5GIRA

Crystal structure of a fab fragment with its ligand peptide
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
213
structure length
207
Chain Sequence
EVQLQQPGAELVRPGASVKLSCKASGYTFTSYWMNWVKQRPGQGLECIGMIHPSDGETRLNQKFKDKATLTLDKSSSTAYMQLSSPTSEDSAVYYCTTHFDYWGQGTTLTVSSAKTTAPSVYPLAPVCSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for multi-specific peptide recognition by the anti-IDH1/2 monoclonal antibody, MsMab-1.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Heavy chain of Fab fragment
total genus 44
structure length 207
sequence length 213
chains with identical sequence H
ec nomenclature
pdb deposition date 2016-06-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5girA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5girA02
4FQLL 4J3UA 4P3DA 4QRTB 5KJRH 2OCFD 3TO2A 5I75B 1JPSH 4UTAL 4BZ1L 3O4LD 4IOSD 3OGOE 4U1LB 5K33A 4HJJL 5FUZH 4LRIA 3CMOH 5ESQA 3VRLE 3D9AL 2R1WA 1A7NL 1SHMA 3ARSA 2WBWB 4PJHF 2XNAA 1KNOB 1UJ3A 1I8MA 4PJHA 4RQQB 2P8LA 1OM3L 1KCLA 2JK5A 3GI9H 2A6KB 1BD2D 4OTXL 1M05B 2OL3L 5H94B 1NANI 1OVZA 1J9CT 1CGWA 4RAHA 4K9EH 1LK3H 1OCWH 2NY6B 4X6BB 4PJAB 1K4DA 3SJVD 5HDQL 32C2A 1IC7L 2BSRB 2WWMC 3BP4A 3B9VA 5FM5O 5IIEA 5CD3A 3V6ZA 4CVWA 2ERJC 1TQBC 2A6KA 2O5YH 4KQ4H 5F96H 3X14B 2MOVA 2C3VB 4JKLA 2F8XC 1DBKL 2ADFL 1I7RB 3AMKA 3F7PC 2X4RA 4ISVB 2IG2L 4HPOL 1IGIH 4RDQF 5EO0B 4PJBA 4TRPL 1RMFH 1MJ8L 2GT9A 2BY0A 2ERJB 1KJ2B 1RFDH 1JUFA 4DUVA 1YYLH 1TENA 4HJGA 4WGWB 1I85C 4QXGH 4KDTC 3ZLQC 1WFNA 4XBGA 1YEDB 3UPCA 4HQQL 4IRSA 1QLFA 4Z7UA 4I9WD 4QOKB 5D1XB 3T0XA 4KMQA 4EN3A 3O6FC 2ITDB 3CX5J 4LCYA 1RUPH 1I1CA 3ARWA 5J13C 5BS0E 4AMKH 1ZT1A 4HCRH 4ZPVB 5T33H 1OAXL 1NMAL 3FFCD 2AJYH 5GGSA 4UNVA 4PJAF 5ICYB 4PS4H 3P0YL 3QIWD 4YBQD 2X4PA 3CVHB 4LFHG 4Y2DD 5C0AD 1Z2KA 3QXWA 3H3PH 4U33A 4Q9QH 1NMCC 2N1KA 4LLVB 4GAJH 1RURL 4NKDA 5B39G 3RGVD 1F6AB 3HUJA 4G6AD 4LHUB 4MCZA 5EO9B 4L9DA 5F7KC 4XPTH 2AAVA 4MCYB 3WFHA 5IMKA 3QHZL 1TTGA 1U3HB 3B2UC 5T3ZL 3VFRA 5CJ8A 3JV4A 4PJ8D 1YUHB 2PTTB 3DX9B 4NN5B 4U1LA 2XWTA 2XZCL 1QFWL 1P4LB 3FFCE 5HYSB 4BQ9A 4JRXB 4WI3A 1OHQA 3MO1B 1IAIM 1WIOA 5JW3H 2NW2A 1JGLL 1JYWA 4O2EB 3T8XA 4JFFA 2G75A 4KHXH 2FJHA 4MB5A 3TJEH 4OF6A 5DJCA 3H3KA 4WI6A 4WW1B 1AY1L 2H32B 3M1BB 3DPBA 3B8SA 1M7DA 1SEBB 3VG9C 1KPUB 4J12A 1U8LA 1PEWA 2K9UA 3HE6C 5INDB 3QDAA 3P9WB 3R4DA 4DQOL 1YMME 1A3RH 3WS6C 1SY6H 4OM1H 1P7QB 4TOYH 1SYSA 1P7KB 1JFQL 4E41A 3MXWL 1JGUH 4WNQB 4FQ1H 3G5ZA 1IGJA 4OF0A 3UZVB 1QOKA 5MERA 3MV8B 2QQKL 4PB0L 4PRID 4N0FA 3OR7A 2VIRB 5J4MA 3UTSA 5EC2B 5JHDB 3G6JE 5DJ8B 1QRNA 5C08D 1T1WA 3BIAX 1LO0L 1KLUA 5DMIH 3TFKD 3L9RA 5BXFA 2KL6A 4HUXA 4MVBC 4UILL 4U3HA 3I9GH 3LRSA 3GMLA 1MSPA 2X9YA 3QISA 4YLQT 1IGTB 1DDHA 5FO8B 1R3KB 5J57B 4JGMA 1YEFH 3U9PL 3RI5K 5C07E 5E2TL 5DVMA 5F70A 1T5XA 1QBML 4MA3A 3MLXH 1A7OH 4PJXB 4G8EB 1FL6A 1G9ML 1E28B 2XT1B 3AVEA 4TSBL 5L7XL 3P4LA 3ARPA 4YDJA 3X3FL 2OJZH 3L1OL 1D5ZB 1F58L 3QT2A 5I73C 1VPOH 2R4SL 4GBXD 1SJVA 3SDCB 1FNHA 2UZXB 3QXDA 3N9GL 2BDNH 4I3RL 4OZIA 4TVPD 1Q94A 4L8SC 2I5YL 3GSVA 4PJGE 5H94A 3ESUF 3L5XH 4UB0L 3CFIC 1PG7X 1X5ZA 3DO3A 4XC3L 4ZQKB 4KUZL 4BH8B 5C0NC 3PP4L 2FSEB 4XCFL 5DC0A 1T20A 2DQJL 3JWOH 1OGAA 3GHEL 3MLWL 3UC0L 3PWPD 3VFGH 5EU4B 4R96A 3MCKB 4OQTH 2V7HB 3VFSA 4OLZH 4Y4FA 3HLAA 3PUCA 2IMNA 4G9FB 1DVFC 5C70A 1XIWD 2ARWA 2UZYB 2VLLB 1H5BA 1DQDH 1TTUA 3CUPA 4GW5B 5BRZA 1MJJA 4I13B 1FYTE 1JV5A 4NWTH 3V6BR 4JJ5B 4PJEA 5BVJA 5IMMB 1EA9C 2KH2B 2Q6WA 1FL3B 3VA6A 5IB4A 1CLZH 4R26L 5C6WH 2DLFH 3FT3A 2OK0L 4P3WA 1WAAF 4HBCL 5BS0D 5FDWB 1CICD 2VB5A 4GXUM 4ONHA 4PJ5E 4XP4H 4BSWA 5FYJE 5HI4C 4KI5F 4S1QH 1JNLL 3WSQL 4QCIB 1INEH 3ZL4L 5DRWA 2P43B 4CAGA 4L9LB 3NFSH 1ORSA 1ONQA 4P2RE 4ODWA 2WP3T 1V7NL 4JFQA 4HUWB 4YX2H 4NFCA 2A74B 2X7LA 4TSAL 1J0JA 4FQXD 3RDTA 1FVEA 3V8OA 5D1ZB 1UH3A 2YXFA 1HHKA 2VISA 1X5XA 2R9HC 3M17B 3QEUB 3N1QC 1EUTA 4PGZA 4WI7A 2XQYG 3PJSA 3TPKA 1XCQB 5EU6D 2V17H 4KKAD 3SE8L 2P8PB 3V4PL 4UTAH 1VHPA 1ZWIB 3I02B 1XGQA 2FLBT 4D9RD 3IB4A 2GUOB 3EYFA 3P4OA 1ZHNB 1A7NH 1IKNC 1OP5H 3D39D 5E8EB 1SBSH 2N7AA 1HYSD 2W0PA 3TWCH 1INDH 4OFYD 5KW9L 1EPFA 2ICWB 1JF1A 1LP9F 2BHUA 5FYKD 2EZ0C 3EO9L 2PNDA 3EYVB 4DGIL 4L8BB 1OCWL 4G80A 1N3NA 4ZTPH 5ABDE 3H6JA 5KANI 4LHUD 3LPGA 4NNXA 5D2LE 1I1AA 4HFUL 5F7DB 5J11B 5C0AB 2MKWA 3VI4E 1QSEA 4K94H 2VN7A 4X4XB 5T1KA 3LQZB 3TIEA 3BIKB 5KTEH 2FX7L 4HIXL 1OAYH 3QUMA 3CVIL 1BECA 3MLSH 4Q9CA 1MREL 3BXNA 1IT9L 3MNVA 4NDMB 3NA9L 2E5EA 4NOFA 5AD0A 1YYLL 4IOIA 5C07D 1F11B 3DETC 5EIIB 1V3JA 4MNHA 4P2YA 1JZ6A 1K8IA 3ULVL 1X7QB 4BUGA 5HBBA 1OTTD 1JHLL 1WK0A 3KR3L 2CMRL 2D0GA 4BQ6A 4WDIA 3QIUD 5HTSA 1XF2B 1FZKA 3UBXG 4X8XA 4NRXA 3RTQD 4D0DB 2CXGA 1TZIA 2ZUYA 2PYFB 3BH9B 5IEHA 5JHLH 1OAQL 4R0LB 1VFBA 2A6IB 1NGXA 1F13A 5EOQH 1KCRH 4J6RH 3SN6N 4G42A 4MSWB 3GO1H 1RZFH 4R8WL 3GMNB 4X9BA 3NN8A 1DUZA 5J13B 2YD1A 4H88L 2XACC 3GK8L 3VD7A 1FL5A 4JDZB 2C9AA 5JA9A 3KPLA 3FZUC 4U1SA 1LDSA 3DX8B 3HZVB 1RK1B 5B8CB 4IIQB 2GTWA 3VXRB 5IVZA 5I8OH 1EGJH 3VI3F 5BW7A 1CL7H 1PG7W 2PW2B 2CDFA 5H2BA 1T3FB 4LARH 1V7ML 4Y19B 3IDYB 3GM0A 4PJFE 5CUSH 4Z76B 1IFHL 5ACZB 5DD0L 5DMYA 2VUOA 4XH2A 1QFWI 2DWEB 1T4KB 3K4ZA 4ORGB 3RDTC 3DV6B 1H3XA 1VFUA 4XXCC 3AS1A 5DD3H 1A5FL 5BJTA 1ROWA 2CRYA 3UXFA 1QKZL 5GGVY 1Z9MA 4WHTA 3WUWG 4P4RB 4MS8C 5HYJA 4P2OB 4M6NL 1EIBA 4OM1L 2AEQL 2H2SD 2J88H 5IW6B 1JFQH 4PGCA 3MXWH 5FYJU 1AFVL 1JGUL 4FQ1L 3FRPA 4WHYG 1KIQB 5FCSH 5K9QG 1CDGA 1BQHG 1ZKAA 4ONGH 5A2JH 4YDKH 2VAAB 3B9AA 1YN6B 1E0OB 3NFPB 5E03A 3IDMB 4JAMA 4PP2A 5I15H 2COQA 2KQMA 4R97B 1HE7A 7CGTA 2X05A 4BK5A 5MHSE 1E27A 1S78D 4IRJC 4KK8C 4KUCD 4K8RH 1CGXA 4CVZB 2YZ8A 5E6YA 1D7FA 1QA9B 5B38A 3FCTA 1TNMA 4LSPH 5EO9A 2DIAA 2R1XA 5CP7A 3VXNA 3DROA 1T66C 1VEMA 3FQNA 5DUPH 1BX2B 5IHLB 3HCVB 1YEFL 4ZSOB 2D9QB 3R0MA 1MUJB 4Y2DC 5E2TH 1BP3B 3AGVA 4Z7QF 5DI8A 3LKQA 3G6AB 4RWYH 4FS0A 2X89D 1L9MA 2EEDA 4WUUB 2OJZL 4NNPL 2AEIT 5DZLA 3B9DA 5L9DH 4QHKI 1LQSR 2RHEA 1BEYL 4L3AA 3OZ9L 5D7LA 4P23C 4HJGB 5HHXL 4BZ2L 4NNYA 3JV6A 1JGDA 1G7JA 3OKYA 1HI6B 4RAUA 4OZGA 2FBJH 4DUWA 5EO0A 4F58L 1XZ0B 4UT7H 2Y1VA 1G7LA 3KYOB 2VLKB 2YK1H 5HHNB 4KUZH 3V5DB 4MAYC 1J0KA 1U9KA 1U92B 1W8NA 2WBJD 2X4TB 2YEZA 3GHEH 2ESVE 4ZFZA 2X5PA 3NIFE 4LHJB 5AWNL 2XTJE 3CIQA 4OLZL 3KPSA 4P5TA 3VXOB 1I3GL 3TA3A 2W9DL 3RVVC 4NZRL 4LLWA 3W0WD 4HMCA 5EUOA 1P2CB 2GSIB 3C6SA 3BMWA 4OZHA 5KSBA 5K9OB 5D72H 3FCTB 4MXVF 4OZFA 1E4XL 5HPOA 4Z7OE 2E9WA 4NWUH 4PJHB 4RGNB 3WKML 4NN5C 3ULVD 3GGWA 3KPNB 5GS1B 2BVQA 2OK0H 2YPVL 3JXAA 1W72L 2CIIB 3QIBA 2P5EE 4HBCH 5AYUL 5GGTH 1HHIA 3U46A 1WSST 4I77H 5JZ7D 2YSSB 2A9NH 1A6VL 2O5ZL 4H5SA 2N56A 1RZ7L 1CVSC 4Z0BH 4NUGH 4XAWH 4BJLA 4X9HA 5IW6A 3ZL4H 1CD9B 2HJLA 5FYLE 1X4ZA 4O2CB 3O11B 3RTQA 3PGDB 5EA0H 2D03L 3BKCL 4PV9A 3FO9B 2R1XB 5B22A 2OM5A 4RNRB 5ADOH 3MLUH 2Y6SD 1G7PA 3QHFH 4PRDB 4X6EA 1XCTB 5F6HI 3O8XC 1DQML 1MCHA 1CT8B 3N50A 4A6YB 2WV3A 1BQHA 1MHHA 2CLZA 5JIHA 5CIPH 4EDXB 3ZDZF 4GSDH 2IQAB 4PP2B 3LMJL 2ILLA 1H3TA 4UOW1 1J0YA 5CZXD 3KYAA 2DICA 4APQB 4AT6B 4ZMAT 1FQ9C 2V17L 4LVNC 3QUXA 5C0FA 1HNFA 5E8NB 2EE6A 4H0IA 2Y07H 3GSXA 4OUOA 3MOBL 3GJFK 3MCG1 4NQEA 4YHPB 1MCRA 1OTSD 1IVLA 4U1HB 4ELMF 3GSWA 2DL2A 4POZD 4F3FB 5IP4A 1FVDB 4OD2B 4PJ9C 3RBGA 1GPOH 1IQWL 3RZCA 2R0KH 4JHBA 2DWEA 4HKXB 2GHWB 5E08H 2YZ1A 3MV11 5HI3C 5IB5A 3FFCA 1A47A 5GRVL 4DGIH 3HZYB 2NTFA 1XGPB 1OPGL 2D0HA 2X4UB 1EAPB 3QJHA 2A9ML 2R69H 1OSZA 3FQXB 1VFBB 5AUMB 5I2IA 1KULA 3U4BL 5JOPE 2IH3A 1HKLL 5D1ZC 1FG2B 1ZTXL 1FO0B 1TQBB 2WWMD 1BD2B 4NHUA 4ACPA 4Z78A 2IPUG 4KKBD 2VDLH 5I30L 4OZ4B 5DMKA 5TFSH 1PQZA 3HMXH 1JNNH 1BM3H 2V9TA 2WW8A 2NY1B 1OAZH 1AR2A 1WAAA 3DARA 3DX7B 1WZKA 4FQHB 4U1SB 2LQRA 2YD3A 1EJOH 1YMMA 4QHUB 1CICC 5DFWH 5JOEA 2H9GB 3GMRA 3CSPA 3SO3C 5C08A 3V8CA 3MNVB 1I8IB 1WWAX 5GSVB 3MODL 3A6CH 1LMKA 4QGTA 3WFEL 2EYTB 3CFEA 1MF2L 4GLRH 1G6VK 3OQ3B 1C8PA 1JHLH 3C5ZB 2BSTA 1YEKH 4X6DF 1WZ1H 3ZYJA 1ND0A 4TYUA 1FO0L 4IEFB 3TBWB 4XBEH 4P2QA 2NY7H 4EEEA 4LCCC 4NFDA 3BEVB 3MROB 4F8TA 3L7EA 4J7RA 4NHCH 5JPMB 4OCSL 4MQ7A 4O58L 4J6RL 3MLZL 4MJIB 2GY5A 5I6XB 5IMOB 3PF2A 4C83A 3TIDB 3RWCB 3GK8H 1MHCB 2DTML 4EI5D 1MH5A 1F42A 1SMOA 4Z7NF 1WQVT 4G6AC 2PCPA 1H8NA 3CSGA 1OAUL 5DQ9B 2MQ0A 1K3ZA 1VACB 4IMLA 3PXHA 4CVXA 1DEDA 1X5AA 3TVMC 1XGQB 4QRPB 1DN0B 1Z0MA 4K3HA 2ZUVA 3HPJB 2PF6A 1MHPH 1EJ6A 5IVXB 1CL7L 1GZQB 3CNKA 3WCYA 4Q6YA 5T1KD 1L0QA 3MUGA 4HC1A 4XP5L 5TGBA 5LGHL 2EEBA 4HULB 3FT4A 4M1GH 5CUSL 1OGAD 1Q1JH 3BP6A 4HUKB 4Y16D 1RIVH 4N0YH 4PJFA 4Y4KB 3D0VA 3GSRA 4XCYB 2ATPA 1RQ5A 1N6VA 4AY0A 4F37F 2VR9A 2I9TA 3Q3GA 5ERWB 1A5FH 1F5WA 1QFUH 1F4XL 4L4TB 3EDFA 4LPWA 4XCEB 4YDIL 3H0TB 4OI9A 4X6DE 2H26B 1KN2H 2GUOA 3EYFB 4DGYH 2R0ZL 4GKZB 5IEKB 5MEQA 5KVGL 1ZT4A 5DT1H 5E6IA 2BNQE 3H9HA 4QRQB 1FORL 5ESVA 3SKNB 3QEUA 4IRSD 5KS9B 4N90D 4ZFGL 5DRZB 5CILL 3AS0A 1J12A 4PJGB 5TE7L 4JZJA 1UCBH 3KYMB 1WV7T 5DWUH 1FL3A 4NCDA 3T2PA 3P9MA 4LSSH 5GPRA 3DWTA 3QNZB 3VXPA 3DVIA 4PJFB 1NFIB 3TFKC 4JR9L 1JN6B 4PBWD 2EYSA 2ICEA 1J0IA 4U6VL 4IJ3C 2VITB 5E8OB 2DN7A 2UZIL 4AIOA 4UT9L 4JCLA 2BVUA 5DJXA 4S2SB 3MFFA 5JDSA 4EUPB 1DN0A 1OGAB 3ARQA 3RUGF 3AY4A 5I8CB 1JPST 2V2XB 3D2UA 5EH1A 5C6PB 3GMMA 2ESVA 4HK0A 1FV1A 1KOAA 3HRZB 3Q6GH 4KVCH 2BJML 5IB4B 2W91A 1J5OH 5L88H 4ZXBB 1MH5B 2QSCH 1T7YA 3OSKA 4WV1A 3MA9H 3O2WH 5GZOC 4D3CH 2GJZB 2BXZA 4LGRB 2VDRL 3REVB 1FC1A 4XVUC 4WI2A 4TNVF 3U83A 5C0CD 1V3MA 1WEJH 1KXQE 3NZHH 4NGHH 5BZDA 2PN5A 3QWQB 1VB9A 2Y9RT 4QGYA 1J8HD 4OGXL 3SGEH 4OUUB 2QTEA 4OFIA 1BZ7B 4HK3N 3U0PB 4B5EA 1PAMA 4GMTL 4JZNB 1CFVL 4YPGB 2XN9E 4LSVH 3S36L 3PNWA 4XCNA 5IFHL 1BOGA 1IC4H 3G5VA 1ZVYA 1XF1A 4NWUL 1YJDC 5FUCE 3WKNA 3LB6C 3QUZB 2Z31B 1W72H 4NUJA 4L3CA 4UUJB 2NY3B 2JIXA 4JHAH 1FO0A 5EORH 3INUL 1DBBH 2EDQA 4P5MB 4Z0BL 3VGAB 2DD8H 5LGJA 2BNQB 4NN6C 1HN1A 4F57H 1P7KA 1UA6H 3ECBA 5C9JA 2DS4A 3ZE0E 3F5WB 5IB5B 3IDGA 3AAZB 3IDJB 1W0WA 3IDNB 5IF0A 4XB8A 5HHME 4JGUA 1DEEA 3VXMA 5MHSD 4E0RB 5DVOA 1A6TA 5GGQL 4ODHL 1Y6MR 3KPRE 4W70A 2WIMA 4FHBD 5EOTB 3D9AH 3IVKA 1F90H 1FNEA 1TVDA 3VD5A 1FGNL 1XR9B 3STLA 1NKRA 1OM3H 4XHJD 4PJHE 3OL2A 4RGNE 4NZTH 4PJEE 4KDWA 2DJ4A 2GK0A 2IH1A 2FATL 3H3BC 5F88B 5K9KB 1KTLA 3FO1A 4R9HA 2FX9H 5DS8B 1NDGB 2A1WL 2OSLA 4XNZB 12E8L 5GZND 4FQ2H 5HHQA 3VH8B 1U93B 5HDQH 2FBOJ 2OQJA 3UDWC 1TJHH 2FNBA 3SGJC 1U8NA 5J11C 4HUVA 1CD1A 2Z35A 4KQ4L 5DGRA 4HXBL 5F96L 4HWUA 1EEUA 1OB1A 2F74B 3D0LA 4KI1A 3D1MC 4KRPD 3TZVC 5L8JB 3QXUA 1AHWC 5IR1B 1A9BB 4AK1A 4TRPH 5IM7B 3MUHL 4LCYB 3RGVC 3MV9D 1JWMA 1J1PH 4POYA 4JVPA 5I30H 3BHBA 3GBNL 4PJAE 3FOLB 4NQSB 3QUYB 1BM3L 4WFGD 4KJPC 5IMLA 1SVCP 1U95A 3ROLB 1DBJH 4LLAA 3JUZA 5JORB 4KAQL 1LGVA 1QNZH 3GIVB 5IQ7H 4OIIL 3GJEA 2XTJD 1NEZG 4GW1A 3SCMB 1S9YA 5ITFA 3AUVA 5BO1H 3L7FB 1A6ZA 4L5FH 4HCRL 3K2MC 1LO4H 5KSUB 1OAXH 1IAOA 1HHJB 3K8LA 4U2ZA 3P0YH 5BRZE 1T2QL 3QUMH 2Z91A 1YEKL 2ADGA 1MCNA 1LO5A 4GJTB 3L6FB 3QCTH 4PB9H 1BZ9A 3G9VA 2ITDA 2NY7L 2XV6B 1BD2E 2EKSB 2R2CA 3DBXB 3O8XD 1P4IL 5CP3H 3TT3L 1P84K 4LASL 5D5MA 1S7VB 4XNQB 1S5HA 3RTQC 3L7FA 4ZFFB 5DXWA 3N85L 3C5JA 4G8GE 5F7EH 2FJFA 2IBZY 2EDYA 2HT3D 4L4VE 1T0PB 2JJTA 5IQ9A 1KJ2A 4O5LH 4L8CA 1WCQA 4Y1AD 4CMHB 1U95B 1VGEH 1P5VA 3VWJB 5T3XH 5IMLB 4L29B 1OAUH 1ETZB 3MPCA 4OZIE 2O5XH 4BFBD 1NCUA 2PYEA 2ZUQB 4ELMA 4XAKD 4RCAA 5F7UA 5CJQH 1AD0A 1AJ7H 2EDJA 3MR9B 3LQAH 4HXAL 2HKFH 2EIBA 3VI4F 2YC1B 4MZ2A 5IR1A 3V7AG 4M7JH 4NN6B 2CR6A 4NC2B 1EVTC 1X5LA 3VRLF 3PWNB 1P5UA 1OY3B 3QEGH 4WFEE 1S8DB 4KJWD 1A3RL 4NFBA 1D6EB 2R39A 4FFVD 2YRPA 2IANE 2OSLB 3KPRA 4MB3A 4NPYA 2WIIB 4NKIL 2IH1B 5K9KA 1TETL 1Y18A 1EV2E 1JPGB 4MX7B 3GIZL 2DQTH 5JQ6L 5CIPA 5HDOA 5DT1L 3G6JA 1LO0H 1AKJB 2NR6D 1Y0LB 5IB3B 4MYWB 4Z18A 1UH4A 5D6DA 4ZFGH 5J6GA 2KZ1B 3BPNB 1RAMA 2R15A 3QXAA 1QTYT 3HB3D 5FF6B 3PV6A 5D70L 1JWMB 3BYYA 2DI9A 5DWUL 4PJGA 2EH7L 1D9KC 5DD6B 3AAZA 4IRJD 1A7OL 4UU9A 4XTRD 3C9NB 4XVSL 4TSBH 1UQSA 4UDTB 3BPOB 2DI7A 3ECBB 4GRWE 2AXJA 3O6MH 2DQCH 4MXQD 5MEQB 3BDYL 5JIKA 1X5GA 2LAAA 4DK6A 2IQ9H 2X9XA 1OT2A 4P2RD 2GCYA 4EI5C 1SVZA 3BZFA 4RGMB 2WBJC 3N9GH 4W6XB 2BDNL 4I3RH 4PBXA 3CSBA 1QO3A 2FX8L 2QSTA 1TZHA 3NZ8B 1DANU 2I9LB 4JM2A 4GKSB 4M00A 4JM2F 1AH1A 3W2DH 1TPXC 4N8CL 4UB0H 3ES6A 1YQVH 1LEKB 3WMSA 1ZGLB 4XNYL 1DE4A 3GMNA 4OLXL 1YECL 4J23A 3UC0H 2VDRH 4IRZH 2C7UA 5ILTL 2OR8A 2VR4A 1FZOB 3NZHL 1CIDA 3BO8B 4XNMA 1HXMA 1RZ8A 3B2VL 1RK0B 2P5ED 3HRPA 4WDIB 5SWZA 3IDUA 1S9VA 5FKAA 4TVSa 2C3XA 4BZYA 4X6DA 1BZQK 1MWAH 1P6AB 2D7OA 3BISA 1CLZL 4RFEB 3VWKC 2VDKL 5HHVL 2OMBA 1NAMB 3JSSA 2DKSA 1HIMH 4JM2D 2W65A 4QHLB 3T2NH 5CEZH 4FTVB 1L6ZA 3WNOA 4O2FA 43C9A 5D7IA 1BVLB 4QT5A 2VDOH 2OTWB 1MLCA 3T1WA 1JNLH 3LQZA 4KQ3H 1QSEB 1S7TB 1UWGL 5EUOE 1NFDE 4JHAL 1HOCA 5D9SA 1MCOL 3QNXA 5I19H 3MV8E 1ZA3A 2DWDB 4PRHB 3S34L 4F57L 4FRWA 1DE4B 3NVQA 4JFOB 5I9QC 4JO4H 3F7RA 4NRZA 5BV7L 2OTPA 1GJIA 1NGZA 3O3EB 5I1KL 1U8KB 5L2KB 4NCC1 2YD5A 3SGDH 5D96B 4RMTA 4NCC2 4JFED 5HGDA 2F54E 1BD2A 4BM7A 2AV7A 4WWID 4ZPTA 5A1AA 2R2EA 1G6RA 1F90L 5I2IB 3I02A 1FGNH 3DGGA 5DMJB 4R90H 4PJDA 1Z3GL 5KVFH 4MA1C 3P2TA 3QWRA 1N59A 1NDMA 5KSVA 4YK4B 4C59B 1WC7A 3HZMA 4WV1C 3DRTB 4XVUD 3PL6C 4RFOL 5F21B 4YWGL 3T4YA 4UQ2B 5F6IB 1CGUA 3QQ9D 1JZ3A 1MPAH 8CGTA 1WBXB 4Z7NE 4M61A 3PWPE 1IGCH 1B2WL 3ZDXF 1X44A 2OMNA 3TO4D 1I9JL 4JJHA 4WO4D 5E5RB 2WBKA 2Q8BL 5EZLB 5DR5H 4PJ9D 5D2LA 5IVOA 4Y5YB 4HXBH 2B5IC 3DUHA 1JN6A 3AU1A 5TH2B 5KTEL 3QNZA 3MNZB 5DFTA 4WFED 3HPJA 2WAHA 4Y4HC 4BSWB 2RFXA 3ET9F 5HGAB 3CLEL 1J1PL 5LJYH 4HX1A 4W4NA 1EEYB 5F93C 5CINH 3GBNH 4WUKL 1IKNA 3WIIH 3AROA 1KJ3H 4M43L 4ZFOA 4WW2C 2LU3A 2EDBA 4ZOAA 4KAQH 3PWJA 5E2UL 5KS9F 35C8H 5KN5B 2Q76A 3BKML 1WWCA 1EO5A 5FYJH 3WNNA 3S96A 3WEXA 1MJJB 3DXAD 4ZAKA 3CUPB 3SBWC 2MNUA 2H26A 1R5IA 4JFXA 1OAQH 3SDYL 4Y5VC 1FFOB 3C2SA 3VGAC 5HGHA 1U8PA 2FB4H 3OJDA 3RVXC 1MIEH 3ZKQD 3QCTL 4PB9L 3AM8A 5GS1A 4G9FD 4JKPH 3C5ZA 1TQCC 4OB5H 4Y4KA 3QSKB 1NGZB 1UXWA 4WFFE 4XXCA 2OS7A 4NRZB 4MA8L 1CL7I 3VFMB 3OF6D 5FYKE 1K85A 1WBZA 2IWGA 3N85H 2E7LA 1JWUB 2MKLC 1URLA 4Y16C 4CN1A 5D2NB 4LLWB 3FQWB 3IXAA 3JZ7A 1NBYB 2GY7B 2KUTA 1GZPB 1FH5L 1RHHB 5CSZB 1MCSA 4OI8A 3LVEA 2EYRA 5I8OL 1EGJL 2F54B 3VD9A 4GUPA 1YMHB 2X4TA 5ICXA 4QYOB 2NZ9D 1MCWM 2RQ8A 3SDXB 5T1LA 5HY9B 3EJJX 3KJ4C 5CJQL 5KOVC 3OKLB 5ECJE 3KYOA 5L2KD 4E5XA 5DD0H 4ZTOL 1BIHA 4NZJA 2WLYA 4OZGB 4HGMA 1MLBA 3HC3L 4K23H 3GJEB 4JG1H 2LABA 3QNYB 1F02I 3MRGA 4RRPG 3G5XA 4KJQD 2J88L 1PDKA 1DCLA 5D8JL 3T3ME 1KLUB 4U6YB 1FNSL 3WXWH 5DJYB 5FA4A 4NT6B 2C26A 2VZOA 5J6GB 2YRZA 3PDGA 5EFIA 3TBYA 1A9BA 4WO4A 3E0GA 4OFDA 2WUCH 4BH7A 1RSFA 1TVHB 3MRHB 5IB3A 4X5XA 2XQBH 3GIZH 4BFEA 4HJ0D 4Y4KC 1OB1B 1DQJA 2AJSL 1MRDH 5I1LA 1JPGA 4PV8A 3ES6B 3LKPB 2XXCB 3T3PF 3LS4H 5EBGA 5FM8A 3L3KB 3DTXB 1QA9A 4PIRF 5E7BA 3L3DA 5E00A 5D70H 4X6EB 2NY3C 4QHNB 1P7QD 2GCYB 5HHOD 4NQTA 1C7SA 4RWYL 1T21B 4I4WA 4KI5C 1GSMA 1KB9J 4I8DA 2A77L 4ZO6A 3RJDA 4UDTA 3WFBH 3BPCA 4F7CA 2HT3C 2Y7QB 4QO1A 3ARFD 5FKPA 3O2DL 3ZTJH 4MD0A 1VADA 1IM9A 2WANA 4QKXB 2NX5E 3MRIB 1Z5LB 3QIBB 4E0RA 2PO6A 1A7QL 4JRXD 2HTLD 3FB7B 2VABA 3FFDB 5GHWH 2V9RA 4F58H 1H3PL 1LO3L 1Q0XH 1WAAE 4GLRI 5K9OA 1B0WA 4BFGA 2B1HH 2HVJA 3DSFH 5C9JB 3VA2C 4ZUSA 5TE4H 3MNWA 2FJFB 3WJJA 1CDJA 2Y36H 1LE5B 2BNQA 3BZEA 4ZPVA 1LWRA 4KDVA 4YXHL 5F7MC 1AQKL 4PUBL 4NO0D 5D7JA 3B2VH 2VH5H 3SKOB 3QH3A 3T04D 1T7WA 1I7UA 4HZLB 3SEPA 1JZ8A 5GRJH 1E4XH 1RHHA 3MC0A 3O11A 5CSZA 1FPTH 3ULUH 5I1CH 4K3EH 1BIIA 4NO0A 1KIRB 5D7JD 4OI7A 5CEZL 5AYUH 1HK6A 1GC1C 1KGCD 3MLYH 5CJBA 4P2QD 5CZXC 3ZYIA 1LE9A 2ZSVA 3K8KA 4PJBB 3GSNA 3QPQD 4OBRA 4MJ6A 4JB9H 3VFTA 1ETZA 4OFPA 4DKEL 3O9WA 1UWGH 5D93B 2BVPA 5EA0L 5BMFL 4KUCF 2D03H 1OTSC 2W9EL 2FWOB 2DF3A 5MI0B 3GDBA 3MLUL 1HINL 3BRDA 3S34H 5GS2D 2F5BL 1AXIB 2AK4A 1DQMH 4HUVB 3PP3H 3IU4L 3OKLA 1H5BC 4P2RA 3L5JA 3TO4B 4QNPE 4MA1B 2ED8A 4N8PA 3O3AA 3BIKA 1HQ4B 1J1XH 1DL7L 2VXTH 2NY6D 5FAAA 2R4RH 1CU4H 2AJ3B 1IAOB 2EYRB 1NC2D 5CGMA 3BP5B 4JFDB 1AGBA 4HAFA 2Y07L 4LVNB 5D71H 4L1DA 1I85A 4XRCB 2V5RA 3WV0A 4NP4L 4R90L 4WFHD 1KIQA 5D6DC 4NO5B 4J4PA 3F8UB 5IB1A 1GGIH 5GRYA 2R0KL 2BOCA 3MRCB 1BVKB 5GGRY 4U1JB 3SCMC 2HVKB 4RZCB 3MX0A 4XNXH 2GITA 1MPAL 3DVFA 4PGDB 2JKXA 3MACH 3BEWB 3G5YA 4ODVL 2D4FA 1HKLH 1F45A 4P57B 3TN0B 4U1IA 1KCKA 3BSZH 1UXSB 3MXVH 1F4YL 1H3VA 5KN5A 4AIXA 1P4BL 1H3WM 3EBAA 4FFWC 3VXRA 3T2QA 2YD9A 4GRLA 3JV5A 4YQXH 5FO7A 4UOJA 5HHQB 4S1DD 1FFNA 3EDKA 5CBEB 4L4TA 3LKSA 3RWHA 3J7HA 1S9WB 4MD4B 3QUZA 5DS8A 4D9QD 4F9PC 2J5LC 3WFEH 3HI5L 5IBLC 1D6VL 1T6VN 2OR9H 1KELL 4ZNEE 3CPLA 1U8KA 5L2KA 5MEOA 1UWEL 4XMPL 3RGHA 3NBNA 5JA8B 3RI5F 2HG5B 3PIQB 2BXYA 4QF1A 3I50L 5KZCD 3IAPA 5JLZA 2VL4A 1CGSH 5HYJB 1PYWA 2VQUA 1IAKB 5ID1B 4UV7H 5EBMB 1NBVH 5D9SB 4Y1AA 1CGYA 1T6WA 4ONHB 5E99H 4OCSH 2NLJB 4XX1G 2L7JA 3W0WB 4MNGA 2JTDA 3IDNA 4I0CC 5IF0B 5GIRB 3MJ8A 3T4YB 1HXYB 2UYLB 3WN5C 3VD4A 2RR3A 3QNYA 1CXLA 3IDIA 3TBTA 5F8QC 1AQDB 4Z0XB 1K6QH 3C6LD 4JREC 4JY4B 3OKDB 4HIHB 3SKMA 4FTVA 3GBML 4TVPE 3BWAB 4QRRD 2W65B 1F00I 3MRFA 2ZNWA 4BSVA 4IDLA 4PLKC 2AJXH 3HC4L 4JY4A 4X4YB 4ODBD 1AD9A 3KPOB 4Y4FB 2AV7B 1YNKH 4ONFH 5JPNA 3HZVA 2Q8AL 4Q97A 3L95A 1K8DB 1FV1B 4HK0B 3GJFA 3QQ9C 4G8GA 4XPFH 5DDHB 3CDGB 3QFJE 4M1GL 4U0RB 4ZQKA 2YR3A 1AIFA 3C08H 3L3HA 3REWA 4CJ0A 1UKSA 3TO4C 4ZTOH 3ESVF 3RVTC 5JLZB 5I76A 2FGWH 3OPZL 4DAGH 2VITA 5E8OA 3Q5YA 1N3NB 5JIIA 3SDCA 4OGYL 1A7RH 1EK3A 2Y06L 4Z7WA 3AFLA 15C8H 2R0ZH 2ENYA 1T5WB 5ETUB 5BZDB 1HHHA 3NCJH 2CRZA 1GAFL 4KJWC 4KFZC 1YEEL 1JPFA 2H45A 2MHAA 3D69B 1FORH 5HVGB 2NQCA 1P7HL 5DA0B 4F2MB 2M8XA 5D2NE 5I8KH 3FL7A 3RNKA 4QRQA 4I2XB 5T1MB 1FVCA 3MRQA 1R3IL 5FGCE 2XQBL 43CAB 3VH8G 2UY7A 4HIHA 4Y7MA 5IVNA 3HZYA 1C16A 3FRUB 1YEJL 3GRWA 4KXZH 1A2YB 2XZQL 4NYLB 1UKQA 2YPLA 3HMWH 4XGZB 4YHMH 3C5SA 3OKKB 4M62H 4ETYA 2O26U 4HUXB 2WP3O 1HXMB 2EDOA 2YD8A 1CE6A 4FZ8L 1RIHL 5F9OL 4CJ1A 5FIEA 2H3NA 5DJ8A 1YMMD 3QA3B 1VSCA 4OLEA 4XP9L 4LSQH 4P5KB 1DTUA 4HWBA 4X7EC 3QIBD 3MV9A 4Q0XL 1E4XI 5CIPB 4LVOB 5I74B 3WS3A 5KBNC 5AZ2H 1JF1B 4PJIB 1TQCB 2ICWA 3MRKA 4A2MA 2QSCL 5DJZB 3DURB 3LV3A 3LQAC 5FHBH 1TIUA 5INDA 3U0WL 4PY7A 4S0TD 4Y19D 1SJEB 2E27L 5I71B 1A7QH 2A0LC 2X1QA 4CGTA 1FIGL 4XP1H 4GRLB 2A38A 4JRYD 4LSUL 3SGEI 3HE6D 4LEOA 4NYLA 4XGZA 5DHVH 1Q9LA 4HFWA 4M48L 5C0BE 3S7GA 4PJEB 3SQBA 5ISZD 3T0WA 4PJDB 5A2LH 3X11B 1MELA 3V5KB 1E4WH 4MJIA 4P9MH 1N6QL 2I26N 4OGXH 2WZPD 5M94B 2MCG1 2FWOA 3K2UH 4K3DH 4N90E 3ULUF 5IHBA 2ZCKL 4OM0H 5GRUL 3RWFA 5IV2A 1NUNB 2FD6H 1FFRA 3AMLA 4PUBH 2PYEB 3BKYL 2EDFA 3VG0H 3VXSE 4W68A 2FR4A 4B7LA 4LSVL 2DYPD 4O9HL 1RJYA 4MJ6B 1EHAA 4LOUC 4KZEL 3WFHB 1DLFH 1D5MB 3DRQA 1N5AA 1FNGA 1BF2A 3QIUB 4MX7A 3FQTA 5TQ0L 2AI0L 3GNMH 2YUWA 1AGBB 3HI6H 1FN4A 3S6CA 1DBBL 2B1AH 2VQTA 4WJ5A 3MRDB 4JANA 3BGFC 2OL3B 2OXHA 5KVEL 1VACA 3MFGB 4DKEH 3MV9E 2OTWA 1RJZB 1F3RB 2DB8A 5FGCB 2K3TA 4QTIL 5DC9B 4Z7VB 4KZDL 3T0VA 1J88A 5D6CA 5E95B 4BQBA 4OD1H 3ARVA 1OW0A 4K94C 3P0VH 3UEZA 3Q6FA 5GGQH 2AQ3A 3MUY1 4LMQI 3IAQA 2VMFA 3OF6A 4EIGB 5GS2H 3HR5A 3W0WA 1KEML 3OGCB 4OCNC 2F53B 2PO6B 5C0ND 1CU4L 1W72B 2DQFA 3CC5B 5K9QI 3MCLL 2FX9L 1FZMB 5JTWA 1O5DT 4NP4H 2H1PL 1DFBH 1N5YL 1DANT 4JQVA 4P59H 2Z35B 4HW6A 1R5WB 3DXAA 1V5JA 4ZAKD 3SE3C 4HH9B 2IGFH 3ZDXE 2OQJB 1M05A 4X7FC 1U93A 3L6FA 4D0CB 4JY5H 4QHNA 3UAJC 4TTDD 1YDPA 5AAWA 5J8OA 2R23B 4YZFE 1KBGH 3L3DB 3ARZA 5E00B 4XPAL 4X7SL 2QHRL 5DEZA 3I6KA 1WWWX 4ZNEA 1I3UA 5C71A 2GAZB 3ILPA 3NFPA 1KT2B 1EX0A 1NFKA 5SWSA 1F4YH 4PJ7F 1YN7B 1FZJA 2B4CL 3T65B 5C0EA 3U9UB 4KXZI 1UM6H 2BRQA 4QRTA 1FYTD 3UJJL 2P8MB 4MQXD 4BH7B 1WCBB 5B4MC 1Y6NR 4PJ5B 4G5ZH 1U8OB 3RZCB 2YXMA 1QSFB 1FVDA 2NY1D 3UZEA 5FEBA 5FF6A 1Y6KR 5DJYA 2E6QA 3CSYB 3HE7B 2JLLA 1MEXL 5EC2A 1IL1B 4XH2B 3IXTB 3B4NA 3W9DB 4LSDA 1E4JA 3QUXB 2SEBB 3SDXE 1AO7E 5J1SC 1KG0A 1OSPH 1JWSB 1DSFL 3DSNA 4M5YH 3SGKC 1CICA 1OW0C 3FT2B 2IFFL 4M6OL 1NEZA 5IVZB 4BQ8A 2XN9A 1Q72H 4V1DB 4LASH 2DM4A 1RK1A 5JXEA 5SV3A 3GI8H 2H2PD 2YA2A 5F7FA 3F65A 2NY2D 1AI1L 3L3KA 1I1RA 3EDDA 1KCVL 4UAOC 1BOGB 2LVCA 2E7LC 4WI4A 1GGTA 1XIWA 4OCRH 2HFFA 1W8OA 3MJ7B 1B4JL 1P4LA 4MJ5A 3TH4T 5HYSA 3I6LD 2XWTB 4WWKD 2AJXL 3HC4H 1AJ7L 2Q86B 2OYPA 2EDHA 4M9OA 5F44A 4JRWA 5E5MB 3TEUA 2Q8AH 1QHPA 2EDLA 1MOEA 2AKRB 2JE8A 2R2BA 1J86A 4M7JL 3UO1L 4GKOA 3UTTD 5EN2A 5FK9B 3HR5B 3RWEA 2J6EH 3KDMB 3VWJA 1U8PB 1CDBA 4WEBH 4G8IA 1U91B 4OZFB 2B8OT 4ZNCD 2YKLH 5CD3B 3QQNA 3PV7A 5K59E 3EJZD 1X7QA 2X4NB 1R0AH 3KPQA 2FGWL 3OPZH 4RISL 4DAGL 5DTFB 1MUJA 1EMTH 2PR4L 4D0BA 3OB0K 3VJ6A 3RKPA 5DZOA 2E8ZA 4NQXA 3QQ4B 4FFWD 5CJXC 5B38B 4MLSA 3SGDI 3GMMB 1GAFH 4AH2A 1EEYA 4GUPB 1PW3A 3UTTE 3WNPA 2ICES 3BZEB 4G9DA 4IRSB 1F8TL 4X7TA 2ZPKL 5GQBA 2VDMH 4JZNA 1X3DA 4XPGH 2I25N 3DIFA 4HPYL 1T1YB 3TLRA 3VFMA 5CEZD 1YEJH 4GRMB 5JHDD 2APXA 2WSKA 1J11A 2CRMA 5E9DD 4NQED 3F7QA 1RZJL 5C86A 1AXTL 4Z95L 4M4RA 3VGEA 3GSOA 1KB9K 3A0OA 3NABL 3PG2A 4TNWF 1OP5K 4AEFA 4WHYH 2AJZB 4PLOB 4H1LB 2XA8H 3NACH 4FZ8H 2DQEH 4QHMA 2R0WL 3PXJA 3PWVA 1TDQA 3QFDB 4HKBA 4LBEB 2IQ9L 3O8XA 4MA7L 1GHFL 4UIKL 5IHZA 4XP9H 3H9HB 4GRLC 4LSQL 1A6AA 1WIPA 4Q9RH 3F6IA 2ORBL 3TBVB 5IFAH 4HFWB 3WL9B 4KK9C 1C1EH 1KLGB 5FHAL 3EW3B 1YQVL 3H0TA 4MNQA 2RAMA 2ESVB 5E2WH 4O51B 3WUWA 3C09C 5F1IB 4DZ8B 1Q9WA 5IK3B 2GYSA 2VXVL 3OKNA 3DURA 5LGKA 2ED9A 4Y8DC 4FFYL 5ILTH 1F97A 2HTLC 3EOTL 4JDZA 3BGMA 5CJOH 3O6FB 3BT2L 4QXUL 2A73B 3ALXA 5T5NF 1YY9D 3GZKA 4M5ZH 1NGYA 2G5BB 3HFMH 1G9NC 4J4PC 4J2XA 3P9MB 4FZEH 3T0BA 4JO1L 4LU5H 4MMXC 4LNRA 2IC2A 4DGVL 1OL0A 3IJYB 3HG1D 1QRKA 1VEPA 1OD9A 5GJTH 3OG4B 4EIZC 1S78C 3VG0L 4TTGA 2CQVA 1HH9A 1MHEB 1R3LB 4HF5L 5E2JA 1JTOA 3G04B 4O2FB 2P24A 1HDMA 2KZWA 3HI1B 43CAA 5EU6E 4YR6A 4NJAH 1BJ8A 1BAFL 4HIJB 4OFKA 5I1HL 5A2FA 5TPWH 4TULH 2WWKO 4XCEA 5D7JC 2J8OA 5I19L 5T5NG 5FKAB 3EKCA 5C2BL 4FP8L 4MD5B 4R4BB 4EJ1C 3O81A 4CMHC 4UQ3A 4NJ9H 3KPLB 1IGYA 1YEIH 3DUUA 1WVZA 4PJCE 4PREB 4YPGA 4WTXA 3GSVB 5EO1B 1JWUA 3GKWL 1R3HB 3VWJD 3EYVA 1A6UL 4WI5A 4OF5A 1NCDH 2CKNA 1OP3H 1M71B 4IMLB 3QJFA 5C0GB 1KEMH 3KGRA 1PQZB 4LPTA 5JO5B 3SOBL 1KB5B 2Z4QB 1BVLA 3CU1A 3BDBA 4GS7C 1UM4L 5JPNB 1NJ9A 1FG2A 3GBLA 4JHWH 3PQYB 4QEGA 5FUOL 4G8EA 3SY0B 2GJZA 1L7IL 3MCLH 4R4FL 5DD5H 3FQXA 2CSPA 1C5BH 4X4ME 4JKMA 2OXGA 1UEYA 1A1MA 3RVVD 3HS0A 3JWDL 1CR9H 4U31A 2FEEI 1TZGH 5C2UB 3SHSA 4LP5A 1PG7H 4DN3H 4UU9B 1JMZA 4HGWA 5DR5L 3DUUB 3CH1A 4JFFD 4EXPX 1ZHKB 1EHNA 1K2DA 3SCMD 5IBLD 1ZT7A 1KBGL 3MJ9L 1B0RA 2VO5A 5EBMA 1YPZA 3RIFF 1GC1H 2DQUH 3TESA 3GRWL 5C0FB 2EKJA 2EXYD 3CLEH 4PJ8C 4IBLT 1MFEH 1CK0L 1FJ1B 4MWFA 2GSGA 4JPKL 2EH8L 2CPCA 5DRXB 5TDNB 2FYYB 1G9NL 3BN9D 4EDXA 2B20A 1BQHB 4UNTA 3KPRB 3FB6B 4JRXE 4YNYA 2BNUA 5DQJB 3ZKXB 4MJIE 2LV4A 4EZMA 3SDYH 2X4UA 2BNRD 2GJ6D 5DHYA 1UC6A 1QRND 1OSPL 2K7QA 3QUYC 3T0ED 2EECA 3ARBA 4P23A 4LBEA 2Y5EA 4XP6H 5FYKH 4LSRL 3MCKA 3WBDA 3VWKB 5FFLA 2JJUA 2WINB 2XKNB 4XVJL 4J3TA 3PV6B 1MJ7H 4OKVB 4EDWH 2BVQB 2HYMA 1KACB 1IM3A 4I0PA 3D0VB 3RVTD 3D3VE 3O6LH 4R2GC 1ZANH 1NC2B 4M6AA 2VE6A 3QDJA 5IQ9B 3G6JB 3QDGB 3ZE1E 2ZCHL 5HYIA 5IVXA 3S97C 2VLRB 4OLUH 1G7MA 1CVRA 4RX4D 1T0NA 3CDYA 1HOCB 3UTSE 4ZDHB 3RX8A 2JELL 3V95A 5D1QA 3UO1H 3MRLB 4JN1H 1VFOA 3HZKB 2J6EL 3WFDH 4KK5D 3I3BA 5MP6H 4JPWH 2FRGP 3FN0H 4AM0B 1E28A 5KVDL 4D0BB 5CWSB 5E56A 4Y88A 3UTTA 3OX8A 1A3LL 1EMTL 2Z31D 2PR4H 3QWOB 3DMMB 5JPMA 3WFZA 4GBXC 5FO8A 3VFSB 4NO3A 4KI5D 4Y16A 1NCCH 2VXQL 5EWIL 1FGVL 4CVUA 4H5SB 5CHNA 4QXWA 4M02A 4P2QB 1ZK9A 4HSQA 5CSBA 4LVEA 3ARFC 3X14A 3RUGE 2ZKHH 1MQKH 2J4WL 5F9AC 3FAWA 5LAXA 3V6ZB 4E9LA 4NKOB 3ZYZA 3VXQA 4HV8A 2PW1B 2VZ1A 3IT8D 4YDLB 5IG7B 2HAZA 4OSUH 5JW5B 4PJAA 4EN3D 1K5NB 1QEWA 1U0QA 1NAKL 1OGAE 4HPYH 1XIWB 4X6BA 5TF1L 5HVWA 4P5TB 3VXOA 1KN4H 3DX6A 1FAIH 3FQNB 2D4DA 5BW7C 2EDWA 4CMMB 4DEPB 3DX7A 4RFNB 1TZHB 3NZ8A 4FXKA 1TVBA 3ARBC 1MFNA 1M4KA 4Z78B 5SWSE 1I8MB 3NACL 5FK9A 4M3JA 3T77A 4HH8A 2ESVD 5C6TH 3WFBL 1L0XA 3C09B 1NC4D 1CLOL 4XWOD 3O2DH 1KTLB 3FO1B 5ISZA 3VGGA 1L6XA 5LCVL 4J3VA 1H3GA 1CDUA 3NGBC 3BZ4B 1Q9OB 4Q9RL 4LF3B 3ULSB 1G6RL 1DDHB 5E1HB 5IFAL 4RX4A 5GHWL 4RIRA 1N0XL 1WGOA 1H3PH 3FB7A 4Z7QE 4MQSB 3Q2CA 1IC1A 4U6HA 5KANG 3T0DA 5I18H 1LHZA 1U3HA 2XOTA 4BYHA 5KAQF 3N0PB 4WFGE 1OOAA 5F8RC 2LVEA 1H0DB 1NSNL 1AKJA 2XN9B 4V1DA 4YXHH 5C0BD 5DLMH 4QXUH 3LS5H 4NO2A 4GQ9H 1CLCA 2VH5L 2VJXA 1BFVH 1S7WB 1YEHH 2OTUB 3ULUL 1GOFA 3LHPH 4PRPD 3I3DA 1YDPB 2NY5C 3CSYA 3LZFH 5GRWA 1J10A 4UINH 3P40A 1T83A 4ODSH 3VG9B 2K7PA 2IPKA 1QSFA 3T8XB 1YN6A 4G3YL 3LEVH 1EO8H 3MO1A 1J1OL 1V8HA 3U9UA 2HJKB 4LCIL 3ZT5A 1LK2A 3HG1A 4M4PA 4YHOH 1D5IH 3PHOB 3RWIB 3VFOA 4G8FA 5FOJA 4JFZH 1S7QB 4QRUA 4R0LA 4KRLB 5DMGD 5ALCH 3HNVL 3CK0H 5E94B 4NRXB 4U6YA 1UZ6E 2ZJSL 1N4XL 1T1ZA 1KB5H 1S7UB 4FMFA 2CDGB 4W81A 4MB4A 3RL2B 1NMBH 3TBSA 2BY3A 4YHIA 1KJVB 3H7BB 1VFMA 4FQJH 3PWLA 3GKWH 1PGRB 1GGBL 3EUUA 1S7VA 2GTWB 5TDOB 5IFJA 1HQRA 1KFAL 2CIKB 4YEFA 1AP2B 4UUJA 1NBZA 4FQCL 2JK5B 4X4XA 5A16A 3LEXA 1OTTC 1ULVA 1TJIL 2MSPA 1JGVL 1CDYA 5CHNB 3S36X 3IFPA 4HAGA 5D2NA 5H35A 3ZE0F 5J12C 3JV6B 3P9LA 1FNGB 4MQXC 1DBML 4M7KL 1C5DA 3MACL 5DJAA 2NY1C 1YY9C 5C8JB 4OUUA 1PVHA 4ENEC 5C0RL 2HKHL 3DI2B 3PABB 3BE1L 3BSZL 5HD8D 1IKFH 5HHMD 3WE6A 3OAZK 3WS6A 3RP1A 3BYTA 3QG6A 5IM7A 5TE6L 3FZUD 5JR1L 2C4XA 4PJ5D 3EO0A 2BSRA 1BJ1H 3DYMA 1EFXA 3GB7A 4PRAA 3MRPB 3CFKA 1RU9H 2QQNL 3HCVA 4KTYA 4WV1B 2I07B 1MFEL 4NDMA 5JDJA 2DIJA 1N0LA 1PLGH 3BXNB 2J8UF 2MCPH 1HILA 2VE6B 2OR9L 1KELH 4G6MH 3OAYK 2F15A 5D4QA 2YPKB 2HH0H 1CD8A 2BRRL 4K71B 4CNIA 1SJEA 5B4MD 2CLRA 2MQ3A 2M26A 4N0UE 1ZA6A 1D9KA 4PY7B 5FA3A 4DVRH 2R1WB 1I1AB 5GS0C 4GRWF 1CGSL 3VWKA 2JCCF 4UV7L 2CGRL 5GISH 1QLEL 1ZGLP 4B0MM 3SDDC 1AO7D 1W0VB 4JE4B 2F9BT 3V4VL 3WLWC 3L3OB 1U8HB 2MTPA 4J3SA 2AJUH 2V2TA 4FXGA 3DXAE 4P4RA 4XHJC 3BAEL 2YPLD 1KSRA 3PWPB 1CE6B 3U1SH 5BJTB 1C12B 4XC1L 3PDDA 5JOFB 2BK8A 5F3HA 4E41D 3QDHA 4JG0L 3EJZC 1QVOA 1U42A 2NZIA 4CADA 3MRJB 1NDMB 5KSVB 1I3RB 2NY4D 4Q6IB 3RL1B 2NY2C 5D7SH 3KWWA 2V2TB 3VFVB 1F4WH 3PJSB 5CMAA 4JFEB 2H6PB 1FLRH 3M8OL 2GTZB 4OLUL 2Z8VC 3W11D 3SDCD 3D87B 3D85D 4GBXB 2HWZH 2VNCA 1IQDB 4KY1H 4AQOA 3D69A 4I3GA 4RGNC 2JELH 4GXUN 2DAVA 2KKQA 4JN1L 4K07A 4F15C 3WFDL 5LBSH 4KPHH 4HMEA 4JPWL 1JHKL 5HI5C 5K9JH 4KMTL 4ODXA 4TUOB 3VRJB 1CD0A 4OGYH 4YZFF 2Y06H 5AZEL 5IBUB 2QBWA 4GG6F 4DKDC 1A3LH 4QCIA 4XCCH 1QSED 1JNHA 2EXYC 4HEPG 3AREA 5IESL 4YFLI 5E9DA 1BZ7A 1I9RH 3S5LB 2VKXA 3QXDB 5IBUG 4ZFOL 1XF5A 4PRIE 5I8KL 2VXSH 3PQYA 5DDHA 2G2RA 4XB7A 2B39A 3KPSD 4FTVD 4X6CB 1DQQB 1ZV5A 4XAKE 3NFNA 5JW4Q 3DMMD 4OZ4A 2IBBA 1JI1A 2PCPB 3L95B 4JO2H 3HMWL 3EOAA 2FDBP 3X3GL 4M62L 4BSVB 3TIDA 3MV8D 5BRZB 3V6FB 2GFBA 2ENSA 3TV3L 2VN4A 5AD0B 5ITBL 1NAKH 1CCZA 2W0FA 4P99A 5E4EC 4LDEB 4PREA 1A7PL 3IDIB 3P4NA 1ZLWK 4ETQB 3BVNA 3MYJB 2VLRD 1ND0B 2VZTA 4IRSC 1OF2A 4HUUA 1H15B 4I5BB 4JO3H 3QZWA 4EUPA 3DNKA 2GIYA 4NQEB 5FOBA 4U0QB 1AP2A 3FN9A 4IDJL 3G08B 2HFEB 5F9WC 2DQGH 1CDIA 2E9IA 3WD5H 4HIJA 1ACYH 3BWAA 2PXYB 4P2QE 4P4KC 1NFIA 1CBVL 4NBZB 1SM3H 1BREA 5JNYB 3FO2B 1ACZA 3UPAA 5E8DH 3G04A 3KJ6L 3TBTB 1LEGA 4PLNC 3MOAH 4KK9D 1NL0H 3MLVH 2V5SA 4MD4A 1IGFL 2MPAL 5DK3A 3ZTNL 5I18L 1DQQA 2NYYD 1MCDA 2BOBB 5HXMA 1ZHNA 2J2ZA 1QYGH 3D48R 3WHE0 2DMBA 3BW9A 2IH3B 5HHPA 4CUCA 2FJHB 4F15B 3F6LA 3HR6A 5DLML 1IEBA 2BSSB 3SPVA 4O2CA 4DEPC 4QF1B 4HIIB 1R3KA 4GKZA 2HG5A 3MGTB 2OZ4L 1MFBL 4LEXH 4O9HH 2L0DA 1FDLL 1MCJA 1JPTL 1O7VA 5DD6A 3S37X 4LLDB 3ARGB 1BFVL 3NA4A 3RDTB 3GSWB 1GVIA 3ZHDA 2XZAH 1T1WB 1I7ZA 4UINL 3UPRA 4FQQB 4JVUA 4GAGH 1YA5A 4O51A 1HZHH 4OLVL 3WUWB 1IZJA 3HI6L 1ZXQA 4QOKD 4KROC 4MCYA 5ADPL 3BUYA 3FKUS 5DRWB 4Y89A 3VWJC 3D39A 1ITBB 4UDUA 1A4JB 1PJ9A 4LFHD 4EKXA 3MRJA 4QTIH 4NIKB 3VXUA 4U1IB 1NPUA 2EDTA 4MAYA 4ZFZB 4OD1L 1BLNA 3TZVA 1CFTA 2H32A 3QDME 1FLTX 1LP9B 2AJZA 1AO7B 3WDIA 3V5DA 4YBLC 2HLAB 2XRAL 1ZOXA 1BMGA 4JPVL 4O2EA 5ANMB 2XFXA 1WFUA 4TTDC 2J12B 1ORQB 1X6NA 3UDWA 4YE4L 4WY7H 4FQJL 5E70A 1REIA 2DL9A 5F7HA 1G7JB 1GGBH 2KPNA 5D7KD 5T1LD 3IETB 4HEME 5LWYH 3BP7A 2AGJL 4HUMB 2BY1A 3ZZ1A 2AJ3A 4LQFL 4Z77A 3M45A 4YDVB 2X4RB 4JFHE 5C3LD 2BERA 3LN9A 1NBZB 3CFEB 4JQIL 1UH2A 4C55A 1AR1C 5FYLH 3BP4B 4L3EB 4LLVA 3ILQC 1PBYA 3HNTH 1A6WH 4N1CA 1A64A 3TA3B 4XHQA 4X7SH 2HMIC 4YHIB 3EO0B 2FIRT 1OP9A 4MDIB 3EDJA 3UCRA 4TUKL 1G9MC 2A83A 5DK0B 1ODAA 5EPMA 2XNAB 5H37H 4OF3A 2P5WA 3UJJH 3VGBA 3VFUB 3P73B 3MZGB 3TYFA 2GEEA 3OMZA 4L8DB 1ZLSH 1FBIH 2J8HA 1KTDB 1V3LA 4RMQA 1JGDB 3DVGB 5KSAB 4MJ5B 2HJKA 3QP3A 3WXVH 4OTXH 1PLGL 4NQCA 2PTUA 3FONA 4LLUA 3TN0D 3O4OB 5ANMA 4GG8B 4ISVA 5DO2C 3TZVD 2XA3A 1VA9A 2W92A 4M1CC 1OD7A 1DQLH 4DVRL 4WCYL 1MCCA 3AS3A 4OFYA 2ITCB 1CFNB 2DYPA 1Q72L 5HGBB 3MGOA 2NPLX 4HGKC 3NH7L 1NEZB 4KJPD 5J6HA 1AC6A 4HDIB 4G8GD 4ORZC 3MV7A 4XVTH 4JKWA 3LKRA 3U4EB 5J6HB 4E42A 2H8PA 1W2KT 4HT1H 3FTGA 3KAAA 3T0EC 3EO1A 1Q38A 2QQLH 4KK5C 3U1SL 2ITCA 3PL6D 3KYKH 1G7PB 4OLYL 1ADQH 1NDGA 1B4JH 3WYRA 3QWRD 5LXGH 2MMXA 2OP4H 2CLVB 4ZUVB 4YPJA 3ARGA 1VADB 1QZ1A 3H42H 1P6FA 5I1IL 4P9HH 5FCUL 1N7ML 5FO9A 3GSUB 3MA7A 3LSOA 3QB7C 4HMDA 1HH6B 1KF9B 1T22A 2D31B 5EFIB 3TBYB 2AJYL 4K3JH 4PS4L 2GAZA 3ILPB 3VFUA 1KJMA 5F71A 3U2SA 3NIFF 4YHNB 2G60H 3JV4B 1TZIB 4U1GB 4X7DC 3OR6B 4KU1A 2BVTA 4WTZG 4LDLB 4LLQB 4ORGA 1IAIL 1NGPL 3C8KB 4DN4L 2VZ3A 3U79A 1DBAL 3HAEA 5AZEH 5GS3A 4J3OC 3DX6B 5HYJE 4PV8B 4NO2B 2BCKA 3NCYS 3QUZD 4XCCL 4J1UB 4IOIB 3QDMA 1QBLL 3SE9L 3HE6B 2NNAA 3OJMB 4HHAB 4GRLD 4JRYB 4A6YL 2XG5A 1ZT1B 3DX8A 1Q9KB 3SDXA 3WFCH 1Q0YL 1U92A 4NUJB 4Y5XA 3TH3T 3STBA 1I7TA 3SJVA 1T04A 1MNUH 4XWOC 3MBEC 3PE9A 3OGCA 1MQ8A 2DRUA 4F37K 2D0FA 3BKJH 1IE5A 3TJEL 3FONB 1RZJH 4EXKA 5MEPB 1S5IL 3IXAB 1LO2L 1AY1H 3NABH 4NO3B 2B2XL 1J0ZA 2NY0B 3ULUD 3ZDYF 1CGTA 4G80B 4X5LA 3UTTB 5SWZD 3V6FA 3P73A 2Z92B 5HVFB 1WISA 4MA7H 3CCHB 3FMGL 3U36A 3ULVE 4ERSH 2F5AH 3OKMB 3VXSD 3WIHA 1R6VA 1KYOJ 1KB5A 2ZCLL 1CTOA 3E8UH 3JTTB 1RZIB 3B6SB 2HRPH 4PB0H 5EZOH 2L4OA 1S9KC 4IDJH 2BMKB 5I1DB 2NY2B 4XZUB 2CKBB 4ZOBA 4G43A 3N06B 1MFAH 4TSCL 5FGBC 5IG7A 1PY4A 5DMIL 3GHBL 2A6DA 6CGTA 3CFBB 1E4KC 3E6HB 3VRJA 2C3WA 2R29L 3CU7A 4RQQA 4XMLL 1C08A 1IGFH 2MPAH 1W0YT 4K7PH 4ZD3L 4Y19E 4KRMB 1JL8A 3MLXL 3H9SB 4EI6A 5F1NA 3X3FH 2LU7A 3MBXH 1NQBA 2HJFB 2ZUSA 3MRNB 4L8BA 4PGCB 1ZEAL 2YWZA 3IDXH 4JPIB 5E7FA 4P3CH 5CMAB 4AEIL 1F58H 4HIEB 2Y4SA 1EZVX 4WHTB 2R4SH 3PWJB 1JNJA 5DK2A 5EBLA 5DHVA 4N9GA 4ELKA 5I66B 1QG3A 1FSKB 4K71C 3CMGA 5GGUA 2YA0A 1EHXA 3QDGD 2XZAL 4YNYB 4ESKA 4P9HC 3DUSA 5F3HB 4D9QE 5ACMA 2Y72A 3L5XL 3E2HB 2PETA 3WIFA 1GGUA 3MRKB 3EDEA 4P0DA 4X99A 3PWUA 1MAJA 4PJIA 4L4TD 1IC5H 1XCQA 4DW2H 5DQDL 4FQLH 4M7ZB 5KJRL 1FJ1A 4UT6L 1IBGH 3JWOL 5IEKA 1YC8A 4NJ9L 1JIBA 2WQRA 3VWKD 3MMEA 5F72S 4MAUH 4F33B 4OQTL 4IIQA 2CXKA 4HLZH 3H9SA 2QV2A 1FCCA 4YBHA 1XGRB 4YAQA 2BNRB 2GJ6B 2P42B 2F54D 1CQYA 3TGXA 5SX4I 1JGEA 4LL9A 2YBRB 3C5SB 1ORSB 5EIQA 2EEAA 1RVFL 4OCXH 5DC4B 3ZMRA 1FFPB 4LGSB 4WY7L 3QG7H 2BSSA 3SPVB 2PO6D 3FQUB 5DGQA 3SDXF 5CKGA 3X13B 1AXSB 1G6RB 2Y23A 3QEQB 5E1AB 4LHUG 5DUMH 4R4FH 4S1QL 1FZKB 3WSQH 2ADIA 4LQFH 1ZAGA 3GSNL 1AHWB 4H1LA 3KLAB 2RCSL 5C0GA 1TZGL 3QFJD 4PG9A 2E7HA 1FL6B 3BWUC 4PJXA 3F12B 3CFDB 2R1YB 3WHE1 4LCCB 2IANB 4R3SA 3DIFB 2VDPH 1ZA3B 2RB8A 2XWBA 3QBTB 1GC1L 4F80A 1CLYH 1R24A 1PSKH 2R56H 2I60H 4YO0A 4Y5VB 5D96C 3CDGA 4GOSA 1WZMA 5F7WC 1NGWA 2O61B 1RUKL 1R24B 5LQBH 3SDDD 1Q9KA 3QCUH 4WFFD 3OR7B 4O4YL 2CRIA 1T80A 2LU4A 2CJUL 4RSVA 3OXRA 1MRCH 5FYJD 2Z93A 5MERB 1UJTA 5EUKA 2PYED 5CFHA 2GW5A 2C1OB 3PWLB 4N1HB 4Q9QL 1F3DH 4GAJL 2ZSWB 1GCFA 3JTSB 4NZDA 1I3RA 4NM4L 2C4FU 3JVGA 1R3LA 2NXZD 3QDJE 3OKEB 2UWEB 3UYRH 5DEGB 3X17A 4XNMB 3IJYA 4G9FE 2ZG1A 5DVNA 4L3EE 4IRJA 4KVNH 1WUNT 4HFUH 4LSRH 4DOHB 1SYVB 1EAPA 5GS0D 1EHLH 1BBDL 1T0MA 1JNHB 4I48B 1QFWH 4GQPH 5EDXA 4XVTL 4YBQC 3O4LA 3GMLB 2DLIA 4NBYB 4AEEA 1KEGH 4U1MA 2W60A 3U4AA 1YYML 3OKNB 4R4BA 1P53A 3RNQB 3D39E 1QLRA 1I9IH 2VIRA 4V2BA 3HB3C 4RGOL 5ENWB 4TUJA 4DFHA 2ICCA 4XNUL 1AR1D 3WL9A 4P9HL 2KQNA 3O3DA 2VDNH 1D9KD 4Q6IA 3RL1A 3MRPA 4QNPF 5CJ5A 1GXEA 5D7KE 3I6LE 4MLIA 4APQC 4C4KT 1G7IB 5KVDH 3NPZB 1CN4A 4MXQC 4M7LL 1BWMA 1RPQA 2HFGH 3VGFA 1YNLH 5CBAB 4YHNA 4Z7OF 5J0BA 3GMOB 2OI9C 5IMMA 3QEQD 5CD5C 4LCWE 4LIQH 4U1JA 4PJ5A 4LLUB 1BVKA 3Q1SH 5IJVB 5F9JA 3VGHA 5CEXA 1ZHBB 2ARJB 3EOYG 1W0VA 3U9PH 1Y18B 5HPMA 3WUZA 4OD3L 3BPNC 3SKJH 3MV7D 5L7XH 3T77B 3GGWB 4L29A 4CNIB 2YA1A 1RZKC 5IMKB 3EO1B 1N6UA 5GJSL 3K8MA 4FXKB 5B8CC 4YUEH 5C0JA 3N1FC 1FAIL 4ZS7H 2H8PB 4MCZB 4RMVA 3FRPG 1F6AA 2AVGA 3VJ6B 3KYNA 3C6LC 4OIAA 1L9NA 3C5JB 2CKBH 1NLBL 3OHXB 2J8UB 3VXME 5C6TL 1S9XB 3KPMA 2I5YH 1CLOH 4M6NH 4NM8L 3UTQB 1IMHC 3B6SA 1VEOA 4LPVA 3V6OE 3A67H 3WE6B 3PP4H 4Q2ZB 4XCFH 3PDOA 4DKFH 2DQJH 3K81A 4RMSA 4LVHC 4P46B 4UIMB 1NLDL 2C4FT 1QUNA 3P9LB 3Q6FB 4WW2A 4TSCH 1BBJB 1BGXL 2IFGA 5BCAA 4LSPL 1J05B 1NSNH 1VESA 5DUPL 1MI5A 4H8WH 3OAUL 4XMLH 1AO7A 3LRHA 3HZKA 5JHDA 3KPRD 2JB5L 3FB5A 2D3VA 3CFJA 4S1RH 4WJ5B 5F1SA 3OV6A 1G7IA 4ZOCA 3SDAB 4G7YL 4G6JL 4ZG1A 1OWRM 2BCKB 3KYNB 4JLRB 1I4FA 4Q7DA 2F19L 3O3DB 4P3CL 2R2HB 3NFSL 5B21A 2SEBA 3OZ9H 5SV4A 1KPUA 4G3YH 3ZKND 1T1ZB 3LEVL 1WICA 3UMTA 1IEAA 3QUYA 2UY6A 5E24E 4FXLA 4YHLH 4OKVA 4YHOL 3SE4A 1IEHA 1E6JH 3T0EA 4JQXC 4JFFB 4PGJA 2Q86A 3ARUA 5EZIL 4XT1C 5FO9B 4DW2L 2HFFB 4UT6H 5F9JB 2XIDA 2NY5H 4ZUTA 1V05A 2AXFB 1KB5L 1IEBB 5IKCB 3DX9A 3VXUD 5ICZA 3E3QE 3MUJA 3PQYD 2W9DH 4Q6IC 3KXFA 2J8UE 3VXMB 2LAGB 1XGYH 3H9SE 4JFHD 1T7XA 1W0WB 3HTLX 3CXDL 2GI7A 1S7WA 2DM7A 3KVQA 5IHUH 4XMKL 1QR4A 1G1YA 4D8PB 3WDHA 5KW9H 1OARH 4PJXE 1XAUA 2QL1A 1R5WA 3DXAB 3CXHK 5JUEL 3EO9H 2UUDK 4KHTH 2R9HD 3QG7L 3H8NA 3IFOA 1D5BA 2V6HA 2B5IB 1MCLA 1TJIH 5J12B 1R5VB 4NUGL 3VFPA 3LIZL 1JGVH 4HS6A 2VC2L 1B0RB 4UNUA 3D18B 1KCUL 5DD1L 4U6HB 5EU7C 1OF2B 4HUUB 4I5BA 4GG8A 4GAYB 4K94L 5T3ZD 1U8OA 1XT5A 4YO0B 2FX7H 3BKCH 5A40E 4Y0GA 5ADOL 4NQCB 3ZTJG 1MREH 3NN8B 3SDDB 4FQIL 3BZ4A 1JPSL 2YD2A 3NA9H 4BZ1H 1AGDB 1JYNA 2V2WB 4PJ9B 5DO2D 1MCEA 3LQMA 3LMJH 3RNKB 4OV5A 3P77B 1FRGH 2ZOLB 1NJ9B 4WTZA 5IW1B 1XF2A 4OAWB 2XICA 1ZLWH 2FCBA 3KR3H 3WO3B 1RUKH 2CK2A 2Z31A 5EULV 1A9EB 5LQBL 2F54A 2Y5TB 4X9IA 1A6PA 3SQOH 4KRPB 1F11A 1K5NA 2F53D 5EOQL 1KCRL 4L3EA 3GO1L 3V6OA 1FZMA 5I17B 4HC1H 2XG4A 1WBZB 2NY4C 5I16B 5E08L 4Z7VE 1U8MB 2CGRH 2Q87A 1H15A 3V4VH 3NCMA 1DBKH 1XEDA 4GRWB 3SDCC 1AGCB 2Z0BA 1MJUH 1XGRA 2IG2H 4X98B 4KJQC 3KPTA 4M1CD 2HA1A 3UYOD 4ZODA 3QXTA 3K0WA 2X4QA 1XF3A 3LCYA 4N0UB 1U41A 1Z9SA 1YPZF 2F53E 2J3SA 1V7MH 1JE6A 3OKDA 3KWWB 4HQQH 4M8QA 1EJOL 3B2UD 4K2UH 3AB0C 1A7BA 3WO4C 4HKJA 5D7SL 1QVOB 1YYMH 3OJ2C 1LP9A 1RUPL 5DD3L 1BLNB 1PX3A 2ADIB 2AP2A 2KDGA 2BC4A 1I9IL 5TDPB 2IMMA 2HWZL 3ZKMD 3ZE1F 2EIZB 5E9DB 1TMCB 4ONOA 5DRXA 3AREB 3H3PL 2M2DA 4OZFH 2VDNL 1FFPA 4PJ7A 3AU1B 3L3GB 2B0SH 5TH2A 5ENWA 2VLMD 4Y5YA 3ZSSA 3LY6A 1HCFX 4DK3A 3HUJE 4XWGL 3LN4B 1J87A 2QKIA 3D85A 1G9EA 1RUML 1ED3B 3QHZH 1U58A 4M7LH 3KYMA 5T3ZH 1I8LA 1YNLL 1LD9B 3O9WD 4KGJA 2HN7A 4U3CA 4MNQB 3E6HA 3ARBB 1X5IA 4Y8AA 2VXSL 4YHYC 2GTZA 4L8SA 3JVGC 4LNVA 4MS8D 1NBQA 1BPVA 4X5WB 4LEOB 3QUZC 5IHZB 3V9FA 5GGSY 4CVXB 4RAVB 1CYGA 1BFOA 2DLTA 2NXZC 3KNBA 1IAMA 3MRBB 1C12A 3OKEA 2GITB 2BHZA 1HHHB 5GJSH 4NOBA 2X9WA 2I9TB 1T5WA 1UT9A 2Q6WB 5DHVB 2AEPH 1HWHB 3MBED 5L2KE 3AXLB 1AE6L 1CDCA 1UVQA 1NUFA 3BP6B 4YK4C 2J1KA 4R7NA 5HHXH 4JO3L 2WBJA 2QQKH 5I76B 1OQOA 1LEIA 4YDIH 3UP1A 4GXVH 1MCBA 4ZXBD 3OWEA 4DGYL 2WLZA 4NRYA 6FABL 3LRGA 3HUJF 1AGFB 1NGWB 2O61A 3QDJD 4F8QA 3A67L 4E41E 2XPGB 2AEWA 1U3ZA 3P4NB 4ETQA 1KXVC 4GW4B 3TNMB 1FHGA 3BZDA 5DJ2A 2VL5B 3CGTA 4RFNC 1AKJD 4V1DD 2W0FB 5CILH 3ZT6A 2EDRA 3MOAL 1NLDH 4R3SB 1I3GH 3ZKSD 3QUKB 3ZDZE 4YH6A 3RZWA 4I2XA 5T1MA 5E9DE 4P23D 1Q8MA 4HWZB 1BQLH 2YMXH 3R06B 1RZIA 2APTA 2FZ3B 4Y5YC 2DQDH 1AHWA 2LTQB 3OAUH 3O9WB 3N1GC 1U36A 4KV5F 4PJBF 4G6FD 4X6CA 4YDJB 3EYOB 3O3UN 5HHOE 5DJDB 1GYAA 3QEHA 2XXMB 3R1GL 1JPTH 3RZCD 1T5XB 4MA3B 4LPUA 5ID1A 3B9KB 2XY1A 1TJGH 2FJGB 3WN5A 3IFLL 3QO1B 2Y25A 3GSUA 3MA7B 4IIQC 2F19H 5C08B 3CX5K 3Q6GL 4ZUUB 1ZGLA 3OG6B 3ZT7A 1SEQL 3ARED 2YBRA 5L88L 1AIFB 3BD4A 3L3HB 4ODXB 4QHUA 4NC1E 5ADPH 4DTGL 5A16B 2IPKB 4F3FA 4KDTA 1XGUA 1K4CB 4PJCB 4YHLL 3QHFL 1QO3B 3ZKXC 2OLDA 5J3HC 3EGSB 2P46B 1F4AA 3RJQB 1WEJL 4H26A 3MZTA 1ZLVH 5DHXB 4TVPL 3U7YL 1UKTA 3L3JA 4NN7C 1NEUA 3HPLA 1DQDL 4U6XB 3SKMB 3MV7B 2OI9B 4NWTL 2AV1B 2NY5L 3S4SA 5B3JE 2HVJB 3OAYH 5FXCH 3RY4A 4I18C 3GI9L 5DVKA 5C09A 4F7EB 5C0CA 2OL3H 3O8XB 1MHEA 2X1XR 1QBBA 3RPKA 4R26H 4YE4H 1XGYL 4K9EL 3V7MA 4NC1C 5GGUB 2W59A 3MV7E 4EQ3A 1Z5LA 1FYTA 4XMKH 1IC7H 5LWYL 2AGJH 3MJGX 2IAMB 3LSOB 3LN5A 2ZG2A 5IT2L 3D2UD 1H8OA 4LF3A 4KC3B 4PGEB 3ALWA 4X6FB 2PO6C 3UTSD 5E6ZA 1PD6A 1HHIB 4QXTA 5FYLL 1RMFL 3SE3A 1ZTXH 4TSAH 1MJ8H 1D9KB 4QWWC 3RGVB 1F3JB 1KCUH 3RA7H 2ID5A 2VDLL 4Y2DB 3C5ZD 2APWA 4QXGL 5FO7B 3MJ9A 3D25A 1G0YR 4B7IA 2FEDD 3OXSA 3RQ3A 2I07A 1XR8B 4S11A 1RZGB 1A6AB 5JW5A 3STZB 1B3JA 4ODHH 5GGSB 4AMKL 1JRHI 4KV5E 4NKOA 3Q0HA 3ARXA 3CFJB 4Q9BA 1ZLSL 3NIGF 1MF2H 1SBSL 4HBQA 1U3JA 3QPXH 1WZ1L 3VFNB 4ZOEA 3W39A 3TWCL 4GG6A 2HVKA 4NZTL 2D7TL 4L3ED 1WLHA 4XBEL 1MCKA 3SO3B 3U82B 4RIRB 1NC4A 4BFIB 2P48B 5BV7B 3SQOL 4HK3J 4NHCL 4K3GA 1BBJA 2FHCA 5IB2B 3KG5A 3NPSC 1NUGA 4ZTPL 3MLZH 4MZ3A 1ZS8B 4X7TB 2V5TA 5ISZB 1J7VR 1NFDB 1NH6A 4J8RA 1I1AD 2D2OA 5EPMB 5B39A 3UJTH 1GH7A 4Q2ZA 5CP3A 3SJVB 5T1LB 3PHQB 1HQ4A 3O45A 3OBAA 4HIXH 2YN3A 4MXWL 2ICWI 3UTQA 5D93C 4CMMA 1G7LB 3VXUB 1JVKA 5DFVC 1P69B 1U8JA 2QQLL 1G7MB 1MHPL 4J1UA 1EDQA 3RIAF 4YBLB 3FOMA 1XR8A 3QIUA 3B9KC 5ID0A 5F7LB 5LAXB 4DZBB 2OP4L 4PLJC 1DBJL 5E2VL 4JY6B 2BSED 4ODUA 1HEZB 1MCPH 3VXUE 2CMRH 4PJDE 2CUIA 4J3WA 4YDVA 5CD5D 4U1KA 2AKRA 4L5FL 2E8YA 3AY4C 2EDDA 2ZUWA 3MRIA 3VXTB 2H2PC 3IETA 1T22B 4P23B 1A22B 4NO0B 4NQDA 4UZGA 1RZFL 3MGTA 4R8WH 3SKUD 4KTEH 4WU7B 1BJMA 4P3DB 1FZJB 2B0SL 4KKLD 1P4IH 3TT3H 4FQXA 3RDTD 3ARDC 1DBAH 1Q9LB 3SDAD 2YD7A 1M6OA 4UILH 5KOMC 3U7AA 3I9GL 4LRNH 4WWKC 2QADD 5CGYD 5TE7H 3QCVL 5DYOB 4O5LL 2H2SC 3SE9H 3I6GB 1TCMA 1QBMH 4IHOB 5C09B 4NBXB 1VGEL 4LMQE 2ED7A 5F88A 1T83C 5T3XL 2VLRA 3RX7A 3HAEG 4LARL 1A4JA 3VE0B 5JNYA 4JR9H 4TUJB 3O4LE 3VCLA 3L1OH 3LQAL 4G6KH 4ZUWA 3BKJL 4P46D 2HKFL 1IL1A 3MBEB 4LLMA 1S5IH 1VPOL 4LKCB 3LEYH 4FQQA 2A2QT 2Z8SA 3MJ6A 1I7ZB 4YHZL 4CKVX 1WBXA 1EGJA 2F53A 5EU6A 1K2DB 4C56B 1J18A 4EBQL 4JVWA 2Z8WC 1WCBA 3WIHL 3TPUA 1NCBH 3BPCB 1UGNA 4XC3H 4Y4FD 1EO7A 3EIFA 1AFVH 5CZVL 2NTSP 3DVGA 5KSAA 1YN7A 1T0MB 3O2WL 4D3CL 4ONGL 2HRPL 2CDFB 5H2BB 1CGVA 5HYQA 1X5KA 1SQ2N 3FQRB 2DIBA 5IROA 4JDVA 3C6LB 3VFGL 3PGCA 4Z5RB 4QY8A 1IM9D 2F8OA 4P4KA 5F9WB 2UWEA 1RJZA 2A83B 3FB6A 3EZJB 4K8RL 4NQVB 4QYOA 5HGGS 1IJ9A 1MVUA 2FYYA 1X5YA 1DQJB 4U1NB 1FCGA 4FFZH 1YQ2A 2Z93B 3VXQB 2HTKC 1TVHA 2XN9D 3WN5B 4G7VH 1K3IA 1D5MA 4MJ4A 1YPZB 4XP4L 5CCKL 1PZ5A 2DLEA 2YMXL 4LK4A 3TH2T 5DJDA 4N1EA 3S35L 4ALAH 4NNPH 1EXUA 4ZSOE 3NIDF 2JCCA 4OCLC 3GJFB 1JZ7A 4HLZG 4NNXB 4HGWB 3IU3B 4Y16B 3BQUB 5KG9B 4WFHE 5BZWA 1TJGL 4BZ2H 4OV6F 3S96B 4UAOB 1UA6L 3X11A 2EO1A 4N8CH 3SY0A 1H8SA 1KC5H 4I18B 4GMSH 4B41A 1MAKA 4BQCA 1QPPA 4MDJA 1HXYA 3MRLA 4MNGB 2OL3A 3HN3A 4R6UA 5I8CA 3P4OB 4IRZL 2QR0A 3QXVA 1GZPA 2BVYA 4CL7A 3ARTA 1CXKA 4X0KB 4P2OC 4NZRH 3QR2A 4R7NB 2P5WD 3M17A 1M7IA 3RVUC 1P1ZA 1MWAL 3AXLA 4OT1H 2FR4B 2VDKH 3WKMH 4LCUB 4C56E 3I85A 2FH8A 1DLHA 2YPVH 2A1WH 3OJDB 1U58B 4U6TA 3HKFA 12E8H 5F1IA 1T2JA 2A9NL 2O5ZH 2HRLA 1FFNB 5CBEA 3RVWC 2YPKA 2NXZB 4W4OC 5J9PB 1RJLA 4PJ7B 2QSQA 3WEXB 1QSEE 5IT2H 4GFTB 4PJ8A 3PWUB 2ADJA 2EIZA 1OAYL 4FNLL 3C9NA 5F97E 3WJLC 1IT9H 5D7IF 5HJ3B 1QFOA 3RA7L 1WIUA 3T3PE 5AEAA 3GM8A 2VDPL 4JO4L 4HZAA 4U7KA 5J1AA 3CZFA 2ATPB 3ZDYE 3ULVH 1DVFA 3WDJA 3K80A 2BOCB 3MRCA 2I60L 4Z6AT 5EU3A 1M7IB 2J7LA 4OIIH 1VCAA 2EDEA 2EIEA 3PL6B 5F1OB 4GKNB 1EEZA 4PRBB 3EFDL 4Y1AE 5HYEA 5JHLL 4P49A 4WEUD 4KRPC 1CWVA 4NPYB 1C08B 4G8GB 3QUML 3BVNB 3QPXL 1JK8A 1KUMA 3CH1B 2D7TH 3O3AB 3N1PC 3BH8A 4NM4H 4TNVK 2E9BA 4LVOC 5I74C 3UBXA 1VFAA 4DKAA 1J8HB 3OTTA 3W9EA 3MRFB 4OZIB 1QRNE 4G43B 5F7EL 1OPGH 4QHLA 3EHBD 2A9MH 1B2WH 2IF7A 1OGTB 3PGFL 4L4VD 4AL8H 2A6JA 4KVNL 5CEZE 4HKBB 2HT4D 4JFPA 4X8JB 3A6OA 2FO4B 4JZOB 1T03L 3UJTL 5KSAD 3HMXL 5IW1A 1JNNL 5D2NC 1OAZL 2ZOLA 4Z7WB 5LKNA 2BVOB 5MENE 3O3EA 1PZ5B 5C8JA 1IFHH 1KEGL 4G8FB 5CLWA 1C5DB 1PYWB 3L5HA 4KK6C 1F6LL 3FN3A 4LLYB 1KIRA 1Q94B 5IWLC 3LRSB 3GMRB 4PRIA 5IJKC 1S7SB 1UB5B 2AEQH 1D5ZA 1FO0H 2I9LA 4JM2B 3TVMD 4OCWH 4IS6A 3LKSB 3JWDC 3RWHB 3KLHD 1IAII 4OAWA 4M1DH 4Q74A 1QD0A 3PGCB 4Z5RA 4CDHA 5TDOA 4O58H 2JF1A 3G5ZB 5I15L 1TETH 2FEDC 3ZKMC 2DQTL 4KTEL 1XGTB 4ZUSB 5JQ6H 4JKPL 3X12B 1S7RB 4OGAD 3W5MA 3K3QA 4PD4J 5L8KB 3G6JF 4PY8I 3V5HA 4P2CG 3F58H 3ROLA 3H9SD 3RWGA 1XH3B 1M7DB 4LRNL 1RZ8B 1QQDB 4DWHA 1FNFA 4LPYA 3QULB 1T89C 1NKOA 2R2BB 3QCVH 4WW1A 3PWPA 2DMCA 3TA3C 5DJCB 4RDQG 1VGKB 1FH5H 1S7QA 4QRUB 3TT1L 2EH7H 4LKCA 1F3DJ 3RWIA 3VFOB 3QQ3A 5C9KA 2D31A 3D5OF 2DTSA 4ZO8A 4OD3H 4F7CB 3MV8A 4XP5H 1JP5A 5LGHH 4AZ8A 2VSCA 5MEOB 3O6ML 2DQCL 1VKXA 2P5WE 1RIVL 5HHOA 1P7QA 1EEQA 2CR3A 3LKNA 1GGYA 4ZUVA 2IQAA 4NC0B 4FN0A 5JW4R 4YHZH 1F4XH 1XCTA 4J4PD 4WGVB 1NCAL 4R4ND 1HILB 3F7VB 4PV9B 4UT7L 2IALB 3PWNA 4PJIE 5D8JH 5I1LB 5KVGH 1I4FB 4HDIA 1NANH 4XTRC 3QO0A 4XNYH 4OIBA 2X09A 1U2CA 4NQDB 1MCIA 3CJJA 4HLJA 1TTFA 4YIQB 4EN3C 3PP3K 2WUCL 1JF5A 1JYXA 2IJ0C 2WQ8A 1VGKA 5GGTA 2APFA 3UTPD 3VFRB 4EN3B 4MJID 4PR5A 1GOHA 3LS4L 3O41B 3DO7B 3I3EA 5EBWA 3T65A 1PKQA 4OZHB 5KSBB 4RWHA 4U6VH