5GIBA

Succinic acid bound trypsin crystallized as dimer
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
223
structure length
218
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Trypsin bound with Succinic acid
rcsb
molecule tags Hydrolase
total genus 52
structure length 218
sequence length 223
chains with identical sequence B
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2016-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5gibA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5gibA02
1C4U2 2OBQA 5AVDA 5C2ZA 4ABJA 3B23B 3ZYDA 1QL9A 1D4PB 1G2MA 4MNXA 1AUTC 2QV1A 4Y8XA 4Q80A 5HGGA 4IBLH 2W26A 1FY1A 1TMUH 5JB8S 1GJ8B 4CR9A 1H1BA 1HAGE 1ZJKA 3QN7A 3S0NA 1JWTA 1A4WH 2WV4A 4GUXA 1CHOG 2KAIA 3M5MA 1RTKA 1S5SA 1VZQH 2FX6A 1QGFA 1QRZA 3ZVGA 4MDSA 2WYGA 3RXMA 1GI1A 4K3JA 4YOGA 4F49A 1NO9H 1IHTH 2ZDVH 1GHWH 1SVPA 3MWIU 1JOUB 2OBOA 3SJOA 1HFDA 1G3EA 3K6ZA 2BXUH 1SOTA 5DP8A 3R3GB 1ELEE 5CHAC 1WU1A 4CHAB 4I7YH 4INKA 1C1SA 2TRMA 2Y81A 3A82A 2O8TA 2P94A 3E16B 1O2IA 1UCYK 1P0SH 1RD3B 2ZG0H 3STJA 1BTUA 3GYMA 1EOJA 2ZHEH 4CR5A 4MVNA 4K2YA 4B2CA 3EA8A 2B5TB 1ZPBA 1AVXA 1P06A 2WPJS 1FY3A 1IQGA 1CA0C 2ZZUH 2BD8A 4B74A 1O3MA 4TY6A 2TGPZ 1GHAG 4ZXYH 1E35B 1HAVA 4K1EA 3BG4B 1YPJH 1RXPA 2ZGHA 3SJ8A 1GCTB 3SV9A 2BDYA 1SC8U 1SGRE 1SLWB 3M5LA 3RC6A 1AGJA 3BTEE 1ANDA 2OD3B 3ATKA 1ELFA 1TGSZ 5LPRA 3ATMA 2GTBA 2PGQB 2V3OH 1V2OT 2ZCHP 4CRAA 4X1QU 2GV6A 1MKXK 1HXEH 2SNWA 2Z9KA 5AFZH 1T8MA 3TK9A 5F8TA 2BLVA 1MTUA 5TCCA 1O3CA 1O2TA 3B8JA 1QCPA 1ZMJA 1YCPM 1IQHA 3MI4A 4I8JA 1YPHC 5EQQA 2BDBA 1T7CA 3TITA 1IQKA 4JZ1A 4ZUHA 1XXDA 3P8GA 1IQNA 2JETC 5FPYA 1O3FA 1TX8A 1DSUA 4NA9H 5A09A 1L4DA 1L1NA 1GI0A 1O2XA 3V7TA 5DP5A 4O3UA 4ZKSU 4CH2B 8GCHF 3MU4A 1PQ5A 2NU3E 4BTTB 3H7TA 1HIAB 1ZJDA 1WQSA 3BSQA 1P2JA 3MNSA 2ODQA 1P3CA 1SGIB 4JYTA 1QBVH 3RXCA 4BNRA 3IG6B 3S69A 2FS9A 3IITA 5EOKA 2EI7A 3GDUA 4K1TA 4WMFA 1L2EA 3S7HB 4J1YA 5GDSH 4RN6A 1Y3YA 3W95A 1L4ZA 3MO3A 1XKBC 4Y8YA 1C5VA 1O35A 3EE0B 5FCKA 1CT0E 1W11U 1SLUB 3E0NB 3FP6E 1EQ9A 1UMAH 3Q77A 3ZVBA 2ZPQA 3VGCC 1GHXH 2PUXB 1AD8H 2Q1JA 1KXEA 1KYNA 3EDXB 4BAHB 5C1YA 1V2UT 3SNEA 2PSYA 1S81A 2Y5GA 4OS7A 4KKDA 3L3TA 5FHTA 4X1SU 1F0RA 1HV7A 1DPOA 1P09A 2CGAA 3T29A 4X8UH 1SHHB 4NSVA 1C5UA 1NRSH 1SB1H 1A2CH 2TGTA 1DT2A 1HUTH 4ISHH 1PPZA 3TIUA 2P8OB 3M37A 2ZU3A 2XWAA 2G4TA 3RXLA 5E0JA 3ZV9A 4YT7H 1B0FA 1DY8A 1F5KU 1YYY1 1KIGH 1HAPH 1HIAA 1BTPA 2ANYA 2YOLA 3F9FA 1A7SA 1SGFG 1UHBB 4K60A 1Z71A 2QA9E 4Z6AH 1W14U 4LZ4B 1GI6A 1C1VH 1YPHE 2GDDA 2ZHFH 2QAAA 5BRRE 6ESTA 3UWIA 2R3UA 4MPXA 1C5PA 3A83A 1O5EH 1KLTA 3RM0H 1CBWB 1BTHH 2TPIZ 4Y8ZA 1GBIA 1O2OA 1UTPA 2JH5D 4X0WU 1Y59T 1P8VC 1V3XA 2QYIA 4DW2U 1C1TA 3PMHB 1QY6A 2CHAC 2FLBH 3F1SB 2C90B 3MOCA 1O5AB 1JIRA 1TNGA 2ZC9H 2G81E 3SU6A 1Z1JA 4JZDH 5FAHA 2BLQA 1YCPK 4FUBA 2RDLA 3EYDA 1ELVA 1EZUC 1SGDE 1EZXC 2G51A 3O8RA 1ZGVA 4FU7A 2XCFA 4NFEA 5DO4H 3A8CA 3WY8A 1G2LA 2ZA5A 1D3TB 4INLA 1KY9A 4JK5A 1HAZB 4D9RA 1K1NA 3D23A 4NGAH 1D6WA 4OS2A 1O2QA 1MAXA 1X7AC 5EPNA 1G9IE 1IQJA 1DFPA 2W7UA 1YM0A 4TYDA 1UHBA 3HATH 2H9TH 4D76A 3NKKA 1V2JT 1W2KH 1C5XB 4CRFA 2HGTH 3NWUA 1HAHH 1YBWA 1VJ9U 1Q2WA 1A5HA 1JRSA 1BRCE 1K9OE 1GWAA 3S9CA 3BTFE 3RXUA 1MTWA 1A3BH 5LGOA 1GG6B 1ZSJA 2FOCA 2O9QA 1C5RA 3LJJA 1XVOA 2PKAB 3KIDU 4K1SA 1ABIH 3A7ZA 2ANKH 2BX4A 4D8NA 4Q2KA 2WPIS 3BN9A 3MNBA 1O2HA 4LK4A 1D6RA 3RC4A 1TA2A 3R0FA 4UEHH 1QQUA 4NA7A 5GIBA 3SJ9A 2W3KA 1SQTA 3U69H 4KGAA 4AOQA 2QIQA 3JZ2B 1FPHH 4ZROA 1GJ7B 1T4UH 2SFAA 5JYIA 3LOXA 2PKSC 1O3IA 2BDCA 2FTMA 2RA3A 1TONA 3LIWA 1EJNA 4UDWH 3SI3H 2ZU2A 2PSXA 4YTAA 2PHBA 2FO9A 1MQ5A 4DIIH 2FOEA 1TQ7B 1GGDC 4A1VA 2A5IA 5T3HA 1ELCA 2A7HA 2FTLE 4Q7YA 1WBGB 3TGIE 2VIQA 1K1IA 2A1DB 2QGRA 1HRTH 1KTSB 1OWDA 3FANA 4UFDH 4IN2A 2BTCE 1O2KA 2HLCA 1HJAB 4UONA 3BIUH 1EOLA 4YM9A 1TNJA 4NIXA 1GHBF 2G55A 3OU0A 1OP0A 5GPIB 5FBEA 1O2LA 3P8OA 1S83A 2VVVA 2B7DH 1QRWA 4H6SB 2G5VA 3GCHC 3A81A 1O2VA 3ZZ9A 1EJAA 2J92A 3M35A 3KEEA 1B7XB 4IW4E 3RLYH 3MU1A 1SGYE 2Z6BD 4THNH 4JK6A 2Y82A 1ZMLA 2GZ7A 3T62A 1AIXH 1GI8B 1G32B 2SGPE 3RXVA 1W7GH 3K6YA 2VWOA 2HNTF 1C5WB 2AS9A 1BHXB 1QBNA 1F0SA 4K8YA 3K2UA 1BIOA 3KNXA 1AFQC 1G37A 2ZF0H 8GCHG 1O3PB 3TJVA 4D7GA 1AWFH 3SV7A 1PYTC 3SU1A 2AMQA 1FMGA 1DICA 1DLKB 3URCA 1WTGH 1ETSH 1TBRH 4AZ2B 1P03A 2VJ1A 3F6UH 4YLQH 1YGCH 4XSKU 2A5KA 3FP7E 3ZZ5A 9LPRA 4RKOB 5DP3A 4OS4A 2WPKS 3E91A 1THPB 4HTCH 4ABAA 5GWZA 1ZPZA 3GY7A 1FUJA 1P10A 1YKTA 2Y80A 1GMCF 1O3OA 2FP7B 1K1JA 2STBE 4ABFA 2NU1E 2ZFPH 4K5ZA 1P01A 3TH4H 4I32A 2H1UA 2OLGA 5EPYA 1TX7A 1TB6H 1N6XA 1GL1A 2IN2A 2J2UA 2ZCLP 3LGWA 4RSPA 5C5NA 1AZZA 7KMEH 1ZLRA 1QB6A 3NXPA 3DT0H 1GI9B 4YT6H 4GPGA 2V0BA 2WUBA 1NRQH 1UVTH 3EAJA 1DXWA 1LVYA 3ZZ4A 2JKHA 2SGEE 4A1TA 1C5NH 2B8OH 3RXAA 1NY22 2FOHA 3A87A 1B0EA 2BHGA 2OC8A 2ZDLA 4MNYA 1THRH 3M3SA 2CF8H 3RXKA 2C8ZB 8ESTE 1FY4A 1OYTH 4ABIA 1C2KA 1C1OA 1C5QA 1KTTB 2FOFA 3MYWA 3RXTA 1K22H 1UVPA 5DP4A 4Y10E 5A8ZA 4ZKRU 2FOAA 1C5MD 1YC0A 2ESTE 1LVMA 1O5GH 5HMAA 2ZFTA 3RU4E 1UTLM 1UK4A 3RDZA 6GCHF 4FVBA 1F0UA 1GDUA 4AFSA 1SGEE 4JYVH 3RMMH 2CXVA 1TBZH 3AW0A 4CRGA 7ESTE 4OGXA 2A31A 1C2JA 1TLDA 1W0YH 3SHCH 1C9PA 1C2HA 1INCA 1TWXB 3A8BA 3HPTB 2OCVB 4IMZA 1FQ3A 4WY3A 2F9PA 3ZVEA 3E8LA 2JH6D 1HCGA 1T4VH 2FEQH 3NK8A 2O8LA 2F9NA 2BVSH 3LGTA 5G4BA 3K65B 5TCAA 3SGAE 2C4FH 2H2ZA 3V12A 3PO1B 1VGCB 2ZHDA 4NIWA 2XXLA 3ESTA 3RUOA 2C8WB 5A8XA 3BG4C 1XUHA 1GJBB 1GBEA 2RCEA 2FX4A 1CHGA 2ZDKA 2ANWA 2ZTXA 2ZCKP 2HVXA 3BEFB 4ASHA 1AB9B 3UOUA 3OX7U 1PPHE 2XTTB 5IDKA 1YLDA 1GDNA 4DIHH 1PYTD 2WPMS 3DFLA 1S6HA 1ANEA 2BQ7B 1A0LA 2FZZA 4YLUA 1AE8H 1CSOE 1AHTH 1QRXA 2F9BH 1TGTA 2WPHS 1CT4E 1GCDA 2GCHG 5DPAA 1UTMA 3QTVH 1GI7B 1MD7A 1V6DA 3QZRA 4I8HA 3VB5A 4E06H 1Y5UT 3FVFB 3SU3A 4ABDA 1HAOH 5GCHF 4LXBH 1BBRE 3T5FH 3LGUA 1G3DA 1TIOA 5I46H 2Z9JA 4A5TS 1RJXB 3SNBA 1Q3XA 2GT7A 1KXDA 3DA9B 1MTSA 5TJXA 2PWXA 3MU8A 4AGJA 1J14A 1FIWA 1GJ9B 1MMJN 4B73A 4TY7A 4X6PA 4MPVA 2HALA 2XW9A 1HGTH 1XMNB 4NCYA 1VITH 3ZZ7A 2FESH 1MQ6A 3SV2H 1NRPH 4UFFH 2Z94A 3GDSA 1FONA 5L30H 1C5YB 2XBVA 4MPWA 1A5GH 2GD4B 1C5SA 2D26C 5PTPA 5BPEA 1ESBA 1P2MA 2A4RA 4WH6A 2XBWA 3SQHE 1EAXA 1HJ8A 1HNEE 1TPSA 3OSYA 1TPOA 1LHCH 3SZNA 4X1NU 1K1LA 1KXBA 5DJ7A 4NIVA 1EUFA 2W5EA 3B9FH 2R0KA 1S6FA 1BCUH 3RLWH 3Q3YA 1D3QB 5EG4A 1LHFH 3M5NA 3QK1A 4Q7XA 3OY5U 5HM2A 5H4IB 3TNTA 2F91A 1GHYH 3NZIA 1GMHF 4YOIA 4Y11E 4B76A 2FS8A 3P92A 1EASA 4HGCA 1HBTH 3LT3A 1FAKH 3TJOA 1SGCA 2Q6DA 1QBOA 3TJUA 4BXWA 2VIVA 4TWWA 1GHBG 1NTPA 2ZNKH 1GJ5H 1TPAE 3HKJB 3QGJA 3Q3XA 1QL8A 1F5LA 3GISB 3RXGA 5FXLA 2CJIA 4A7IB 1BT7A 3TPIZ 1OPHB 4AX9H 2P95A 1BOQA 2BX3A 3UNRA 2VVUA 1OXGA 1ZSLA 1D9IA 1AI8H 2ZFSA 3V0XA 1KXAA 1O33A 1P57B 1KDQB 1Y3VA 3VB4A 1CBWC 2PLXA 3SOSA 1ANBA 1UTJA 3TGKE 1O32A 1IHSH 1O3EA 3K9XB 4ABHA 1H9IE 3VB3A 2CMYA 3GYLB 3P6ZB 4BAKB 3KCGH 1S84A 3LDXH 1TAWA 2WV5A 1EAIA 2FWWA 1HAXB 2UWPA 2NWNA 3RXFA 1CGJE 1CU1A 3T28A 3RMLH 5CHAB 4DJZB 1LHGH 1TFXA 1WOFA 3GCTF 2SGQE 3E1XB 1BA8B 4BAMB 2FYRA 1S0QA 2OXSA 1C4Y2 1GMCG 4ABBA 4NWKA 1C1NA 3F9EA 1SGQE 1GI3A 1Y3XA 3KF2A 1HPGA 2B9LA 2Y6TA 4ISIH 5C1UA 1ELTA 1TMTH 1YP9A 1C2FA 2QC2A 1FN8A 2HOBA 4AFUA 3PV4A 3BEUA 1DSTA 2Z3EA 1CT2E 3VFEA 3QZQA 4AB9A 2GMTC 5EGMA 1E34B 1NRNH 4O03A 2GV7A 1ELBA 3UR6A 3BTTE 1AMHA 1E36B 2OQ5A 1UCYE 1Y3WA 1O3BA 5E2PA 1C9TA 2BMGB 3EQ0H 4TPYA 4X8TH 1C1QA 4FU8A 1TOCB 1MTNC 3PLKA 3M7UA 3T2NA 1SPJA 3SQEE 1N1LA 1RTFB 4LOYH 1GBTA 4FUIA 2FI5E 1ELAA 1KDQA 4AG2A 3ZYEA 2Q6GA 3OY6U 4X1PU 4NSYA 1P2OA 1DOJA 5EQSA 1SG8B 3A84A 4HI3A 3ZZDA 1LDTT 2GZ8A 3RXPA 1LKAA 1MU6B 4UD9H 2XCNA 2ZECA 2Y7ZA 1E38B 1NESE 4E7RG 3QO6A 2BY9X 2JETB 3LGVA 1UJ1A 3F9HA 1NT1A 1ZMNA 1GL0E 3SUEA 3M36A 2G00A 1ZHMA 4Y6DA 1TGBA 3SGQE 5JBTA 2NU0E 3RU4T 2Y7XA 2AYWA 3GY2A 2GT8A 3MU5A 2FDAA 2ZIQH 4Y76A 4AYVB 3SGBE 4DVAU 4YO9A 4CRBA 1G30B 2A5AA 1C2MA 1YLCA 4X1RU 3ZZ3A 6GCHG 2DUCA 1O2SA 2H6MA 4FUEA 1O5CB 4OS6A 3RXIA 1UO6A 3BTDE 4ISLA 2CN0H 4ESTE 1AVGH 2THFB 4IC6A 2VWMA 2VGCC 1BJVA 1C5ZB 3M7QA 1KSNA 2PTCE 2QN5T 1Z1IA 1B5GH 2CF9H 2K1QA 2FOGA 4A1XA 1S82A 3VGCB 2V3HH 1ID5H 1PQ8A 1AUJA 1FLEE 3UFAA 4BXSA 1BHXF 3ATLA 3RP2A 2D1JA 2J95A 4VGCB 1O2RA 1UTNA 2P93A 5FBIA 3UIRA 1EB2A 5ETXA 2ZPSA 4FXGH 1BITA 1ZYOA 3ZZ8A 1ZOMA 2ZWLH 3D65E 4R0IA 1Z8IB 1BMMH 1T31A 1BTYA 2EA3A 5C5OA 4D9QA 4X8VH 1O2YA 1O31A 1V2ST 4JYUH 3P17H 1QJ7B 1O2PA 4KTCA 2HPQH 2QXIA 3A8DA 2WPLS 2G4UA 1O0DH 2V6NA 2A7JA 1AY6H 4O3TA 3V13A 5GCHG 2XBYA 1XVMA 1Z8JB 3JZ1B 2Q6FA 1H8IH 1O39A 1UVUH 2YNBA 2D2DA 1O2UA 3D62A 2C8XB 4DOQA 2XBXA 2H5DA 2HPPH 2XC0A 1QNJA 2QXJA 5I25A 2GCTB 3SNDA 1OX1A 3SO3A 3HGNA 4MG3A 3TNSA 1QJ1B 1WCZA 2W3IA 1Z8GA 4XDEA 1TABE 1ACBE 3PWCA 4WVPE 1K28D 3CS7A 2F9VA 3BIVH 1H9HE 3MH6A 4CRDA 3QX5H 2QCYA 3UR9A 1WSSH 1SGTA 4IGDA 3W94A 3PROA 1ANCA 5C67A 4H42U 1FDPA 1ZHPA 2BD7A 1AVWA 4K69A 4X2YA 3A8AA 3UPEA 2CHAB 2F9UA 1C1WH 2Z9LA 1UTOA 2Z3CA 1W8BH 1AQ7A 4M7GA 4J2YB 1O3AA 3MU0A 3UUZA 3Q00A 2ULLA 1G36A 1GHAF 1T32A 2B0FA 3U9AH 1WYKA 4GHQA 3NUMA 3TVJB 4KELA 1P9SA 3TH3H 4ZMAH 5EW2H 1EPTC 1MCTA 4FU9A 5B6OA 1LQEA 2SGFE 4MLFB 4X6MA 3RXOA 1GVKB 3SORA 3SU0A 1GMHG 2ZP0H 1BTWA 1OSSA 1MKWH 3VPKA 4Y71A 2EEKA 3U8TH 2QXHA 3S9AA 6CHAC 1TNLA 3TK5A 3NPSA 1O3KA 1C1MA 2ZQ2A 4FUGA 2BQWB 3BV9B 3U98H 3U1IB 2VIPA 2OC7A 1ZR0A 3PM3A 2RA0A 2VH0A 1Z7KA 1A1RA 4UE7H 1F5RA 2PTNA 4AYYB 4AFQA 1RFNA 1TOMH 3TK6A 1W12U 3TJNA 1E37B 4GAWA 2ZGJA 1O36A 1DUAA 1GJ4H 2A0QB 2RG3A 4XBCA 4NWLA 4AN7A 1F2SE 1QA0A 1TNIA 1O5DH 1OOKB 2ZDNA 1ZRKA 3PTBA 1GPZA 1V2QT 2BDIA 2AEIH 1C2DA 2BQ6B 3FAOA 3OYPA 2HNTC 1F7ZA 1D3DB 2AERH 2R3YA 2GP9B 1EX3A 1GBDA 2PR3A 1FAXA 3BG8A 4INHA 4Y0ZE 5J4QA 1RIWB 3P8FA 2BD3A 3URDA 2D8WA 4U01A 1GMDF 2PKSB 3SUGA 4X2WA 1MD8A 2OQUA 2BB4A 1PPGE 3ATWA 1Y5BT 3SN8A 1P9UA 1BBRH 1VGCC 1KXFA 1QHRB 3BTHE 3GOVB 1EP5A 3L33A 3A89A 2WUCA 2F3CE 3OTJE 1G3CA 1GBMA 1L1GA 1O2MA 1GBLA 2IOTA 3GCTG 1YPKH 2F9OA 2A32A 2O8MA 2C8YB 3A85A 1GGDB 2G8TA 4X2VA 4OGYA 3RXEA 1KLIH 1QTFA 1GBCA 3GDVA 4FUDA 4U30A 1SLXB 2STAE 1SMFE 3ATIA 3ZVAA 2OC0A 1VCPA 3SI4H 1LPGB 4WMEA 5A8YA 2Z9IA 2ZU5A 3UNSA 1YPLH 3ZVDA 1KXCA 2TIOA 3MH5A 4CRCA 2ILNA 1CVWH 5C20A 3KQDA 5DP6A 5T6GA 1HLTH 1Y8TA 4SGAE 5ESTE 1MCVA 5JPMH 3A7YA 1O30A 3VB7A 3GCHB 4FVDA 3A86A 3S9BA 2AMPA 4JCNA 2SGDE 4MNVA 3MNCA 4X6NA 2FIRH 4R8TB 4ZHLU 5L6NH 1UTKA 3G01A 1PPFE 1XUKA 1OWIA 1SFIA 4Y7AA 5E8EH 3A80A 1BJUA 3TLOA 4CHAC 1T8LA 1DS2E 3MH4A 1RS0A 2VH6A 5A2MH 1O2JA 1BMNH 1BTZA 1FJSA 3ELAH 3T25A 3UQOA 1O2WA 1JMOH 2W7SA 1NC6A 2H9HA 1AFQB 1DWDH 1V2MT 4AB8A 2ZO3H 1K1OA 2P3FH 5E0HA 7GCHF 1EZSC 2VVCA 3A7TA 1ORFA 1V2NT 2I6SA 4WXIA 1JXPA 3C27B 4E7NA 1FN6A 2PGBB 3I77A 2HNTE 2GX4A 4CREA 3M61U 3M3TA 2FXRA 3SJKA 5CE1A 1C5LH 5JDUB 1O3HA 1TYNA 4YOJA 1BTXA 2ZDMA 4MTBA 5AF9H 1O37A 2ODPA 2H9EH 2P16A 3DUXH 9ESTA 1OKXA 2ASUB 2IPHA 1HAIH 1P02A 1DVAH 1GCTC 2Z3DA 3GCOA 3EA9A 2PFEA 2FYQA 2AGIX 2LPRA 2NU2E 1Y5AT 2BVXH 3CS0A 1XX9A 1N8OB 1O3JA 1MZDA 1TALA 3CENA 2AIPA 1XUFA 3LC3A 1OWKA 1H4WA 5E0GA 3PMAB 3GY6A 2NU4E 3GICB 2ALVA 2AH4X 2J94A 3AAUA 1ZPCA 3LH1A 1O2NA 3NCLA 1PQ7A 1K1MA 3UREA 1EAUA 5LPEA 1GJCB 1LVBA 1ZTJA 1ESTA 1P04A 3LKWA 3VXFH 1SGNE 1PQAA 4K8BA 2OUAA 2BZAA 1JIMA 2VB0A 4XBBA 2P3UB 2BXTH 3RC5A 1K21H 1MAYA 3RXRA 2FODA 5HXFA 2BY8X 4X2XA 1HYLA 3BTGE 1TPPA 2PUQH 3PMJA 4DCDA 2BD9A 3DHKH 2ZU4A 1DM4B 1BUIA 2OP9A 1GVZA 1H9LB 2BLOA 2CV3A 3UWJH 1VR1H 3DFJA 1J15A 1D3PB 2BY5X 1P05A 4BAOB 4B2AA 4LZ1H 1NU9A 3UTUH 1NS3A 1ARCA 1C2EA 1NM6A 1S85A 1P12E 1BRAA 1UK2A 1DUEA 1FPCH 1UCYH 2G5NA 4KTSA 4FUFA 1VITF 1HAYB 4GVUA 3CP7A 1BQYA 4DURA 1DWEH 2ZGCA 3AW1A 3EGKH 1O34A 1FNIA 1CGIE 1K2I1 2FPZA 3LU9B 2FM2A 1V2LT 1YPMH 2QY0B 3MO9A 2FMJA 4ABGA 1ARBA 1GVLA 4B2BA 3P70B 3N7OA 1J9CH 1SGPE 1BZXE 1FI8A 5EXLA 5K7RA 2ALPA 3SNCA 5L2ZH 1J17T 1P2NA 2A4GA 2AGEX 1ZZZA 1A0HB 1LHEH 1PPEE 1P11E 1BRUP 2BVRH 1EAWA 4H6TA 1QIXB 1CA8B 3E0PB 1OWJA 2P8OC 3Q3KA 3BTWE 4HFPB 1MKXH 1TGNA 1GBFA 2V35A 1DE7H 4I31A 2XRCA 3RXQA 1GBKA 2TGDA 5GXPA 2R0LA 1DWCH 3SUFA 2VNTA 1IQIA 3PLBA 4H4FA 5J4SA 4QT8C 1A61H 2J9NA 4JZFH 4GHTA 3MO6A 3LC5A 3A7WA 1TRYA 2BY7X 1RRKA 5HM9A 4A6LA 4F4OC 2ZKSA 1CO7E 4BAQB 3FFGA 1O3LA 2HRVA 3GY3A 3VXEH 2EC9H 5L2YH 4RKJB 1PJPA 1AE5A 3RXJA 8KME2 1SGFA 1CQQA 3ZV8A 1FZZA 2QXGA 1W7XH 3RXSA 1J8AA 2ZFRH 1AFEH 1TX6A 5GJ4B 2XC5A 2F83A 5A0AE 3SU5A 2BDGA 1MUEB 5C1XA 4O9VA 4DT7B 4X6OA 3M5OA 1UTQA 1GJDB 2ZU1A 5ESBA 3C1KA 2GGVB 2ZHQH 1SFQB 4B71A 2BOKA 1S0RA 4WMDA 3RMOH 3ENSB 3TU7H 4JZIA 1IQMA 2GVFA 1A46H 1GBJA 1TA6A 2BDAA 3ZZCA 1GHVH 1SQOA 1QB1A 1UVSH 4DGJA 2ZFQH 1TMBH 4HZHA 4ZKNU 1DDJA 1SR5C 1LHDH 4XOJA 5AHGH 1XUJA 3BF6H 1C1RA 5JB9S 4ABEA 3MNXA 5SGAE 1GMDG 1C2LA 1FV9A 1WAYB 4DY7B 4IN1A 1GJAB 2VINA 1L1JA 1CA0B 3SJIA 2QF3A 4I8LA 2AMDA 4XBDA 5F8ZA 2O8WA 3KGPA 1ABJH 4BOHA 1W3CA 1WUNH 2ZEBA 4UFGH 1HB0B 2VIDA 4FUCA 2ZFFH 2C93B 1P2KA 4VGCC 2TBSA 3HK6B 5EXNA 1HDTH 3QLPH 1BMAA 1ZTLA 2A2QH 2BM2A 4YZUA 5DP7A 1TQ0B 3ZVCA 1BMLA 4BTUB 2O8UA 5C3NA 5A0CA 1PPCE 3PYHA 4MNWA 4OS5A 7LPRA 1GG6C 3KHVA 5EODA 5DP9A 2FLRH 2PV9B 1LTOA 1LO6A 2P3TB 1NFXA 1U6QA 1GBAA 2J4IA 5DGJA 3FZDA 3LGYA 3SV6A 3LJOA 1O3DA 2G52A 5LPFA 1O3GA 4KTUA 1FY5A 1W0ZU 2YNAA 1RGQA 1C5OH 3M3VA 1KLJH 4ZHAA 4Y7BA 3ZZ6A 5HYOA 1MTVA 1V2WT 2GCTC 5EW1H 2ZTZA 1IOEA 1DXPA 3ITIA 1JRTA 2ZQ1A 1TBQH 5AFYH 1YPGH 1VCQA 3RM2H 4IC5A 1DITH 1LPKB 1XM1A 3U8OH 3L6PA 3O8CA 3KQCA 2BDHA 1J16A 1ESAA 1PPBH 4KP0A 4I33A 1BDAA 3KL6A 2JH0D 7GCHG 1ZGIA 3AVZA 5EXMA 1AU8A 1EP6A 3O8BA 1OWHA 4Q7ZA 1OS8A 1WV7H 1YCPH 4Y79A 3A7VA 4U2WA 2UUFB 3BTKE 4GCHF 3ODFA 1OP2A 1HJAC 2J38A 1IQLA 1GBBA 4CH8B 3I78A 3HK3B 1EB1H 3PB1E 2SNVA 2VWNA 1AKSB 1EZQA 1EATA 4NA8A 3SBKA 1EKBB 4NIYA 1V2KT 2XYAA 5DKMA 3RXBA 4NFFA 2UWOA 1O5FH 2J34A 3FZZA 3DD2H 3STIA 3HGPA 3LGIA 1QFKH 4AG1A 1V2PT 1THSH 1A0JA 2UUKB 1IQFA 1TNKA 1SI5H 1UVOA 2PW8H 1NROH 1EXFA 1XXFA 1O3NA 2GCHF 2GMTB 4SGBE 1C2IA 4X8SH 2UUJB 3KQEA 3PWBA 3BTQE 5LH8A 2ODYB 2TGAA 3H5CB 2WYJA 1CHOF 4O97A 1MTNB 2GDEH 1HJ9A 1Z8RA 3PMBB 1ETTH 4NG9H 3TGJE 3F9GA 1LQDB 3MTYA 1ZHRA 1T8OA 1QL7A 4BANB 5FPSA 2GZ9A 1QB9A 3LH3A 2A7CA 2BOHB 1FIZA 2HWLB 1SBWA 1C5TA 1H8DH 1RTLA 1W10U 5FCRA 5F03A 2OINA 3FP8E 1NFUA 1NZQH 2FI3E 4WWYA 1L0ZA 1MU8B 2DE8A 2IJOB 3A7XA 1RIWC 1ELGA 3ZVFA 4NZLA 3T26A 5CMXH 3RMNH 2M5TA 4AFZA 1VITG 1HXFH 1AWHB 1AKSA 3S7KB 4XFQA 3SW2B 2BD5A 4WH8A 3BEIB 4WXVA 1MBQA 2VGCB 1A3EH 1C1UH 3LPRA 3TH2H 1DWBH 2FOBA 1TGCA 4Z0KA 4DG4A 3RXHA 2VIWA 1G3BA 1TE0A 2H5CA 2BD4A 4WJG2 1GDQA 1Q31A 4ZH8A 1VCWA 1A5IA 4ISOA 3EA7A 4UFEH 5F8XA 1YF4A 1SOZA 4IMQA 1EJMA 1V2VT 3PTNA 1MKWK 1V2TT 4ZXXH 2WINI 1ZTKA 4WF8A 1BB0B 1NFYA 2AFQB 1QURH 1LMWB 3ZZAA 3U1JB 1ZSKA 1WTHD 4AGKA 2PKAA 1C4V2 1GHZA 5DG6A 4D7FA 2Y5HA 3QDZB 1SQAA 3E6PH 5JBBS 4CBNA 1QR3E 3MH7A 1LVOA 1FXYA 3UNQA 1MZAA 1MBMA 2BD2A 3RXDA 1P2QA 1GI5A 2A4OA 5T6FA 6LPRA 2ZGBH 5FX5A 2R9PA 3AASA 4FUHA 2ZGXH 2FI4E 3SU4A 1WQVH 3QTOH 3QUMP 1AZ8A 3M7TA 2LNCA 3BTME 1O5BB 3PLPA 3GY4A 5A0BA 2SGAA 1GI2A 1OP8A 3PO1C 1BRBE 4GSOA 4ZAEA 1O2ZA 5IYTA 3IWMA 3MHWU 1BBRK 2VIOA 3P95A 5DK1A 2AIQA 4OS1A 2A4QA 2BYAX 2UWLA 1DX5M 1V2RT 4XE4A 3T27A 1AB9C 3VB6A 5T6DA 2VU8E 3LONA 4B75A 5JBAS 1K1PA 4ZHMU 4ISNA 4E05H 1N8OC 1QQ4A 2EI8A 4ZKOU 2BZ6H 1LCYA 3KN2A 4BTIB 3F68H 3GY5A 3VEQB 2Z7FE 2P59A 4U32A 1Y3UA 2QF0A 3E3TA 4JZEH 1XUGA 1MH0A 2Z9GA 3UY9A 1EPTB 3ODDA 4A92A 1VJAU 2A2XH 5ABWA 1E0FD 1W13U 1NN6A 1Z6EA 1O38A 2ZTYA 2OTVA 4Y0YE 1SL3A 1AN1E 5F6MA 1DY9A 1N6YA 6CHAB 1ELDE 1ETRH 3H7OA 4JMYA 2OC1A 1ZRBA 5EU8A 2C3SA 4TPIZ 1JBUH 1XUIA 3I29A 3GY8A 1P2IA 1F92A 3O8DA 3Q76A 1NPMA 2XWBI 3ZZBA 3SHAH 2ZI2H 1XKAC 1NU7B 2R2WU 1GI4A 2ZPRA 1IQEA 1FY8E 2A45B 4TWYA 1Z6JH 1DLEA 2ZDAH 3SU2A 2GKVE 1QA7A 3SV8A 1TNHA 8LPRA 1UK3A 5FPTA 2ZHWH 1NRRH 1M9UA 2KAIB 4B1TA 2R2MB 4YESB 1PFXC 3QGNB 1IAUA 5JBCS 2DE9A 4GLYA 1QJ6B 1O2GH 2FOMB 4CBOA 2BY6X 1T8NA 1C2GA 2ANMH 2I6QA 1GBHA 3QWCH 2EI6A 4I8GA 3UQVA 1YPEH 4PROA 1OYQA 4AORA 4FUJA 2Y5FA 1SLVB 1P3EA 2XC4A 3D49H 3MMGA 1C1PA 3MFJA 2BLWA 1NFWA 1TRNA 3AAVA 1CE5A 4NZQA 1SSXA 4MQAA 3E90B 1SHYA 1DANH 3GCNA 3V3MA 1OWEA 1TRMA 2UUYA 1EPTA 4GCHG 4I8KA 3KQBA 4IS5A 3U8RH 3SNAA 3A88A 5E2OA 1LKBA 2AGGX 3HKIB 1AO5A 1LPZB 3SUDA 2VWLA 3RU4D 5EQRA 5K0HA 4MPUA 3UOPA 1HAVB 1F0TA 5FX6A 1GJ6A 2XNIA 3P8NA 1CGHA
chains in the Genus database with same CATH superfamily
1C4U2 2W6JD 2OBQA 5AVDA 5C2ZA 4ABJA 3B23B 3ZYDA 1QL9A 1D4PB 1G2MA 4MNXA 1AUTC 2QV1A 4Y8XA 4Q80A 5HGGA 4IBLH 2W26A 1FY1A 1TMUH 5JB8S 5KECA 1GJ8B 4CR9A 1H1BA 1HAGE 1ZJKA 3QN7A 3S0NA 1JWTA 1A4WH 2WV4A 4GUXA 1CHOG 2KAIA 3M5MA 1RTKA 1S5SA 1VZQH 2FX6A 1QGFA 1QRZA 3ZVGA 1FX0B 4MDSA 2WYGA 3RXMA 1GI1A 4K3JA 4YOGA 4F49A 1NO9H 1IHTH 2ZDVH 1GHWH 1SVPA 3MWIU 1JOUB 2OBOA 3SJOA 1HFDA 1G3EA 3K6ZA 2BXUH 1SOTA 5DP8A 3R3GB 1ELEE 5CHAC 1WU1A 4CHAB 4I7YH 4INKA 1C1SA 2TRMA 2Y81A 3A82A 2O8TA 2P94A 3E16B 1O2IA 1UCYK 1P0SH 1RD3B 2KCYA 2ZG0H 3STJA 1BTUA 3GYMA 1EOJA 2ZHEH 4CR5A 4MVNA 4K2YA 4B2CA 3EA8A 2B5TB 1ZPBA 1AVXA 1P06A 2WPJS 1FY3A 1IQGA 1CA0C 2ZZUH 2BD8A 4B74A 1O3MA 5FL7D 4TY6A 2TGPZ 1GHAG 4ZXYH 1K0HA 1E35B 1HAVA 4K1EA 3BG4B 1YPJH 1RXPA 2ZGHA 3SJ8A 1GCTB 3SV9A 2BDYA 1SC8U 1SGRE 1SLWB 3M5LA 3RC6A 1AGJA 3BTEE 1ANDA 2OD3B 3ATKA 1ELFA 1TGSZ 5LPRA 3ATMA 2GTBA 2PGQB 3PRDA 2V3OH 1V2OT 2ZCHP 4RT0A 4CRAA 4X1QU 2GV6A 1MKXK 1HXEH 2SNWA 2Z9KA 5AFZH 1T8MA 3TK9A 5F8TA 2BLVA 1MTUA 5TCCA 1O3CA 1O2TA 3B8JA 1QCPA 1ZMJA 1YCPM 1IQHA 2EY4C 3MI4A 5HKKD 4I8JA 1YPHC 5EQQA 2BDBA 1T7CA 3TITA 1IQKA 4JZ1A 4ZUHA 1XXDA 3P8GA 1IQNA 2JETC 5FPYA 1O3FA 1TX8A 1DSUA 4NA9H 5A09A 5C0TA 1L4DA 1L1NA 1GI0A 1O2XA 3V7TA 5DP5A 4O3UA 4ZKSU 4CH2B 8GCHF 3MU4A 1PQ5A 2NU3E 2K8IA 4BTTB 3H7TA 1HIAB 1ZJDA 1WQSA 3BSQA 3F3BA 1P2JA 3MNSA 2ODQA 1P3CA 1SGIB 4JYTA 1QBVH 3RXCA 4BNRA 3IG6B 3S69A 3F0OA 2FS9A 3IITA 5EOKA 2EI7A 3EE7A 3GDUA 4K1TA 4WMFA 1L2EA 3S7HB 4J1YA 5GDSH 4RN6A 1Y3YA 3W95A 1YY3A 1L4ZA 1E1RD 3MO3A 1XKBC 2KM0A 4Y8YA 1C5VA 1O35A 3EE0B 5FCKA 2IJD1 1CT0E 1W11U 1SLUB 3E0NB 3FP6E 1EQ9A 1UMAH 3Q77A 3ZVBA 4I86A 2ZPQA 3VGCC 1GHXH 2PUXB 1AD8H 2Q1JA 1KXEA 1KYNA 3EDXB 4BAHB 5C1YA 1V2UT 4Q4LA 3SNEA 2PSYA 1S81A 2Y5GA 4OS7A 4KKDA 3L3TA 5FHTA 4X1SU 1F0RA 1HV7A 1DPOA 1P09A 2CGAA 3T29A 5C94A 4X8UH 1SHHB 4NSVA 1C5UA 1NRSH 1SB1H 1A2CH 2TGTA 1DT2A 1W0JD 1HUTH 4ISHH 1PPZA 3TIUA 2P8OB 3M37A 2ZU3A 2XWAA 2G4TA 3RXLA 5E0JA 3ZV9A 4YT7H 1B0FA 1DY8A 1F5KU 1YYY1 1KIGH 4F48B 1HAPH 1HIAA 1BTPA 2ANYA 2YOLA 3F9FA 1A7SA 1SGFG 1UHBB 4K60A 1Z71A 2QA9E 4Z6AH 1W14U 4LZ4B 1GI6A 1C1VH 1YPHE 2GDDA 2ZHFH 2QAAA 5BRRE 6ESTA 3UWIA 2R3UA 4MPXA 1C5PA 3A83A 1O5EH 1KLTA 3RM0H 1CBWB 1BTHH 2TPIZ 4Y8ZA 1GBIA 4Z1MD 1O2OA 1UTPA 2JH5D 4X0WU 1Y59T 1P8VC 1V3XA 2QYIA 4DW2U 1C1TA 3PMHB 1QY6A 2AHME 2CHAC 5GNDA 2FLBH 3F1SB 2C90B 3MOCA 1O5AB 1JIRA 1TNGA 2ZC9H 2G81E 3SU6A 1Z1JA 4JZDH 5FAHA 2BLQA 1YCPK 4FUBA 2RDLA 3EYDA 1ELVA 1EZUC 1SGDE 1EZXC 2G51A 3O8RA 1ZGVA 4FU7A 2XCFA 4NFEA 5DO4H 3A8CA 3WY8A 1G2LA 2ZA5A 1D3TB 4INLA 1KY9A 4JK5A 1HAZB 4D9RA 1K1NA 3D23A 4NGAH 1EFRD 1D6WA 4OS2A 1O2QA 1MAXA 1X7AC 5EPNA 1G9IE 1IQJA 3OFND 1DFPA 2W7UA 1YM0A 4TYDA 1UHBA 3HATH 2H9TH 4D76A 3NKKA 1V2JT 1W2KH 1C5XB 4CRFA 2HGTH 3NWUA 1HAHH 1YBWA 1VJ9U 1Q2WA 2XNDD 1A5HA 1JRSA 1BRCE 1K9OE 1GWAA 3S9CA 3BTFE 3RXUA 1MTWA 1A3BH 5LGOA 1GG6B 1ZSJA 2FOCA 2O9QA 1C5RA 3LJJA 1XVOA 2PKAB 3KIDU 4K1SA 1ABIH 3A7ZA 2ANKH 2BX4A 4D8NA 4Q2KA 2WPIS 3BN9A 3MNBA 1O2HA 4LK4A 1D6RA 3RC4A 1TA2A 3R0FA 4UEHH 1QQUA 4NA7A 5GIBA 3SJ9A 2W3KA 1SQTA 3U69H 4KGAA 4AOQA 2QIQA 3JZ2B 1FPHH 4ZROA 1GJ7B 1T4UH 2SFAA 5JYIA 3LOXA 2PKSC 1O3IA 2BDCA 2FTMA 2RA3A 1TONA 3LIWA 1EJNA 4UDWH 3SI3H 2ZU2A 2PSXA 4YTAA 2PHBA 2FO9A 1MQ5A 4DIIH 2FOEA 1TQ7B 1GGDC 4A1VA 2A5IA 4TT3D 5T3HA 1ELCA 2A7HA 2FTLE 4Q7YA 1WBGB 3TGIE 2VIQA 1K1IA 2A1DB 2QGRA 1HRTH 1KTSB 1OWDA 3FANA 4UFDH 4IN2A 2BTCE 1O2KA 2HLCA 1HJAB 4UONA 3BIUH 1EOLA 4YM9A 1TNJA 5HIYA 4NIXA 5B6LA 1GHBF 2G55A 3OU0A 1OP0A 5GPIB 5FBEA 1O2LA 3P8OA 1S83A 2VVVA 2B7DH 1QRWA 4H6SB 2G5VA 3GCHC 3A81A 1O2VA 3ZZ9A 1EJAA 2J92A 3M35A 3KEEA 1B7XB 4IW4E 3RLYH 3MU1A 1SGYE 2Z6BD 4THNH 4JK6A 2Y82A 1ZMLA 2GZ7A 3T62A 1AIXH 1GI8B 1G32B 2SGPE 3RXVA 1W7GH 2KCOA 3K6YA 2VWOA 2HNTF 1C5WB 2AS9A 1BHXB 1QBNA 1F0SA 4K8YA 3K2UA 1BIOA 3KNXA 1AFQC 1G37A 2ZF0H 8GCHG 1O3PB 3TJVA 4D7GA 1AWFH 3SV7A 2OK5A 1PYTC 3SU1A 2AMQA 2HLDD 1FMGA 1DICA 1DLKB 3URCA 1WTGH 1ETSH 1TBRH 4AZ2B 1P03A 2VJ1A 3F6UH 4YLQH 1YGCH 4XSKU 2A5KA 3FP7E 3ZZ5A 9LPRA 2KFWA 4RKOB 5DP3A 4OS4A 2WPKS 3E91A 1THPB 4HTCH 4ABAA 5GWZA 1ZPZA 3GY7A 1FUJA 1P10A 1YKTA 2Y80A 1GMCF 1O3OA 2FP7B 1K1JA 2STBE 4ABFA 2NU1E 2ZFPH 4K5ZA 1P01A 3TH4H 4I32A 2H1UA 2OLGA 5EPYA 1TX7A 1TB6H 1N6XA 1GL1A 2IN2A 3F2GA 2J2UA 3F0PA 2ZCLP 3LGWA 4RSPA 5C5NA 1AZZA 7KMEH 1ZLRA 1QB6A 3NXPA 3DT0H 1GI9B 4YT6H 4GPGA 2V0BA 2WUBA 1NRQH 1UVTH 3EAJA 1DXWA 1LVYA 2KZ4A 3ZZ4A 2JKHA 5EJZA 2SGEE 4A1TA 1C5NH 2B8OH 3RXAA 1NY22 2FOHA 3A87A 1B0EA 2BHGA 2OC8A 2ZDLA 4MNYA 4F55A 1THRH 3M3SA 2IPQX 2CF8H 3RXKA 2C8ZB 2WZQA 1FY4A 1OYTH 4ABIA 8ESTE 1C2KA 1C1OA 1C5QA 1KTTB 2FOFA 3MYWA 3RXTA 1K22H 1UVPA 5DP4A 4Y10E 5A8ZA 4ZKRU 2FOAA 1QZ8A 1C5MD 1YC0A 2ESTE 1LVMA 1O5GH 5HMAA 2ZFTA 3RU4E 1UTLM 2YMSB 1UK4A 3RDZA 6GCHF 4FVBA 1F0UA 1GDUA 4AFSA 1SGEE 4JYVH 5HIZA 3RMMH 2CXVA 1TBZH 3AW0A 4CRGA 7ESTE 4OGXA 2A31A 1C2JA 1TLDA 1W0YH 2J98B 3SHCH 1C9PA 1C2HA 1INCA 1TWXB 3A8BA 3HPTB 2OCVB 4IMZA 1FQ3A 4WY3A 2F9PA 3ZVEA 3E8LA 2JH6D 1HCGA 1T4VH 2FEQH 3NK8A 2O8LA 2F9NA 2BVSH 3LGTA 5G4BA 3K65B 5TCAA 3SGAE 2KCAA 2C4FH 2H2ZA 3V12A 3PO1B 1VGCB 2ZHDA 4TSFD 4NIWA 2XXLA 3ESTA 3RUOA 2C8WB 5A8XA 3BG4C 1XUHA 1GJBB 1GBEA 2RCEA 2FX4A 1CHGA 2ZDKA 2ANWA 2ZTXA 2ZCKP 2HVXA 3BEFB 4ASHA 1AB9B 3UOUA 3OX7U 1PPHE 2XTTB 5IDKA 1YLDA 1GDNA 4DIHH 1PYTD 1COWD 2WPMS 3DFLA 1S6HA 1ANEA 2BQ7B 1A0LA 2FZZA 4YLUA 1AE8H 2KX4A 2V7QD 1CSOE 1AHTH 1QRXA 5F53A 2F9BH 1TGTA 2WPHS 1CT4E 4B6EA 1GCDA 2GCHG 5DPAA 1UTMA 3QTVH 1GI7B 1MD7A 1V6DA 3QZRA 4I8HA 3VB5A 4E06H 1Y5UT 3FVFB 3SU3A 4ABDA 1HAOH 2LELA 5GCHF 4LXBH 1BBRE 3T5FH 3LGUA 1G3DA 1TIOA 5I46H 2Z9JA 4A5TS 1RJXB 3SNBA 1SQRA 1Q3XA 2GT7A 1KXDA 3DA9B 1MTSA 5TJXA 2PWXA 3MU8A 4AGJA 1J14A 1FIWA 1GJ9B 1MMJN 3FO8D 4XD7D 4B73A 4TY7A 4X6PA 4MPVA 2HALA 2XW9A 1HGTH 1XMNB 4NCYA 1VITH 3ZZ7A 2J98A 2FESH 1MQ6A 3SV2H 1NRPH 4UFFH 2Z94A 3GDSA 1FONA 5L30H 1C5YB 2XBVA 4MPWA 1A5GH 1S6LA 1C5SA 2GD4B 2D26C 5PTPA 5BPEA 1ESBA 1P2MA 2A4RA 4WH6A 2XBWA 3SQHE 4P00A 1EAXA 1HJ8A 1HNEE 1TPSA 3OSYA 1TPOA 1LHCH 3SZNA 4X1NU 1K1LA 1KXBA 5DJ7A 4NIVA 1EUFA 2W5EA 3B9FH 2R0KA 1S6FA 3UB0A 1BCUH 3RLWH 3DSGA 3Q3YA 1D3QB 5EG4A 1LHFH 3M5NA 3QK1A 4Q7XA 3OY5U 5HM2A 5H4IB 3TNTA 2F91A 1WDIA 1GHYH 3NZIA 1KMHB 1GMHF 4YOIA 4Y11E 4B76A 2FS8A 3P92A 1EASA 4HGCA 1HBTH 3LT3A 1FAKH 3TJOA 1SGCA 2Q6DA 1QBOA 3TJUA 4BXWA 2VIVA 4TWWA 1GHBG 1NTPA 2ZNKH 1GJ5H 1TPAE 3HKJB 3QGJA 3Q3XA 4AC9A 1QL8A 1F5LA 3GISB 3RXGA 5FXLA 2CJIA 4A7IB 1BT7A 3TPIZ 1OPHB 4AX9H 2P95A 1BOQA 2BX3A 3UNRA 2HVYB 2VVUA 5C0UA 1OXGA 1ZSLA 1D9IA 1AI8H 2ZFSA 3V0XA 1KXAA 1O33A 1P57B 1KDQB 1Y3VA 3VB4A 1CBWC 2PLXA 3SOSA 1ANBA 1UTJA 3TGKE 1O32A 1IHSH 1O3EA 3K9XB 4ABHA 1H9IE 3VB3A 2CMYA 3GYLB 3P6ZB 4BAKB 3PV2A 3KCGH 1S84A 3LDXH 1TAWA 2WV5A 1EAIA 2FWWA 1HAXB 2UWPA 2NWNA 3RXFA 1CGJE 1CU1A 3T28A 3RMLH 5CHAB 4DJZB 1LHGH 1TFXA 1WOFA 3GCTF 2SGQE 3E1XB 3U28C 1BA8B 4BAMB 2FYRA 1S0QA 2OXSA 1C4Y2 1GMCG 4ABBA 4NWKA 3N99A 1C1NA 3F9EA 1SGQE 1GI3A 1Y3XA 3KF2A 1HPGA 2B9LA 2Y6TA 4ISIH 5C1UA 1ELTA 1TMTH 1YP9A 1C2FA 2QC2A 1FN8A 2HOBA 4AFUA 3PV4A 3BEUA 1DSTA 2Z3EA 1CT2E 3VFEA 5EJ1A 3QZQA 4AB9A 2GMTC 5EGMA 1E34B 1NRNH 4O03A 2GV7A 1ELBA 3UR6A 3BTTE 1AMHA 1E36B 2OQ5A 1UCYE 1Y3WA 1O3BA 5E2PA 1C9TA 2BMGB 3EQ0H 4TPYA 2W6ID 4X8TH 1C1QA 4FU8A 1TOCB 1MTNC 3PLKA 3M7UA 3T2NA 1SPJA 3SQEE 1N1LA 1RTFB 4LOYH 1GBTA 4FUIA 2FI5E 1ELAA 1KDQA 4AG2A 3ZYEA 2Q6GA 3OY6U 4X1PU 4NSYA 1P2OA 1DOJA 5EQSA 1SG8B 3A84A 4HI3A 3ZZDA 1LDTT 2GZ8A 3RXPA 3WWBA 1LKAA 1MU6B 4UD9H 2XCNA 2ZECA 2Y7ZA 1E38B 1NESE 4E7RG 3QO6A 2BY9X 2JETB 3LGVA 1UJ1A 3F9HA 1NT1A 1ZMNA 1GL0E 3SUEA 3M36A 2G00A 1ZHMA 4Y6DA 1TGBA 3SGQE 2PP6A 2NU0E 3RU4T 5JBTA 2Y7XA 2AYWA 3GY2A 2GT8A 3MU5A 3PRBA 2FDAA 2ZIQH 4Y76A 4AYVB 3SGBE 4DVAU 4YO9A 4CRBA 1G30B 2A5AA 1C2MA 1YLCA 4X1RU 3ZZ3A 2M2AA 6GCHG 2DUCA 1O2SA 2H6MA 4FUEA 1O5CB 4OS6A 3RXIA 1UO6A 3BTDE 4ISLA 2CN0H 4ESTE 1AVGH 2THFB 4IC6A 2VWMA 2VGCC 1BJVA 1C5ZB 3M7QA 1KSNA 3DSOA 2PTCE 2QN5T 1Z1IA 2JIZD 1B5GH 2KCPA 2CF9H 2K1QA 2FOGA 4A1XA 2JJ1D 1S82A 3VGCB 2V3HH 1ID5H 1PQ8A 1AUJA 1FLEE 3UFAA 4BXSA 2F4LA 1BHXF 3ATLA 3RP2A 2D1JA 2J95A 4XRNA 4VGCB 1O2RA 1UTNA 2P93A 5FBIA 3UIRA 1EB2A 5ETXA 3MQKC 2ZPSA 1YLNA 4FXGH 1BITA 1ZYOA 3ZZ8A 1ZOMA 2ZWLH 3VG8A 4ASUD 3D65E 4R0IA 1Z8IB 1BMMH 1H8HD 1T31A 1BTYA 2EA3A 5C5OA 4D9QA 4X8VH 1O2YA 1O31A 1V2ST 4JYUH 3P17H 1QJ7B 1O2PA 4KTCA 2HPQH 2QXIA 3A8DA 2WPLS 2G4UA 1O0DH 2V6NA 2A7JA 1AY6H 2J97A 4O3TA 3V13A 4OM9A 5GCHG 2XBYA 1XVMA 1Z8JB 3JZ1B 2Q6FA 1H8IH 1O39A 1UVUH 2YNBA 2D2DA 3OTPA 1O2UA 3D62A 2C8XB 4DOQA 2XBXA 2H5DA 2HPPH 1BMFD 2XC0A 1QNJA 2QXJA 5I25A 2GCTB 3SNDA 1OX1A 3SO3A 3HGNA 4MG3A 3TNSA 1QJ1B 1WCZA 2W3IA 1Z8GA 4XDEA 1TABE 1ACBE 3PWCA 4WVPE 1K28D 3CS7A 2F9VA 3BIVH 1H9HE 3MH6A 4CRDA 3QX5H 2QCYA 3UR9A 1WSSH 1SGTA 4IGDA 3W94A 3PROA 1ANCA 5C67A 4H42U 1FDPA 1ZHPA 2BD7A 1AVWA 4K69A 3FN8A 4X2YA 3A8AA 3UPEA 2CHAB 2F9UA 1C1WH 2Z9LA 3OE7D 1UTOA 2Z3CA 1W8BH 1AQ7A 4M7GA 4J2YB 1O3AA 3MU0A 3UUZA 3Q00A 2ULLA 1G36A 1GHAF 1T32A 2B0FA 2F43B 5T1VA 3U9AH 1WYKA 4GHQA 3NUMA 3TVJB 4KELA 1P9SA 3TH3H 4ZMAH 3OAAD 5EW2H 1EPTC 1MCTA 4FU9A 5B6OA 1LQEA 2SGFE 4MLFB 4X6MA 3RXOA 1GVKB 3SORA 3SU0A 1GMHG 2ZP0H 1BTWA 1OSSA 1MKWH 3VPKA 4Y71A 2EEKA 3U8TH 2QXHA 3S9AA 6CHAC 1TNLA 3TK5A 3NPSA 1O3KA 1C1MA 2ZQ2A 4FUGA 2BQWB 3BV9B 3U98H 3U1IB 2VIPA 2OC7A 1ZR0A 3PM3A 2RA0A 2VH0A 3DCLA 1Z7KA 1A1RA 3OEHD 4UE7H 2WSSD 5KGOA 1F5RA 2PTNA 4AYYB 4AFQA 1RFNA 1TOMH 3TK6A 1W12U 3TJNA 1E37B 4GAWA 2ZGJA 1O36A 1DUAA 1GJ4H 2A0QB 2RG3A 4XBCA 4NWLA 4AN7A 1MABB 1F2SE 1QA0A 1TNIA 1O5DH 1OOKB 2ZDNA 1ZRKA 3PTBA 4ZCNA 1GPZA 5CHBA 1V2QT 2BDIA 2AEIH 2LP6A 1C2DA 2BQ6B 3FAOA 2QE7D 3OYPA 2HNTC 1F7ZA 4ACBA 1D3DB 3FOAA 2AERH 2R3YA 2GP9B 1EX3A 1GBDA 2PR3A 1FAXA 3BG8A 4INHA 4Y0ZE 5J4QA 1RIWB 3P8FA 2BD3A 3URDA 2D8WA 4U01A 1GMDF 2PKSB 3SUGA 4X2WA 1MD8A 2OQUA 2BB4A 1PPGE 3ATWA 1Y5BT 3SN8A 1P9UA 1BBRH 1VGCC 1KXFA 1QHRB 3BTHE 3GOVB 1EP5A 3L33A 3A89A 2WUCA 2F3CE 3OTJE 1G3CA 1GBMA 1L1GA 1O2MA 1GBLA 2IOTA 3GCTG 1YPKH 2F9OA 2A32A 2O8MA 2C8YB 3A85A 1GGDB 2G8TA 4X2VA 4OGYA 3RXEA 1KLIH 1QTFA 1GBCA 3GDVA 4FUDA 4U30A 1SLXB 2STAE 1SMFE 3ATIA 3ZVAA 2OC0A 1VCPA 3SI4H 1LPGB 4WMEA 5A8YA 2Z9IA 2ZU5A 3UNSA 1YPLH 3ZVDA 1KXCA 2TIOA 3MH5A 2CK3D 2VBCA 4CRCA 2ILNA 1CVWH 5C20A 2K0QA 3KQDA 5DP6A 5T6GA 1HLTH 1Y8TA 4SGAE 5ESTE 1MCVA 5JPMH 3A7YA 1O30A 3VB7A 3GCHB 4FVDA 3A86A 3S9BA 2AMPA 4JCNA 2SGDE 4MNVA 3MNCA 4X6NA 2FIRH 4R8TB 4ZHLU 5L6NH 2RFKC 3WWFA 1UTKA 3G01A 1PPFE 1XUKA 1OWIA 1SFIA 3SZEA 4Y7AA 5E8EH 3A80A 1BJUA 3TLOA 4CHAC 1T8LA 1DS2E 3MH4A 1RS0A 2VH6A 5A2MH 1O2JA 1BMNH 1BTZA 1FJSA 3ELAH 3T25A 3UQOA 1O2WA 1JMOH 2W7SA 1NC6A 2H9HA 1AFQB 1DWDH 1V2MT 4AB8A 2ZO3H 1K1OA 2P3FH 5E0HA 7GCHF 1EZSC 2VVCA 3A7TA 1ORFA 1V2NT 2I6SA 4WXIA 1JXPA 3C27B 4E7NA 1FN6A 2PGBB 3I77A 2HNTE 2GX4A 4CREA 2JJ2D 3M61U 3M3TA 2FXRA 3SJKA 5CE1A 1C5LH 5JDUB 1O3HA 1TYNA 4YOJA 1BTXA 2ZDMA 4MTBA 5AF9H 1O37A 2ODPA 2H9EH 2P16A 3DUXH 9ESTA 1OKXA 2ASUB 2IPHA 1HAIH 1P02A 1DVAH 1GCTC 2Z3DA 3GCOA 3EA9A 2PFEA 2FYQA 2AGIX 2LPRA 2NU2E 1Y5AT 2BVXH 3CS0A 1XX9A 1N8OB 1O3JA 1MZDA 1TALA 3CENA 2AIPA 1XUFA 3LC3A 1OWKA 1H4WA 5E0GA 3PMAB 3GY6A 3SYJA 2NU4E 3GICB 2ALVA 2GJGA 2AH4X 4FOUC 4RI0A 2J94A 3AAUA 1ZPCA 3LH1A 1O2NA 3NCLA 1PQ7A 1K1MA 3UREA 1EAUA 5LPEA 1GJCB 1LVBA 1ZTJA 1ESTA 3N7DA 1P04A 3W1EA 3LKWA 3VXFH 1SGNE 1PQAA 4K8BA 2OUAA 2BZAA 1JIMA 2VB0A 4XBBA 2P3UB 2BXTH 3RC5A 1K21H 1MAYA 3F2HA 3RXRA 2FODA 5HXFA 2BY8X 4X2XA 1HYLA 3BTGE 1TPPA 1W0KD 2PUQH 3PMJA 4DCDA 2BD9A 3DHKH 2ZU4A 1DM4B 1BUIA 2OP9A 1GVZA 1H9LB 2BLOA 2CV3A 3UWJH 1VR1H 3DFJA 1J15A 1D3PB 2BY5X 1P05A 4BAOB 4B2AA 4LZ1H 1NU9A 3UTUH 1NS3A 1ARCA 1C2EA 1NM6A 1S85A 1P12E 2RDEA 3DSPA 1BRAA 1UK2A 1DUEA 1FPCH 1UCYH 2G5NA 4KTSA 4FUFA 1VITF 1HAYB 4GVUA 3CP7A 1BQYA 4DURA 1DWEH 2ZGCA 3AW1A 3EGKH 1O34A 1FNIA 5C17A 1CGIE 1K2I1 2FPZA 3LU9B 2FM2A 1V2LT 1YPMH 2QY0B 3MO9A 2FMJA 4ABGA 2QF4A 1ARBA 1GVLA 4B2BA 3H09A 3P70B 3N7OA 1J9CH 1SGPE 1BZXE 1FI8A 5EXLA 5K7RA 2ALPA 3SNCA 5L2ZH 1J17T 1P2NA 2A4GA 2AGEX 1ZZZA 1A0HB 1LHEH 1PPEE 1P11E 1BRUP 3OEED 2BVRH 1EAWA 4H6TA 1QIXB 1CA8B 3E0PB 1OWJA 2P8OC 3Q3KA 4Q63A 5DN6D 3BTWE 4HFPB 1MKXH 1TGNA 1GBFA 2V35A 1DE7H 4I31A 2XRCA 3RXQA 1GBKA 2TGDA 5GXPA 2R0LA 1DWCH 3SUFA 2VNTA 1IQIA 3PLBA 4H4FA 5J4SA 4QT8C 1A61H 2J9NA 2JDID 4JZFH 4GHTA 3MO6A 3LC5A 3A7WA 1TRYA 2BY7X 1RRKA 5HM9A 4A6LA 2V3MA 4F4OC 2ZKSA 1CO7E 4BAQB 2XOKD 3FFGA 1O3LA 2HRVA 3GY3A 3VXEH 2EC9H 5L2YH 4RKJB 1PJPA 1AE5A 3RXJA 8KME2 1SGFA 1CQQA 2L74A 3ZV8A 1FZZA 2QXGA 1W7XH 3RXSA 1J8AA 2ZFRH 1AFEH 1TX6A 5GJ4B 2XC5A 2F83A 5A0AE 3SU5A 2BDGA 1MUEB 5C1XA 4O9VA 4DT7B 4X6OA 3M5OA 1UTQA 1GJDB 2ZU1A 5ESBA 3C1KA 2GGVB 2ZHQH 1SFQB 4B71A 2BOKA 1S0RA 4WMDA 3RMOH 3ENSB 3TU7H 4JZIA 1IQMA 2GVFA 1A46H 1GBJA 1TA6A 2BDAA 3ZZCA 1GHVH 1SQOA 1QB1A 1UVSH 4DGJA 2ZFQH 1TMBH 4HZHA 4ZKNU 1DDJA 1SR5C 1LHDH 4XOJA 5AHGH 1XUJA 3BF6H 1C1RA 5JB9S 4ABEA 3MNXA 5CDFE 5SGAE 1GMDG 1C2LA 1FV9A 1WAYB 4DY7B 4IN1A 1GJAB 2VINA 1L1JA 1H8ED 1CA0B 3SJIA 2QF3A 4I8LA 2AMDA 4XBDA 5F8ZA 2O8WA 3KGPA 1ABJH 4BOHA 1W3CA 1WUNH 2ZEBA 4UFGH 1HB0B 2VIDA 4FUCA 2ZFFH 2C93B 1P2KA 3N7EA 4VGCC 2TBSA 3HK6B 1VKYA 5EXNA 1HDTH 3QLPH 1BMAA 1ZTLA 2A2QH 2BM2A 4YZUA 5DP7A 1TQ0B 3ZVCA 1BMLA 5EJLA 4BTUB 2O8UA 5C3NA 5A0CA 1PPCE 3PYHA 4MNWA 4OS5A 7LPRA 1GG6C 3KHVA 5EODA 5DP9A 2FLRH 2PV9B 1LTOA 1LO6A 2P3TB 1WXRA 1NFXA 1U6QA 1GBAA 2J4IA 5DGJA 3FZDA 3LGYA 3SV6A 3LJOA 1O3DA 2G52A 5LPFA 1O3GA 4KTUA 1FY5A 1W0ZU 2YNAA 5IK2D 1RGQA 1C5OH 3M3VA 1KLJH 4ZHAA 4Y7BA 5DSFA 3ZZ6A 1MTVA 5HYOA 1V2WT 2WPDD 2GCTC 5EW1H 2ZTZA 1IOEA 1DXPA 3ITIA 1JRTA 2ZQ1A 1TBQH 5AFYH 1YPGH 1VCQA 3RM2H 4IC5A 1DITH 1LPKB 1XM1A 3U8OH 3L6PA 3O8CA 3KQCA 2BDHA 1J16A 1ESAA 1PPBH 4KP0A 4I33A 1BDAA 1SKYE 2JH0D 3KL6A 1ZGIA 7GCHG 3AVZA 5EXMA 1AU8A 1EP6A 3O8BA 1OWHA 4Q7ZA 1OS8A 1WV7H 1YCPH 4Y79A 3A7VA 4U2WA 2UUFB 3UAIC 3BTKE 4GCHF 3ODFA 1OP2A 1HJAC 2J38A 1IQLA 1GBBA 4CH8B 3I78A 3HK3B 1EB1H 2WHXA 3PB1E 3KYFA 2SNVA 2VWNA 1AKSB 1EZQA 1E79D 1EATA 4NA8A 3SBKA 1EKBB 4NIYA 1V2KT 2XYAA 5DKMA 3RXBA 4NFFA 2UWOA 1O5FH 2J34A 3FZZA 3DD2H 4P02A 3STIA 3HGPA 3LGIA 1QFKH 4AG1A 1V2PT 1THSH 3KYGA 1A0JA 2UUKB 1IQFA 3CNRA 1TNKA 1SI5H 1UVOA 3KQ5A 2PW8H 1NROH 1EXFA 1UW7A 1XXFA 1O3NA 2GCHF 2GMTB 4SGBE 1C2IA 4X8SH 2UUJB 3KQEA 3GS9A 3PWBA 3BTQE 5LH8A 2ODYB 2TGAA 3H5CB 2WYJA 1CHOF 4O97A 1MTNB 2GDEH 1HJ9A 1Z8RA 3PMBB 1ETTH 4NG9H 3TGJE 3F9GA 1LQDB 3MTYA 1ZHRA 1T8OA 5EIYA 1QL7A 4BANB 4RT1A 5FPSA 2GZ9A 1QB9A 3LH3A 2A7CA 2BOHB 1FIZA 2HWLB 3WW7A 1SBWA 1C5TA 1H8DH 1RTLA 1W10U 5FCRA 5F03A 2OINA 3FP8E 1NFUA 1NZQH 2FI3E 4WWYA 1L0ZA 1MU8B 2DE8A 2IJOB 3A7XA 1RIWC 1ELGA 3ZVFA 4NZLA 3T26A 5CMXH 3RMNH 2M5TA 4AFZA 1VITG 1HXFH 1AWHB 4YXWD 1AKSA 3S7KB 4XFQA 3SW2B 4B6FA 2BD5A 4WH8A 3BEIB 4WXVA 1MBQA 2VGCB 4FETA 1A3EH 1C1UH 3LPRA 3TH2H 1DWBH 2FOBA 1TGCA 4Z0KA 4DG4A 3RXHA 2VIWA 1G3BA 1TE0A 2H5CA 2BD4A 4WJG2 1GDQA 1Q31A 4ZH8A 1VCWA 1A5IA 4ISOA 3EA7A 4UFEH 5F8XA 1YF4A 1SOZA 4IMQA 1EJMA 1V2VT 3PTNA 1MKWK 2KR7A 1V2TT 4ZXXH 2WINI 1ZTKA 4WF8A 1BB0B 1NFYA 2AFQB 1QURH 1LMWB 3ZZAA 3U1JB 1ZSKA 1WTHD 4AGKA 2PKAA 1C4V2 1E1QD 1GHZA 5DG6A 4D7FA 2Y5HA 3QDZB 1SQAA 3E6PH 5JBBS 4CBNA 1QR3E 3MH7A 1LVOA 2WV9A 1FXYA 3UNQA 1MZAA 1MBMA 2YMSC 2BD2A 3RXDA 2L6OA 1P2QA 1GI5A 2A4OA 5T6FA 6LPRA 5KEDA 2ZGBH 5FX5A 4HG6A 2R9PA 3AASA 4FUHA 2ZGXH 2FI4E 3SU4A 1WQVH 3QTOH 4ACAA 3QUMP 1AZ8A 3M7TA 2LNCA 3BTME 1O5BB 3PLPA 3GY4A 3PV5A 5A0BA 2EQNA 1GI2A 2SGAA 1OP8A 3PO1C 1BRBE 4GSOA 4ZAEA 1O2ZA 5IYTA 3IWMA 3MHWU 1BBRK 2VIOA 3P95A 5DK1A 2AIQA 4OS1A 2A4QA 2BYAX 2UWLA 1DX5M 1V2RT 4XE4A 3T27A 1AB9C 3VB6A 5T6DA 2VU8E 3LONA 4B75A 5JBAS 1K1PA 4ZHMU 4ISNA 4E05H 1N8OC 1QQ4A 2EI8A 4ZKOU 2BZ6H 1LCYA 3KN2A 4BTIB 3F68H 3GY5A 3VEQB 2Z7FE 2P59A 4U32A 1Y3UA 2QF0A 3E3TA 1NBME 1XUGA 4JZEH 1MH0A 2Z9GA 3UY9A 1OHHD 1EPTB 3ODDA 4A92A 1VJAU 3FKSD 2A2XH 3F2FA 5ABWA 1E0FD 1W13U 1NN6A 1Z6EA 1O38A 1YWUA 2ZTYA 2OTVA 4Y0YE 1SL3A 1AN1E 5F6MA 1DY9A 1N6YA 6CHAB 1ELDE 1ETRH 3H7OA 4JMYA 2OC1A 1ZRBA 5EU8A 2C3SA 4TPIZ 1JBUH 1XUIA 4DT4A 3I29A 3GY8A 1P2IA 1F92A 3O8DA 3Q76A 1NPMA 2XWBI 3ZZBA 3SHAH 2ZI2H 1XKAC 2QF5A 1NU7B 2R2WU 1NBMD 1GI4A 2ZPRA 4M9FA 1IQEA 1FY8E 2A45B 4TWYA 1Z6JH 1DLEA 2ZDAH 3SU2A 2GKVE 1QA7A 3SV8A 1TNHA 8LPRA 1UK3A 5FPTA 2ZHWH 1NRRH 1M9UA 2KAIB 4B1TA 2R2MB 3NRLA 4YESB 1PFXC 3QGNB 1IAUA 2J5UA 5JBCS 2DE9A 4GLYA 1QJ6B 3ZIAD 1O2GH 2FOMB 4CBOA 2BY6X 1T8NA 1C2GA 2ANMH 2I6QA 1GBHA 3QWCH 2EI6A 4I8GA 3UQVA 1YPEH 4PROA 1OYQA 4AORA 4FUJA 2Y5FA 1SLVB 1P3EA 2XC4A 3D49H 3MMGA 1C1PA 3MFJA 2BLWA 1NFWA 1TRNA 3AAVA 1CE5A 4NZQA 1SSXA 4MQAA 3E90B 1SHYA 3AK5A 1DANH 3GCNA 3V3MA 1OWEA 1TRMA 2UUYA 1EPTA 4GCHG 4I8KA 3KQBA 4IS5A 2YMSD 3U8RH 3SNAA 3A88A 5E2OA 1LKBA 2AGGX 3HKIB 1AO5A 1LPZB 3SUDA 2VWLA 3RU4D 5EQRA 5K0HA 4MPUA 3UOPA 1HAVB 1F0TA 5FX6A 1GJ6A 2XNIA 3P8NA 1CGHA
chains in the Genus database with same CATH topology
1C4U2 2OBQA 5AVDA 5C2ZA 4ABJA 3B23B 3ZYDA 1QL9A 1D4PB 1G2MA 4MNXA 1AUTC 2QV1A 4Y8XA 4Q80A 5HGGA 4IBLH 2W26A 1FY1A 1TMUH 5JB8S 1GJ8B 4CR9A 1H1BA 1HAGE 1ZJKA 3QN7A 3S0NA 1JWTA 1A4WH 2WV4A 4GUXA 1CHOG 2KAIA 3M5MA 1RTKA 1S5SA 1VZQH 2FX6A 1QGFA 1QRZA 3ZVGA 4MDSA 2WYGA 3RXMA 1GI1A 4K3JA 4YOGA 4F49A 1NO9H 1IHTH 2ZDVH 1GHWH 1SVPA 3MWIU 1JOUB 2OBOA 3SJOA 1HFDA 1G3EA 3K6ZA 2BXUH 1SOTA 5DP8A 3R3GB 1ELEE 5CHAC 1WU1A 4CHAB 4I7YH 4INKA 1C1SA 2TRMA 2Y81A 3A82A 2O8TA 2P94A 3E16B 1O2IA 1UCYK 1P0SH 1RD3B 2ZG0H 3STJA 1BTUA 3GYMA 1EOJA 2ZHEH 4CR5A 4MVNA 4K2YA 4B2CA 3EA8A 2B5TB 1ZPBA 1AVXA 1P06A 2WPJS 1FY3A 1IQGA 1CA0C 2ZZUH 2BD8A 4B74A 1O3MA 4TY6A 2TGPZ 1GHAG 4ZXYH 1E35B 1HAVA 4K1EA 3BG4B 1YPJH 1RXPA 2ZGHA 3SJ8A 1GCTB 3SV9A 2BDYA 1SC8U 1SGRE 1SLWB 3M5LA 3RC6A 1AGJA 3BTEE 1ANDA 2OD3B 3ATKA 1ELFA 1TGSZ 5LPRA 3ATMA 2GTBA 2PGQB 2V3OH 1V2OT 2ZCHP 4CRAA 4X1QU 2GV6A 1MKXK 1HXEH 2SNWA 2Z9KA 5AFZH 1T8MA 3TK9A 5F8TA 2BLVA 1MTUA 5TCCA 1O3CA 1O2TA 3B8JA 1QCPA 1ZMJA 1YCPM 1IQHA 3MI4A 4I8JA 1YPHC 5EQQA 2BDBA 1T7CA 3TITA 1IQKA 4JZ1A 4ZUHA 1XXDA 3P8GA 1IQNA 2JETC 5FPYA 1O3FA 1TX8A 1DSUA 4NA9H 5A09A 1L4DA 1L1NA 1GI0A 1O2XA 3V7TA 5DP5A 4O3UA 4ZKSU 4CH2B 8GCHF 3MU4A 1PQ5A 2NU3E 4BTTB 3H7TA 1HIAB 1ZJDA 1WQSA 3BSQA 1P2JA 3MNSA 2ODQA 1P3CA 1SGIB 4JYTA 1QBVH 3RXCA 4BNRA 3IG6B 3S69A 2FS9A 3IITA 5EOKA 2EI7A 3GDUA 4K1TA 4WMFA 1L2EA 3S7HB 4J1YA 5GDSH 4RN6A 1Y3YA 3W95A 1L4ZA 3MO3A 1XKBC 4Y8YA 1C5VA 1O35A 3EE0B 5FCKA 1CT0E 1W11U 1SLUB 3E0NB 3FP6E 1EQ9A 1UMAH 3Q77A 3ZVBA 2ZPQA 3VGCC 1GHXH 2PUXB 1AD8H 2Q1JA 1KXEA 1KYNA 3EDXB 4BAHB 5C1YA 1V2UT 3SNEA 2PSYA 1S81A 2Y5GA 4OS7A 4KKDA 3L3TA 5FHTA 4X1SU 1F0RA 1HV7A 1DPOA 1P09A 2CGAA 3T29A 4X8UH 1SHHB 4NSVA 1C5UA 1NRSH 1SB1H 1A2CH 2TGTA 1DT2A 1HUTH 4ISHH 1PPZA 3TIUA 2P8OB 3M37A 2ZU3A 2XWAA 2G4TA 3RXLA 5E0JA 3ZV9A 4YT7H 1B0FA 1DY8A 1F5KU 1YYY1 1KIGH 1HAPH 1HIAA 1BTPA 2ANYA 2YOLA 3F9FA 1A7SA 1SGFG 1UHBB 4K60A 1Z71A 2QA9E 4Z6AH 1W14U 4LZ4B 1GI6A 1C1VH 1YPHE 2GDDA 2ZHFH 2QAAA 5BRRE 6ESTA 3UWIA 2R3UA 4MPXA 1C5PA 3A83A 1O5EH 1KLTA 3RM0H 1CBWB 1BTHH 2TPIZ 4Y8ZA 1GBIA 1O2OA 1UTPA 2JH5D 4X0WU 1Y59T 1P8VC 1V3XA 2QYIA 4DW2U 1C1TA 3PMHB 1QY6A 2CHAC 2FLBH 3F1SB 2C90B 3MOCA 1O5AB 1JIRA 1TNGA 2ZC9H 2G81E 3SU6A 1Z1JA 4JZDH 5FAHA 2BLQA 1YCPK 4FUBA 2RDLA 3EYDA 1ELVA 1EZUC 1SGDE 1EZXC 2G51A 3O8RA 1ZGVA 4FU7A 2XCFA 4NFEA 5DO4H 3A8CA 3WY8A 1G2LA 2ZA5A 1D3TB 4INLA 1KY9A 4JK5A 1HAZB 4D9RA 1K1NA 3D23A 4NGAH 1D6WA 4OS2A 1O2QA 1MAXA 1X7AC 5EPNA 1G9IE 1IQJA 1DFPA 2W7UA 1YM0A 4TYDA 1UHBA 3HATH 2H9TH 4D76A 3NKKA 1V2JT 1W2KH 1C5XB 4CRFA 2HGTH 3NWUA 1HAHH 1YBWA 1VJ9U 1Q2WA 1A5HA 1JRSA 1BRCE 1K9OE 1GWAA 3S9CA 3BTFE 3RXUA 1MTWA 1A3BH 5LGOA 1GG6B 1ZSJA 2FOCA 2O9QA 1C5RA 3LJJA 1XVOA 2PKAB 3KIDU 4K1SA 1ABIH 3A7ZA 2ANKH 2BX4A 4D8NA 4Q2KA 2WPIS 3BN9A 3MNBA 1O2HA 4LK4A 1D6RA 3RC4A 1TA2A 3R0FA 4UEHH 1QQUA 4NA7A 5GIBA 3SJ9A 2W3KA 1SQTA 3U69H 4KGAA 4AOQA 2QIQA 3JZ2B 1FPHH 4ZROA 1GJ7B 1T4UH 2SFAA 5JYIA 3LOXA 2PKSC 1O3IA 2BDCA 2FTMA 2RA3A 1TONA 3LIWA 1EJNA 4UDWH 3SI3H 2ZU2A 2PSXA 4YTAA 2PHBA 2FO9A 1MQ5A 4DIIH 2FOEA 1TQ7B 1GGDC 4A1VA 2A5IA 5T3HA 1ELCA 2A7HA 2FTLE 4Q7YA 1WBGB 3TGIE 2VIQA 1K1IA 2A1DB 2QGRA 1HRTH 1KTSB 1OWDA 3FANA 4UFDH 4IN2A 2BTCE 1O2KA 2HLCA 1HJAB 4UONA 3BIUH 1EOLA 4YM9A 1TNJA 4NIXA 1GHBF 2G55A 3OU0A 1OP0A 5GPIB 5FBEA 1O2LA 3P8OA 1S83A 2VVVA 2B7DH 1QRWA 4H6SB 2G5VA 3GCHC 3A81A 1O2VA 3ZZ9A 1EJAA 2J92A 3M35A 3KEEA 1B7XB 4IW4E 3RLYH 3MU1A 1SGYE 2Z6BD 4THNH 4JK6A 2Y82A 1ZMLA 2GZ7A 3T62A 1AIXH 1GI8B 1G32B 2SGPE 3RXVA 1W7GH 3K6YA 2VWOA 2HNTF 1C5WB 2AS9A 1BHXB 1QBNA 1F0SA 4K8YA 3K2UA 1BIOA 3KNXA 1AFQC 1G37A 2ZF0H 8GCHG 1O3PB 3TJVA 4D7GA 1AWFH 3SV7A 1PYTC 3SU1A 2AMQA 1FMGA 1DICA 1DLKB 3URCA 1WTGH 1ETSH 1TBRH 4AZ2B 1P03A 2VJ1A 3F6UH 4YLQH 1YGCH 4XSKU 2A5KA 3FP7E 3ZZ5A 9LPRA 4RKOB 5DP3A 4OS4A 2WPKS 3E91A 1THPB 4HTCH 4ABAA 5GWZA 1ZPZA 3GY7A 1FUJA 1P10A 1YKTA 2Y80A 1GMCF 1O3OA 2FP7B 1K1JA 2STBE 4ABFA 2NU1E 2ZFPH 4K5ZA 1P01A 3TH4H 4I32A 2H1UA 2OLGA 5EPYA 1TX7A 1TB6H 1N6XA 1GL1A 2IN2A 2J2UA 2ZCLP 3LGWA 4RSPA 5C5NA 1AZZA 7KMEH 1ZLRA 1QB6A 3NXPA 3DT0H 1GI9B 4YT6H 4GPGA 2V0BA 2WUBA 1NRQH 1UVTH 3EAJA 1DXWA 1LVYA 3ZZ4A 2JKHA 2SGEE 4A1TA 1C5NH 2B8OH 3RXAA 1NY22 2FOHA 3A87A 1B0EA 2BHGA 2OC8A 2ZDLA 4MNYA 1THRH 3M3SA 2CF8H 3RXKA 2C8ZB 8ESTE 1FY4A 1OYTH 4ABIA 1C2KA 1C1OA 1C5QA 1KTTB 2FOFA 3MYWA 3RXTA 1K22H 1UVPA 5DP4A 4Y10E 5A8ZA 4ZKRU 2FOAA 1C5MD 1YC0A 2ESTE 1LVMA 1O5GH 5HMAA 2ZFTA 3RU4E 1UTLM 1UK4A 3RDZA 6GCHF 4FVBA 1F0UA 1GDUA 4AFSA 1SGEE 4JYVH 3RMMH 2CXVA 1TBZH 3AW0A 4CRGA 7ESTE 4OGXA 2A31A 1C2JA 1TLDA 1W0YH 3SHCH 1C9PA 1C2HA 1INCA 1TWXB 3A8BA 3HPTB 2OCVB 4IMZA 1FQ3A 4WY3A 2F9PA 3ZVEA 3E8LA 2JH6D 1HCGA 1T4VH 2FEQH 3NK8A 2O8LA 2F9NA 2BVSH 3LGTA 5G4BA 3K65B 5TCAA 3SGAE 2C4FH 2H2ZA 3V12A 3PO1B 1VGCB 2ZHDA 4NIWA 2XXLA 3ESTA 3RUOA 2C8WB 5A8XA 3BG4C 1XUHA 1GJBB 1GBEA 2RCEA 2FX4A 1CHGA 2ZDKA 2ANWA 2ZTXA 2ZCKP 2HVXA 3BEFB 4ASHA 1AB9B 3UOUA 3OX7U 1PPHE 2XTTB 5IDKA 1YLDA 1GDNA 4DIHH 1PYTD 2WPMS 3DFLA 1S6HA 1ANEA 2BQ7B 1A0LA 2FZZA 4YLUA 1AE8H 1CSOE 1AHTH 1QRXA 2F9BH 1TGTA 2WPHS 1CT4E 1GCDA 2GCHG 5DPAA 1UTMA 3QTVH 1GI7B 1MD7A 1V6DA 3QZRA 4I8HA 3VB5A 4E06H 1Y5UT 3FVFB 3SU3A 4ABDA 1HAOH 5GCHF 4LXBH 1BBRE 3T5FH 3LGUA 1G3DA 1TIOA 5I46H 2Z9JA 4A5TS 1RJXB 3SNBA 1Q3XA 2GT7A 1KXDA 3DA9B 1MTSA 5TJXA 2PWXA 3MU8A 4AGJA 1J14A 1FIWA 1GJ9B 1MMJN 4B73A 4TY7A 4X6PA 4MPVA 2HALA 2XW9A 1HGTH 1XMNB 4NCYA 1VITH 3ZZ7A 2FESH 1MQ6A 3SV2H 1NRPH 4UFFH 2Z94A 3GDSA 1FONA 5L30H 1C5YB 2XBVA 4MPWA 1A5GH 2GD4B 1C5SA 2D26C 5PTPA 5BPEA 1ESBA 1P2MA 2A4RA 4WH6A 2XBWA 3SQHE 1EAXA 1HJ8A 1HNEE 1TPSA 3OSYA 1TPOA 1LHCH 3SZNA 4X1NU 1K1LA 1KXBA 5DJ7A 4NIVA 1EUFA 2W5EA 3B9FH 2R0KA 1S6FA 1BCUH 3RLWH 3Q3YA 1D3QB 5EG4A 1LHFH 3M5NA 3QK1A 4Q7XA 3OY5U 5HM2A 5H4IB 3TNTA 2F91A 1GHYH 3NZIA 1GMHF 4YOIA 4Y11E 4B76A 2FS8A 3P92A 1EASA 4HGCA 1HBTH 3LT3A 1FAKH 3TJOA 1SGCA 2Q6DA 1QBOA 3TJUA 4BXWA 2VIVA 4TWWA 1GHBG 1NTPA 2ZNKH 1GJ5H 1TPAE 3HKJB 3QGJA 3Q3XA 1QL8A 1F5LA 3GISB 3RXGA 5FXLA 2CJIA 4A7IB 1BT7A 3TPIZ 1OPHB 4AX9H 2P95A 1BOQA 2BX3A 3UNRA 2VVUA 1OXGA 1ZSLA 1D9IA 1AI8H 2ZFSA 3V0XA 1KXAA 1O33A 1P57B 1KDQB 1Y3VA 3VB4A 1CBWC 2PLXA 3SOSA 1ANBA 1UTJA 3TGKE 1O32A 1IHSH 1O3EA 3K9XB 4ABHA 1H9IE 3VB3A 2CMYA 3GYLB 3P6ZB 4BAKB 3KCGH 1S84A 3LDXH 1TAWA 2WV5A 1EAIA 2FWWA 1HAXB 2UWPA 2NWNA 3RXFA 1CGJE 1CU1A 3T28A 3RMLH 5CHAB 4DJZB 1LHGH 1TFXA 1WOFA 3GCTF 2SGQE 3E1XB 1BA8B 4BAMB 2FYRA 1S0QA 2OXSA 1C4Y2 1GMCG 4ABBA 4NWKA 1C1NA 3F9EA 1SGQE 1GI3A 1Y3XA 3KF2A 1HPGA 2B9LA 2Y6TA 4ISIH 5C1UA 1ELTA 1TMTH 1YP9A 1C2FA 2QC2A 1FN8A 2HOBA 4AFUA 3PV4A 3BEUA 1DSTA 2Z3EA 1CT2E 3VFEA 3QZQA 4AB9A 2GMTC 5EGMA 1E34B 1NRNH 4O03A 2GV7A 1ELBA 3UR6A 3BTTE 1AMHA 1E36B 2OQ5A 1UCYE 1Y3WA 1O3BA 5E2PA 1C9TA 2BMGB 3EQ0H 4TPYA 4X8TH 1C1QA 4FU8A 1TOCB 1MTNC 3PLKA 3M7UA 3T2NA 1SPJA 3SQEE 1N1LA 1RTFB 4LOYH 1GBTA 4FUIA 2FI5E 1ELAA 1KDQA 4AG2A 3ZYEA 2Q6GA 3OY6U 4X1PU 4NSYA 1P2OA 1DOJA 5EQSA 1SG8B 3A84A 4HI3A 3ZZDA 1LDTT 2GZ8A 3RXPA 1LKAA 1MU6B 4UD9H 2XCNA 2ZECA 2Y7ZA 1E38B 1NESE 4E7RG 3QO6A 2BY9X 2JETB 3LGVA 1UJ1A 3F9HA 1NT1A 1ZMNA 1GL0E 3SUEA 3M36A 2G00A 1ZHMA 4Y6DA 1TGBA 3SGQE 5JBTA 2NU0E 3RU4T 2Y7XA 2AYWA 3GY2A 2GT8A 3MU5A 2FDAA 2ZIQH 4Y76A 4AYVB 3SGBE 4DVAU 4YO9A 4CRBA 1G30B 2A5AA 1C2MA 1YLCA 4X1RU 3ZZ3A 6GCHG 2DUCA 1O2SA 2H6MA 4FUEA 1O5CB 4OS6A 3RXIA 1UO6A 3BTDE 4ISLA 2CN0H 4ESTE 1AVGH 2THFB 4IC6A 2VWMA 2VGCC 1BJVA 1C5ZB 3M7QA 1KSNA 2PTCE 2QN5T 1Z1IA 1B5GH 2CF9H 2K1QA 2FOGA 4A1XA 1S82A 3VGCB 2V3HH 1ID5H 1PQ8A 1AUJA 1FLEE 3UFAA 4BXSA 1BHXF 3ATLA 3RP2A 2D1JA 2J95A 4VGCB 1O2RA 1UTNA 2P93A 5FBIA 3UIRA 1EB2A 5ETXA 2ZPSA 4FXGH 1BITA 1ZYOA 3ZZ8A 1ZOMA 2ZWLH 3D65E 4R0IA 1Z8IB 1BMMH 1T31A 1BTYA 2EA3A 5C5OA 4D9QA 4X8VH 1O2YA 1O31A 1V2ST 4JYUH 3P17H 1QJ7B 1O2PA 4KTCA 2HPQH 2QXIA 3A8DA 2WPLS 2G4UA 1O0DH 2V6NA 2A7JA 1AY6H 4O3TA 3V13A 5GCHG 2XBYA 1XVMA 1Z8JB 3JZ1B 2Q6FA 1H8IH 1O39A 1UVUH 2YNBA 2D2DA 1O2UA 3D62A 2C8XB 4DOQA 2XBXA 2H5DA 2HPPH 2XC0A