5GIRA

Crystal structure of a fab fragment with its ligand peptide
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
213
structure length
207
Chain Sequence
EVQLQQPGAELVRPGASVKLSCKASGYTFTSYWMNWVKQRPGQGLECIGMIHPSDGETRLNQKFKDKATLTLDKSSSTAYMQLSSPTSEDSAVYYCTTHFDYWGQGTTLTVSSAKTTAPSVYPLAPVCSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heavy chain of Fab fragment
publication title Structural basis for multi-specific peptide recognition by the anti-IDH1/2 monoclonal antibody, MsMab-1.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 44
structure length 207
sequence length 213
chains with identical sequence H
ec nomenclature
pdb deposition date 2016-06-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5girA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5girA02
1NDGA 3MOBH 5FKPA 3VE0B 5C0IB 3U0PA 3HE6B 1I9RH 1A14H 1KGCD 1T1XB 3IKCB 2CDGA 1HCFX 3CIQA 4EUPG 3FHQA 1I3RB 4QHNA 3TH2T 5D1QD 5DDHA 4F15C 2I60L 3GSWA 3OG4B 3EYVA 4RNRB 2I9TA 4TPRL 4FP8L 4P3DB 3ARXA 1KFAL 3HFML 2L4OA 1QR4A 3RL1A 1QEWB 3ZE2F 1BFVL 1FL6A 3DRQB 3O9WB 3S5LB 3O41B 2CQVA 3NH7H 3S3PA 4QRPD 5BS0B 1N4XH 4XVSH 1IC7L 4PD4J 4Z78B 5I75B 3QIUC 3E6HB 4WO4D 3MLPA 4KK8C 4HFWA 1F42A 3QNZB 3SE4A 4LSVH 4OFDA 4GS7C 2VB5A 2JCCA 5MI0C 1UWEL 3BRDA 4PV8B 3QIWD 2QQKL 3VFMB 5C0CB 3RNQA 3K80A 2HJKA 1RZGA 3OXRA 4LSSH 5GHWL 4N8VG 4HZLB 4LLUA 4DK3A 2LAGB 3F7PC 3ARZA 1ADQL 2FIRT 1F13A 3HI1A 4L8SA 4OLYL 4KRPD 3QUKA 4ZG1A 3ZE1E 4CVXA 1MFDH 1OSZA 2EDLA 5E1AB 1HQRA 1TVBB 2XFXB 2YSSB 3P4OA 3TBTA 3RIAK 5IWLA 2A0LD 1OTSC 1NAMH 4LHQB 5ETUB 3PABB 1L0QA 2WM0A 3LN4A 1MI5D 1PQZB 5I1DB 4QRUB 4IJ3B 1UKSA 3U4EB 2EO9A 3RTQD 4QOKB 4XNXL 3VGAB 1YQVL 4PJFF 5MHSE 2IQAB 3ARTA 1H3GA 4PJFB 4BH8A 2AEQL 2I24N 5HHPA 1NAMB 5IB1A 2JELL 3BAEL 1F3DJ 3D85D 3CLFH 4LVNB 2NTSP 5FYLD 3O45B 2YD2A 1DLFL 3PWLA 3QFDB 3ZL4L 1B2WH 1AGEA 4L4VB 4NKDA 5DA4A 4EOWH 1H3XA 5HVHC 4M7LH 5T1DH 3SO5A 4TNVK 4KJPD 1KLUA 3UJJL 3H9HB 4YIQB 1WAAA 3HN3A 5JHLL 3VXRB 3MLTA 4ZQKA 4NQDB 5IJVB 5DZLA 5E2WL 4XPAL 1Q9LA 2X89A 1F45A 3BO8A 4QF1A 2GJ6B 5DQ9B 4TSCH 1I7TB 5F9WB 4OGYH 2IF7A 4J1UA 3FQXA 1LDSA 2LVCA 2QHRL 2VDQH 3MXWH 3LD8B 3V9FA 4HFUH 3EW3B 1XFPA 3M45A 2AV1A 1NAKH 1UM5L 4GAYA 3FOLB 5EA0H 5E9DD 2W9DH 3EJZD 1E6JL 5DJ6A 4OI9A 2VDLL 3IVKB 1CGTA 5D2NB 4UQ2B 3REWA 1QFWH 4PUBH 3AUVA 1WTGT 3LPWA 5CJQH 3T4AA 4TRPH 4JFOA 3B5TA 4PB9L 3X11B 3ILQD 4NHCH 1B88A 4HQQH 4NN6B 4Z95L 1PYWB 3MV9A 5IBLD 3TJEH 5EIIB 3L5WB 3WS3B 3EO1B 2F8XC 4TOYL 1XGQA 4FFYH 3OJ2C 3L3HB 4LSPL 2D03L 4O2FA 4AIOA 2JLLA 5D1QB 3SE3A 3M17A 4XNZC 2BNQE 2AQ2A 4YXLH 3LV3A 3HZMB 4EN3A 3QXTA 1HHJA 2PTUA 4OLUL 5DHYA 3U48A 4QEGA 2DQJH 4X5LA 2IAMC 1SMOA 2BFVL 3X12A 2J4WH 4H88L 4QRPB 5C09D 3SPVB 5ICXA 2E7LA 4O9HH 2HMID 5IP4A 1C12A 5HGAA 1XIWD 3KJ6H 3HS0B 4J6RL 4WO4B 3VFPB 4ETYA 4RWYL 3DHJA 3QUZC 1A9BB 4WFHE 4FQ2L 1LO3L 4NQED 1T5WB 3QI9D 2OK0H 5CEZL 3RGVD 4MB5A 2GEEA 2BNUB 4WFGE 4NNPH 1CL7L 3LRHA 5HDQL 3BPCA 3QIWB 2CUMA 4HIXH 1N6VA 3OKNB 2BVUA 3X13B 3AREC 5AUMB 5CD3B 1T1ZA 4YBQC 4KI5D 3ARGA 4DZBA 2MHAB 3EHBD 1QHPA 1DL7L 5KJRL 2VWEC 4KRPB 1ZTXH 2D7PA 3PWJB 5DVOA 1G7PA 4UUJB 4JJ5A 3H9SA 3LKRA 3S35L 4EIGB 4XCCL 5ESQB 3L9RB 2MWCA 4RISL 3RWCA 1P6FA 4ZS6D 2DQGL 4K2UH 3RNKA 4JM2F 4FTVD 4G7VH 3CVIH 1QFOA 3SDYH 4XXCC 2R1YA 1B4RA 2VITB 1QFHA 2X4TB 5FYLH 4R8WL 1TQCB 3PP3H 5JXAL 4U1LB 5CP7B 1MI5B 5F7MC 5DD6B 1OAZL 1DBJL 4C56A 4MJ2A 2E6PA 3RTQB 1F02I 2NY3D 4MA8L 1TENA 5AZ2L 1KIQA 4M9OA 3EO0B 2XZCL 1J0YA 4S1QL 1DQTA 4YHLH 3D85B 3IKKA 4WI4A 4HSQA 5CILH 3SEPA 4GW5A 2ZUQB 3WFCH 3Q1SH 2DQFB 1OM3L 1XCQB 4XBGB 1L9NA 3H2WA 3WKMH 4QT5B 2NY1D 2UWEA 3FQNB 4HKXB 4RX4D 1U6AL 3U9UB 4OCLC 1KIPA 2BSTA 1ZANL 3BSZL 4PTTB 3LCYA 3M8OL 3L7FA 3IDJA 1U8LA 4ODWA 4PJ7A 2H26B 3D2UA 2CLVA 1D5XB 1OT1A 4WEBH 3CSYA 4Q97A 1DQDL 2DDQH 3QFJE 5HI3D 2C9AA 4NRXA 3S97C 1UC6A 4KVCL 4JFPA 1MCQA 1YEGL 2V17H 1A7NL 3D18B 5E9DB 3OJVC 3V0WL 3W9DA 3PIQB 1BQSA 2C4FT 4NT6A 3VRLF 2QSCH 3OJDA 1KPRB 3QEQA 3TIDB 4X5XA 1EERB 1PLGH 2JJWA 4J3OC 5B4MD 1UM4H 3H9ZA 5JXED 1FNGA 3T77B 5A16A 1LO5B 1JPGB 1JUFB 4JZJB 5D1XD 5HYQB 1J05A 3K1DA 3NOIA 1IKNC 1OW0A 3UO1L 5MERA 3OKEA 1UQSA 3OKKB 4XNMA 5I8OH 2F58L 3P11H 5BRZE 1A3LL 1E27B 2A9NH 1NFIB 1IQWH 1D9KD 1EHNA 3HI6L 5JOPE 1DZBA 2JB6B 4ZODA 4LK4A 1IT9L 4DKEH 1GYAA 4LOUC 4PJ5E 5EUOA 1JTPA 2YN3A 2ED9A 5GZNC 5C09B 5B39A 4WW1A 1XGUB 1CWVA 4XWOD 1FNEB 1XIWB 3NFSL 1L0YA 1ZHNA 2FGWL 2FX7H 5E2UH 3MRHB 3QWRA 5T5NF 4NQEB 3QI9B 3C6LA 3FCTA 3RGVB 2A83A 3B4NA 5SX4I 1X5LA 2ERJB 4HWBH 1F6LL 4XC1H 3ARBC 3MRCA 1MEXH 4AJ0A 2VIRB 2X4RA 4Z0BL 2KDGA 3AB0C 3PV7A 4HGKC 1N7ML 1D5IH 4P46C 1MELA 3BVNA 1G1YA 4L8DA 5CBEA 1N8ZB 4FQPA 1VFUA 2ICEB 1U3JA 1IGTA 4HBCH 3TT3L 3MCLH 3U9PH 3P77B 3QO0A 4U1GC 3BHBA 5JPMB 1DQLL 5BCAA 3EDKA 1VESA 3LKQA 4YWGH 4DVRL 3C9NB 1G9EA 4AEIH 5HYSA 3LIZL 4PJXB 1EJ6A 1RD6A 1HZHH 2PR4H 3LPFA 3TO2B 4GAGL 3DPBA 4FTVB 2VYRE 4I0PD 4RBPK 3F7YA 2P7TB 3VXQA 5KTEH 4CMHB 2BVEA 3MCG1 4UNTA 4OIAA 1MJ8L 4HHAB 4OCSH 1HHIB 4D8PB 4OD3L 1N5AB 3FQRA 1WZ1H 5E5MA 4JANB 1C5BL 5I1HL 4DZ8A 2LTQB 4WHCA 4LF3A 5LAXA 1BVKB 1ZVSA 5J1TC 2GCYA 2NY3B 4HJ0D 4KQ4H 3BP4A 3G04B 3O3AA 1DVFA 3T2QA 4X80H 2V2XB 1YEIH 2P8PB 2YKLL 5AG9A 2BC4A 2CR6A 3QQ3B 2OBGA 5IFAL 3L3KA 3PWUB 4KKAC 3WXWH 1DEEA 4HIIA 3NCJH 1BZ7B 1I1RA 1Q38A 4KZDL 3ALPA 1WISA 4LCCA 2Q7YA 5DJ0A 1IM9D 2NY1B 4Y2DA 1FDLH 4PJGF 1PD6A 4Y5YC 3SE8H 3LKOB 4QYOB 4L9LB 3LDBB 4JFXB 4JVUA 3MRFB 4PJGE 2XKUA 1JGDA 4PB0L 5IMMB 4YGVB 4LNVA 5MEQB 2H32B 4A6YA 5D8JH 3EOTH 1K85A 4LVHC 3QXAA 3JWOL 5GS0D 3WLWC 4LP5A 4RGMB 4ONFH 3EOAA 5L7XL 1UXSA 4F7CB 1NBYB 2ZJSH 1BGXH 1T0MB 3E2HB 1BQHG 1KJVB 1WGOA 2IH1A 5LBSL 1N59A 5D7LA 1U8JB 3GRWL 4OBRA 2BHUA 1FJ1B 1CIUA 1IAIL 3NAAH 2YC1A 1S7RA 2BY1A 1WFOA 3NABL 4HK0B 2C3VA 1LEIB 3BJ91 4OZ4B 2E7HA 1LP9A 3BEVA 2VABA 4G8IA 3MC0A 4P2RE 4NN5C 2Y36L 4M6MH 4YK4B 4L29A 1PGRB 4JPWL 6CGTA 4M7ZB 5ESAB 1QUNA 3BKYH 3C5JB 5F7YC 4KMTL 4PRHE 1D9KB 4V2BA 4KV5F 2X89D 3MREB 4M03A 3DXAD 4PJHB 5DJDB 2Y23A 4KV5E 5FO9B 1NEUA 2X10A 1VHPA 4S1DD 1FNSH 1OGAA 1Y18B 3HPJB 5F7DB 1T04B 1BF2A 3DMMC 3GHBL 3KAAA 4ALAL 5F6HJ 3P4MA 1NDGB 4WGVB 5FKPB 2W91A 1LDPH 1BZ9A 1P5UA 3BEWA 3MV9D 1JYVA 1HI6A 2VXVL 2V6HA 1A8JH 1JPST 2DQCL 3VWKC 3QT2A 2CDGB 2YMXL 4QHNB 1KN2H 3OGOE 4ZS7L 5DDHB 3TT1L 3V0AC 1ED3A 3GSWB 3EYVB 3IAPA 5DJ8A 4D9RD 3CMOL 2I9TB 5IBUG 4F33B 3KNBA 4PRIA 4PJEE 3RJQB 1A6PA 1KEML 4K9EC 5SX5K 4R9HA 4EN3D 1WWAX 2DM3A 4F7PA 2B0SH 4Y1AD 2R2HA 3NIDF 3KYNA 3DSFH 2D2OA 4I0PB 4E5XA 3VWJA 1BBJB 1WEJH 4OFIA 1U8PA 2HFTA 1T7XA 3QAZB 3HRZA 4XP9L 4J3SA 2JCCF 2XTLA 4M62L 3BJLA 3T0EC 1A3RH 5GRWA 3JV4A 1GCFA 2JCCB 1X5GA 5F1SA 3ZT7A 5J1SC 1JMZA 1TJGH 3HG1E 1UFUA 1NCBH 1S78C 3PP4H 3RNQB 3MBXH 3OXRB 1RZGB 5CUSL 4LLUB 1XEDA 1VFAA 3HI1B 3TJHC 1U8IB 4NC0B 3MRJA 4YHOH 1XGRA 5GS0H 5GJTH 3DOSA 1IM9B 4CVXB 5CJXA 1T21A 4MQXC 5EPMB 5ALBL 1CTNA 1OSZB 3CD4A 5DUPL 1HQRB 5A2JH 1PEZA 4P2OD 3TBTB 1I7UB 3A67H 4Y4HC 2ZSWA 2F5BH 3CLEH 4M7LT 3OB0H 1S7UA 1XGTA 2AW2A 4RMVA 5SV3A 3TWCL 3GIZH 4G80A 4OGAC 4BELD 2DL9A 3RWEA 1XGYL 5F7EH 1ORQA 3LN4B 5IROA 5HGGS 1FLRL 5DMJB 3T0BA 1P69B 4XX1G 5EORL 3BXNA 4C56D 4Z7VA 3VFSB 4JGMA 5E95B 5IR1A 2FBOJ 1CZ8H 5E6ZA 1LQSR 5BV7C 2X42A 3T2NL 4YBLB 4BH8B 3LQZA 4G6JH 2WINA 5HHPB 5H37G 4DUWA 1AD0A 3HPLA 4JB9L 4PJCB 3TN0C 1ZK9A 1S8DA 2CSPA 3PWLB 3QPXL 5CJOL 3T2OA 4XHJD 4N90E 1AGEB 2BRRH 1MFAL 1CLCA 5M94B 1ZSDA 1RZIA 1RK0B 4PJ9D 3QSKB 3MLTB 5K9JL 4Z18A 4D9LL 4ZQKB 3UC0H 2X1XR 4R26H 1Q9LB 1MPAH 3DXAB 2WIIB 3TZVA 5IT2H 1Q9WA 5C0EA 5C9JA 3D2UD 3KLDA 2H1PL 4J1UB 3FQXB 1OAKH 3HMWH 2HVJA 5F6HI 4JO1L 4LIQE 2P8MA 1ZVHA 3PWPA 3QA3B 1NGYA 2IPTH 4XNQB 4DN3H 1II4E 3GO1H 4GAYB 4GRMA 4YHMH 5DJ2A 1J12A 1IC4L 5DJ6B 4G8GE 4CADA 1PBYA 4L3CB 4WI5A 3HAEA 4JFOB 3BGFC 2CUIA 2IFFH 4JM4L 3SDCA 2CIIB 4TULH 1NGQH 3X14A 2G5RA 3MV9B 4GOSA 1WBYB 3EO9L 4ODTH 4XVUC 4IMKC 1EXUB 1YEFL 3VG0L 5GJSL 4NZUH 5HI4D 2VDNL 3WYRA 2HT2D 3I9GH 3PF2A 3M17B 5I1GL 5FGBC 1INDL 3F62A 2VLKA 2NR6D 1EO8L 1UEMA 3LV3B 3MBEA 2VDOH 4EUPH 2PCPA 5D7KD 4EN3B 1UA6L 4YPGB 1CXKA 4GFTB 3KLSA 5DHYB 2HN7A 2EDFA 4Y1AB 3UZVB 1IL1A 3ARYA 3X12B 2R0ZL 5ICXB 2W0KA 3K8KA 2W0FB 4N0CC 4JFQA 1C12B 5HGAB 2AJXL 3BDXA 2XRAL 4J2XA 5DJCA 4S1RL 3CXDL 3QWRD 1A5FL 3C08H 3C6LD 2EDYA 4PY7A 1TETH 3BPCB 3KR3H 2O5YH 4YHKH 2X09A 1A22B 2XWBB 3CSPA 4LAJH 8CGTA 2EYSB 1MWAH 3L3JA 2IANE 1QBBA 2WWMD 4NNYA 1AP2A 3TFKD 3SCMC 4WUUD 3GMNB 3ILPB 2WWKT 1RJYA 3D39A 4ZUTA 5E6IA 1J5OH 4HUKB 1G7PB 3GBMH 4DFIA 1AGDB 2AXFA 4GMTL 1K6QH 3LKRB 1I8MA 4HUUA 3RZCC 3OB8A 4Q7DA 2H6PB 4P2OB 4G9FE 3BE1H 4PG2C 3OAUL 3UTPE 2D4FA 5GGTA 2GIYA 3RNKB 1H0DA 4JRYA 2QADD 5D70H 2G9HB 3WIHA 3UJIH 2G5BA 4DQOL 2R1YB 1NFKA 1GGIL 2WBKA 1ZLUK 3KPQA 1KEGH 3TO4C 4UINL 4Y4KA 5I15L 3QZWG 3HC4L 4EDXA 4C56B 1ZA3B 4ODVL 4Z6AT 5BOZG 3QWOA 2VH5H 3BKJH 1R24A 2HTLD 3N9GH 4U33A 4OD2B 4F57H 5H35A 3F8UB 1R0AH 1NCTA 1Z2KA 2FLBT 2CXKA 4FQXD 4GW5B 3U46A 1JHKL 4LEXH 2WSKA 2IG2L 4U0RB 3WN5A 1QSFE 2UWEF 1S7QB 1UZ6F 2Y7QA 3OXSA 3ZYZA 3GBLA 4DGVH 4Y2DD 4C59B 4G8EA 2FEDD 2DKSA 3VXSE 3TPUA 2MKWA 5F7HA 2CGRH 4PJ9B 5C0GA 2WLYA 1PG7W 4PJ7F 2BSTB 1NC4D 3L7FB 3G6AB 5LG1A 1F58H 3IDJB 1FQ9C 1U8LB 4ODWB 4PJ7E 5E8PA 2F53A 2OL3A 4HGWA 1T1YB 3D2UB 5GZOC 5FUCE 2K1MA 1BFOA 3CSYB 3O9WC 2A6JB 3DRTA 4LGSB 3MUJA 4OM1H 4NRXB 3NTCL 2VZTA 4X99A 3EOBA 5I75C 5BXFA 3W9DB 4NT6B 4NWTH 5D7JA 3LEYL 2SEBA 5D7LD 3OJDB 4BSJA 2IGFH 4JGJA 4X5XB 4P5KA 5C1MB 3DVFA 3FZUD 2CDFB 2VZ3A 1LK2B 2V2TB 1SYSB 1TJIH 4X4YA 1KPVB 1GXEA 3AAZA 4KDWA 4OCMC 5J0BA 5F3HB 5IW3A 3X17A 1J05B 4DW2H 4KVNH 2YPLA 4LAQH 3LMJH 5MERB 3OKEB 1UQSB 1LK3H 1L7IH 1MNUL 2BNRE 4XNMB 5FYJU 4OI7A 2BX5A 2Z35A 4MB4A 3WCYA 3MUZ1 1FIGH 2DKUA 3B9DA 1YECL 2FATL 4HLZG 4LSTH 5JO5A 1CVSC 5EUOF 4RRPA 2F9BT 5HVGB 1KJ2L 2AEWA 5EUOE 3M1BA 1CXLA 3CX5K 5DVKA 5D2LA 1UB5A 4DKDC 1OGAD 5B39B 2OTWB 3WLBA 4WW1B 4NBXB 5EBGA 4APQC 2X70A 4RZCA 1ZHNB 3DTXB 1JGLH 4U3HA 4X6DA 1I9JL 1ZHKA 3JSSA 4YHZL 5ISZE 4BK5A 4IJ3C 2HH0L 3VH8B 2Y06L 3C6LB 2NX5D 3QJFB 3VGAC 1GIGL 3PGFL 4MLSA 5E5UB 1MIEH 4U6VL 1FH5L 4NWUH 2OXHA 3MRCB 1EMTH 2VDMH 2X4RB 4XP1L 2IC2A 5JLZA 2GITA 4WUUB 3BQUA 1IC5L 2AJZA 5FF6B 2ZCKL 3BVNB 2EDBA 2HAZA 3MJ7A 4L8DB 2YA1A 1RJCA 5CBEB 4CJ0A 5I76B 4GRWH 3BMVA 5DWUH 2FX9L 5FM4A 4XTRD 3NCCB 5CWSA 3QO0B 3PGCB 3BHBB 4PRID 5I1KH 1NQBA 3W81A 3FQUA 3OR7B 4UOJA 5HYSB 4OLZL 4BUHA 4X98A 4FQJH 1F11A 4OLWL 2QADB 4LCYB 3WIFB 5HD8D 1B9ZA 1JYNA 2ITDA 5F9WC 3BN9D 4GRWF 3VXQB 4NO3A 4OJFL 3MROA 3SJVA 3LS4H 1G9MH 4AG4H 3LD8C 4GRWE 2UZYB 4GQ9H 4XPBL 5D7IE 1HYSC 5CZKA 4ZYKA 4LF3B 5LAXB 3ZDYF 3SGKA 1A7RH 1ZVSB 5D2NC 2GCYB 1JHTA 3LQAL 5E24E 3TBWA 3O3AB 5KOMC 1WIUA 3AC0A 4S0SD 2WQRA 1YJDL 4XXDB 1JHLH 1I9IH 4NN6C 1IAKA 3X3FH 4HXBL 3L3KB 4A6YH 4FQXB 4DTGL 1CDYA 3EFDH 1DEEB 1FSKB 3BDYL 2P45B 2Q7YB 3F12A 2PXYA 4XP6L 2MCG1 1OLLA 3FT4B 4RDQG 1OPGL 5DYOA 1A6WL 4Y2DB 1BJ1J 1NCDL 1S7WA 5D1QC 3NBNA 1JFQL 5CZVL 4AEHH 4XCEA 1NANH 2XWJA 2F54A 3RY6A 4GKOA 3AY4C 5DUML 1NC4B 1JGDB 3BP5A 4K3GA 3K2UL 4ERSL 1NLBL 4K07A 2MCPH 5IHZA 1RURL 1VACA 3VXUD 1ZLSL 4O51B 3EOAB 3EKCA 1UXSB 3SO3C 2DQUH 3TEUA 3MOAH 1VA9A 5FB8A 4KRNA 32C2A 2Y07H 3MV01 1IBGL 4WO4C 2IH1B 2JF1A 3QRGH 5LQBH 1N59B 5GISH 3K81A 4P5TD 5D7LB 5D7SH 3H6JA 4OZFG 4ODHL 1JPSL 3TYGH 3FB6B 1S7RB 4WFHD 5D93B 1UWXH 4XMKH 1RAMA 4X0KB 3UPRB 1T89C 1LP9F 3B9KA 3QIWC 3T1FA 2BSSB 2C3VB 1PKQA 3LKPA 3NGBC 4P59H 2CLZA 2RAMA 1KTRL 3BISA 3WFDL 3BEVB 1T66D 5FO7B 4IIQC 1T7YA 3ARDD 2ENSA 4H0HB 4YC2B 4KRPC 1FC2D 4Q9RL 5E94A 3P0VL 4ZTOL 3EGSA 4XNYL 2NY6D 4G8FB 2X9WA 1G7LB 4U1KA 1K2DA 3AU1A 5JIHA 1C5CL 1PVHA 2A0LC 3U7WL 4N9OB 4FQ1H 3PWPD 2EXYD 1OGAB 5D6DC 2ZZUT 3V6ZA 5KVDH 1IFHH 3U7YL 2PN5A 1L7TL 2FB4L 4Y8AA 1TQCC 2IBBA 1F2QA 3C2AH 5FYKE 4YDKL 2AXJA 1NMBL 4GKZA 2R0LH 3DYPA 4YH6A 1KTDA 1WWBX 3P4MB 1DR9A 2NX5B 1K8DA 3SDCD 3UDWC 5HI5C 3RTQC 3SGDI 5CD5D 3VD4A 4O58H 1MHCA 3BEWB 4YO0A 4CBPA 3FAXA 4OCRL 3WO4B 1MAJA 2P43B 4NC1C 3QYCA 2VSCA 2EDDA 4N8CH 1KOAA 3TCXA 1T6WA 3QEGL 1KC5H 3BT2H 3UTSE 2ZUQC 1ED3B 2MQ0A 5FGCE 2VLKD 2ITCA 1QRNA 3ALWA 4HS8H 4JHAH 1REIA 3HZKB 3KNBB 2ZOKA 3F58L 4KJPC 5DRZB 3ME0A 3OKLB 3GMRB 1UWGL 4QRQB 1DBKL 4NQCA 1U2CA 1MRCL 1MCOH 1TQBB 2R2HB 4OKVA 3WIIL 5D4QA 2VAAA 1XR9A 3U0WH 1KCUL 1U8PB 2ARJA 5D96B 4L4TA 4XVJL 1U91A 3HRZB 1NL0L 1ZHBA 4RCAA 1ACZA 4UDUB 2YK1L 3K0WA 5F7KC 1JE6A 2E27L 1RJLB 1WICA 5JHDD 3EJZC 2OTPA 3OQ3B 3JV4B 4XPGH 2R56H 4P57B 4BJLA 3FFDA 3JV6A 1UEYA 3ILQC 3K4DA 5HHVH 4B50A 3UPAA 2CKNA 5ANME 2A6IB 5E99L 5IBLC 1GVIA 3D39D 2DOCA 3VFGL 4JZJC 3C6SB 3LRGA 4HT1L 4KHTL 2Q76A 3MRJB 5E6ID 2UV3A 2F5AH 3MLZH 1KYOK 2IADA 2J6EL 4Z7WF 1YYLL 4NZJA 2VDPH 2D0GA 1W2KT 4Z7WE 3EYFA 2C26A 3G5XA 4UT6H 4XNUL 3T08A 2ZSWB 4JRYD 5BRZD 2DLFL 1TZHA 1YPZA 3WUWG 1EV2E 2BNQB 4K8RL 1XGTB 4LU5H 2VZOA 4G80B 2Y6SD 3LN9A 2L7JA 1AR1C 3VXUB 3WFEL 4XPHL 4MXQD 1ORQB 4PS4L 4Y4KD 4HJJH 4Z7VF 1BECA 1CLZL 1CICA 5L2JB 2HMIC 2IMNA 1XIWC 1VFOA 3LSOA 1PY9A 1HCVA 1OP9A 5IR1B 4G7YL 3SGJC 4P5TB 4EZMA 2D7TL 3OPZL 3QI9C 3LQZB 3CSBA 3RGVC 4CDHA 4C4KT 4H5SB 3VFRB 2ERJC 1AD0B 4FNLL 1MH5A 5I2IA 1S8DB 5I1EL 1FGNL 2DQHH 5KSUB 5ESVA 1G7QA 1ROWA 2HKHL 4TN9A 1XMWA 4RAVA 2Z91A 4KI5C 5DJYA 1KELH 3ARDB 1ZLWK 1ZSDB 3CZFA 3EHBC 4Y5VA 2FRGP 2P4AB 1QRKA 5EBLA 5I16A 2VKWA 1WCBA 3H42L 5JW4N 1YA5A 1N6UA 1WFTA 2AK1L 4I18B 1HKLH 2NY6B 2FCBA 1Q9WB 4PIRF 1PZUB 5C0EB 5EN2A 5C9JB 3CX5J 5DR5L 4BQCA 4ZS6C 3S4SA 1U36A 5GGUA 2VR4A 2HVJB 4D0BA 3OMZA 4BSVA 2P8MB 5I9QB 3PWPB 1NGYB 4NO2A 4GRMB 4CMHC 5ECJE 5DJ2B 4EXKA 4PTUB 5D7JD 2J88L 3C87A 2G75A 2LTQC 3GI8H 3HAEB 2HTKD 4ZFFA 1G7IA 4KXZI 3SDCB 1CL7I 3A0OA 2NY3C 4M5ZL 3V8OA 1BBDL 1KBGH 1ZT4A 1IQDA 5FECA 2YPLD 1D5BB 3JTTA 1RSFA 4BQ8A 2PKDA 2HFFA 3O4LE 2VLKB 1Z9OA 3BP6A 3C60A 2CMRL 1WZKA 2PTVA 4YR6B 5EIVA 4IHOA 4P9MH 3HMXL 2GSIA 3QEHA 1JPTL 7CGTA 2PCPB 3LH2H 3LDBC 3X3GH 3BIKA 1A4JB 4H20L 1N2RA 2D7NA 3HA0A 4JVWA 4D9QD 4NZTL 1AIFA 1ETZB 2JJSC 3ARPA 1JF5A 2HN7B 4W4NA 1IL1B 1DTUA 5DK0A 2GSGB 4KK6D 5IV2B 4E9LA 4JFQB 3HNTL 1OOAA 5TE6H 3GMQA 3O2DA 5IVXA 2GYSA 5HI3C 4RGMC 2VXQL 3S96A 1MF2H 5HVFB 3S9DB 5K9KA 3JVGA 4DEPC 5JHDB 2XV6B 3E2HC 4PY7B 5EC1A 3EUUA 3ALXA 5CBAB 2E9JA 3L3JB 3V6FB 2IBZY 3O2VL 5DT1H 3BWAA 1AP2B 1XR8B 5GGTL 5B4MC 2IMMA 3WIHH 4X4MA 5JXEC 4R90H 4J3WA 3BQUD 1J0JA 2E5EA 2CUHA 1RJYB 3D39B 3JWOC 3D87B 2A1WH 3S3SA 2BVQB 5E6IB 4QCIA 3NFNB 4ODSL 2AXFB 1I8MB 4RFOH 3I75B 5D71H 4YFDB 4AH2A 4I0CC 2HFGL 3EYQD 4QTIH 4M7ZC 1Q72H 1VGEL 5DMKB 3KXFE 4MZ2A 4LSQL 1H0DB 1GGYA 4JRYB 1MFEH 2YA0A 5BRZB 3N1QC 1RMFL 1A6AB 2GAZA 1Z9SA 1DQQA 2G5BB 4PY8I 3SJVD 3V4UH 5IW6A 4JN2A 2P44B 3MR9A 2P8LB 2H8PA 3D3VA 3KPQB 4Y4KB 3PV6B 2IAMA 4NKMA 2AJYH 1T20B 4EDXB 4I2XA 4LLQA 1MHHA 2A74B 3SDXF 1GPOH 5T5FH 1IILE 1R24B 3QUZA 3SDXE 1G7JB 4H8WL 4J3VA 5FUOL 15C8L 5DJXB 1CDHA 4F80A 3TH4T 5DD1H 2OL3H 1VPOH 3CDGB 1T03L 3U46B 5DEFA 5EU6A 4Y7MA 5T33H 4XPFH 2ADFH 4J8RA 4PLNC 1AQDA 1NGWA 1UH4A 5KSBA 1ULVA 3AREA 3QPQD 4M93B 1FE8H 4GRLA 4G8EB 4OUUA 5LCVL 3IYLW 1ZS8B 3TPUB 5C0GB 5C71A 1UXWA 4OF0A 1W8NA 5F71A 4MA7H 2OL3B 2FD6L 3U79A 4XX1E 4UT7L 1CXEA 4ZFGH 4OGXL 1P7QB 4KTDL 1BFOB 1FNFA 3PJSA 3TCLA 3KPRA 4EKXA 3CFJA 2EDOA 1IGCL 3DRTB 1OAUL 1FG2A 4I0PC 4HIJB 5M7QA 1RK1A 3EOBB 2XZQH 4KROD 1BM3H 5D7JB 3IS1X 4XXCA 3KYMB 3QAZC 3RAJH 1TVHA 1FAIL 3CU7A 3SE4C 4P5KB 3V6OE 5MENA 4TSAL 4KGLA 1FIEA 3GB7B 3DX6B 4LRIA 4X4YB 3B9KD 4HJ0C 5D9SA 2UUDK 1Q94A 4OFVA 3AAZB 2E7MA 3IDMA 1LE5A 1L9MA 1K4CB 3HG1D 1Y6MR 1X5YA 3L3DA 3LHPL 5IW1A 2YPLB 2ZSVA 3FB8B 3TBSA 1TFHA 2CO6B 2Z35B 3RVXC 4BQ9A 5EOCH 4OQTL 3QRFM 2W38A 3L3IA 4CW1A 4UV7L 1PAMA 4LPVA 5JO5B 4M4RA 5D2LF 1RUML 4NUGH 5JW3H 3IFOA 3M1BB 5B38B 3CVHL 5D2LE 4BM7A 1CIDA 1UB5B 1FVCA 3QDGA 2RHEA 5E0QA 4X6DF 1MJUH 2X70B 3QO1B 4RZCB 2YR3A 4BZ2H 5GS0C 2HFEA 3JUYA 1ZHKB 4KHXH 2G60H 2PW1A 5C0JA 2ZCHH 1KSRA 4HC1H 5KAQG 1I9EA 1CGSL 2MKLC 3JBG7 1R3KA 1ZE3C 3CVHB 4YBLC 1EHLL 4WJ5A 1E6OL 5JLZB 4U6XA 1UYWL 3T65B 3WV0A 3BQUB 2AJZB 4BFIA 4PLOB 2X4QB 4OIIL 1R3HB 5HHNA 4PJDE 1JGUH 1QO3A 1FYTA 3ELAT 1QRND 3FONB 5C7XH 1F90H 5CWSB 5KOVC 3C8DA 4BH7A 4Z77A 1OT2A 1IKNA 3J7HA 1IEBA 5CINL 3L95B 1PX3A 4JY6A 4CVZA 3FQUB 1FGVL 4NQCD 4M7KL 1HQ4A 1JI2A 4X98B 1F11B 3TGXA 2JB5H 3RDTA 4Z9KB 5ICYA 4NO3B 3MROB 3SJVB 4ZSOE 2ADGA 4ZFZA 4L4TD 3O6LH 3BZEA 3JTSA 4S1DC 5SWSA 1AGFB 4DAGL 2YUZA 1NSNH 5DRXA 5C0FA 4F9LC 1EFXA 1G7MA 2BOBA 4ZYKB 5BW7C 2X9YA 4MQSB 2FX8H 4F58H 2RGSA 4KQ3L 4NGHL 2FZ3B 4JFFA 3TBWB 4N1CA 1IAII 1NGPH 4YXHL 1BQLL 1CVRA 5GS1A 1OB1A 1IAKB 1VKXA 4POYA 3N85L 1V3JA 4KAQL 1S7VA 1QPXA 3QDHA 3ARBA 4PBXA 5JW4R 3F12B 1V3KA 1RY7B 5DYOB 4DVBB 3SE3C 1OARH 3VXTA 4LPCA 1BPVA 3DVIA 1YC8A 3O6KL 4HXAL 1TJHL 1X7QA 4NOFA 1IVLA 3DETD 2AEPH 2HVKB 1H8SA 2WUBL 4LFHD 4EN3C 5FYJE 3ZHKA 1NCCL 2ESVA 3LAFA 1W0VB 5IHZB 1VACB 1WSST 4Q74A 1UG9A 4MA3B 3L7EA 5TDPA 2GTWB 4A2MA 3SOBL 1CICD 2E7LC 1IGJA 3IDNB 3WJJC 4KROB 5FB8B 2IEPA 3NCMA 32C2B 5HGDA 5C6TL 1CYGA 1WWCA 5I19H 2EDJA 5GGVL 5C8JA 1H5BB 3ARUA 5JQ6L 3CDYA 4FQLL 2NZIA 3HNVH 5CCKL 1OSPH 1CGWA 1ITBB 3B9KB 3MLVL 5T3ZH 3PUCA 4LMQE 2KPNA 1OCWH 1JV5A 1PKQB 2DLHA 3RVWD 2CLZB 5AEAA 4E41E 4NYLA 4U4BA 2Z31A 1NMCB 1GHFH 3GMOA 3HG1B 4ZFOL 4ZPVB 4Z7OF 1BVZA 1GZPA 1RIVL 1KJ3H 2VLJE 4FABL 4Z7OE 5E94B 3RY5A 3LS5L 3P0YH 4E42B 3EGSB 1NCUA 3PE9A 4Y5YA 1FC1A 4RGND 2ZP0T 4P2OC 5T3ZE 4PGBB 1KENL 2Y5TA 4G9FD 4ZFOB 2XKNA 5J3HD 1A6UH 3V6ZB 2NYYD 3KPLB 4LQFL 4WVRA 5HHOE 5GIRA 2FIKA 4JY4A 1WTLA 1MFCL 2R4RL 4GKZB 4BKLA 1X3DA 1RULL 2CKBL 2NY5L 4JKMA 4Q0XL 1TTGA 2I5YH 1GGCH 2J8OA 1SEQL 1ERNA 1MQ8A 1WUNT 5I8EA 5TE4L 4QXUH 3RWIA 3D69B 3QUYC 4LPXA 4ORGA 1HE7A 4RA3A 5BJTA 3WFHB 4KKLD 4HH9A 4POZD 2AJUL 3G6JA 3OF6A 5E8DH 3QXDB 4XHJC 2ITCB 1QRNB 3C60D 3KPTA 4RMUA 3M07A 4AMKL 2ZOKB 2UVFA 5KANG 2FL5A 1QSFD 5EU5A 4LIQL 4N0YL 5JPNA 1JWSA 4OF3A 4PJ9C 2R0KL 4F3FA 2FBJL 2N56A 4Z0XB 1R3IH 2XN9E 4NQCB 2J8UA 4R0LA 4S10A 1INQA 3HKFA 2DQIH 2PF6A 3K1KC 3S7GA 1MHPL 3E8UH 4FOMA 4KY1L 4L4TB 1G84A 3RWDA 1YNKH 5DQJA 2LFGA 5JDSA 4PRPE 4HUXB 3QR2A 2GT9B 4MJ6A 2EDRA 3HRPA 3RVUD 5IQ7L 4WHYG 1RZJL 3DMMA 2OR9H 2CK0H 3VGEA 3VW3L 2CO7B 1MY7A 3MXVH 3FFDB 4QNPF 3QHFL 5DD3H 1FO0H 4D94A 2NY7L 1QVOA 3DBXB 3SQOL 3UAJC 5CGTA 4M9PA 2Q76B 1HINH 3FTGA 4FQQA 3TV3H 4XBEH 3LKNA 5F9JA 5TQ2H 2IADB 2HT2C 4J3UA 5INDB 2AI0H 3KPOB 5JIKA 3CFCL 4MAYD 3D25B 4F15B 1YDPA 3G5XB 1UCBL 2BSED 3GKZA 1YPZF 2W65A 4M5YH 2NR6C 4DGIL 4LBEB 4P4KC 1D6VL 3BESR 1SEBB 2APWA 1YPZE 1TZHB 4JEGB 2V5SA 1OTUD 2W59A 4LL9A 4M43H 4LPYA 3MJ9L 4NM4H 2WBWB 4C54A 1CDUA 3D3VD 1JL8A 3DX7A 2YS4A 4ZTPH 3IAGC 3QNXA 1CICB 1QPPA 4KJQD 2ICWB 3CDCA 1P2CA 3MRQA 3ZYOA 1BVLB 3D9AL 4RDQF 2P5EA 3QUZD 1F3DH 1QFUH 5F7NC 5ISZD 2ADIA 2N7AA 1MH5B 4LARH 5I2IB 5MI0B 5EU6D 2WW8A 4U1MA 5ESVB 2XQBH 6FABL 3OWEA 3SE9L 3MV11 4RAVB 2Z91B 5DJYB 3V5HA 4GRLD 3BDBA 2QQQA 3CZFB 4Y5VB 1H8NA 3BOVA 4H1LG 5TF1H 2FJHB 1AXSB 5EBLB 5I16B 2EH8L 1V7ML 3RU8L 5DLML 2QQLL 3W2DL 4ZOEA 1YQ2A 4RGNB 5EB9A 1UCTA 3KYOA 3UJTH 3GSVA 4N68A 3S4SB 1FORH 3KPRD 5GGUB 1DFBH 3DNKA 1FV1A 4D0BB 4MDJA 4BSVB 1VSCA 2QADC 4G9FB 1CR9H 1C7TA 3C5SB 5GSRB 5E00B 4S0TD 4HKJA 1RUAH 4ZDHA 4FHBD 1X6NA 1RUPH 2A38A 4NBZB 1E4WL 2YD9A 1QQDB 1KCSL 5HYIA 4ZFFB 2GJJA 1G7IB 5MEND 4PGEA 2ORBL 2VXUH 2YUWA 4TUKH 5DHVB 4BK4A 2OMBA 2NY0D 4N8VB 2HTLC 5ILTH 1D7FA 2YBRA 5IBTL 1B6DA 4KJYA 4QXTA 1IGIH 1CLOH 2JIXA 1ZT4B 4EBQH 3NIGF 5FECB 3CK0H 4YUEH 3U36A 1MVUA 4FQXC 1RUQL 1CFSA 5HHXH 5B21A 3TN0A 3PP3K 1U8NB 1X9QA 4HDIA 1FPTH 3O2DH 3C60B 4FA8A 4IHOB 1X4YA 1AJ7L 4Y2DC 5C07E 3QEHB 4WHTA 1A1OB 1QSFB 1YEKL 2FEDC 3O0RH 4M48H 3VFTA 3BIKB 4NJAL 5K9QI 1MCSA 5I8KL 2KZ1B 1YJDC 5E7FA 1AC0A 3RBSA 3QDGD 3V79C 3NFPA 1MRDL 43CAA 5IVXF 4ZO6A 3CFBA 1JPFA 3VXOA 1QLRB 4LPTA 4BFGA 5IVXB 2MPAH 1PSKH 2VDRH 5EOTA 5CGYD 5FHBL 5K9KB 3Q5YA 3IJYB 3QCVL 4JHZA 1OLZA 1CS6A 4P9HL 3ESUF 5KVMC 2WP3O 4MSWB 4TVPD 3FN0L 2KKQA 5L6YL 1LEGA 3PNWB 2BVPA 3AS3A 3BWAB 3S36X 2HWZL 4OFYA 5D93C 4Z8FH 1V05A 5SX4H 4XVTL 4OB5H 2FO1A 5C86A 4FZEH 2BXZA 3MV7A 1FYTD 4IMKA 4QCIB 4QRTA 1CF8L 3ZTJH 4LEOB 4KZEH 4CNIB 3ECBA 3FB7A 4AH2B 3VDBA 4MAYB 1SJHA 2C1OA 3C8KA 4UILL 5EC2B 2WBJD 4FZ8H 5FGBA 3R1GL 4V1DA 1XF3B 2OJZL 1EAJA 3RDTD 2GAZB 1DQQB 5I17B 2ZUUA 3FFCA 3T0VA 4XAKE 2L7UA 5DMIH 3MR9B 2H8PB 3Q3GA 4KJWD 4LOUD 3D3VB 5SWSD 4CU6A 1ONQA 5C0AE 3BZ4A 2R8SL 4NKMB 1EFXD 1U8HB 2H3NB 3MJGX 4I2XB 4LLQB 3C5ZD 1MHHB 4NZDA 3DV4A 1BJMA 3RRQA 4JFFD 3L5HA 1N64H 3QUZB 4NM8L 5E2VL 1WWWX 3TIEA 1C8PA 2VXSH 3CFIC 5ISZB 1G6RL 1QNZH 3B8YA 4R3SB 5L2KA 1K8IA 3GK8L 5KSBF 1DLHA 5DEFB 5EU6B 4DCQA 1EGJL 2MTPA 5IFHL 1XF2B 4J8RB 2AGJL 1NKOA 1EK3A 2OCFD 1AQDB 1NGWB 2IBZX 3PQYE 5KSBB 4GRLB 2R1XB 4OUUB 3KPSE 1AGCA 1CBVH 5ALCL 2VJXA 2DIJA 3QG7H 1HOCA 4LLDB 5DC4B 3GSNA 3QQ4A 5C08A 2VWEE 4XTRC 1QOKA 2ZOLA 2NY2C 2OZ4L 1G6RB 1ACYL 2ESVD 3AMKA 4GG6A 4PG9B 5E8EB 4RAUA 1NEZG 4HUVA 3KPRB 3CFJB 1ND0B 4PG2A 2R69L 1TQBC 1FYHB 1F4WL 1FG2B 4GXUM 4L3EA 5HD8C 1NMAH 1RK1B 5KVGL 1IMHC 3NA9L 3BN9C 5TPWH 4YQXL 3WDIA 1VADA 5D96C 1TVHB 3UTQA 1P4IH 4EDWL 3SKOA 4TUOA 5F1OB 3TO4A 1W72A 5MENB 1U8OB 1MCKA 1DBML 3DURA 5D7IB 35C8H 4Y89A 3R4DA 4XH2A 5D9SB 5CJBA 2NY0B 1Q94B 3ZDXE 1LNUB 4PYHA 3QCTH 3HZYA 3IDMB 1LE5B 2Z31D 4GAJL 2Z8RA 1EEZB 1M7IA 2BCKA 4QHUA 4DUVA 3VE0A 3IFLH 2BVYA 2ZSVB 4GKSB 1W0WA 2O5XH 1JJUA 2VLLA 4F9PA 1A6VH 2C3HA 4G6AD 3L3IB 3OZ9L 1J10A 2DWDB 2R0WH 1J1OH 3IFOB 4TVPH 4MAUH 5M95B 1T6VN 1FVCB 1AY1L 2IPUG 3CNKA 3QDGB 4GSDH 4F2MA 4P3DA 3HLAB 4K94L 4AM0A 1T83C 2E6QA 1P7KA 3O9WA 3DRQA 2X2YA 4NFBA 3QULA 5C0JB 5GRUH 4JLRB 4WI9A 3NVQA 4LCIL 4P3WA 2DJUA 5BS0A 5ACMA 3WSQH 5KS9E 4HK3J 4F8QA 3VRIA 4XP4H 4Q6YA 5JUEH 4M61A 4P5TC 1R3KB 1AFVL 5L88H 4WJ5B 1MHEA 4LCWA 4U6XB 3LZFH 5EDXA 4K8RC 1F8TH 2CJUH 2BJML 4UBDD 1RFDH 1BX2A 3VXMA 4BFIB 3OF6D 5CJ5A 2JKXA 5HHNB 3VFMA 1FYTB 5C0CA 5E8NA 1FVDA 5E5RB 2DMCA 1T66C 4BH7B 1R6VA 4Z77B 3ARDC 3U4BH 4N0RA 4X6CE 1IEBB 2WBJB 2DQTL 1P1ZB 2LABA 3I3BA 5DD5H 1HQ4B 4I18C 4LCUB 1BIIB 3RDTB 2NY6C 5FYKL 5ICYB 5E1AA 2ADGB 3T3PF 2YSSA 4UTAL 4ZFZB 3BZEB 4G3YL 4QHLB 5SWSB 5I9QC 2EXYC 4ZOCA 5FA4A 4OSUL 3HC3H 5DRXB 5E4IA 1FZJA 1EFXB 3O81A 4MLIA 1ADQA 5ETUA 3C5ZB 4APQA 1U58A 3RQ3A 2HJLB 3DMMD 2WMPA 1AKJA 4JFFB 4PJ8D 1MREL 1F3RB 5I1DA 4GW1B 1JTOA 4HUWA 3MLXH 1AQKH 5C2BH 4KTEL 3SDCC 5GS1B 1RIHL 4UU9A 4WFEE 1SY6L 3H9YA 4QOKA 1QBAA 1YNLH 1J8HA 4Y19E 4HS6A 3NZ8A 4OLVH 4L4JA 1K3IA 5KVEL 3AB0B 1UENA 1NUGA 1MCDA 4YDLB 3B5GA 4FQIL 4HF5L 2EH7H 4XPTL 1RPQA 2NMSA 4X7TA 1NBVL 3GBNL 1CFVL 4L4VA 1X7QB 2BDNL 4G42A 2EEDA 4I77H 3O4LD 1JWMB 2IPKA 3DO7B 2ESVB 2G2RB 3H9HA 4DGYL 1BD2E 4M1DH 4DN4H 3VXRA 4AEEA 2B1HL 3NACH 3L7EB 3QQ9D 4K55A 1UACL 5D5MF 4C83B 5L0QB 2NZ9D 1IGJB 3V4VH 3LEVH 1A1NB 1MFBH 1I7TA 4UIKH 2W1NA 5D5ME 2I07B 5HGDB 2AEIT 3RUGA 4W81A 3EYOA 5CMAA 3KJ4B 1IGML 4LKXA 1HXYB 1CI5A 5C8JB 1A4KA 2P5ED 2V2WA 1AXTL 1RU9L 5MEPA 3FOLA 2DQEH 1U3HA 1GZQA 5JR1L 3IVKA 4XAWL 1S9WB 1LO4L 3B2UD 1JV5B 2PUQT 4NYLB 5TE7H 2Z31B 2QSVA 1N5YH 4D0CB 1D5MB 5EU7C 4WY7H 1GZPB 1AI1H 2CRYA 1P7HL 3L5WA 2DI8A 5DGRA 1KLFA 3EO1A 4YBHA 5E6IC 3Q6GH 2D0HA 3OAZK 4HWEL 1CDJA 12E8L 1WF5A 4P2CG 3L3HA 3EBAA 5T5NG 4MQXD 4Y5YB 5D1QA 5MP6L 3P9WB 3HUJE 1FFPA 2B1AH 3ARVA 2Y5TB 2EKJA 3AY4A 2XKNB 3WXVH 3KXFD 4P3CH 4QXWA 5TFSL 1LE9A 3QHZL 3ULUE 3IXTA 3QDME 4M6NL 2A6DB 3GEWB 4OGAD 3UBXA 2XWTA 4Z5RB 3LOWA 5LJYH 4MXQC 4Y4KC 4LVHB 4WUKH 4OT1H 4BKLB 1OQOA 5LWYL 4M1GL 4QRPA 3REVA 5ADPH 3V7AG 3VGGA 4K7PX 3NZHL 2NNAA 2P1YA 4X7SL 4JKPH 3G5YB 1T2XA 4WO4A 3RWIB 4ORGB 4POUB 5BO1L 3DSNA 2JIXD 1BEYH 4YE4L 3G6JF 1T5WA 3OB0K 1MCPL 1HIML 5I1CH 2BNUA 4MXWL 5FCUH 1Z3GH 5I30H 4FMKA 1UZ8B 1YEHL 2QL1A 3G6JB 4B5EA 3TN0D 1RIUH 2P48B 1FRGH 4HBQA 3GSUB 3OKNA 3X13A 2EDXA 5AUMA 4M93C 1Z9MA 3I02A 4R7NB 4JHWL 2FL5B 1MCWM 3AS1A 4C58B 1NLDL 4JFDE 4IIQA 5EU5B 4JZOA 2J8UF 5JPNB 1JWSB 4F3FB 1WZMA 4H8WC 2J8UE 3O3BA 4R0LB 3BRGC 1INQB 1X5AA 1N0XL 5T3XH 3MRIB 4MD0A 2KQNA 2DLGA 3RHWF 5ACLA 3EZ8A 3L9RA 4I3RL 3WHE0 4XWGL 1DE4B 5MEOA 1I3GH 4HKBA 3HNSL 1HN1A 5JOFA 1VFMA 3GSXA 3MA7A 1ZGLP 4X7FC 3HB3D 5D6DA 1NUFA 5D7JC 3QISA 5IHUH 3DI2B 1X5ZA 4GMSH 3DMMB 4HUMB 1XH3A 2X4TA 4NO0D 3VI4E 3G6DL 3MODL 4PJ8B 4UV4H 5T3XE 5IGXL 2C3GA 2HTKC 4OZHF 4IOFD 3WFBH 3MRDB 4GXVL 3IDXH 1LO0L 3MSPA 3UDWA 4OZHE 1QVOB 1L0XA 1F4YL 4K9EH 4OTXH 3GJEB 2PYEE 2AXGA 3FTGB 3MV8E 4FQQB 3EO0A 3LKNB 5B8CC 3Q5TA 1M71B 1I75A 5FK9B 5I1IH 4QRRE 3IDGA 2W65B 3RX7A 4V1DD 1MVFA 2DQFA 1XCQA 4OV5A 4JKKA 1ZEAL 2VE6A 3IU4L 3O4LB 1YYMH 1HKFA 3FFCD 4P5MB 4X8XA 3MRPA 1NBQA 1S5IL 2FO4A 5C0BA 3U9UA 4J3XA 5CP3A 1YMME 4PV9A 3DX7B 2CDEA 4PTTA 1JTTA 4NKIL 3QNXB 4KK6C 3JWNC 1P2CB 1ZWIA 4IMLA 5DMGD 1CFBA 1WBXA 2D3VA 2AABH 4JZNA 5ITBL 5FXCH 5DJZB 3KPNA 1OAQL 2D7OA 1BFTA 4QXGH 5EO1B 2P5EB 4R4FH 1G0XA 4HZAA 3T0EE 5E9DA 2ADIB 3PIQA 5L2KD 3S34H 3BFOA 2V7HA 3TIDA 4ZO8A 1KIRA 5FKAA 5CGMA 4UB0H 2EIDA 3RI5F 2KBGA 1OD9A 1CCZA 3QNYA 1IAMA 5IBUB 1LO5A 1JUFA 3MLYH 4JZJA 1KXQE 5HYQA 5D72L 3BIAX 2XA3A 4OCWL 3RX8A 4HUNB 5BQ7A 4KDVA 4N5ED 4BZ1L 3UYRL 3EYQC 3QDJA 4XT1C 3KYOB 3GSVB 4NCC1 5KVFH 4M3KB 5BV7H 1FV1B 3J8F7 1NFIA 1A0QL 2JB6A 3KXFB 4TQEL 2AS5M 4HKJB 4K3EH 1KIUA 3THML 3NN8B 2Q8AL 4AY0A 5DD0H 4WU7B 2NCMA 3TO4D 2HG5A 1XAUA 4HPOH 2YD3A 2P24A 1FNEA 1XIWA 4XC3L 2AJ3B 5BV7B 1HILB 2YBRB 3BKCL 2JIXB 4IRZL 4NQEA 3N06B 4UOW0 3ZTNH 1EJOH 4GUPA 2YZ8A 1RUKH 4DKFH 5EG6C 5F9DC 3B43A 4MNQE 2VIRA 3QPQC 3QXUA 3VFTB 5DRWA 4NRZA 4HG4J 3RY6C 2E8ZA 4JO2H 4O02L 5EOQL 3S37H 5J56B 3W0WA 1DBBH 1L6ZA 1LWRA 1JWUA 3MRMA 5C70A 4K3JL 4HGMA 3CFBB 1JPFB 4PGJA 1JYXA 3I3DA 4JFEE 5GZOD 3VXOB 5I18H 3C9NA 4LSRH 5SWZA 3STBA 4PJXA 1NJ9A 2HKFH 2JE8A 5EOTB 4ZD3H 3TO2A 4FTVA 4KROC 2RCSL 4HEME 1B3JA 1YN6A 5EIQA 1G9NL 4JRXE 4WRLA 3CXHJ 4NO0B 1HHIA 2DB8A 2K7PA 4G6MH 3V0VA 1IKFL 1H5BC 2YPKA 1LEGB 4LCWD 2N1KA 2XOTA 2P5WE 1KCRH 5FAAA 2X4OB 1NFDA 4WV1B 3VXMD 4PBVC 2Y4SA 3GZKA 5F96L 1IE5A 1MJ7H 1MQKH 3MV7E 3G04A 4NZRL 1IJ9A 4QRTB 1NMCC 2V2XA 5IB5B 2P8PA 2XT1B 3LB6D 4ELMF 4HULB 1PG7X 3ECBB 3NCYP 2OP4L 1QBML 4E41D 1QSEE 3FB7B 3QQ3A 1RZ7H 1ZKAA 1V7NL 1SJHB 2C1OB 4ELME 1QLEH 3BD4A 3PHOB 1NCWL 5LGHL 1J8KA 4DUXA 5C6WH 4V1DB 2OXGA 3MLUH 5IFJA 7FABH 4LSUL 1G7HA 4R4NC 1HSAB 4WWID 1H3PL 4OLXL 25C8H 4KRMB 1IAOA 5ADOH 3EYSL 5B3JE 5HYJA 3GI9H 2JJSA 1ONQB 3BZ4B 5IMMA 1PY4A 1V8HA 4XCNA 4YGVA 5JW5A 2XICA 2H32A 1FZOB 4JO3H 4APQD 3GSNH 1AKJD 1I8KA 5A40E 4FFWC 5AWNL 1AO7D 3TIEB 5TDNB 3FO0L 3A6CH 4F7CA 4PJIA 4LLVA 2W60B 4XCFH 5L2KB 1K8IB 1J8HD 5GSVA 3RWJA 2IH3B 4LLMB 3MLRH 4MXVF 2RFXB 4DCQB 3OHXB 1GC1L 5HDBE 1S3KL 5IESH 5JXEA 4HK0A 3MRKA 3MA9H 3S36L 5F9OL 2F19H 3GSNB 1LEIA 5C08E 5AYUH 5J1AA 4OZ4A 2ZOLB 4PJDB 1A2YB 3GNML 1W72H 5C6PB 1A21A 3IRZA 5DZNA 4GG6B 1S7XB 2DD8L 4BQBA 4PJBE 3W5MA 3HHRB 4RAUB 3A6BH 1GSMA 1P4BH 2VL5A 3MLSH 1GRWA 4Y4FD 3GRWA 5ESAA 3VXRD 4HUVB 2XI9A 1A7PL 3C5JA 2Q8BH 1FBIH 3MACH 4L3EE 2ILLA 3ZHLA 1NUDA 4OV6F 5EFIB 1INEH 1YEJL 4PREA 2CIKB 1BWWA 5FO9A 4YXKL 3UTQB 4HS3B 1JF1B 1KTLB 3SKOB 4TUOB 3TO4B 1M6OA 5EWIH 2R1WA 1HYSD 3H3BC 5C0RL 1U3HD 4U3CA 4PRPD 5F7DA 3HZYB 4OM0H 2R2CA 4JFHD 1VDGA 3ROOA 1M7IB 4R2GC 1AH1A 1VCAA 2EO1A 1JRHL 1PEWA 3VRJA 3DROA 1S9VA 1W0WB 2BHZA 5IEKB 2VLLB 5FYJL 5HGHA 2A73A 1FP5A 1FFOA 3B8SA 4LLAA 3WD5L 1Y6KR 1RZJC 4MNHB 5I66A 2I60H 3SN6N 5DK3A 1U2HA 3OL2A 1HNFA 1Z6JT 2YOCA 3DETC 4TPRH 4F33A 4FP8H 1A1MA 3FRPA 4F2MB 1KFAH 3HFMH 4AM0B 2F74A 3MX0A 4XGZA 1P7KB 4N1EA 3W11C 1BFVH 5T1LD 3QZWB 4UIMA 3QULB 4XMLL 1LO2L 1F4AA 4CU8A 1CICC 4I0PA 5EBMA 1V3MA 3ZE2E 1BBJA 2BVOA 1IC7H 5EZOL 3VRIB 2V9TA 4M61B 3I2CL 3I6LD 3TLRA 3MNWA 1MHEB 4LCWB 5KSVA 2J5LB 2W0PA 4JGUA 3SGDH 1BX2B 3VXMB 1UWEH 4JPVL 2VLMD 2NY4D 3RVWC 2QQKH 5C0CE 4BSWB 4OCXL 4S1SL 5E8NB 5I1AA 1FVDB 5GHWH 2FLRT 3K8LA 4E41B 2WQ8A 3ORJA 3L3OB 4Y5VC 4U0QB 1ADQH 1NDMA 2QBWA 4WW2B 4JPKL 4YDIL 1KJMA 3PXJA 4KK5D 3V95A 3QH3B 1EZVX 4MB3A 4OLYH 1U8IA 1O7VA 1SM3L 1IM9A 5CEZD 4WFFE 5EPMA 3NCYS 3OBAA 4RGNC 3RVVD 1TVDA 2ICWJ 3ZDZF 1DSFL 4IRSD 5GGSA 3GDBA 2WUCL 1I7UA 3CFEA 2YWYA 5KSAA 1FZMA 2GY7B 3ZDZE 5FA4B 5J3HC 4EI6A 1FZJB 2NYYC 3R8QA 2DTML 4KWUA 1SMAA 2X7LA 4EEEA 2VDKL 3CU1A 4APQB 1U58B 3OKMA 4AQOA 5CAYB 1AKJB 4U2YA 5HYFA 4HUWB 1AO7B 3IXAA 5KW9L 4UU9B 4LRNL 5HI5D 4XNXH 3VFSA 3B2VL 1YQVH 1J8HB 4D3CL 4HS6B 3NZ8B 5GPRA 4PJFE 1BJ1H 2AEQH 1KB5L 1P9MC 2HLAA 2JELH 4KKLC 4CKVX 3BAEH 3BW9A 4POZC 43C9A 4PJCA 5CJ8A 4X7TB 2BXYA 1DLFH 1M4KA 4U7KA 4BZYA 3C60C 3ZL4H 3O6FD 3ZYIA 4L4VE 1KUMA 3IU3B 3V4PL 3U30B 4G42B 2IPKB 2CXGA 3UJJH 4IOIB 1RK0A 5JHLH 4Y4FB 1S7SB 2YD7A 5C0BD 4I5BA 4NQDE 5T1MA 3L5XL 5E2WH 4XPAH 4MNGA 2VNCA 4JY5L 4OD1L 3DXAA 2GJ6E 2WIIA 3DWTA 4LKCA 5CLWA 3RUGB 3EYOB 5CMAB 2QHRH 5DFWH 2AK4D 1HH6B 4LKXB 1C1EL 1A4KB 3DX8A 2V2WB 4OZGA 3GUTA 3QA3A 3JVGC 4XNQA 1UM5H 5MEPB 3RVUC 4F9LA 5BW7A 1U3HB 1GZQB 4PRPB 1E6JH 2VDLH 5D2NE 3SDDD 4L3CA 5AAMA 5CLTA 3IFNL 1KXVC 5SWQA 5B39G 1F4XL 4PB9H 4NJ9L 2FSEA 2CIIA 4Z95H 3L1OL 1WBYA 4MJIA 3VGHA 1KGCE 1EXUA 1OL0A 4TOYH 1Z9LA 3BH8A 8FABB 4CAGA 4WCYL 4P9HC 3KG5A 5E2TL 4LSPH 2D03H 1U8MA 3O2WL 3QDJD 2V9QA 4MAYC 4I9WD 4G9DA 3RWFB 1FFPB 3T0XA 3MO1A 1UH3A 5I0DA 3ARRA 2B8OT 4JFYB 1OTUC 3ZE0F 3U0TB 2EZ0D 1LE9B 3AFLA 3IXTB 4DFHA 4XB8A 2GTZB 4YPGA 3UBXB 2XWTB 3ZE0E 3A6OA 4OLUH 5T1LB 1AR1D 4Y1AA 1MLCA 5H94B 2BFVH 4KJQC 5L8LB 4H88H 4QRPE 3REVB 2QQNL 1FN4A 1EPFA 2W0FA 3SO3B 3WJJA 1AHWC 2NNAB 1BF8A 4J6RH 2N4IA 4X9BA 4RWYH 5IK3B 4FQ2H 2ARJQ 1LO3H 3WHXB 3MUHL 3GHEL 5CEZH 4U3XA 4KXZH 2V9RA 3D6GA 5GRZA 1CL7H 1T4KA 5HDQH 2XPGB 2NY4B 2XWBA 3BZFA 2EYSA 3NGBB 1VEPA 2FWOA 3I02B 4GRLC 3GMNA 2ICWI 4IIQB 4YPJA 1YMHB 3ILPA 4JZOB 4D0DB 1OP3K 4JPIA 2E7BA 5D6CA 4TNWK 1DL7H 1KT2B 4EI5A 5KJRH 3DI3B 2X4UA 3O3BB 5CHNA 1AGDA 3W0WD 4MD0B 3S35H 4JG0L 1ZLUH 1M05A 1RV6X 3VXPA 3OSKA 4PRAA 4XCCH 3P30L 4XMPL 4HH8A 3RA7L 2H6PA 4RISH 4P2OA 4IRSB 5MEOB 4HKBB 4Q9CA 2DQGH 3O6ML 5SWZD 5CKGA 5JOFB 2R2EB 2G9HA 3GSXB 3MA7B 3O11B 3AM8A 4NUJA 1RVFL 3UTTA 1KN4L 4K71B 4OZFB 1B4JL 1XH3B 2VC2L 4R8WH 3JXAA 5JXAH 1MI5E 3U82B 4J3TA 1OAZH 4KMLB 1DBJH 4XP5L 4LRIC 1ZA3A 2NY0C 3E3QC 1TPXB 3RZWA 5I73B 5C2UB 3H3KA 4K7PL 2AXGB 2FHBA 4MA8H 4NC1E 5CP3H 2MFNA 3QUYA 5AZ2H 4OD2A 2XZCH 2A9ML 2DL2A 4LHUA 4S1QH 1ZXQA 3VA6A 3IDGB 5FYLE 4KUZL 3O6FB 1OM3H 1IGFL 5AZEL 1S7QA 1EIBA 4OV5B 4K3DL 2VE6B 1NCNA 1RI8A 1CXHA 3MRPB 3DX9A 1U6AH 2FO4B 4P2QE 1S7TA 4PJ9A 5C0BB 5HYJD 2L0DA 4PV9B 5TGBB 1ZANH 3BSZH 4ONGL 2CDEB 3M8OH 4HAFA 3G6AA 1JGVL 1SQ2N 1TNMA 3KWWA 2YEZA 2ZUWA 1ZWIB 1T1YA 4IMLB 1WBXB 4JZNB 2A6JA 3KPNB 2AK4B 1DQDH 3KLHD 5CGYC 1R5WA 5INCA 1OAYL 4KVCH 1YEGH 2GFBA 1FZKB 1A7NH 2GJZA 2OJEA 3V0WH 1CGYA 3SDDB 1J1XL 1F2XK 2V7HB 1KIRB 5FKAB 1YEDA 3VRLE 3MGAA 4K94C 1ZA6A 2ENYA 2XXCB 4DOHB 3GMLA 4F7TA 3F5WA 3QNYB 2PYFA 2CDFA 1LK2A 2V2TA 1SYSA 2EIZA 4JR9L 3H8NA 4P4RA 1KPVA 4JFZL 2YWZA 5F3HA 5I1LA 5LXGL 3G5VA 5DC9B 5BQ7B 2R29L 3L3GA 3QDJB 3UO1H 2WBJC 4M7JL 2F58H 1A3LH 1FVEA 2ZUSA 3RDTC 3HI6H 1LILA 4P4KA 1VENA 5I74C 1IT9H 4KJWC 2XZAL 2AVGA 4RQQA 4B7LA 4WEUD 1V5JA 5T1KA 2V5RA 2HG5B 4URTB 5C09E 4IDJL 2OTWA 4HIEB 1MLBB 4KUCD 3C5ZC 4JDVA 2P24B 3NFSH 1X5HA 4OBSA 1F5WA 3DTXA 2FGWH 4HLJA 1FFNA 2JJVA 4TYUA 3WUZA 5E8OA 5GS1C 3VH8A 1SHMA 5FOJA 4MJ4A 3OR6A 1HNGA 3QJFA 1KJ2A 4GUPB 2PO6C 4BQ6A 4XZUA 1MCBA 4KI5F 2Z93A 4ODXA 4Z0BH 4X9FA 1JN6A 2DAVA 4YDLC 1N7MH 3ABZA 5SV4A 4WUUA 2EEAA 4KI5E 5FF6A 3S8WA 1EUUA 5DRWB 1YUHB 4NRZB 1VERA 2OX5A 5IM7A 4K23L 5I76A 3TT3H 4JO4L 3W0WB 4U6YA 3PGCA 2DWEB 1JWUB 3MRMB 1DQLH 4PJXF 3V7AE 4DVRH 2A2QT 3OR7A 5SWZB 3LIZH 1NJ9B 3W9EA 5L0QC 4GAGH 1E4XL 4FTVE 1OAXL 4LCYA 3FB5A 3GSRA 3WIFA 1UM6L 1KCLA 2O93L 3C8HA 2F15A 3TF7C 4ZOBA 1YN6B 1SVCP 1MJ8H 3KJ4C 4FG6D 5J89A 4OD3H 4MD5B 3V0VB 1C5BH 2YPKB 3AROA 5I1HH 1MCEA 3GKWL 2R4SL 3BYYA 4HD9A 2DJ4A 4CU7A 1NFDB 1SYVA 2QSQA 5TH2A 3SKUD 5GS3A 2Z31C 3QIBD 2YKLH 4XXDA 1EVTC 1E28A 3SKJL 2H32H 5IFAH 2KH2B 4FQXA 4KZDH 4G6AC 3RVXD 1H8OA 3FT4A 3T1WA 5IFJB 3ULVD 1G7HB 2BZDA 4OAWB 2KUTA 4G6KL 4MD4B 1IAOB 4ETQA 5DHXB 1JP5A 1WBZB 5HYJB 5KSAD 3PG2A 1NC4A 4IRJA 5EUKB 1YZZA 1LEKB 4PB0H 3N1MC 4XCNB 5JW5B 1JNNL 2M1KA 1MAML 3ARFD 5CSGA 3LVEA 3W39B 4MQ7B 3JWOH 1I8KB 1D6EB 1SBSL 2GQHA 3QDMD 4O51A 4MJ5A 1IZJA 3U1SL 3MFGB 5L7XH 4R7DA 3MOQA 2ZNXA 4PJIB 4DEPB 4JN1L 4LLVB 4YZFF 5LBSH 1IARB 5GSVB 3RWJB 2HT4C 1OWRM 2ZPKL 3GRWH 4YZFE 1IAIH 3FB6A 4UBDC 3NABH 5GQBA 1Y0LA 2XZZA 2Y1VA 3MRKB 3QCUL 4X0KA 3UPRA 3CZJA 1CK0L 2BSSA 2FHCA 5TDOA 1MCWW 1A7QL 5J1AB 3QUML 3HAEG 4N0UB 2NW2A 5FO7A 5GGQL 1UVQB 5ICZA 2Y36H 3EJYD 3T0AA 2Y5EA 1PG7L 3OGCA 4JPWH 2VL5B 4R0LC 4KMTH 4PJHF 4YHPB 2V5YA 2AJSL 4Z7UB 4PJHE 4MHHG 4G8FA 4PREB 2CR3A 5FM5M 1G7LA 3RJDA 1QTYT 4OZIB 5I1JL 1M1SA 1M6OB 4TSBL 5IQ9A 2R1WB 2VMFA 1QYGL 3DJ9A 1D5ZA 1TIUA 3H3PL 3GHBH 3EYUL 4PJ8C 3HI5L 3VU2A 2HRPL 1IEHA 4UQ3B 4ALAH 3ROOB 4Y16C 2NX5A 3FQWA 3MCKB 3BD3A 4RIRA 4CN4A 3VRJB 2VXVH 3DROB 3GSOA 4MJID 4QHMA 1S9VB 3DUSB 2DJSA 2DQCH 5HGHB 2A73B 4IBLT 5L9DL 3RKDD 3WJLC 2YMXH 1FFOB 4U2ZA 4HPYL 3I50L 4ZS7H 1O0VA 3GJFK 3TT1H 5I66B 4P99A 3UZQA 5E56A 3CMOH 4NP4L 4PP2A 3BKML 3HZKA 1A1MB 3ZHDA 5DRZA 2F74B 1KEMH 3JWDL 4XGZB 1Q0XL 3OKLA 3GMRA 3DGGA 4WI7A 4QRQA 4OQ1A 1HWGB 4UIMB 3QQ9C 2NZ9C 5F3BA 5EBMB 1CQYA 2BVOB 2EYRA 3RGHA 4M4PA 3NIDE 2GUOB 4IOSD 1EEQA 4XP9H 1J1PL 3KYKL 3MNWB 4M62H 2AP2A 3ZKMC 4UDUA 5KSVB 3MPCA 3ULVL 2A6KB 1RJLA 1A7OL 2JCCE 2LAAA 5C3TA 5FOBA 4HW6A 3B2UC 5FDWB 4P57A 1MUJA 4WTXA 2V7NA 3QIBB 5I1AB 5A1AA 5CUSH 3D0LA 2VTFA 1J87A 2A6IA 1NDMB 1SJEA 2IFGA 4J12A 1KJMB 3ESVF 2XQYG 4EI5D 3C6SA 4ODBD 4PGDB 3VDAA 3ULUL 1MCNA 5TQ0L 3F6LA 1CG9B 3MLWL 1NEZA 5ALBH 2X40A 1GGBL 5DUPH 5BMFL 3HZVB 4EIZC 5GGSB 4JDTL 3CFEB 5KSAB 4OCYL 1FZMB 3INUL 3VI3F 4F8TA 4EI6B 3ZKXB 3QQNA 3V52L 3R06A 4KU1A 5KG9A 2BNQA 3VI3E 2X7LB 3UTTD 3ARFB 3TWCH 4GH7B 1T83A 3OKMB 1UT9A 3VXUA 3QDMB 1XGYH 2HJFA 2J6EA 3MRLA 1FLRH 2B2XL 4U1JA 3IXAB 3SY0B 5IVZB 5EORH 5L2JA 1DQML 3WS6C 2UZIL 1ZOXA 4P5TA 4XRCA 4XBPA 1ZLWH 4NPYA 3T2NH 3QUYD 1S9KC 4MS8D 4PJCF 4PRBB 1AE6L 2HLAB 4LHUD 3IDIA 2YPVL 2X5PA 2DBLL 1BFSA 3BW9B 4H5SA 4RMTA 3VFRA 4OFKA 43C9B 4JB9H 1ORSB 3QPXH 5CJOH 5KSUA 4I3SL 1WAAF 1MFAH 4M1CD 5E08L 2C4XA 4YGAB 3ARDA 4NDMA 2Q3AA 3PDGA 1WAAE 1BZQK 4O4YL 4D9LH 5K9JH 4I5BB 1DBAL 2ZKHL 4PRDA 5T1MB 2VQ1B 4MNGB 4I18A 3BN3B 3V7MA 3ZSSA 4LKCB 3O3DA 3BUYA 2H1PH 4OZGF 4PJAB 4O2EB 2QR0A 5J6GA 2IALA 4JO1H 3DX8B 4OZGB 1NCAL 3GUTB 4RRPG 5IB3B 3HB3C 4MVBD 4LDEB 3WNNA 5J06A 1IC4H 4PTUA 2VERN 4Q9QL 1KCVL 4AL8L 2X1OA 4JM2A 3SGEH 4IOFC 5SWQB 3FKUS 4PD4K 4JM4H 4WV1C 2FSEB 4JQVC 2WP3T 3V6OC 2J12B 3MV9E 1ZV5A 4ZUUA 2O5ZL 4MJIB 3EO9H 4LASL 1YEFH 4G5ZL 1EDQA 3UAJD 3VG0H 2DQDL 5GJSH 9CGTA 1Q0YL 3BH8B 2VDNH 4WTZA 3BD5A 4JHBA 4MCZA 1U8MB 1G9NC 3RPIB 2EKSA 5ID1B 1D5BA 1HSBB 1XZ0A 4G9DB 5I1GH 4L5FL 1INDH 5GRJL 3MO1B 5DQDL 4YR6A 1EO8H 3QEUB 3BH9A 4P4KD 4W4OC 4ZUVA 1LVEA 3MZGB 1RZ8A 1UA6H 1A4JA 1ETZA 3IETB 4Y1AE 1MLCB 5T1KD 5CSBA 1OF2A 2GSGA 1YEEL 2R0ZH 1FN4B 3SDAC 5DMGC 5IV2A 4Y8DC 1A02N 2AJXH 2XRAH 2A77L 3WNMA 2GHWB 5L8JB 4KTYA 4S1RH 3CXDH 3HMXA 1CDBA 1A5FH 2DS4A 3QFJA 4OF8A 5JHDA 2VLRD 4KK9D 1T4KB 1CGXA 5CBAA 2QJDA 3BZFB 3V6FA 2FYYA 3EDFA 1MIML 1XR8A 2FWOB 5D1ZC 2NLJA 3L6FB 4YHIA 1MCJA 4YDJA 4JPIB 5D6CB 1RZKL 4EI5B 2X4UB 3V2AR 2BVQA 3ZT6A 3NFNA 5CHNB 4JQIL 5BZDB 3H9SE 4GMTH 4N5EC 3I75A 5FIEA 1M05B 3VXPB 4YLQT 1BIHA 4PRAB 3WMSA 3N50A 3BP7A 5DMKA 1GC1C 3MFFA 2D9CA 3OAUH 1X4XA 5BRZA 2IQ9L 1U8KB 4MWFB 4DJMA 1A6AA 4OI8A 4NUJB 3WE6A 3UTTB 5F7WC 2APFA 4DQOH 2P8LA 3RWGA 1GAFL 1GGIH 3P0GB 2OM5A 2ICES 4UINH 5I15H 3PV6A 4PJ5A 4Z76B 3ZZ1A 1KV3A 1T20A 1TZGL 3HC4H 5F1IA 1H9VA 4C56E 1QKZL 4ODVH 2A74A 4IS6A 1KG0B 2JJTA 3TP4A 1QLFB 2ICCA 3QUYB 5GS2D 1G7JA 2WV3A 1CLYL 2W9EL 5DJXA 4LHUB 4E0RA 3S88L 3CDGA 1WITA 1JHKH 1NBZB 1G1CA 2IG2H 4TTDD 4F9PC 4PP1D 2FJGA 1Q9KA 5IEHA 1ODAA 2UWEE 1UZ6E 5FHAL 1ZS8A 3DX9B 2DMBA 1S7TB 3ARWA 1A6TA 1T22A 2MQCA 4ZXBD 4IRJD 1T2QL 2Z0BA 3LEXA 3KWWB 2YEZB 4G6FD 5FUZL 1IM3B 1P7QA 3VFUA 2D0FA 3WNPA 1T3FB 1R5WB 5INCB 3NTCH 3OTTA 4HIJA 2UUDH 2GFBB 2GJZB 2XIDA 2OJEB 2NPLX 3ES6A 4HMCA 4YX2L 2XNAA 1T1WA 3KYMA 3LEYH 1MOEA 2Z4QB 4ZUWA 2M26A 3QEQE 1F97A 3BGMA 1YEDB 1XF4B 1ZA6B 2J5LC 4JG1L 3GMLB 4F7TB 3GB7A 5BVPL 3F5WB 2PYFB 5EZIL 5DGQA 3BX7C 2FJFB 1WT5C 2EIZB 3AVEA 3DX6A 1QR1B 4P4RB 3TNNA 4K7FB 4M6OL 4L1HA 5I1LB 3G5VB 2YXFA 3LB6C 5B8CA 1K4CA 4PLKD 4GAFB 4WW2C 3L3GB 5TJWK 1MNUH 3FB8A 5HJ3A 3FMGL 1ES0A 2FECL 2VXTL 1FVEB 1YECH 4WU5A 2FATH 5GGRA 4P4KB 5D7KE 4O5LL 1KJ2H 4UT9L 1CE1L 2CH8A 5EZJB 5E70A 4RQQB 5B38A 4W6XB 5T1KB 1BAFL 4FFZL 4RGOL 1KNOA 4JDVB 3QO1A 1CU4L 1ZHLA 4OQTA 4ZUSB 1I9JH 1FFNB 4YHZH 5E8OB 2HH0H 2Y06H 3VGDA 2VZVA 3OR6B 1KJ2B 1Q1JL 1GIGH 2VLRB 3P9MA 4CVUA 3PGFH 4U6VH 4NIKB 1FH5H 4UTBL 4KDTC 4XZUB 3CVHA 2AJVL 2Z93B 4ODXB 5J8OA 4XP1H 5MHSD 2VO5A 5EO0A 1JN6B 5KN5B 3T65A 1I1AC 1EEUA 2X4NA 1ZLVH 4WUUE 1CE6B 4HCRL 1IC5H 2ZCKH 3D1MC 1P53A 2X4QA 1R3HA 2XA8L 5IM7B 3FONA 4HJGA 2FX9H 3U30C 1X5JA 4U6YB 1HDMA 4KPHL 1N6QL 1RZFL 2NY2D 5HBBA 4NFCA 4P2RA 3L95A 4Y4FC 3BPLB 4LP4A 1UJTA 1MRFL 2LU4A 4AIZB 2APTA 4OLZH 4PJBB 3W9EB 4OLWH 1P5VA 1TTFA 2EIEA 5GS2H 4FQCL 3FB5B 3GSRB 2B4CL 4OJFH 5HSFA 1QBLL 1F6AA 4HV8A 2XKSA 2V5TA 1AGFA 4XPBH 2ZCLL 4LFHG 4OUOA 4UOW1 1U3HC 3FO1A 3LY6A 1SYVB 3RKPA 5HTSA 3LQAH 2J7LA 5TH2B 2FZ3A 3ZDYE 3T04D 1IC1A 1U95A 1NH6A 2E9IA 1JCKA 1YJDH 1JNLL 5HXMA 4FXKB 1E28B 4HXBH 5IG7B 4DTGH 3MOBL 1V3LA 3OKDB 1A6ZA 3BDYH 1I9RL 4XP6H 1IAIM 5F8RC 1OPGH 2HRLA 1A14L 4WWKD 4MDIB 3VD5A 1A6WH 5F1NA 1NCDH 4DVBA 1JFQH 4ETQB 5CZVH 4ZAKD 1CFQB 2OLDA 4ZXBB 5DUMH 4IRJB 3K2UH 2CLRA 2HVKA 4ERSH 2BNQD 1NLBH 4G6FB 1SBBA 4U31A 1W0VA 4PJEA 1RURH 3FO9B 1I8LC 4M00A 4MA3A 1ZLSH 4MJ5B 2GTWA 1HH9A 4R7DB 4ACPA 3IDNA 1IBGH 3S4SG 5TF0A 3NH7L 3NCBB 1N4XL 2D31A 4XVSL 5D7LE 3VXNA 1H5BA 4ODHH 1JPSH 4K8RD 1Y0LB 1BREA 1JRHI 4LSVL 2NY4C 5TDOB 1QHOA 4WFGD 3ZLQC 1LP9E 4Y0GA 2NW2B 3WFDH 3R0MA 3HG1A 5ICZB 4ZPVA 4LSSL 2Z92A 4KK5C 4B0MM 1ZVYA 3OGCB 2X4PA 1DJSA 4B7IA 4P23A 2H45A 4QO1A 4Q9RH 3P0VH 3ZE1F 4ZTOH 4E42A 4XNYH 3O4OB 3RVVC 2ZNWA 4IRSC 4PGBA 1MFDL 1NGZA 1C5CH 1MCCA 2O26U 3U7WH 5DEGB 5IQ9B 4ZFOA 1OGAE 1VEOA 4LMQI 3WBDA 1D5ZB 5IB4A 2Z8SA 3U7YH 3KPLA 4K71C 4X6EA 1L7TH 2FB4H 1NAML 5F7UA 1QSZA 3UYOD 4JM2D 4Y5XC 3U7AA 4YDKH 2DYPD 1NMBH 3VCLA 2H9GA 2NX5E 3FQWB 5A43C 2APXA 5IF0A 3VD9A 4RIRB 1CDCA 3QUXA 1TPXC 5I73C 2UVEA 3GSOB 4QHMB 4OCRH 2LU3A 3D69A 3WFHA 4OIBA 3QEGH 3MRRA 3E1F1 1U3ZA 3P9LA 3O6FC 3QXDA 3CLFL 4PP2B 1WV7T 1S9XB 2CKBA 4JAMA 4PRIE 2VR5A 1WC7A 3F58H 1B2WL 2NY2B 4EOWL 5IKCA 4M7LL 5T1DL 5HPOA 1UWGH 3DGGB 4JQXA 1DBKH 4PBWD 4Z0XA 1HK6A 1MRCH 1P84K 5HGBA 3WIIH 3O3EA 4P2QD 5F3BB 3PGDA 2EYRB 3AMLA 4FXLA 4ZNCD 1CD0A 1KCUH 4AEFA 1DN0B 1QD0A 4TSCL 4XVJH 1NL0H 4OGYL 4XCYB 1EBPA 2YK1H 4HUXA 3ZT5A 3MXWL 2VDQL 2E27H 2GT9A 3QG6B 3VFWA 5BOPA 3QFJD 5J4MA 4HFUL 2EE9A 2OR8A 2RR3A 1NAKL 5FOBB 5EA0L 3SDDC 2HLFD 2W9DL 3ZTJG 1MUJB 2V7NB 4G8GA 2RB8A 1QFWL 3D0LB 3D5OF 1IEAA 4PUBL 4MYWB 5E99H 5CJQL 1SJEB 4TRPL 5J11C 4NHCL 3VFGH 5J7CC 3DBXA 4HQQL 4HT1H 4KHTH 3HR5B 3TJEL 1KF9B 3N1GC 2J6EH 4WWKB 1FCGA 1YYLH 1NEZB 5INDA 4QY8A 3KPOA 3V5DA 2C1PB 2CPCA 4FFYL 3D25A 4ZAKB 4JRWA 3D48R 3LPGA 3ROLA 3IRPX 3TESA 4XNUH 4LBEA 3I84A 5FCSH 2DLFH 1SEBA 3R06B 2EZ0C 5KG9B 4K8RH 4YXLL 3PWVB 4OCNC 5JOPD 4PGZA 2VZ1A 4R4BA 3VXUE 3WFEH 4XPHH 4PS4H 1T80A 2HJFB 5GGRY 3MRLB 4PJ5D 1CLZH 4U1JB 4LHJB 2ICWA 5EBWA 2DQJL 4Z7VE 3BWUC 1BVLA 2J4WL 4PY8J 2OMNA 4G7YH 1B90A 5CEYA 4XRCB 4O9HL 4XBPB 4NPYB 2D7TH 4HK3N 3KJ6L 4J7RA 5DRNB 3OPZH 1N3NB 2OR7A 4P48A 3IDIB 1GOHA 4YEFA 3MJ9A 4FNLH 3CSGA 2OK0L 1NC2A 3FN9A 4EUPA 5I1EH 1FGNH 1TCRB 3UBXI 4NNPL 2OYPA 3GSQA 4H26A 2HKHH 2PW2A 3FQTB 4HIXL 2IANA 4H25B 3TNMA 4NDMB 4ELKA 2C3XA 3MNVA 2FJHA 4KKBC 1AXSA 2B5IB 3H42H 2C5DC 4PRDB 5IMKA 4GW4A 3P3YA 5DTFA 2AK1H 1ZTXL 3HAEH 1CD9B 3O3DB 5F7LB 3BUYB 5DR5H 2DLEA 1P7QD 3RHWK 5J6GB 2QR0B 2IALB 1TNNA 2GKIA 3PWPE 4G9FA 3UMTA 3C5SA 1MWAA 5GSRA 5KZCD 4K2UL 5E00A 3HCVA 3PDDA 4LPUA 3TC9A 1YY9D 4QLRA 4G7VL 1EAPB 3CVIL 2J88H 2O61A 3SDYL 4TTGA 4JM2B 2DYPB 1QQDA 3QWQB 5K59F 5FYLL 4X4XB 2WNGA 2AQ3A 5K59E 5DHVA 2AAVA 4ZUUB 4N8VA 3K2MC 4M5ZH 3UXFA 1BBDH 3CFDB 4F37K 4LNRA 4MCZB 1P9MA 1HEZA 1NKRA 2EKSB 4BA8A 1XZ0B 2ADJA 2GK2A 1U8NA 4YHLL 2VLKE 5CILL 5DFVC 2CMRH 3AXLA 2Q7NA 3BH9B 5EU3A 3HMXH 3WFCL 3Q1SL 1JPTH 1I85C 4ZUVB 1A1OA 1QSFA 1RZ8B 3WKML 1WQVT 4QWWD 4H20H 4WI3A 5IVNA 4NZTH 2DF3A 3VXSA 4GJTB 2NQCA 2QTEA 1UADC 4P2QB 2VUYA 2YRZA 2ATPB 1OF2B 2Q86B 3KPPA 1VFBB 3HNTH 1QLRA 3KLHC 1JF6A 2VXQH 5LGJB 4WEBL 1KULA 4NQTA 4I4WA 3WKNA 3IJYA 3QFJB 2DDQL 5JHDE 5DO2D 1KPUA 3MYZA 4NQXA 4CDGC 2V17L 4N5UA 3RIFK 4MSWA 1U93A 3GMPA 5ABDE 3DVNB 2DIAA 3PNWA 4GT7A 2FYYB 5EZLB 3O2VH 5GGTH 3SBWA 2QSCL 2NLJB 2R23A 4YHIB 2W92A 1T2JA 4N9GB 5EU7E 4YDJB 5HHME 1PLGL 2X1PA 3D39E 1UM4L 3RI5K 3WNOA 5GRXG 3PDOB 4ODSH 5DUBA 4LEOA 4QRSA 4CNIA 4NQVA 2HFGH 4P2RD 4MAYA 3BP7B 3C2SA 5EC2A 1AGBB 5DS8A 1VGEH 3MFFB 1PZ5A 2BNRA 1XF3A 5I8OL 3GGWA 4FFVC 4LSQH 4JRYE 3P11L 1RMFH 2A9NL 4MMZC 1J0KA 3WE6B 5I17A 1IGYB 1IQWL 4PRHD 5GGVY 3RWGB 4DKEL 2EE6A 4PJ5B 1GL4B 4YDVB 5F1IB 1U8HA 2H3NA 1AHWA 4IS6B 2KZWA 4Z7NF 1S5HA 1U42A 1SVZA 1XCTB 1U3YA 4H8WH 5FUOH 15C8H 4Z7NE 5JOEA 1O7SA 2FX7L 4E0RB 5E2UL 1WJ3A 5ISZA 1T03H 4R3SA 4UI2A 4HWBL 1XF2A 2FJGB 4XC1L 1Q9KB 1MEXL 5IEHB 3O8XA 2R1XA 4WI2A 5H8DA 5LCVH 3ULSB 2GY5A 3DYMA 3KYAA 2EDKA 1D5IL 4LLDA 1A6TB 4JE4B 5GRVL 1T22B 2R2BA 2AERT 4G43A 5F97E 3BPOB 4HBCL 3HTLX 2F53E 1G6RA 2FD6H 3LEXB 4UT7H 3MCLL 3U9PL 1JNHA 1XF5A 4PG9A 4OGXH 5E8EA 4KTDH 5JMRA