2IN2A 1G3DA 1QL8A 1HNEE 2FOHA 2QF3A 2SNWA 1C5OH 2XC4A 4ZMAH 1UTJA 1ZPZA 3KYFA 5J4QA 3PRDA 1A2CH 3ZZ3A 5EJZA 1YPHE 3M5NA 4JZIA 3BEUA 2VVUA 2QF4A 2ODQA 8KME2 2FX6A 4Q2KA 2GT8A 1T31A 1Y3XA 3M5LA 3AASA 2FEQH 3K2UA 3UUZA 3VEQB 1GGDB 2HVXA 3LGYA 3KL6A 1P04A 1UTQA 3T62A 1GCTB 2VIDA 3FZDA 3STJA 2OP9A 1FPCH 4IN1A 2BMGB 3M7QA 1C2JA 3FO8D 1MKWH 2BY5X 3RXFA 4A6LA 1SVPA 4UEHH 4BXWA 1GJ7B 5DP7A 3RM2H 3WY8A 1MABB 4ISOA 3N7DA 4I8KA 1QJ7B 4H42U 4X8VH 2TGPZ 2PV9B 1JWTA 3TPIZ 3CNRA 1RIWB 4J2YB 2Y7ZA 1KXFA 1AHTH 1MTSA 2G5VA 2C90B 2H9HA 2OQUA 7KMEH 1ANEA 2PSYA 4NIXA 1NRSH 3ENSB 2QV1A 2FOFA 2ZPQA 1MU6B 1DVAH 4GLYA 1LPZB 1SQTA 2JJ1D 2PTNA 3P8OA 5C94A 4DG4A 1QGFA 2W6JD 4QT8C 1AZ8A 4CH8B 1S6HA 2XC0A 5L30H 1L1GA 1ANDA 2C8XB 1UVOA 3GY3A 2BY8X 1GHBG 3GCOA 4R0IA 4JZEH 5C2ZA 2A31A 2VVCA 1F0SA 3P6ZB 3S7KB 3BTDE 1ZTKA 2CHAC 5T6DA 2G52A 3KQDA 3RXPA 1GMHF 1AB9C 1YBWA 1EJMA 3W94A 1GHZA 1KYNA 1NZQH 5F8TA 1W2KH 1N1LA 1Z71A 1JRTA 4IC5A 1YCPH 2FP7B 1YLCA 2YNBA 1FIWA 1YPHC 2TGAA 2TBSA 2D26C 2HLDD 4Y7BA 3SYJA 5C1UA 1O2HA 2G51A 4AOQA 4MPXA 1C1OA 1AUTC 1P01A 2FWWA 4ISNA 4ZHMU 4CRAA 2BLWA 5HM2A 1YPJH 3E90B 2HWLB 1SLWB 1D4PB 3HK6B 1BHXB 2ANWA 7LPRA 1C2IA 1L0ZA 4GVUA 3SJOA 1DE7H 1CT4E 1BHXF 4YLUA 3ZZCA 4LZ1H 2G5NA 4HGCA 1TB6H 1FONA 1VKYA 1O35A 1DS2E 3HPTB 1O3FA 2QXHA 1ZR0A 4THNH 2J97A 1WTGH 4J1YA 4RI0A 1AWFH 1AY6H 4MNWA 1H1BA 1HBTH 1L4ZA 2UUFB 1C5YB 1GJDB 3F9HA 2P8OC 3DFLA 1NU9A 1ZZZA 1GJCB 4XD7D 3KHVA 4X1PU 1RTKA 5C3NA 1HDTH 1T8MA 1WSSH 1HPGA 1UHBA 1A5HA 1DANH 1XXDA 2A4RA 3ATLA 3OSYA 3OY5U 1BJVA 4ZH8A 3F0OA 2Y6TA 2QAAA 2XCNA 1K1IA 3RXKA 2XNIA 3RU4T 1FLEE 2GV6A 2Z9IA 1V6DA 5C0UA 1P9UA 1MQ6A 1FMGA 1OKXA 2AIQA 4CH2B 4CREA 2R3UA 1DSUA 2G8TA 1UVTH 2XCFA 3FP7E 1S6LA 4I8LA 3RP2A 1TOCB 1UJ1A 2TGTA 2WPKS 2BY9X 1P02A 3A7TA 1TGBA 2PW8H 2ZO3H 1EXFA 5T6GA 3V13A 1V2KT 1YYY1 3BG4C 7ESTE 1YM0A 4B2AA 2ZGCA 5A09A 2W5EA 1UW7A 2EY4C 1EAUA 1JMOH 2UWOA 5E2PA 3RU4D 4E7NA 3C27B 4Q4LA 3TK6A 5EPNA 3ZZ9A 5C67A 1L2EA 2WPIS 2ZKSA 1NN6A 3RUOA 2KCYA 1ZHPA 5GWZA 5F03A 4UFDH 1AFEH 3CP7A 4NZLA 1AIXH 4KKDA 3U1JB 3UNRA 2XTTB 5F8ZA 4UDWH 1GHWH 1W7XH 1EPTA 1MBQA 1C1RA 2Z9JA 2ZU2A 4AG2A 5F6MA 4E06H 2FODA 1CA0C 3E16B 4PROA 1A0LA 1C5TA 2RDLA 3U9AH 1DFPA 1O3CA 1GVZA 1OOKB 1G3CA 5EXLA 1Z8GA 5SGAE 1QCPA 2H6MA 1UTLM 1EB2A 1F0RA 1DICA 1ZGVA 4FUIA 2J38A 5EODA 2PGBB 5EPYA 1UCYE 5EW2H 1CT2E 4YLQH 3UOPA 3PTNA 2Y7XA 1CHGA 4A7IB 1CGJE 2Z3DA 1TPOA 1DWEH 2OQ5A 2BDHA 1HGTH 1MKXK 2BHGA 1QRWA 1SFIA 3A89A 3M5OA 4AG1A 4CHAB 1GJAB 8GCHG 1PYTC 2O9QA 4F55A 4WJG2 2ZHDA 4O9VA 4XRNA 2YMSB 1C2EA 3RMLH 2ZU5A 3A7WA 1V2JT 1HJ8A 1SFQB 1VZQH 4SGBE 1C4U2 2CJIA 1KY9A 1TNLA 2J98A 2QE7D 3RXMA 2BTCE 2V3MA 2ODYB 3GY4A 3AAUA 1Y59T 1BTUA 1AVGH 2XBYA 3OE7D 2BD4A 2BD2A 4AFUA 5A0BA 2GT7A 3CS0A 5GCHG 2SGQE 4FUFA 1BUIA 3A81A 5BRRE 5JB8S 1DXWA 3MU5A 4BAMB 2NU2E 3MU4A 5JPMH 1O3KA 3LJOA 5GPIB 3U69H 2QY0B 4Q80A 2NU4E 1ZRBA 1N6YA 1E36B 1BIOA 2ZA5A 4MPVA 3QGNB 1EZXC 3SI4H 3RXSA 1E0FD 2FM2A 2UWPA 1O30A 2WV9A 3RXEA 1C1MA 1BRAA 3CENA 2GCTC 2GZ7A 2HNTC 2ZFSA 1FIZA 3TU7H 3BIUH 4MNXA 3P95A 2KAIA 1E79D 2BDGA 3LGTA 2ZCKP 1A3EH 2ALPA 3ATIA 1O3HA 4YM9A 3URCA 4BTTB 2VBCA 1DY9A 4GHQA 1L1NA 3LGUA 2VH6A 3SNBA 1UCYK 5FX5A 3RXQA 3L3TA 1HB0B 1GI2A 4X6OA 1UK3A 1GBLA 2ZFFH 1EJAA 2WSSD 1O2QA 3GISB 2EC9H 2WHXA 1C1VH 1SQAA 3DFJA 1O2RA 5DO4H 1DOJA 5IYTA 5C5NA 3UR9A 1BMNH 2I6SA 1BCUH 2FLBH 1DXPA 4X1NU 2PUXB 3QX5H 4X6PA 4B74A 5EOKA 1SL3A 1ZYOA 1S81A 1NFUA 3GY5A 1CVWH 4ZKSU 1C2DA 3Q3YA 3LIWA 2AGGX 2IPQX 5CHAB 1ZMJA 2ZHQH 1K28D 2FX4A 2WV4A 2R9PA 4JMYA 2K8IA 2G55A 2WPDD 1AE8H 3W1EA 1ZTLA 2ODPA 1DT2A 1O2TA 1EPTB 3RXGA 3UPEA 2WINI 3LC5A 3LH1A 3WWBA 1SOZA 4Y6DA 4U32A 4BAQB 2A2XH 1EFRD 3N7EA 1GMDF 1THRH 2OBOA 5LH8A 4ZHAA 3S0NA 3FAOA 3QGJA 4ZXYH 3U98H 2WYGA 5GNDA 1MAYA 1B0FA 3RXDA 3UY9A 4FUGA 4GCHG 1FXYA 4CR5A 4ZKNU 1LHDH 1ZRKA 2GMTC 4RT0A 1BQYA 2ASUB 3EA8A 3ODDA 3ZZBA 1P09A 1OX1A 3HGNA 2GTBA 3KQBA 3LGIA 1P2JA 1TA2A 2AHME 2BX3A 1CSOE 1HAHH 3KF2A 2ZGHA 1TGSZ 2O8WA 1JIMA 1GBMA 5CE1A 5G4BA 2GDEH 5FBEA 3BIVH 1ELFA 3MI4A 1WQSA 2J5UA 1SLUB 3D49H 3KQEA 1CGHA 1ELBA 1NBMD 1FNIA 3M3TA 4FUCA 2Y5GA 4MPWA 1VJ9U 1AI8H 2J98B 5A0AE 4FETA 1HUTH 3Q76A 3RMNH 2QF5A 3EGKH 2ZQ2A 1GHVH 6CHAC 1FY3A 2ZPSA 4YOGA 1YPGH 4JZFH 3SO3A 3DA9B 1NESE 3P8NA 1E37B 1GI0A 3FN8A 8GCHF 1GWAA 2XW9A 1OWJA 1C1UH 1YWUA 1RXPA 1J16A 1P2QA 1PPEE 4B76A 4IS5A 4CRDA 3K6YA 1NRRH 1SOTA 1GL0E 4Q7ZA 1VITH 1TRMA 2J4IA 3SQEE 1QA7A 5C20A 4XDEA 1JIRA 2FLRH 2QXIA 1TGCA 1OP0A 1TRNA 1WYKA 3PV4A 1O5GH 5JBBS 4Y8XA 3RM0H 1S85A 3GDUA 3F2HA 3V3MA 1C1SA 1NRPH 2ZU4A 4AB9A 1C2FA 4E05H 1ELAA 2FESH 1OWIA 5GCHF 5IDKA 1KLTA 2ZHFH 1FDPA 1Z6JH 1K1JA 4CBNA 2BZ6H 2FMJA 2XRCA 3LPRA 4I7YH 1T8OA 1HYLA 4OGXA 4Y8YA 4TY7A 1SC8U 3TVJB 5IK2D 3PYHA 1V2UT 1V2NT 4BTUB 2IJOB 3P92A 1L1JA 3NZIA 3SU5A 1ZHRA 4FU8A 1O3AA 5DP3A 2CF8H 4LOYH 1XUIA 1O34A 2VU8E 1MTWA 2P3FH 2Z94A 4BTIB 3KEEA 1EATA 1KLJH 3JZ1B 5DGJA 3ZIAD 2EI7A 2AMQA 4MNVA 1KXEA 9LPRA 1CHOG 4MG3A 3PMHB 2Y82A 2H2ZA 2YOLA 4ISIH 1MD8A 2GJGA 3F9GA 4JZDH 4O3TA 3B8JA 1BBRH 2ANMH 4X8UH 3RC5A 2JJ2D 2VWOA 2WPLS 3RLYH 4U01A 1GBKA 4ABEA 1GBTA 1GG6C 3NKKA 3Q3KA 1O33A 4X8TH 2ZU3A 4UFEH 3ZZAA 4AN7A 5FAHA 4VGCB 1C5LH 2OC1A 3PLKA 3LGWA 3NXPA 2J2UA 1KSNA 1AU8A 3DT0H 1MTVA 2ANYA 1GJ5H 1O2LA 1CBWC 5EG4A 1DITH 4JYUH 4OS1A 3EA9A 1GPZA 5HYOA 4UFGH 1GI4A 1ID5H 2J94A
chains in the Genus database with same CATH topology
2ZC9H 3SUGA 2A5IA 1AB9B 1O0DH 2Z9GA 1QURH 3SU3A 4I33A 4ESTE 1CT0E 1DSTA 1O2MA 2F9BH 2PGQB 2SGFE 3OX7U 2VIQA 4TPYA 3A7ZA 3T29A 3VB4A 2BQWB 1THPB 1ZHMA 1KXAA 3S9CA 1XKBC 1Q31A 1GBDA 1G2LA 3RXBA 4WMEA 1KXDA 2H1UA 4K2YA 1QBVH 4GPGA 2FXRA 3RC6A 2Q1JA 1YF4A 4GCHF 1Y3WA 4DIHH 3PMAB 4E7RG 1MCTA 1QBOA 4GSOA 2ZFQH 1HLTH 5HMAA 2OXSA 2BDAA 3PROA 2ZTZA 2A7JA 2VWLA 1RTFB 4R8TB 1OP2A 2FOMB 3TH4H 2VIOA 3E3TA 5FCKA 3MH7A 4X2VA 4CRFA 1PPHE 1V2OT 5PTPA 1SG8B 3QWCH 4TY6A 5K7RA 1K1MA 1ZPCA 1O2KA 4A1VA 2HALA 2P8OB 3LDXH 3FP8E 2STAE 1W11U 2ZWLH 3M3SA 5L2ZH 1ZLRA 2ZNKH 2D2DA 3SGQE 3U8TH 3SUDA 1O5DH 1GJ4H 3SV6A 1YCPM 3K6ZA 3RXUA 3TJVA 1FAXA 2VINA 2BD3A 2SGDE 1V2VT 1LHEH 1WU1A 1VCWA 3BTGE 2FS9A 2BYAX 2AH4X 4AYYB 2LNCA 2D8WA 1GCDA 3SNCA 1O31A 3AW1A 4M7GA 1BITA 4VGCC 1ZSLA 3UNQA 3QO6A 4B71A 4CRGA 3O8RA 3L33A 4Z6AH 4O97A 1HJ9A 3BG4B 5JBAS 1LDTT 1AKSA 1JXPA 2ZEBA 2B5TB 4BAKB 2OC0A 4YOJA 2BY6X 1HCGA 2FTLE 4HZHA 2QCYA 3TK9A 2Z6BD 2EI8A 3LJJA 5TCCA 2A45B 4TYDA 1O2PA 1SR5C 4OGYA 1A0HB 2JETC 2VIVA 4AGKA 2OBQA 4NFFA 4Q7YA 1FY1A 1MMJN 3Q00A 5ESBA 3R0FA 4K60A 2FI5E 3M36A 1GI3A 2QGRA 4XFQA 1SGTA 2QN5T 1LPKB 3BTTE 3FZZA 1CA0B 3NWUA 4HFPB 4HI3A 1C5QA 1P2IA 1G2MA 2ZHWH 1GVLA 1A3BH 2XC5A 2EI6A 1J17T 5FXLA 1RJXB 1XUFA 1FY8E 1KLIH 2BDBA 3ZZ7A 5T3HA 5C1XA 1O5FH 4FUEA 3P17H 4NIYA 1C9TA 1ZGIA 3VGCC 2BOKA 4MTBA 1QB1A 3IWMA 1G32B 1MAXA 2D1JA 3E6PH 5AFYH 5DG6A 2F9OA 1TMBH 2AGEX 3ZZ5A 3UNSA 1CHOF 1PPGE 4GUXA 2BLQA 1GBFA 1TBZH 2RG3A 3ATKA 4BXSA 1Y5BT 2V0BA 1KIGH 2ZQ1A 1N6XA 5GDSH 4XBDA 1EX3A 3H7OA 1KTSB 3D23A 4HTCH 1ZSJA 1YGCH 1DY8A 4DY7B 3URDA 1MKWK 4KP0A 4X6NA 3T28A 5DPAA 1DLKB 4RKOB 1O3EA 2DUCA 3MNBA 1W12U 4JYVH 5FHTA 1P05A 1EP6A 1XVOA 2FIRH 4KELA 3O8CA 1IQKA 3MOCA 3HK3B 4K8YA 1PYTD 3V0XA 3ZVEA 3PLBA 1GHAG 3A8BA 1K22H 1HAGE 1Q3XA 1P0SH 3U8RH 3LOXA 1GMCF 1Z1JA 5AVDA 2WUBA 4ISLA 3RXHA 1UTMA 2WPHS 3D62A 3E0PB 4NWKA 1V2ST 4YESB 3BTKE 1O2SA 4A1TA 3AAVA 1BA8B 2W3IA 3DUXH 2GCTB 1Z8IB 3PMJA 3SUEA 4Y0YE 2B7DH 3NCLA 2LPRA 2EEKA 4D7GA 2PWXA 1V3XA 1F2SE 1ARBA 1JRSA 1P3EA 1H9LB 2HNTE 1FUJA 3RLWH 2CF9H 4X1SU 1YCPK 2AFQB 1P2NA 1O2IA 3ZVDA 3PO1C 3BV9B 1ELEE 1D3PB 1OPHB 3SV2H 1SQOA 4MPUA 1VGCC 1IQMA 8LPRA 4X2XA 1AKSB 5DP6A 1BMLA 1GHYH 4ZHLU 2ZHEH 1UTOA 3SN8A 3TGIE 4ASHA 2FOAA 4BANB 1NRNH 1Z8JB 4KTCA 5EXMA 1ETSH 1TRYA 4NFEA 2OD3B 1F5LA 2BXTH 2UUJB 3TH3H 1C1WH 2F3CE 1XUHA 3SNEA 2V35A 2M5TA 1TNHA 3K9XB 1ZJKA 1P8VC 4OS7A 1IQIA 2GDDA 3BSQA 3KQCA 4WMFA 1QNJA 2ZFPH 3QN7A 1IQHA 1QRZA 1ZJDA 2BVXH 1TNGA 1DX5M 5EQQA 1CU1A 3JZ2B 2OTVA 1E34B 3BTEE 4ZXXH 3EAJA 1GHBF 4D8NA 1MCVA 2AERH 1XUKA 1UK4A 1G30B 2GMTB 1BDAA 1TBRH 5B6OA 4IBLH 4LK4A 1CGIE 2ZTXA 4D76A 1HRTH 5ABWA 1VITG 2ZI2H 3T26A 1NPMA 1O2ZA 1WBGB 1A5GH 4IGDA 2BDCA 1Y5UT 3VB5A 1SGEE 1W7GH 2W7SA 3PLPA 2O8LA 2VIPA 4H6TA 1G9IE 1G3BA 1SGRE 2GCHG 1W3CA 2BY7X 1RS0A 3BTHE 4X1QU 2GV7A 1TOMH 2QIQA 4NIWA 3ZVFA 2BM2A 2IOTA 1MZDA 1YPLH 2GP9B 1OP8A 2G81E 3PMBB 2R2MB 1PJPA 2P95A 3NK8A 2J95A 2BLOA 4AORA 3O8BA 5K0HA 3UWIA 4ZROA 2WUCA 1ZTJA 1UVUH 6CHAB 2ILNA 4FUJA 3GCTG 1C5MD 1EP5A 1HV7A 3MYWA 2P3TB 4O3UA 1EAXA 5DP9A 1NC6A 1QA0A 2VVVA 5DKMA 5ETXA 1Q2WA 4AFZA 7GCHG 2A4GA 2H5CA 4I8HA 1GI1A 3BN9A 1FI8A 1C5VA 1TX7A 3TITA 4GAWA 4I8GA 4CRCA 4BNRA 3A83A 1ELVA 3M7UA 1IQLA 2WV5A 4GHTA 5FPYA 4UFFH 4XE4A 4ABDA 1AE5A 2O8UA 4MQAA 1ESBA 4DURA 1O37A 1TQ0B 3GY2A 1G37A 3DD2H 2Y80A 1TFXA 2ZFRH 4RN6A 1ELDE 4IN2A 4D9QA 1O3NA 1QFKH 4H6SB 1LVYA 1QQ4A 4NA7A 4RSPA 5AHGH 4K1EA 3ZV8A 1A61H 1OYTH 3RC4A 1SMFE 4DOQA 2RCEA 4FVBA 1N8OB 2AIPA 3IG6B 1UTPA 4F4OC 2FOEA 6GCHG 1GJ9B 1K1OA 1NRQH 1QRXA 3RXAA 4ABFA 1TE0A 1Y3VA 4WH8A 1W8BH 3V7TA 1WV7H 2ZG0H 3VB3A 4INHA 2ZCHP 3FANA 1F5RA 3MO3A 2FO9A 4X1RU 2XWBI 4B2CA 5FX6A 3SNAA 1V2RT 1U6QA 2GGVB 3IITA 1L4DA 5FPSA 3E0NB 1GDNA 3GYLB 1P06A 1T32A 2Y5HA 1RFNA 2ANKH 3U8OH 1D6RA 1GG6B 1UTNA 2A2QH 2FTMA 1TONA 1D3DB 1SLVB 2PHBA 3GY8A 2VJ1A 3OY6U 2ZTYA 3ELAH 1CA8B 4DCDA 3I77A 1HAPH 3GICB 3A87A 3SU6A 3TGJE 1CBWB 1SI5H 1A7SA 2F83A 1V2LT 1GJ8B 4A92A 2F9UA 1NROH 3SHAH 1AQ7A 2J34A 1S82A 2P93A 2F9PA 1IQEA 2O8TA 1JBUH 1NO9H 1C1NA 4WH6A 2ZCLP 3SU4A 4WXIA 3E8LA 1LVOA 3R3GB 5AFZH 5I25A 1Y3UA 1GBIA 4A1XA 1K21H 5EQRA 4ABBA 3MNSA 2QXGA 2Z3CA 4JCNA 4FUDA 1EQ9A 2B9LA 3BTWE 3GDVA 1H8IH 3VXEH 2ZGJA 1AWHB 2FOGA 1LVMA 2C3SA 1QL9A 3T5FH 5JBCS 1C5ZB 3KCGH 1NFYA 2HLCA 4BAHB 1BJUA 2FOBA 3P8FA 1YPEH 1SGIB 3KIDU 1VJAU 1AUJA 3B9FH 3M3VA 1LTOA 2F91A 1K1PA 4INLA 1GBEA 1GMHG 1N8OC 1O3OA 3RXVA 2BDYA 4SGAE 4XSKU 1INCA 5EQSA 2STBE 3HGPA 2GCHF 4IMZA 1FQ3A 3G01A 1MQ5A 4AGJA 1EZUC 2P59A 1RGQA 3QDZB 1H9IE 1B7XB 2BB4A 1VCQA 1GI5A 3KN2A 2SNVA 4U30A 3NPSA 3ZZ4A 3BEIB 1F7ZA 5DP4A 4KGAA 2C8YB 2VIWA 1TMTH 1NTPA 2VH0A 3E1XB 4INKA 2XBWA 3HKIB 4WY3A 1DM4B 1GBJA 1TX8A 3UREA 2V6NA 1IHSH 4DT7B 1W10U 2BD7A 3TNSA 4D7FA 1W14U 5HXFA 4ABAA 3SUFA 1GJ6A 1TX6A 3RXLA 1BRUP 1BOQA 1CO7E 1XMNB 3TNTA 3VB6A 2ZFTA 2JH0D 2ZDMA 3UTUH 2W7UA 4KTSA 3SQHE 2G00A 3LKWA 3O8DA 3GCHC 2TIOA 1O3JA 4X0WU 3V12A 2ZECA 3RXOA 1BBRE 2VB0A 1TNKA 3DHKH 1GBHA 4ZUHA 4K1SA 3QLPH 4B75A 1HAZB 1ETRH 1GI6A 5DP5A 4IW4E 5T6FA 1SLXB 3RXRA 2A4QA 2JETB 3PWBA 1TMUH 3HATH 3RMOH 1NFWA 1TYNA 2PKSB 3ESTA 3GOVB 1GBCA 4IC6A 4DVAU 4ABHA 1QB9A 3EDXB 3M61U 4AB8A 3H7TA 1QL7A 3GYMA 2XBVA 1LQEA 1FY5A 2W3KA 1E38B 1GJBB 1QTFA 1XUGA 1ZMLA 6GCHF 2ZDVH 2NU1E 3ZV9A 1DDJA 2JH6D 1LO6A 1OSSA 3SZNA 3VGCB 3TGKE 4F49A 1C2LA 4B1TA 1QQUA 1V2TT 2RA3A 1ETTH 1BRBE 3A8CA 3BTQE 2ALVA 2CGAA 1HAYB 2QYIA 3UQVA 1WAYB 1KDQB 3UWJH 1SHYA 3PM3A 1V2MT 1EJNA 3MO9A 1OXGA 1YPMH 5EGMA 1O2OA 1GBAA 3MHWU 1K2I1 5E0JA 1HFDA 3MH6A 1FZZA 2I6QA 2P94A 2ZZUH 1DUEA 2PUQH 5JDUB 3MNXA 1C1PA 3ZVCA 1ELCA 2PKAA 1A46H 2ZPRA 2F9NA 2GD4B 2P3UB 2VGCB 1SGFG 1IQFA 5TJXA 3SNDA 1W0ZU 1DUAA 3SJ8A 1PPFE 2Q6FA 4JZ1A 3ZVGA 1FN6A 5LPEA 1TQ7B 4KTUA 2BX4A 2WYJA 1HAIH 1A4WH 3BTME 3BG8A 1BBRK 1BTXA 2SGEE 4Y79A 3TJUA 1KXCA 2FDAA 3ZYDA 2Y81A 1YP9A 4A5TS 2C93B 4K8BA 1IOEA 3KNXA 4WMDA 2SGPE 2THFB 3I78A 1OS8A 1Y3YA 4I31A 1BTZA 3SU1A 1C2MA 4YT7H 3SU0A 1C9PA 1YC0A 3SV8A 2XWAA 1O2VA 1IQGA 1SGFA 2FYQA 1O5BB 1RTLA 2HPPH 2YNAA 4K5ZA 3SOSA 1AO5A 1UVPA 3ZVBA 1ABJH 2V3OH 1RRKA 1PQAA 4Q7XA 3BF6H 4TPIZ 3SJKA 3L6PA 1WQVH 3TK5A 1HJAC 2PKSC 2BVRH 2FI4E 1EB1H 2A5KA 4ABGA 5I46H 1XXFA 2W26A 1P2KA 1H8DH 3BTFE 5AF9H 4XBCA 3EE0B 4WVPE 2ZGXH 3PO1B 1O3BA 5DK1A 4Y7AA 1UVSH 1V2PT 1VGCB 1SSXA 1C5XB 3MH5A 1O2UA 4ABJA 2BD8A 2A5AA 2AGIX 3ZYEA 5JYIA 1JOUB 2EA3A 1Z6EA 1ANBA 2B0FA 4NSYA 2BD5A 2Z9KA 3F68H 5C5OA 1O2WA 5A2MH 3P70B 1K1NA 1OWHA 3A7VA 3H5CB 2CMYA 3ZZ6A 5FBIA 1BTPA 2ZGBH 1T4UH 2V3HH 1MKXH 2GVFA 3VB7A 5JBTA 1P9SA 3N7OA 3RMMH 4X6MA 1O3LA 3LH3A 1MH0A 4DW2U 1BTYA 1GGDC 1O3DA 1K1LA 8ESTE 2B8OH 1GCTC 1MBMA 3SI3H 4ABIA 2VGCC 5EW1H 5GJ4B 1J9CH 1DWCH 1XX9A 3EYDA 1WCZA 4ZKOU 1S0QA 2TPIZ 1PQ8A 3OU0A 5GIBA 1O38A 2GKVE 3U1IB 5E0HA 1DWBH 1QR3E 2AMDA 1LHFH 2Q6GA 3OTJE 1MTNB 5LPRA 1RIWC 1QJ6B 3W95A 1GDQA 3LC3A 2A7CA 2G4TA 1C1QA 3BEFB 1C2GA 1FPHH 4ZAEA 1MD7A 1B0EA 3RU4E 1C1TA 2ZIQH 4K1TA 1C5RA 1GMDG 3EA7A 4DJZB 2PKAB 1SHHB 4RKJB 4NGAH 1SPJA 1O3GA 4JK6A 4IMQA 4BAOB 1OWKA 2FI3E 1CE5A 2HNTF 3HKJB 1P03A 5ESTE 4AYVB 4WWYA 1WOFA 1D3QB 2ZP0H 2PFEA 1T4VH 3MU8A 3TH2H 4CR9A 1G3EA 3S9BA 4NIVA 4NCYA 1P12E 4Y8ZA 2O8MA 1LKBA 4OS4A 1MTUA 4YT6H 1P2MA 1ZMNA 1IQNA 1EAIA 5DP8A 1UCYH 1RD3B 2JH5D 5LGOA 1ACBE 1AD8H 4X2YA 1PPCE 1O2YA 1O3MA 2Z7FE 3A7XA 4NZQA 1Z8RA 3MNCA 4U2WA 4LZ4B 4UONA 3ATMA 3RXTA 3M35A 2GZ9A 1GDUA 1MU8B 3SGAE 3MMGA 4ISHH 2UWLA 2UUYA 3MH4A 1EOLA 1TAWA 1QIXB 3ZVAA 2P16A 1PPBH 3S7HB 1ANCA 1HIAA 1ZOMA 4X2WA 3D65E 1A1RA 5JB9S 1G36A 3F6UH 1AMHA 1SGCA 5GXPA 3A85A 2PR3A 1TGNA 1AFQB 2G4UA 3TIUA 1DWDH 2OINA 1IQJA 3ODFA 3OYPA 4Y71A 1TALA 1TABE 1WUNH 2ZDNA 1FJSA 2OUAA 2R0LA 3SW2B 3FP6E 1TWXB 1V2QT 3UOUA 1NM6A 2PTCE 3VPKA 1UMAH 1K9OE 1SGDE 1F5KU 1YLDA 5L6NH 3A88A 2BQ6B 3S9AA 2AEIH 1P11E 1C5WB 1MTNC 1Z1IA 3MU0A 2TRMA 3CS7A 4FUBA 4TWYA 3SHCH 1NY22 4FXGH 1C2KA 1GL1A 2RA0A 1O3PB 3FVFB 1B5GH 1TIOA 1FN8A 3QK1A 2H9EH 2ZU1A 3SORA 2HGTH 1F0UA