5GIRA

Crystal structure of a fab fragment with its ligand peptide
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
213
structure length
207
Chain Sequence
EVQLQQPGAELVRPGASVKLSCKASGYTFTSYWMNWVKQRPGQGLECIGMIHPSDGETRLNQKFKDKATLTLDKSSSTAYMQLSSPTSEDSAVYYCTTHFDYWGQGTTLTVSSAKTTAPSVYPLAPVCSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for multi-specific peptide recognition by the anti-IDH1/2 monoclonal antibody, MsMab-1.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Heavy chain of Fab fragment
total genus 44
structure length 207
sequence length 213
chains with identical sequence H
ec nomenclature
pdb deposition date 2016-06-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5girA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5girA02
3EJJX 1S9YB 3MA7A 4L5FL 1UM4H 1QR1B 3BVNA 1JV5B 3VJ6A 3QWQB 4RNRB 3SJVE 1BQSA 1K3IA 2D03H 4NO5B 4NDMB 4WU7B 4LVEA 5CMAA 5DHVH 5HYSG 4YWGH 1YA5A 1TZGH 1KB9K 5EB9A 4PGCB 3MRGB 2GJJA 5IFJA 3B43A 5IBTL 4B53A 3NAAH 3HE6A 3GRWH 4WGWB 3TN0A 3OB0K 3V6FB 1RZGA 4ETQA 3K1DA 3MCKB 2CKNA 1Q9WB 3D87B 1CK0L 3ZKXB 4AG4L 1CLCA 3EOBB 5J3HC 3MJ9A 4NQXA 5MHSE 4U6YB 4DEPC 3SKMB 5GS1C 3FOLA 3K7UA 4OGYL 1T4KB 4BKLB 4W6YB 3ZT6A 4P46A 2AI0L 4GBXC 5J6HB 4I9WD 1H3VA 3U0WL 2WLYA 3BJ91 1MCOL 3QDMA 4Q2ZA 2P44B 5H2BA 4D94A 2XN9D 5GGQL 2ICEB 1JK8A 1KEML 4R6UA 5DC4B 4QTHA 2H2SC 5T1LA 3QWRD 5D1XC 4OLUL 4KY1L 3DTXA 1JMZA 1S7UA 3IFOB 1IKNC 4RMSA 4QYOA 2FEDD 4TNWF 2R23A 1NBYB 4PTTB 3B9DA 1T04B 5I8EA 5GGUA 2A1WH 4MJIB 4N0YL 4NQDB 3UXFA 4Q9QH 4XHQA 5L0QC 4TNWK 1DBAH 3H3PL 4JREC 3UDWA 1GGYA 4Y2DA 4NKDA 2EYSB 3BSZL 3BQUC 3I75B 2DN7A 4TVPE 3TYFB 5C2UB 1LO3H 3PWVA 3OKEB 3UPRA 3DVFA 4OSUL 1G7MB 4JZOB 1JF6A 5B4MC 3KPPB 4WFFE 2FO4B 5HBBA 4FN0A 2YWZA 1F8TH 4JO2H 4XVTH 5FEBA 3SY0B 3NCCB 2HJKB 1EHLH 3CFDA 3BE1L 3DX7B 4BM7A 3L7FB 3PV7A 3GMLB 3MREA 2OK0L 4BQBA 2KL6A 4X9IA 3V5KB 4CN6A 3T4AB 5C0GA 2CGRH 3PHQA 4Y4FD 3MRCA 2R1YB 5KVDL 3NFNB 1NKOA 1J5OL 1CLOH 4JQXA 1BOGA 1RZIB 3G04A 1FBIH 1B4RA 1LE9B 4EIZC 1CG9A 4JY4B 1KJMB 5D1ZA 1HH9B 3SDAB 1I4FB 1EJ6A 5BZDA 2WMPA 3DV6A 4AEIH 4BFBD 4WW2C 2AW2A 3W0WD 4JN2B 4Y7MA 5TDOA 4EBQL 2MKWA 2VQUA 5DI8B 1LEKB 5F6IB 4EVNA 1UEYA 5I1GL 4U6XA 3H9ZA 4KTEH 4WFGD 4LLVA 2FGWH 3L5XL 4RMRA 4P2RD 1H5BB 4KK8D 1X5JA 4NO2A 3X14B 1VFAB 3S34L 3T4AA 4BFEA 4OT1L 5JXAH 3P4NA 2HVKA 3AM8C 3MRCB 4M6NH 2NXYC 1MWAH 4ONOA 3G6DL 4C57C 4Z7QE 2IWGA 2GEEA 5DR5H 4MQXD 1U8NA 1F4WH 4KJWD 3TA3C 2DL9A 3EFDH 3RAJL 5TE4H 3HMXA 3TO4B 4FQCH 4YDJB 2BSSA 4ELMA 5I1HL 4DAGH 1Q9OB 4OF3A 4UAOC 1AGEA 3DO7A 3LRSB 4XVJL 3TCXA 3I84A 4OZIF 4EXPX 4Q9BA 4QRSA 2MQ0A 1INEH 2ZSWB 3BO8B 3CH1A 1RJZA 1ZA3B 3V5DB 3BN9C 3C60A 1K6QL 4X7TB 1QO3B 1VFOA 2X89A 4KKAD 2GK0A 1FO0L 1JN6A 1R6VA 3U6RA 4P48A 3H42L 4XPGL 5IK3B 4HXAL 5EIVA 2Q7YB 3A6CL 1C16A 3G6JB 1F3DJ 3BOVA 3NCEB 1J1OH 2JJUA 2NY1B 3HI6H 5LBSL 1BF2A 2XXMB 4M3KB 2VLRD 4KRPD 4WUUA 5AYUL 2ZUYA 1SM3H 4JHWL 2C4FU 5HY9B 1T66D 4KUZL 3E3QC 3VGFA 4K7PX 4XAWH 3VW3H 5DK2A 2VB5A 3K3QA 2RHEA 3KPTA 2X9XA 5AD0B 1OAKL 1DQLL 2WWKO 3EIFA 5F96H 4NN7C 2QQQA 5EBMA 3IVKB 5SX5H 5HDQL 2CXGA 5D6DA 4RGNB 3MFFB 5L7XL 1KTDA 4KVCH 4X98A 1WGOA 2DIJA 3MZTA 5IJVA 1QKZH 1TXKA 3MQIA 4GSDH 3HZVA 4FMKA 4FQ1H 3NCMA 5D1ZC 1Q9LA 1RJZB 3E2HC 5MHSD 3PQYA 2XWBA 4OD1L 3UTZA 5IBUG 1BJ1H 3FOMB 4DVBA 2HMIC 1FAKT 1DQML 4NHCH 1NUFA 3VFTA 3NTCL 4G7VH 3H9SE 3IDXH 4I77H 4LSSL 3BT2H 5BRZA 1A4KB 4ALAL 3ZL4L 4U49A 4PJCB 2VLJB 4R8WL 5D1QA 5E4IA 2ZJSL 2DBLH 1INDH 2RQ8A 2JCCE 4NZJA 5HGDA 3MRQB 5KVEL 4V1DD 5DK2B 1C7TA 1S7TA 1LEIA 1TJHH 3RVWD 2F53B 1ROWA 4P2QD 5GRVK 2RCSL 2F58H 4K23H 1DR9A 3PP3H 3BKJH 1UGNA 3STZA 3WSQL 3RUGA 4HKJA 2MCPH 4WWKA 2QHRL 5C9JB 5CHNA 3GSNB 5IP4A 2WWMD 3K4AA 3BH9B 5HTSA 4Y1AB 4WI6A 1QOKA 4NBYB 4QRPD 2G9HA 2I60L 4JZNB 1FJ1A 3FQUB 2DD8L 4LLYA 4CNIA 5FYKL 4CVXB 4R2GC 1G9MC 3SOBL 5JZ7C 1MIEL 1XIWB 4L8SA 3DPBA 4I18A 1XGPA 5CJ5A 4O4YL 2X41A 1B2WL 4X5LA 2UUDH 4R9HA 2EDQA 3H6JA 3HRZA 3EO9H 3DROB 5C71A 1MUJA 1CXIA 4D9LH 3BIKB 4ZUWB 2F74B 2YBRB 2IAMC 4Z76A 3Q2CA 4GLRH 3NFPA 4K9EL 1QD0A 1DQQB 1KB9J 4U6VH 5DRXA 3FQNA 1A4JB 2GSIA 4HJJH 1F3JA 1FZJA 4EQ3A 3K8MA 4R7DB 5BOPA 5IFAL 5DJAA 5HHMB 1P6AB 4LU5L 2AVGA 2VXQH 2ZNXA 2O93L 5B3NA 1R5VB 4U1SB 5I1AA 2DQIL 5DJCA 4GAFB 5I18L 4HC1L 3MLRL 5E8OB 2W38A 3MJ9H 1YEIL 2DQTL 1FYTB 4GRLA 4LLYB 3TYGL 4CNIB 1FZOA 2G2RA 5BV7B 15C8H 4HDIB 1MJ7L 1XEDA 2GHWB 3GKWH 4JFOB 4RAUA 1U8OA 3QR2A 2HTKC 2VAAA 5J13B 3VRLE 5F7NC 4K94H 3TBWB 2BCKB 3RJDA 1G0DA 5E2TH 5B38A 3TH4T 4X9HA 3EHBD 3HUJF 3S5LB 4HQQL 5HHNB 3JVGC 4HIEB 1T5XA 5EIIB 4XXCC 1BQHG 4J8RB 3MFGB 1JGDB 4KPHH 1RU9H 3TC9A 4NT6B 5EOQH 1FL6A 3UAJD 4ZSOB 3UTTD 5A2KH 3SGKC 4UIKL 4XP6H 4X5XB 4JFYA 5I6XC 4QKXB 1G7QB 5D71L 4MNQE 5IIEB 1RUQL 4HX1A 2PTTB 5CINH 1NPUA 5KVFL 1YQ2A 1ORQA 4EKXA 4WY7L 3C8DA 5E08H 3WFEH 2FJFB 5IQ7H 1HCVA 3HZKB 1MI5E 4PRDB 5JMRA 1I7TB 2LAGB 4OCWL 4HBQA 1E27B 1C08A 2IALB 2NY7H 1GL4B 4X4YB 2DI8A 1KN4H 3NCJL 1ZT1A 1DBBL 4PJXE 1SVZA 3CSGA 3SDAC 2R2BA 3TCLB 3WHXA 2Y5EA 3VWJC 3QH3A 1OTSD 5KANI 5EORH 4IOFD 1EVUA 3V7AE 1F90L 3O6FB 3REWB 2ENSA 2JELL 4H25B 4Z0XB 4PV8A 1SHMA 1NGWB 4HUXB 5IVZA 3RWGB 4BSWA 4PJ5B 2YKLH 4FFWC 5DRZB 5EU7C 1JUFA 4PV9B 1KBGH 1B4JL 3MUGA 3LKRB 4J3UA 2W59A 4MS8D 2EKJA 3S36H 3MLWL 1MH5B 5CJQH 3GUTB 5KJRL 3ULVD 4P9HC 5F88A 4U31A 1XGQB 1YC8A 3QCTL 3MRLA 1KCUH 5EFIA 2Y9RT 4M7KH 4Y5XC 2H1PL 4WV1A 5DMIL 1LD9B 2RFXB 2J6EH 5FK9A 1DUZB 4TQEH 2HT2C 2C4FT 2EECA 3OPZL 5HYQA 5D96C 2B0SH 4ZD3H 1EVTC 5B8CB 1MFDL 3WFDL 2YZ8A 2OTPA 5C0BA 5TF1H 5CD3A 3O2DL 1HHKB 1N59A 1YEDA 2MTPA 3ARBC 1J8HD 3H0TA 4I3RL 5LG1A 5A16A 5A2FA 1AQDB 1Q0XH 1T0MB 4URTB 5FGCE 1PG7L 2Q20A 3F58H 3RPIA 1KB5L 3K80A 3OGOE 5GGSA 3VD5A 4ELMF 4F80A 1A3LL 4KK5C 1FL5B 4PJFB 3W9DA 3C6LB 4L29A 3KYMA 4CKVX 4FNLL 1AGBB 4DKEH 1OAZL 4WUUD 2WUCL 4YLQT 1A7RH 1AFVL 4GBXA 4ZPTA 1G7JA 2R9HD 2AEIT 4JHAH 1RHFA 1C8PA 2BY3A 3KLDA 3KNBA 3D9AL 2GTZB 4RFEB 4OB5H 1PAMA 3DVIA 4LCWE 5FO8A 3JTSA 4XPBL 5CCKH 1JRHH 3QYCA 1ZVYA 4HCRL 2BK8A 5KVGL 4N8CL 1OQXA 4XH2B 5J6HA 3HE6C 1CD1B 4DGVL 3IJSA 1TTUA 1MQ8A 3RZCB 5CWSA 3ULUC 3IXAB 5CLTA 3WFBH 4OZGF 4Z95L 1CIDA 5HVWA 1ZGLP 3AMLA 2P8MA 3FT2A 1CXEA 1UWXH 1MIML 4MXQD 3TNNA 5LGHH 3TIEA 5DHXB 1I7RA 2AXHA 5JPMB 1CDIA 1YMHB 2Z93B 3P0YL 4K9EC 4ZDHA 1RJYA 4JVPA 3EUUA 2V7HA 1UWXK 2A77H 1RVFH 1O7SA 5ISZA 4JO4L 3QUML 4QRUB 4JM2A 2HJKA 3HFMH 3WMSA 1FDLL 4GS7C 4G6JH 2PTVA 4LQFL 1QLRB 1NEZG 5C0AE 4Y2DB 4NKDB 4KKBD 1HQRA 2A9NH 5DTFB 3DYMA 2FL5B 5C3LD 1T1XA 5T1MB 4S2SA 4S1SL 1UQSB 1BD2A 1FPTL 1Z5LA 1LDSA 4Y5VC 2VABB 1EXUB 1PQZB 5MEOB 2FO4A 4LLUB 3VWKB 2CIIB 3KPQB 1RZIA 1TLKA 5FYKD 4NQEB 5BO1H 1A3QA 4TOYL 3DGGB 3BH8A 1T83A 5DMGC 5I76A 5GS0H 1CFQA 1AKJA 3V4VH 3GDBA 1IQWL 2HJLA 2MMXA 5E00A 3T0BA 1K3ZA 4OGZA 1JTPA 4PRBA 3GKZA 3OJMB 4HKBA 4ZOBA 3V8OA 3PL6A 5ENWB 3T2OA 1N4XL 4MGXA 4EUPH 1QSFA 1NGPH 1IAKA 2VDKH 1JYNA 1HSAB 2PO6C 1D3CA 3ZTJH 2WINA 1VADA 5L2KB 2X05A 2BNUA 1T3FA 5ISZB 1TPXC 3MV9D 4PB9H 3IDIA 2BRRL 5FYJL 3T65B 3NABL 3UCRA 1FZKA 1XGUB 1LNUB 3VH8B 1AHWC 3VI4E 3ES6A 2E8ZA 1VFAA 4JRYA 1ODAA 1CF8H 3OF6A 1F2XK 1X4XA 2OXHA 1INQB 2QQLL 4NC0B 2N56A 2JF1A 1A9EA 4HMDA 4LSTH 5DVNA 2VABA 2O5XH 3GZKA 4RGOL 2MJWA 4HUVB 2AEPH 5BW7C 2R69H 2VZUA 3VFSA 3DX8B 1HXMB 3QWOA 2WBJD 4DGYL 2CSPA 5ESQB 3RVXC 1MFAL 1T0PB 3GMRA 3F12A 4U1NA 1AGFB 2APTA 3TLRA 3O4LE 3WJJC 3L5JA 3ARSA 3P9LA 4XX1G 4AL8L 4RRPG 5ENWA 1OD9A 1QTYT 3ZKSD 4FA8A 5I1EL 4LSRH 2YK1L 2FBJL 3HAEH 4Y16B 2OJZL 1MQKH 3VA2C 4PRNA 3K2UL 5ETUB 5CBAA 4WU5B 1DLFL 5I1KL 1MSPA 5TDNA 4CL7A 3BP7B 1LNUA 3PWJA 5EULV 3VDCA 3AY4C 4D0CB 2I26N 1T5WB 4QT5A 1MJJA 1QSEB 3QFDB 1MCNA 1LILA 2J5LC 3U7AA 3S88H 4I3SL 32C2A 1U0QA 4DW2H 1BAFH 1AXTH 2Z4QB 4P57A 4X6FA 1WCBB 2F19L 4I48A 4G7YH 4BFGA 1WBXB 1EZVY 1CR9H 4A6YA 4BJLA 5SWZE 1N5YL 2C26A 3KLAA 1DVFA 1WBYB 1YECH 3ALXA 4TSCH 3QG7H 4GXUM 3MX0A 2SEBA 3DV4B 4M8QA 4Z9KB 5ACMA 1JTTA 3BPOB 3LD8B 3QPXL 4ODVL 4LK4A 1IGTA 1DBML 1KNOB 4HF5H 2JB6A 4GRWE 1S78C 4C54A 4WU5A 2EIBA 2EYRA 2X6MA 4PRIB 3W5NA 3BZFA 1SEBB 3LKOA 4JR9L 5IG7A 2I9TB 1FH5L 1N7MH 3BPCB 4WNQA 4ZXBA 2V7NA 1T1WA 4PLNC 4KMLB 3JV4B 1PLGL 5FF6A 4WI8A 3QULB 5E6IA 3QXTA 3GSWB 1AD9A 2HFGL 3AROA 1MNUL 3WKNA 4JANB 3HNVH 5C7XH 4XPTH 5LCVL 4D9RD 3IJHA 1H3PH 1P4IL 4R7NB 2F53A 4NZTL 3C5JB 2D7OA 1QLFB 4PGDA 3ARXA 4LEXH 3OKMA 4NDMA 1BQUA 3GMQA 3JZ7A 4MWFA 3VFRA 5K9QI 2D4FA 5JUEL 3TWCL 3G6AB 2QL1A 1MOEA 3KPMA 2R2HB 2PYFA 4FP8H 4HXBH 4CVXA 1WC7A 4HJGA 5E70A 4CW1A 5JIPA 2V7NB 3VG0H 1X5YA 2X4OB 2NXZB 2Z31C 3QZWB 1FFOB 3R0NA 5C9JA 3GSNA 2Y36H 2CDEB 2LU4A 4KHTL 3NCYP 4TRPL 3RVVC 1MLCA 2PXYD 1ZSDB 3QHZH 3NFSL 1F6FB 4PJEF 3ULVE 4KVNH 1AR1C 1IAOA 2VLRA 3KJ4C 5F9WB 3IKCB 3QJFA 3MOAH 4L5FH 3QCUH 4M62L 5F9OL 5F9AC 3RZWA 2YPLE 4RWYL 2R0ZH 1XIWA 2R0WL 2OQJA 4LCCC 3PNWB 1HE7A 4C4KO 2JE8A 2DIBA 1A7BA 1YPZF 2NXZD 4IS6B 4BZ2L 5AZEH 3QIWC 1A6ZA 4XNQA 3ZE0F 1CD9B 4OZGE 3CZFB 2XT1B 4XXCA 2XZAH 4PJCF 1XZ0B 5EG6C 4UZGA 2VRAA 4OCXL 5D7LE 1DVFC 2F74A 2YBRA 2DB8A 3HR5B 4L4VD 3Q3GB 3PE9A 2J88H 3EJZD 4AT6A 3EYFA 3I50H 3T4YB 4YNYB 3HZYA 5CJBA 3AU1A 4TPRL 2X4QB 4PBXA 3RVTD 3SE4A 1U8IB 5CSBA 1HQ4B 1KPVB 1ZHNB 4OZIA 2PR4L 1AC0A 3BP5A 4R4ND 2OZ4H 2W0FB 3IKCA 3QJFB 3U0WH 1H0DB 4GRLD 1S78D 4X6BA 4YFLF 5C09D 4IHOB 4OM1H 2ZG3A 3CFDB 3IDJB 1KLFA 3NZHL 2BP3A 4NNXB 2PTTA 3V5KA 3MRGA 2WZPD 4NP4H 3VXPB 3D85D 3MACL 3HZKA 4N5EC 2F53D 4PRDA 3D2UB 4OCSL 5IVXB 4XC3H 5C09B 2IAND 5KSAB 3H3PH 2ZPKL 5DD5L 5F6IC 2VO5A 2J7LA 3UTPE 3O4OC 4NQSB 4ZOCA 2J8UA 2IG2H 1ZS8B 1LO3L 4MNQB 1AY1L 4U1JA 2YPLA 5JHLH 4PFEA 1NMCC 3TJEH 2WM0A 5HPMA 2PO6B 3UJTH 4YZFE 4NC1C 1LK2B 4XGZB 1EHLL 4U1KB 2CRZA 3X3FL 3QCVH 3F5WA 4OCYL 4L4VB 4DKDC 5H35A 2E6JA 2K9UA 3CK0H 3R8BB 2VUOA 1JZ2A 2GKIA 3HI5H 3MRLB 1SJXA 3C5ZC 3RKDD 5DQ9B 3ME0A 2AQ3A 2L0DA 1RZKH 4GBXD 4MD4A 3QUYC 5D8JL 5ESAB 1A64A 5BVPL 4Q9RL 5EO9A 3KYNB 4XNUH 1I9RH 4GW1A 2BNQE 3KPNA 3MYZA 3LKSA 4OZIE 4G5ZH 4N8VB 3D0VB 3BKCL 1DP0A 4G42B 1RUAH 3UTOA 3C2SA 4UUJA 5ICXB 4YHNB 4FFYH 1WICA 5F1NB 2NZ9D 3C60D 2GTWB 2LE9A 3UTTB 1TVBA 3P9WB 3MRKA 4FOMA 4PS4H 1EBAA 4JREB 2CDFA 2A74A 5D9SB 3VI3F 2Z91B 4JFQA 4LSPL 3WFZA 4BK5A 4YQXL 2V2WB 3O0RL 1QBAA 1WT5A 3GBNH 2FX8H 1ZHKA 5AWNL 1A14H 1KCRH 3DTXB 1QRNB 1MRFL 4X7DC 4JG1L 5F7MC 2NCMA 3ARVA 3B2VH 5IOPB 4GO6B 2R23B 3KPSB 2BHZA 4JKPL 2EXWC 1K8IB 4CADB 4KQ3H 2C1PA 1OP9A 3NN8A 2LVEA 4KMTL 2VLMD 5K9OA 1TJGH 4UUJB 1U95A 5CEYA 1NJ9A 1QP1A 4Y1AE 3KYMB 3I75A 1QSFE 1B0GA 3SO5A 3X11B 2WBJB 1MCCA 1OOAA 5C0IA 5A2LH 4Z7UF 2A6JB 3OKNB 3TM6A 1V3MA 2GW5A 3RL2B 5C07A 3MV9A 4CDHA 3UTZB 3W82A 5F7KC 5B3JE 3L7EA 3VXRD 1V3KA 4UU9A 3NOIA 2B39A 3WBDA 4FQPA 4P4KA 1TZHB 4KGLA 1YUHA 4ZTPH 3C6SA 3PIQB 1ONQB 4JHWH 4DTGL 4UILH 3B8SA 4XNZC 4KUZH 5CILH 4AMKL 1GC1L 3VW3L 1IC4H 4JM4L 2C4XA 5IB2A 1K8IA 3BXNA 1MCBA 1ZT4B 2UZXB 4HAGA 3FT2B 2QSCL 1TTGA 2J4WH 5ICYB 3TIEB 4YDJA 4AQOA 1OGAB 3MNVB 4DWHA 4L4TA 1GZPB 4MB5A 4KK6C 5GZND 1KPUA 5F1IA 5ID0B 1DDHB 1Q0YH 2GY7B 3O8XB 4XT1C 3P11H 4MA8H 4RGNE 5AYQA 4TVPD 4GW5B 4DUVA 2Y07L 2VZOA 1R0AL 5C07B 2O5YH 3RVWC 1JHKH 1MAML 2VLKB 4U7SA 1T2QH 1IGYA 3IDXL 2CLRB 4I77L 3BT2L 2ICCA 1ZA6B 4PP2A 3G6JF 1XGPB 12E8H 2BFVL 3LKNB 3OTTA 1HQRB 2P7TB 2DBLL 4JG0H 1INDL 2EDOA 4L4JA 5D2LE 5BS0A 4S2SB 1OGAE 5DJDA 4H26B 1WT5C 3MO1B 4GJTB 4ZNEE 5FUCC 4G3YL 2W92A 3MLUH 3IT8D 4AIXA 3BH8B 1OGTB 1A6UL 1HOCA 4XP4L 1KGCD 1O7VA 4HPYL 5CJXA 3MLXL 2QHRH 2O5ZL 2ZKHH 3RFZC 1MAKA 4KV5F 3MMEA 4HEPG 3BZDA 2YD5A 3WDIA 2W0PA 4NHUA 2A73B 5F7DB 2XA3A 2W91A 2XG5A 2I60H 4JO3H 2BVEA 4P4RA 1DFBL 4PREA 1FZOB 3UTSD 2EDFA 5ESQA 1FG2A 3OWEA 4JY6A 5SX5K 2AV1A 4GMSL 3TH2T 5IFHH 3IS0X 3QISA 5C0BD 5TFSL 1BEYH 4F7EA 5MEPA 2BCKA 4IRSA 1OF2A 5GZOD 2V17L 2EKSB 3HNSL 2VE6B 4FQHA 1QFWM 5A2IH 5EA0H 1JF5A 5EZIL 3S5LA 4K7FB 3GRWL 2F5BH 3QI9B 5HGDB 5SWSA 1FZMA 1M7IA 2LU3A 1CK0H 4O2FA 4OZGB 1RZFL 3MV01 3LEVL 1UM5H 3OGCB 3LS5H 4LU5H 4J3OC 4F9LA 2FRGP 1VGKA 3ZTJG 1F3RB 1UKQA 3P9LB 1ZANL 5DSCB 5HHME 3QNZA 1BWMA 3HZVB 5I1IH 1EAPB 1CT8B 1NMCB 4QY8B 3TYGH 4PGEA 3OKDA 5DEZA 3DHJA 2D4DA 2FJFA 4L1DA 4XHJC 4ONHB 2ED8A 5SWQB 4MA1C 1YDPA 2ZG1A 3S3PA 1H15B 4YX2H 3TGXA 4U1MB 3VFOA 1RQ5A 2DQFB 1DVFB 1WBYA 4LKCB 3KLHC 5I0DA 3CAFA 3QDHA 4CU8A 2XZQL 1YN7A 1OF2B 1MFBL 4G6KL 5GZNC 4XMKH 4C83A 3REWA 4X6EB 2ZOLA 3MLZL 3OAZK 1RU9L 5AAMA 5DURD 3RU8H 3TBTB 1OCWL 1QR1A 2IEPA 5IMKB 4Q9QL 1MPAL 1JWSB 4NO5A 1XF5B 1Y6KR 3HPLB 1G7IB 3BSZH 4G9DA 3U79A 1RUQH 5DVOA 4OCNC 4JFDB 4QHUB 3WJLA 5CINL 1CGUA 4HFWA 4HS6A 2XN9B 1T0NA 2Z35A 1MRCH 4GG6E 1YNLL 3MZGB 2ZSVA 1ZE3C 3HC4L 4MJIE 4NQDE 2IAMD 4XVTL 4V1DA 5BV7C 3QIUA 1WJ3A 2XQYG 4JFPA 4QRRE 4KV5E 2JCCB 1YY8A 2NY7L 3IAPA 4UV4L 3QBTB 2MSPA 4DVRL 3KYOB 5E5UB 4P9HH 5FO7A 4BUGA 1EAJA 2OK0H 4I18B 3E6HA 3O3DA 2N7AA 1K4CB 4PJHB 2CGRL 4AEHL 1ITBB 5DQJB 4PY8J 1JZ7A 2D3VA 1MUJB 4IOIA 3KPMB 1QA9A 1YEGH 2VDRL 5CKGA 3ZKMD 4JB9H 3GMPB 3B3IA 5I1LB 1XR8B 3F6IA 4MDJA 1CDCA 1FFOA 4AIZB 2HTKD 3RNQB 5E1HB 3X17A 4PD4K 3WN5A 1QG3A 3DIFA 5IB3A 1A1MB 5EBLB 3QCTH 4BQ6A 3NVQA 2DIAA 1JZ6A 4KROD 3KJ4B 2H1PH 5F9WC 5B38G 3PJSB 4UT6H 1CICA 3ARGD 3LY6A 4KTEL 4IRSD 1AJ7L 4PRAB 4KJWC 3VXSD 4PJGA 5E2WH 4GKSB 3GRWA 4LBEB 4ZD3L 2QTEA 1BQHB 2NX5B 3S34H 5FV1L 2PUQT 3D3VA 3QEQD 3VMNA 5KTEH 5D7JC 2CUMA 1K4CA 1UYWH 1YPZE 1ZSDA 3CSYB 2FH6A 5DD0L 3TYFA 3L5WB 4N90D 1DZBA 3QRFM 2H32B 1S8DB 4X6DB 1F4YH 5LAXA 1FL6B 3EFDL 4X9FA 5E6YA 4YNYA 2Y06L 4Y5XA 5KG9B 5JXEC 1CXFA 4JFYB 3JWOC 4DZBB 5FYLL 3RNQA 4PJ8C 1RD6A 3C08L 1CCZA 4EZMA 5IB3B 3BP4A 1KTRL 3DO3A 5JPMA 3T0ED 1BM3L 3O6FD 2LTQB 1INEL 4OLZL 4AM0B 1RV6X 1T21B 1ES0A 4ODSL 4M7ZC 4P3DA 1HSBA 5GS2D 5C6TL 5HDBF 2A6KA 1BZ9B 2FGZA 3WUZA 2NW2B 4PYHA 5GGTA 5IEKA 4R4FH 2A6IA 4XBPA 2APBA 3RTQB 3LIZH 5CD3B 1TCRB 2P8PA 3TA3B 1W8OA 3DV6B 5F6HI 5AYUH 2VLKD 5DJYA 3TFKD 4TVPL 1BZQK 4ZO7A 1UQSA 5JLZB 1GGUA 1VB9A 4MJ6B 1P53A 5EUOA 3QXUA 3WO3B 1T1ZB 1OAKH 4HWNA 2FWOB 3BEWB 1N8ZB 3U9UB 4XB7A 2ED9A 4QXTA 5LGHL 3ZKND 4PRIE 3KS0H 3LHPH 4KVCL 4YHKH 1DE4B 4U1IB 1I8MA 4LSDA 3FN0L 4KRMB 2JIXD 1U8MB 4UIMB 4MXVE 2Z9TA 3GSXB 4ZPTB 3HG1A 1CICC 2WINB 3TN0C 4FG6C 3QUYA 1VEPA 3ELAT 3I3EA 2NY0D 4J3TA 4K7PH 1B9ZA 1FDLH 1DQMH 1EUUA 3NTCH 2AQ1A 5GSRA 3LS4H 4WUKL 1WLHA 2OJEB 4PLJD 1DBKL 1KXVC 5FO8B 4R8WH 4QWWC 2A9NL 2ZJSH 5EZJB 1YEDB 2BVOB 3WXWL 3WDHA 3PV6B 3NCFB 1FPTH 5J8OA 3TO4C 1A9EB 3DWTA 2AK4E 1Z3GL 5ITFB 3LN5A 1U8LA 5J4MA 1YEHH 1EZVX 1N3NB 2X1WL 4ODTL 3SDCB 3BKJL 2LAAA 1JWMA 5JZ7D 5DK3A 5IESH 1H3GA 1XF1A 2LU7A 4LVNC 3FHQA 4N0CD 2AJXH 3S8WA 2VKWA 4X0KA 1I8LA 2GFBB 4S1DC 3FO2A 3EYQD 1OB1B 3R4DA 4JRWA 3QUXB 5TDPB 3VG9C 1JPTL 4DN4L 4Y16A 1OSPL 3HE6D 1NBZA 3UZVB 3ZT7A 3UC0L 3RVUD 1YYLH 5DGQA 1JHTA 5TDNB 3VI3E 3BP7A 5I30H 3MGOB 2P43B 3PWJB 4M7JH 3P2TA 3UEZA 2VXSL 2M2DA 4YHZH 4WHCA 1CF8L 2Z8SA 5MEND 1Y0LB 5T1LD 5T3ZD 4IRJC 3VCLA 2BY2A 3UTSA 2GJZA 5IOPA 2E9JA 3MRRA 4E5XB 3REVB 5E1AB 3IJSB 1RULL 3L9RB 5CWSB 4K9EH 1W72A 5T1DH 3HZMB 3T08A 4DGYH 1G6RB 1DLHB 3FOMA 5IFAH 3W0WA 3DGGA 2VXTH 3RX7A 2A0LD 3ROLB 4I0CC 1RURL 1JNNL 1RHHB 2R2EA 2VOTA 3CDYA 4KXZI 4ZQKB 3S3SA 2F54A 1IT9H 4JFDD 3TZVB 5F7YC 3EYUL 3PL6B 4XBEL 5HHQB 1MQKL 5DUML 1IBGL 1OY3B 2V7HB 5DRWB 1KNOA 5KSBF 4GRWH 2XG4A 1TVDA 4ZTOH 3EAKA 1MJ7H 3BISA 1W0YT 4YFLI 5K59F 3ARRA 3UPCA 4EUPB 2R8SL 1S7QA 4QRRB 2DYPB 1XCQB 2BRQA 2R4RH 4O51A 4JQIH 1OAQH 5F7EH 4H0IA 1CL7L 1J0KA 3TZVC 4Q0XL 4PJEA 4UT7L 1BAFL 3SE3A 1JGLH 5C0IB 4DKFH 4WFED 2DMBA 2F19H 5EOQL 3MLTB 4FFZL 4JZNA 2ZCLL 2DWDA 1RK1B 2LQRA 1MHEB 4XP6L 3BUTA 1SBSL 1KIPA 4TSCL 3QG7L 1EHAA 5JPNA 1IGFL 3WIHH 5IW1B 3MJ8B 4L4TB 1VFBB 2PF6A 5D1XB 4JRXB 1UG9A 4DFIA 3V4UH 4RIRB 2FYYB 3E6FB 43CAB 5E08L 4YGVB 4OCLC 4J1UB 1SJEA 2E7CA 4WI2A 3SKNA 4CVZB 3T2QA 4NUJB 3CLFL 4HCRA 2X1PA 3K74B 1KN4L 3FAXA 3NCJH 4JQVA 1DBBH 2NR6C 3QZWA 5I75C 4PP2B 4DFHA 4OFVA 2B4CL 2MQ3A 1T5WA 1KPUB 3ARQA 4JFEA 4I2XE 3L95B 5C7XL 4O9HL 5KSBA 3DOSA 3VH8G 4OI8A 1IE5A 1KBGL 2NY0C 2VXVL 3O3AB 4LNRB 4M6ML 2MPAH 4XTRC 2E9WA 2R1XA 3P30H 2H6PB 3GIZH 5CSZA 3LEYL 1P7KB 3FB5A 5JR1H 3MLVL 4IS6A 2CLVA 5JUEH 3IJYA 1JPGB 1U36A 2WSKA 5CIPB 3LCYA 3A67L 4L3CA 3M8OH 4M7KL 1R3HA 2FSEB 5HHXL 1XZ0A 2AJ3B 2CD0A 2CIKB 3DETC 1W0VA 4FP8L 4H0HB 5GGTH 4OM0H 3RKPA 4YDVB 3QQ9C 1UZ8B 3O4LA 4ZYKB 1KPRB 5L9DL 2BX5A 4FQLH 2EIEA 4PRHD 4KZEH 4M1DL 2OP4H 1A5FL 4MCZB 5DYOA 4PJEE 4LEOB 3ETBF 4EDWL 4S1DD 1DCLA 3STBA 4ELME 3V0WH 3MMEB 2HH0L 5K33A 4CN4A 1MELA 4XBGA 2YD6A 4KVNL 1B0WA 1J8HA 2ZG2A 1CWVA 3MOAL 2EH8L 4M62H 1QVOB 2DM7A 1HKLL 4V1DE 3CXDH 4XXDA 3WNPA 5F7FA 5A2JH 2R0ZL 3ARGA 4K55A 2ZUTA 3AXLB 3QDGB 1NCDH 1J18A 3RWJB 1P7KA 3FB5B 1GIGH 5AZEL 5SX4H 1P69B 2AXGB 3LV3A 5DHYA 1EO8L 2X4RA 3UZQA 1G9NL 4OBSA 5E56A 4DKEL 4NYLA 1YEJL 3S97C 3C2AH 3O6FA 2NY5L 1IGTB 2WQ8A 4OCXH 1BECA 1U2CA 2BSRB 4YDVA 2Y25A 3ULUD 2APXA 5SWQA 1VDGA 4WUUE 2APFA 2XWTB 3MXVH 4TPRH 4LIQH 3VFUB 5DVKA 1OAYH 1UENA 4X4ZA 5FKAA 1F45A 5JIHA 4NKOA 3FTGA 1Q1JL 3BDXA 3B9KD 5DSCA 4GQ9H 1ED3A 2EDDA 2OMBA 2C3VB 1FCGA 3FONA 2YMXH 3WJLC 5DVMA 3EGSA 3RBSA 1PGRB 4PJ5D 1U42A 1CDHA 5I8KL 3WFBL 4CU7A 1CDBA 2CK0H 1KJ2A 1REIA 1CU4L 4LIQE 4OM1L 2CR3A 3DX9A 3RWJA 1CXHA 3ORJA 2VMFA 1ZVHA 1N2RB 3P0VH 4LLDA 1AI1L 2OQJB 3T0DA 3ARZA 1JWUA 3NZHH 4L4VE 3B83A 4PJIF 4JVWA 4MWFB 3GMMB 3O6LL 4Q58C 4UV7L 2WP3O 4PJIE 4JO1H 1XGYL 2F53E 4TN9A 5I8CB 2QQNL 5C0DB 5BRZE 3OJDB 2A77L 1LO4H 4XCYB 4PJ7B 5E6ZA 2V5MA 4R2GB 1JGUL 2JCCA 1YY8B 5SX4I 5FDWB 3ZSTA 2OL3L 4G6JL 5FFLA 5J13C 3PG2A 5FO7B 1WZMA 4S1QH 4KK8C 3FCTA 3HCVA 5EC1B 1K5NA 2CUIA 4LDOB 3CX2A 4IIQB 3WNOA 3DRQB 4WRLA 4YDIL 5C09E 1NDMB 4PJHA 1U93B 4KH2A 3X13A 3R1GH 4I1NB 4ORGA 2H26A 4QRQA 1Y18A 3UJTL 2NLJA 3DVGB 4XVSH 4UNUA 5FV2A 4JFPB 2R29H 4RNRA 1NFDB 4HGMA 3X3FH 3KYOA 1RZJC 4YHPB 3DYPA 1J0HA 3G9AB 1R3IH 4XPHH 3IDJA 2ERJB 5D7IF 4XRCA 4GQPH 1CFBA 5D2NB 3V5HA 4ZFOL 1KIRA 1I7UB 4J7RA 3WUWG 2AEQL 2WK2A 4XCYA 4CDGC 1YN6B 3MPCA 2IQAB 2P8LA 5E9DD 4RMTA 5K9OB 2NX5A 1L7IL 4CU6A 5E94B 4HHAB 1KPVA 1ZHNA 2ZOKB 2FIKA 1ZLWK 2UVEA 4G80A 3BZEA 4I5BB 2CUHA 4NWTH 1E4WL 3ZYZA 3UTTE 2Q6WB 1TETL 1G7HB 3TIDA 1X5IA 1DN0B 2EDBA 3D18A 1EMTH 4OAWA 4LF3B 1A6AB 3KYKH 5JIKA 5JQ6L 2QEJA 4YHPA 4IJ3C 1FNLA 3L3IA 3MRBB 5F21B 3QDJB 3H2WA 3IFLH 4S11A 3CLEH 1NANH 4NFBA 1QACA 3B9KC 4JG1H 4UMGA 3D2UD 3HUJE 1KIRB 3OZ9H 2DMKA 4MAUH 4M7LT 2YN3A 4DCQB 1ND0B 1DLFH 4U1GC 4O58H 4UQ3B 5HHMD 3CPLB 2E9BA 2WQRA 5I8EB 3HI1A 5J6GA 2IC2A 4OFDA 1OTUC 5C09A 5KG9A 3VXQA 3ZYJA 1WAAF 3T8XA 1WWBX 4OUUB 1ADQH 3LRHA 2ATPB 4MNQA 1EHXA 1SYSA 1MRDH 3GJFB 4PRHE 1I3UA 5LQBH 4JKWA 5IB4B 5D2NE 5IHUH 3SPVA 3KPPA 4RX4D 4K3JL 2J12B 4WI5A 3IGAA 1CR9L 3RWDB 2JCCF 3BKYL 4NZRH 1U2HA 4OLYH 4RISH 2FX9L 1XFPA 4NN7B 1IKFH 1JZ5A 5ANMB 5I19L 3PGCA 4DTGH 1JNLL 5D2LB 3SGEH 2APVA 1ZHLA 4MD4B 1IC4L 1H5BC 2D7TH 1EO5A 5D4QA 3V6FA 2EDKA 2HFTA 4DGIH 1KN2L 4J12A 4JM2F 4GAYA 2J4WL 4NQXB 4JY4A 3SDAA 1KJVA 1I4FA 1E4KA 2WIIB 4G8IB 1KEGH 1MJ8L 4UDTB 1N0LA 3BKML 4YDLC 4XCFH 2CMRH 2JB5H 2HFGH 5TDOB 5I9QC 4GLRI 1RIHH 5BS0D 4QHMB 1XMWA 2OL3A 1MNUH 4GG8A 3TBVB 4NHUB 1R0AH 5D9SA 4K2UH 1AGCB 2LVCA 3CSPA 1UCBH 4LCWD 4Q2ZB 1JWMB 3QDGD 1CFNB 1NBVL 1E4XI 1EV2E 4WTWA 1UWEH 1N26A 5IKCB 5ADOH 5IVNA 1R3KB 1TZHA 3QIUD 5C0BE 3EDJA 2YD9A 5KSUA 5IWLA 1P1ZB 2NXYB 3X12A 2ADJA 5HGBA 1ZK9A 3QI9A 4G9FB 5E8NB 5SWSB 3CJJA 4ZO8A 3SKJH 5HGHB 5BJTA 2ZNWA 1J1PH 4TSBH 1HXYB 4ODUB 1KG0A 4CVWA 4Y4KD 3NN8B 4HPYH 4XPFH 3UPAA 3QHFL 2O5ZH 1KJVB 2DTMH 4RMVA 5JDJA 5FA3A 3CFCL 4NC1E 1QHOA 4RZCB 3NFSH 3GM0A 2NNAB 2WBJA 5CGYC 1DANU 3B6SB 5H94B 3I85A 4N9OB 3OKEA 1AHWB 1FNGB 1RUKH 1PG7X 4GAGH 4P59H 4FQIH 1CT8A 3AREC 5CZXC 4JPWH 1S9YA 4PJ8A 3BDYH 4JFZL 1J12A 4ZXBD 3BVNB 4YHYC 5E7FA 1IGML 2AJSL 4MZ3A 2PW2A 1OTUD 3GIVB 3ROLA 1NAMH 1BEYL 1LO0H 4ZFFB 2F54B 4H20H 3TZVA 1JYWA 2V17H 3LKNA 5KSUB 3AAZB 5EA0L 4I2XA 4N0FA 4OIBA 5EZIH 3MV9E 4N0RA 5I16B 3PHQB 5E9DB 1RZJL 4L8DB 4D3CH 1PEZA 3V4PL 5B4MD 2J88L 1HXYA 1ZLSH 1RZFH 2HVJB 4H1LA 4W4OA 1QLFA 1H3TA 2L4OA 4WFGE 2EDRA 2OTWA 4RA3A 4ELKB 5EBMB 3TV3H 25C8H 2EE2A 3DURA 3Q0HA 4U6YA 1WITA 1GZPA 1IGCH 4QHKI 3SJVB 2OZ4L 4XPAH 4GS7B 1M7XA 2XZZA 4OKDA 1BD2D 4Y19E 2X4NB 1KGCE 1RK1A 2VSDA 1Y6MR 1EFXB 1SJHB 3GIVA 3NA9H 2DRUA 4JFFE 1KELL 1U91A 3R06B 3SDXE 4F2MA 4O02H 3VD7A 3NIGF 4L8DA 4OFYD 2KKQA 1LEIB 4XVUC 5T5FL 5MEQB 5E8EB 4RRPA 2JJVA 4I0KA 2ZPKH 2KQNA 1JGEA 1CFSB 2VZVA 5HYJD 1PJ9A 1UT9A 4P5MB 5C8JA 4DN3H 2BERA 1L9NA 3BX7C 4AEEA 4B5EA 4FABH 2EDXA 4RIRA 2EYSA 5E6IC 4JFEB 4JPKH 5A40E 1ZLUK 1BJ1J 4B0MM 4PBWD 1P9MA 4Z7UA 4GRMA 3ULVL 3GGWB 5C2BL 4L8BA 4HUUA 4LARL 1H9VA 2DQFA 1GXEA 3R8QA 1RFDL 1KLUB 2J3SA 2UZIH 3BEVA 1Q72H 5CGYD 5HGAA 3JUYA 1R3HB 3CSYA 1EEZA 1IKNA 3SQBA 5BVPH 4JB9L 4Q9RH 5DK0B 3OG6B 2H9GA 4XNUL 3O4LB 1FZMB 1M7IB 5TQ2H 5IMLA 4XHJD 5E8EA 3CVIH 3HHRB 5ISZD 3MRIA 4BFIA 1RUAL 2IADA 3UP1A 4PJIA 1AO7B 5DUBB 3TH3T 4YFEA 2V9RA 3QNZB 1CGTA 5EZLB 4MNGB 4Y4HA 2X1QA 2M1KA 4PR5B 3RWCB 4KZDH 1WWWX 2HN7A 2DQDH 1RJLB 3JWOH 4P3DB 1RZKC 1FNSL 3DLQR 5E2WL 1LK3L 1FL3B 3VG9B 5IJKC 4YBQD 5I1DB 3SDXA 3VFTB 5JXED 3CMGA 2RIKA 1IEAA 4R0LB 1VCAA 1UYWL 2YD4A 4QLRA 4OBRA 5L2KE 1HNGA 3LN9A 1GOGA 4Z0BL 2V5SA 1P5UA 4HIEA 3VE0A 4RDQG 3F65A 1F4YL 5HPMB 1UB5B 3QJHB 4ZFGH 4XC1H 2IH1B 3P73B 1RUPH 4GFTB 5FECB 1CVRA 5KS9A 4H5SA 3SKUD 2YPVL 5BMFL 3VWJB 1BM3H 4OQ1A 1X5ZA 1T0NB 4WW2F 5B39A 3EYOA 1H8SA 2LTQC 2BSRA 1IAIH 4PPTA 5ESAA 3VA6A 1U92B 1CICB 3ZSSA 1CS6A 4J3WA 3UZEA 4ZNCD 1LP9A 4R4FL 2A38A 5GSRB 3D0VA 2R0LH 5EBWB 4PRPD 4MB3A 1U8JB 1G9EA 2GSGB 2G5BB 4CVUA 1H8OA 2VL5A 3P4MA 4MNHA 5GGVY 1TVBB 3PQYE 3C5SB 4IJ3B 1TZIA 4P2OB 1AD0A 4GMTL 5JOEA 4PJ5A 2CDFB 1YEFH 3GMPA 5SV3A 3V6OA 1E28A 1BFSA 4ZFZB 1C1EH 3MUGB 3VFGH 1ZT7A 5MP6L 4UTBL 4HPOL 4XMLL 2GFBA 1BHGA 4PGCA 3OAYH 3FO1B 4ORGB 5CGMA 3GSQB 4ENED 3DXAD 1XF3B 5DD1H 2RBLA 4JFHE 2Z31B 4WENB 4JQXC 5DDHB 3NZ8B 5FK9B 1MAMH 3E0GA 4DJMA 4XP1L 3SEPA 3UAJC 4DVBB 4X4XA 4P5TA 4V2CB 1K2DA 3OL2A 1OT1A 2AJVL 2EDNA 4LVOC 4U1GB 1KACB 3W81A 4F3FA 1NJ9B 5D2NA 5D70L 5IVOA 5FYJE 1KC5L 3PWVB 2ITDB 1TZIB 4P2OA 5JO5A 1RAMA 2W1NA 2YSSB 1S8DA 3W9EA 2A6JA 3OKNA 1YEHL 3MRJB 2QADC 1I1FB 3D3VE 3CDCA 5KS9E 2IAMB 1UM4L 5IESL 2VLRE 2VNCA 3DUSA 4MD5A 3VXMD 1PYWB 2AJXL 4HGWB 4YWGL 2X70B 1KFAL 1HZHL 5GZOC 2DLTA 3RGVD 4OLWH 5FYJU 2AGJH 2NY5C 1A3RL 3RA7L 3THMH 3RY4A 5IF0A 3UYPA 3P4OB 5D7LA 3NZ8A 4X5WA 5C0FB 5FOJA 3T3PE 1L9MA 3LSOA 4H0GA 4U0RC 4P3WA 4GMSH 3MOBL 1VFUA 2AKRA 5GPRA 4P2RA 1I1RA 1LE9A 5C0EB 1BOYA 4I5BA 4JPIA 3ULVC 5FYKE 2Q6WA 1IFHL 1LEGA 4YXHH 1IC7L 2QADB 5JDSA 2ERJC 3BIKA 4ZUWA 3IXAA 3MV8B 1Q9KA 1SEQH 1ZXQA 1PYWA 4HGWA 4ZODA 2HAZA 2EZ0D 5IW1A 4YZFF 1MHCB 4TNVF 2IPTH 4P2QA 5I1IL 4R3SB 3IDNA 2N4IA 5LKNA 1U8PA 5D6CA 2EC9T 4OTXH 4WO4B 3DSNA 4KK9D 3T8XB 3KHQA 3L3GA 4P9MH 2I24N 2DLFL 1DBAL 2EDYA 2HJFA 4Q0XH 4Y8AA 4UT7H 1NFIA 1AGEB 4YHOH 4F7MA 4JN2A 2IPKB 3LRSA 1KJ3L 2R1WB 2VDNH 1L4IA 4MQTB 5DWUH 2XOTA 4LHQB 1BLNA 4MLSA 4APQA 5E4EC 2G60L 3U83A 1WFNA 1T0MA 4BH8A 3CH1B 3U46A 4PREB 1XR9B 5B22A 1M05B 1RMFL 2C3GA 3OKKA 5GRVL 1NUNB 2R2EB 4ZQKA 1GJIA 4MQSB 4WI4A 3IJYB 1YNLH 4KI5D 1NBZB 3PWLB 3ULUE 1T20A 4NZUH 1QYGL 5D72L 5J1AB 3CIQA 2GTZA 3UROR 1CFNA 4DVRH 4EI5D 3BI9X 3GMOB 3KPOA 4MCZA 1ZLWH 3TO4A 3O6KH 1HEZB 1V3LA 2WIIA 4NGHL 5HYJE 1U6AH 5D1QD 4F37K 4OF5A 4AEHH 1FVDB 1KF9B 3RX5A 1GGIH 4JHBA 3OR7A 3MRNB 5GRUL 1PEWA 3PABA 4OIIL 1NCAL 1W72B 5IVZB 3V5DA 2MPAL 5T3ZE 1EJOL 1G6RA 2NY0B 2RR3A 3RY5A 3VGAC 5I1GH 1HWGB 3DMMC 3OV6A 4OCRH 4PJAA 5IHZA 5EIQA 3L5XH 3IFNL 2DI9A 3KXFD 1RIUL 3SDDC 4R0LC 2DJ4A 4H8WC 2XNAA 3ZHLA 1YMHA 2X7LB 2Z93A 5FYJD 3S9DB 3U0PB 1P1ZA 1MI5B 4J23A 1XH3A 2BJMH 5HHXH 1OPGL 3QXVA 5HI4C 5FUZH 2J1KA 4LASL 5ETUA 3BESR 5L2KD 3Q48A 4Z7VB 3O2VH 1P7QD 4J4PA 2FLRT 5B3JF 2VDOH 4LCIL 4M1DH 1CVSC 3ZE2F 1A5FH 1J0YA 3MJ7A 4E41B 2FHCA 5B39G 5DJXB 5FUCE 3GJEA 1WISA 3V0WL 1QLRA 5TE4L 4P4KD 4NKOB 4D9QE 1WZ1H 4DAGL 2NNAA 4JFDA 4PJEB 2EH8H 1HKLH 2XN9A 3K81A 4XNZB 1GGTA 1SYVA 4OLVL 4MMXC 2PO6D 5BZWB 1AH1A 2DQHL 5D7SH 2EC9U 4MQXC 1NCDL 3JWDC 3CH8A 4JY5H 4V2BA 5ALCH 1V8HA 1FRGL 3V8CA 2P45B 1DTUA 3EDDA 2HJLB 1MFCL 3DURB 2HT3D 1R5WB 4PJCA 2VDPH 2DDQL 3J8F7 3LQAH 3MCLH 1F6AB 1BWWA 5HDOA 4UTAL 1D5ZB 3I6GB 4UDUB 3WKMH 1JFQL 1N64H 3MXVL 3FQWB 5I1LA 2I07B 2D2OA 1OAYL 1RPQA 1ZVSA 5HDQH 1WVZA 1QRND 1Z0NA 5DA4A 4YJZL 5HYEA 3QXDB 1DL7L 5HYIA 3LMJH 4KI1A 4FG6D 4W6XB 4KAQH 1OAXL 1R24B 3O45A 5DZLA 3O41A 3GBLA 3KR3H 2FHBA 3LKPA 5C0AA 1XF4B 1FV1A 1PKQB 3O6LH 1BQHA 1NCBH 4IMLB 2ZCHH 1R5WA 3S35L 1QBLL 4G8GE 2YA2A 1QFWL 1JPGA 5CIPA 3QDME 4QCIB 2XFXB 3TO4D 5B8CC 2OSLB 3GSRB 3ARED 4UDUA 1T80A 5KVEH 4GRMB 1YN6A 5LAXB 4PJXB 3RWFB 3OXRB 4QO1A 5C0JB 2OL3H 4XNMB 4S1QL 4JM2B 1CQKA 3T09A 3PGFL 4Y5XB 4D8PA 3EYVA 1T7YA 1DSFL 1ZVSB 3VXRA 3QIBC 2HLAA 5I1AB 3IU4H 4RDQF 4HX1B 5H8DA 3PL6C 4JKLA 2WAHA 4XVSL 3ZDXF 3FRUA 3NCYS 1WCBA 3C6LC 2IMNA 2EDWA 3SDCC 1LP9E 3O41B 2HFEB 4D0DB 4FZ8L 2ZUWA 2DD8H 4PJCE 3LKPB 1C08B 3SOBH 3L3IB 1V5JA 5CMAB 3C5ZA 4ZSOE 1BIHA 3F7VA 3AREA 1EA9C 1HYRC 5EU4A 1TZGL 1XT5A 3MRDB 4QOKA 2XFXA 1W0WA 5DD6B 1NC2D 4YHYB 2AEQH 1X5XA 2H9GB 1QSFB 3HR5A 1UB6A 3NAAL 4HS3A 3PP3K 4M9OA 4AT6B 4OKVA 5IG7B 1I9JL 4YBLB 4QEGA 3U1SL 4HWUA 4HJJL 3VH8A 4QGTA 5KSAC 3QXWA 2CO7B 3O3EA 4UBDC 3VXUE 5J0BA 2Z8WC 4J3VA 2C3VA 1DE4A 4ODBD 4PG2C 3IDGA 1UADC 4OGYH 5ACZB 2DQIH 1J05A 2LABA 3VXOB 5LXGH 4HC1H 3RWIA 1JI1A 5CUSH 1EMTL 2VLJD 3G5ZB 1I7TA 4MAYB 3MV8E 5ITBL 4LVNB 2VXTL 4G8GA 3VGAB 3WCYA 15C8L 4LMQI 4C56A 1TVHB 1ZT1B 5TPWH 1IT9L 3GM8A 3WHXB 3RI5F 3QH3B 5T1LB 4QXGL 4X83A 1V05A 4ERSH 3OZ9L 2BVOA 1VEOA 2YEZA 3B2UC 1NGXA 3NMEA 1AGDB 2Y5TB 5FO9B 5T1KD 3T77A 3JV5A 4ZTOL 4K3EL 3I3BA 3H7BB 4S0SD 4M00A 5IVXA 3N1MC 5IQ9A 3TO2A 1JMXA 2QLVB 2PW1B 2R4RL 1X6LA 2XIDA 4HWZA 1OAQL 2H3NA 3VGHA 1CL7H 2UZYB 1D6VH 2CDEA 1Q94A 2CRMA 2JTDA 3TPKA 2XKUA 4EXKA 4UDTA 2MNUA 3FO2B 4WI3A 1CLYH 3BZEB 1JGLL 1U9KA 1XIWD 1XGQA 4U1JB 2YPLB 2BVYA 2NZIA 3G5XA 2VLRB 4FQJL 4QHMA 1HILA 4K3JH 3TIDB 4X80L 2OXGA 1AGCA 1DVFD 4APQD 4MAYA 3WFEL 3QEQE 3EDEA 1SBSH 4OCWH 5DJ6A 1F8TL 4JO2L 4F9PC 1LWRA 4F8QA 2KUTA 4LCUA 4LCCB 2Y72A 3STLA 4JLRB 3TT1L 2PXYB 5I19H 4HLZG 1K8DA 4EQ2A 3P4MB 1XAUA 5D7IE 3ZYIA 5EORL 1F90H 1X7QA 1MCQA 3MRRB 4E5XA 1BFTA 4J2XA 5MI0C 1GGBL 6FABH 4ZPVA 4OLEA 3EYFB 4K71C 4PJDB 3EDKA 1MI5D 3HZYB 3DGCR 4XNXH 2NXZC 2H3NB 1FLRL 3QIWD 1T2JA 4G80B 1RIHL 3VWKD 5SWZB 3GHBH 4Z8FH 1JBJA 1OW0C 1HILB 4ZS6C 3WHE1 5DRWA 1DBJL 5DI8A 4NBXB 3SPVB 5DMIH 4JANA 1NBVH 3RDTA 1A6TB 4TQEL 3U4EB 1N6QH 3MRMA 3MLVH 3BRFA 2KPNA 3FZUC 3STLB 4M5YH 3EJYD 2B0SL 4FQQB 1U3HD 3QIWB 1KIQB 4PJ9D 3PP4L 4OZFH 1IAII 2PYEE 4QF1B 1A2YA 4FTVE 1OP5K 4I3GA 2YSSA 3W9EB 5F6HJ 1KB5A 1OT2A 4TULH 4QRPB 3LSOB 5L9DH 3L3JA 2DTSA 1QEWA 1I3RA 3W2DH 2OP4L 3HE7D 1F4WL 2RAMA 1NEZA 2XV6B 2ILLA 1D5MB 1W72H 4M5ZL 3WD5H 4EDWH 3MNWB 5C0EA 4P23A 1J10A 1YPZB 3F58L 2X70A 4FQCL 1OL0A 5I17A 1ZS8A 2FO1A 2ZP0T 4KRNA 1RUKL 4P59L 3B2UD 4JHZA 2FYYA 3E6FA 4FNLH 3C5ZD 4JPWL 3P4OA 2FZ3A 3BDYL 4GUPB 4O2CB 5E8PB 1NGZB 1R5IB 1IGMH 4PY8I 4QRUA 3RDTB 2VXUH 1G6VK 4O00A 3L1OH 2FB4L 4YPGA 4H20L 3FRPA 3WIFB 5IB1B 4K8RC 4Q97A 4UBDD 1ACYH 4IRZH 2VWEC 2GY5A 4R3SA 1NMAL 1YNKL 5ALBH 2OBGA 3IAQA 4LP5A 4OD2A 1ZLSL 2E7HA 1OARL 3VXSB 3M07A 2AQ2A 2FH8A 4XAWL 1YYML 4LNRA 3WV0A 3DXAA 4U3HA 1NEZB 4KKAC 2GJ6A 1JYXA 2MHAA 2X2YA 1MIMH 3K2MC 4GQ9L 1S5IL 3E2HB 3SO3C 1FIEA 4DUXA 3PWPA 4UAOB 2CKBL 1CD0A 4BZ1L 4JGMA 3MA9L 4NQEE 4Y16C 3ARPA 2YR3A 4RFNB 5I8KH 1JL8A 1PSKL 5EU3A 1T66C 3S5LG 1Q9LB 2EO9A 2H45A 3MLYH 3VXNA 2RB8A 2R56L 2YC1B 3GGWA 1I1CA 1AI1H 5EOCJ 1P4LA 3QI9C 3HG1E 3HFML 4YPGB 1S9WB 4KGJA 4NHCL 4JFDE 1ZOXA 4PRPA 4UV7H 2ARWA 3BYTA 4JO1L 4LSSH 5DJZA 1EEUA 2XN9E 4ZOEA 1KLUA 3BEVB 4Y19D 3ZL4H 2PNDA 4Z18A 5CEXB 4FXKB 1EFXD 4X8JA 5E24E 1KSRA 5CZXD 5IMMB 2NY1C 5BVJA 3SHSA 2P24B 1TJHL 1GZQB 4ZUVA 5HYFA 5LGKA 4WFEE 4L9DA 3CDGB 4FABL 1UM6L 1HHGA 5JW4M 4PRNB 2VDKL 1KCKA 3L5HA 3QDMD 5E0QA 5M7QA 2VTFA 2X89D 4PB9L 1NUDA 3T1FB 2JK5B 2BRRH 2NYYD 3C9NA 2N7BA 5FYJH 5FYKH 5MERB 4QXUL 4OLXH 4WNQB 1E6JH 3VFUA 4OFYA 1MIEH 3G5VA 5CAYB 4R0LA 5AZ2H 1NSNH 3SJVD 1FVDA 3VWKC 2VE6A 1T6WA 1MI5A 5GISH 1B0RA 3RIAF 3AVEA 1I3VA 4PTUA 3DXAE 4WEBH 2GJ6E 3RX8A 4Z76B 2HVJA 2FX7H 3MJ7B 2AEPL 4Y2DC 4S1RL 4X9BA 2WUBL 3PWPE 1GZQA 3QUXD 1TQBB 3W0WE 1SY6L 4DKAA 5JNYB 1FN4B 3QHTC 4OV5A 3FT3A 2PTUA 1F58H 2HWZH 1NCWH 4PJ9C 4NWTL 3VFRB 3BQUB 1E4WH 4IOSD 2DKMA 4AL8H 3WLBA 4KZDL 5FA4A 3U48A 5JW5B 2DQDL 5B39B 4HKZB 5L0QB 4LSRL 3BHBB 1UZ6F 3I6KB 1FIGH 1YEIH 2Z91A 1U92A 1WFUA 1U3HB 4PRPE 1NKRA 2DQTH 3FO0L 3MXWH 1NC2B 5T3XE 1KULA 5DJXA 4HUUB 4EUPG 2FJHA 1K5NB 5T33H 3U2SA 1RSFA 4KK6D 1SYVB 3HE6B 1BMGA 5BZWA 5HD8D 3OAZH 3MV7E 4KPHL 3P77B 4G7YL 4ZSOA 2C1PB 1RUPL 2NTSP 4FS0A 4IDJL 2EO1A 3EOBA 1CFSA 2XQBL 4UIKH 4B50A 4LHUG 4FXGB 1ADQL 4PLKC 5C8JB 1HWHB 1YECL 5DT1L 1KYOJ 3KDMB 1YEEL 1LO2H 3VU2A 1MRDL 3WHE0 3DMMA 4MSWA 3IRZA 4ODWB 4HKZA 4PR5A 1F6AA 4NJ9H 5GXBB 3QXAA 4HIHB 4CMMA 4EN3D 2I27N 3HR6A 4RBPK 3O2WH 3A6BH 5K9KA 1IMHC 5IM7B 3HRPA 4NZRL 1OLLA 3WIIH 1E4XH 4P5TB 3VXUA 3WS3B 1T1YB 3EYQC 1HQ4A 5C0ND 2C3WA 1UH3A 1QPPA 2ZUVA 1UCTA 3FKUS 5DD3L 3UTQA 5FUOL 2WWKT 2WBWB 4E0RA 4HEME 1RIVH 4F9LC 3TBYA 1C1EL 4LCWA 3RZCC 3HNVL 3BXNB 1VACA 1PVHA 3DX6A 4BFIB 2NYYC 1ZT4A 1EO7A 1Z9MA 4UTBH 5JOPE 3DRTA 1KEGL 1VGKB 1A7PL 4YHMH 1QFUH 3BKMH 2X40A 1MH5A 2FD6L 1MCDA 1OGAA 3MNVA 4MNGA 1JPFB 4LOUC 4M7LL 4MXWH 3Q6FB 1HN1A 3OHXA 5DD1L 5IB5B 4YAQA 3INUH 4HIHA 4KDVA 2KBGA 1IC1A 4PJXF 1IEHA 3Q3GA 4WV1B 1U8QA 2CPCA 1Q38A 4GKSA 1RZ8B 4XZUA 5F3HA 3VG0L 3ZKXC 3ZE2E 3C5ZB 4MXVF 2PN5A 3MREB 4WTZA 1JF1A 1MFDH 5D70H 1G9NC 1U8JA 1LQSR 4PJBA 2Y36L 4TRPH 3G9VA 5ANME 3H0TB 3SKJL 5DJDB 1QBML 1NCCH 3D3VD 3QEQA 5FCUL 2B5IC 1LEGB 3HMXL 4TSBL 2ADFL 3OKOA 1MREH 1S7WA 4H8WH 3I9GL 5KW9H 2R2CA 1WFOA 4KDTA 4LSQL 2DTML 4NQCE 5CEZH 1T03L 1G84A 2IH3B 3RPIB 4LMQE 1KB5H 3AREB 3F5WB 2ADGA 5GSVA 1UEMA 2CRYA 2AGJL 1F2QA 4GAGL 4YAQB 1UVQA 2PYED 4RAVA 4D9QD 1A7QL 3AS1A 1WBZB 5EUKB 1U8PB 4U6XB 2A6KB 3D39E 3QUXC 2X4PA 5DJ8B 2D31B 2KQMA 3P9MA 3IU3B 4N1HB 5GJSL 3VXTA 1BZ7B 4NQSA 3CDFA 1QFHA 3L3HB 3O3EB 2G5BA 4XPBH 2VL5B 1QFPA 3P4NB 1IFHH 2Y6SD 5HDLA 4Q6YA 1UXSB 5F72S 2ICWJ 1J05B 3V4PH 1MY5A 1HI6B 2Y5TA 3MYJB 4HGKC 4GG8B 1FVEA 5EUOB 2DQJH 1FGNL 4DGVH 3OX8B 1NL0L 1N8ZA 3FFDB 3IF1B 4MDJB 4Z95H 3MLSL 1EERB 4MZ2A 4L4VA 5H35B 4OZHF 2K7PA 2NY2C 1PY9A 5EN2B 3N1QC 4LHJB 4J6RL 2Q8BH 1FORL 4NNPL 2ADJB 2YXFA 3BP6B 1KCLA 4NP4L 4KMQA 3TN0B 5EO9B 2PKDA 3QNYA 4P0DA 1KG0B 1P9MC 5HYSA 4M6OH 4LPWA 4DK6A 1U41A 4P2RB 4OJFL 4PJ8D 5CEYB 3K1KC 3H9SB 4EDXA 4MAYD 1OW0A 4KI5E 1ZV5A 1B0GB 3X11A 2UY6A 3EOAA 5DWUL 1X7QB 2ITDA 4JQVC 3S37H 4X6EA 1PX3A 2JLLA 4S1SH 2DMCA 4D0BA 1MCFA 5D5MB 4Z7OF 5JA9A 5CP7A 1UA6H 4PJDF 4KKCD 1D9KD 1I1AD 4GH7B 4JJ5B 3P4LA 4JLRA 1XF5A 3WYRA 1B88A 2VR4A 2Z8RA 3EHBC 5E2VL 2NY4B 4HS6B 4W4NA 3HI5L 3D39A 5C0CD 3V0AC 2VLKE 4QGYA 5D72H 3T04D 5I66A 3MRPB 3PQYB 3QNYB 5D8JH 2XWBB 3S35X 1S5HB 4NRYA 2VLLB 4WO4A 1I9RL 3NABH 4NM8L 5L2JA 5JW3L 2NW2A 3O6KL 4NGHH 3HS0B 2ARJA 4G5ZL 3BPNC 1AIFA 3RTQA 5BRZB 4HIIB 4S0TD 1Q72L 1MCIA 3BZ4B 3O3DB 2EZ0C 4LPXA 3HA0A 1A47A 2HJFB 5DFVD 4QF1A 5J1TC 3S98A 3SGKA 3GSUA 4YPJA 1QQDA 3FQRA 2QQLH 4UT9H 4OIAA 3PDDA 5JORB 3HZMA 1C12B 3QUYD 5I0ZA 4Z7QF 2OI9C 3GHEH 2Y7QB 2R69L 3SY0A 3W0WB 2FHFA 3DUUA 5TH2A 1MCPH 5KOVC 3O0RH 3KWWA 4K3GA 1RIUH 4L3EE 1YPZA 3F12B 5D7JB 5KS9F 2H8PA 3QB7C 5EPMB 4X7EC 1MHCA 5AWNH 1A1MA 3N0PB 2KZ1B 4NOBA 1A14L 1KCRL 3HUJA 4OCMC 1XIWC 2C5DC 1D5XB 4PGBA 2YK1H 2JJTC 3O2VL 8FABB 5JOFB 2MKLC 4QOKD 4JKPH 5I1KH 1RZGB 4XP9L 4MJ4A 3RGVB 3LB6D 1JHLL 5C08D 1S7QB 3K8LA 3JTTA 3Q6GH 4LBEA 1CGVA 4NC2B 2Q1EA 5JOPD 1WZ1L 3D3VB 4JCLA 1EGJL 3NIFE 4Z0BH 1C5DA 1AXSB 3O8XA 4C56D 3RWHB 2NX5D 4GG6F 5HPOA 3SKOA 3SDDA 2DQHH 5D7SL 1AXTL 1LEKA 5DMKA 4MHHG 3V0VA 1G7LA 4WJ5A 2WBKA 2ZUQC 5H2BB 4NQCB 3OJ2C 1IGYB 1MFCH 2Z31D 4NCDA 5J57B 5J3HD 4A6YB 3NGBC 4AIOA 2UYLA 4NO2B 3X14A 5IBLC 3DVNA 4QWWD 3ULUH 5BW7A 2J5LB 2P7TA 1CN4A 5DJCB 2CR6A 5I73C 3LQAL 3IFOA 4WTZG 4HF5L 2E5EA 1OP3K 3GNML 4K3HA 3VXNB 2G2RB 1J0JA 1DQDL 3T2NH 1HOCB 3ZDZE 3MV8D 4OZGA 5DXWA 4JFOA 3JTTB 3DMMD 4RAUB 5GGUB 3CVHA 4ESKA 5GHWL 2IADB 4K8RH 5E99L 4NQCD 2BSSB 3WO4C 5IEKB 1AO7A 3JV4A 1E4KC 2OR9L 5DUBA 3PWPB 3FO9B 2BY1A 4PJ9A 2VKXA 5M95B 2OCFD 4GMTH 3L9RA 3P11L 2V5RA 1YEFL 4MA8L 2R9HC 2HN7B 3CZJA 4JZOA 5JLZA 1BVKB 2Y07H 3VFGL 3IJHB 3AFLA 1IGIH 4HKXB 4ONHA 5MP6H 4D0DA 3PXHA 3HE7A 1J0ZA 3NA4A 5EO1B 3U6RB 4H88L 2VDML 2VN7A 3RVTC 3VFVA 1LE5A 2HLFC 4LEXL 3I6LE 2Q8AH 1QBBA 4U3CA 1P84J 5D2LF 1YN7B 4FQHB 3MRDA 1IAIM 2F8VA 1NLDH 4Z7WB 5I15L 1D5ZA 3I6GA 2GIYA 3KPSD 3QJHA 4LPYA 1TPXB 4HXBL 3MLUL 4NOFA 1MCLA 5DGRA 4PY7B 1DSFH 3K0WA 4F15B 2AJVH 4MXQC 3GJEB 3VRJB 4XWOD 5T1KB 1AR2A 3EFFA 3KLSA 4TUKL 4NNYB 4KKNA 1EAPA 1PW3A 1GHFL 4N5ED 4U1LB 3G5ZA 5AG9A 4TSAH 2CKBB 4MD0A 5EO1A 4RWYH 4HIXL 2VZSA 1TCMA 3BPLB 2F5AL 3C09B 1GOFA 3GUTA 5IFHL 1Y6NR 4BZ2H 5D1QB 1P7QA 4J4PD 4WEMB 3QQNA 3ZHKA 3HNSH 3ULVF 1A3RH 3RA7H 1AR1D 3D0LA 4LLQA 3V7MA 1SJEB 1C7SA 1QA9B 2UY7A 4Y16D 5FO9A 3U7WL 2NTFA 3T77B 1IZKA 1AO7E 4ZFZA 5SV4A 3U1SH 3ULSA 1NC2A 1MJUL 3UBXI 2DQGL 4JZJC 3LEXB 3VXMB 5F9JB 2F54E 3QI9D 4P46C 5LGJB 4PJFF 1CBVL 1A6VH 1IL1A 3V52L 3PHSA 2MFNA 2BNQA 2EE9A 5LXGL 4YXHL 5JIIA 5ILTH 5INCB 4HT1H 5INDB 3ARDD 3ESVF 4OFPA 2WP3T 2YUZA 1OVZA 1SEQL 2VN4A 3DX9B 2Y1VA 1QO3A 1XF4A 4YX2L 3TPUA 2IPTL 4E42B 2XZQH 4QOKB 5L88H 1AGBA 2J2ZA 4JFFA 5HVHC 1E6OL 1NBQA 3NIGE 3MR9B 5C0RH 5D7IB 4GBXB 2B2XH 2EIDA 2OSLA 2AJYH 3GSRA 3OR6B 4ACPA 1QNZH 3MGAA 5FGBA 1I1FA 3HB3C 4FZEH 5FDWA 2IGFL 3X3GL 2FNBA 3EYVB 3N85H 4UINH 1UJ3C 1CLYL 2C7UA 4JDTL 1LO5B 2IG2L 4KI5C 4NRZB 1AY1H 4X80H 1HYSC 1UJ3A 1MRCL 5JHLL 3VXUD 2ENYA 2EH7H 1CZ8L 4LRIA 3MLTA 1XCTB 4M8VA 4Y2DD 4ZUTA 2GK2A 4XGZA 3GSVA 4DQOH 4G8GB 5J9PB 1MHEA 2J8UF 4B7IA 3TPUB 2VIRB 3WE6B 3GSOA 4FQQA 4I0PC 1FP5A 3AS3A 3ILPA 4JFEE 4PUBL 5B38B 1EPFA 3TA3A 3MR9A 5TE6L 2DI7A 5D96B 4RFOH 2IJ0C 1LDPH 3VFNB 3BGMA 4NZUL 1NGXB 43CAA 3E3QE 5GIRB 1EHNA 1RZKL 1I1YB 5D93C 3J7HA 3DX6B 1T1ZA 2YN5A 5EDXA 1RZ8A 3PGDB 3D48R 1WIPA 4FXLA 4Y4FA 4HHAA 2MOVA 3FTGB 1JJUA 2H2PD 3HKFA 5JTWA 1I75A 4YHNA 1LGVA 5HI5C 2IF7A 3IDGB 4RGMC 1GGIL 1RUMH 5GRUH 4PD4J 2R0KL 5CBEA 4FQ2H 2V2XB 5D5MF 2A74B 1XCTA 3RRQA 4XVUD 3GJFH 1X9QA 1E27A 2IQ9H 3IFNH 4C56B 2W65A 4L8SB 1U3YA 2Z92B 5FB8B 5ERWB 4PRBB 1NFKA 3VXSE 2ADGB 5GSVB 2P8PB 4X7CC 3T3ME 5FM4A 3BD5A 4OQTL 1MRFH 3ARBB 2WW8A 5FUZL 2R1WA 4KROC 5C70A 4ORZC 1VADB 4X99A 5L2KA 2HKHL 3RWGA 4BSWB 3EDFA 3V6OC 1S7WB 3NH7L 4IRSC 4BH8B 3VI4F 1C5BL 3VXME 2ZZUT 4M5ZH 4EI6A 4R7DA 1BBJA 2AK1L 1OD7A 1Q94B 4LPCA 1QLEH 1GYAA 3LRGA 4X0KB 1WEJL 1NDMA 5GJTL 4ZNEA 1RK0A 4YDKH 5MENA 5F88B 2ICWA 4KUCF 1CGXA 1R3JB 2YD2A 4HUWB 4ZS7L 3NBNA 4HUKB 5E8OA 2FEDC 1U8HA 3MBEC 3QUYB 4OI7A 5EUOF 4Y5YA 2ATKA 4JY5L 3QQ3B 1NFDA 5ALCL 5C6TH 1DQTA 1IM9A 4IMKC 1A6TA 2FB4H 3AY4A 4P46D 4MYWB 2I9LA 4P4KB 1MWAA 4XP5H 1N59B 4U05A 5DJZB 5SWZD 5E6ID 1A02N 3ZE0E 4E41D 1BFOB 3IDMA 2ICWI 4DOHB 1WTLA 1OWRM 1PZ5B 4UILL 4N1EA 4MHHI 1MFEH 4PJ5E 3DECA 4OGAD 1BX2B 5CP3H 3O9WC 5SWSE 5C9KA 2QJDA 2AS5M 4G6FB 3KGRA 1W8NA 1OTSC 5IIEA 3TBVA 5ID0A 3MA9H 1JNHB 1PSKH 3FN0H 4J3XA 5CJXC 2FBOJ 4KAQL 4UNTA 3T1FA 4P5KA 4WVRA 3L7FA 3F7PC 7FABL 1NCBL 4JJ5A 4PJHE 1JNJA 1GVIA 1JWUB 1N0XH 1I9IL 4JN1H 1KIQA 1ZGLA 1X3DA 3O11B 3QUZC 3RWEB 3TVMB 4M1CD 5J11C 3E8UL 1L7TL 3L3JB 1F13A 5D5MA 2VLLA 2P5ED 4G3YH 3BPCA 1R3LB 1ZLVK 2PETA 4XB8A 3CC5B 3PGFH 5ID1A 2ID5A 3F62A 2B20A 5I74B 3F6LA 3MLXH 1MHPH 5J89A 4IIQA 4Y8DC 5I17B 1UM6H 5F8QC 3QEHA 5HHQA 2Y6SC 3LQZB 4F58L 1TNNA 3KPLB 2A73A 5F7DA 1Y18B 4EVNB 4PJ8B 3MV11 1ERNA 2C3HA 3WL9A 4FZ8H 4M6AA 3QDMB 4YFDB 4ONFH 1QFOA 1DUZA 4PGDB 4EI5A 1E6JL 5F89B 4POYA 1UKTA 1KOAA 4PYGA 4HK0B 4GRWF 5GGRA 1WCQA 3KPSE 4P2RE 1NSNL 2YRPA 3BUYB 5HI5D 5GISL 1IGJB 1QQDB 3FQRB 2WIMA 4HH9A 1HINH 4NN6B 4WEBL 5F7LB 3L95A 2F5BL 1NBYA 4PTTA 4ETYA 1JTOA 4G6FD 1I9JH 5T5NG 5GGSY 2WUBH 3DUUB 5TH2B 5ID1B 3S7GA 1KV3A 3LEVH 4I4WB 2D7PA 4ZUVB 1NCWL 1FV1B 1PKQA 2X4UB 3N1GC 4JRXA 4RGNC 3OB0H 3HUJB 4HS8L 3KS0J 1A21A 4E9LA 2ARJQ 3LN4A 4XBEH 4R97B 4JPVH 5CUSL 2YRLA 5DEGA 5EU7E 5C6PB 1P2CB 4NKMB 2QADD 3FO0H 3OKDB 1FZKB 3D18B 1AP2A 3RWFA 1M6OB 3ARFB 4NUJA 3K4ZA 3BWUC 5F3BB 5TPWL 1I1AC 5DYOB 5T3ZH 2AXJA 4OZHE 4LKCA 4ERSL 1AE6H 1U3JA 5DRNB 1MFBH 1J87A 2VISA 4G6KH 1CFVL 3LH2H 3QP3A 5KSBB 2ZOLB 5DMKB 4DCQA 4APQC 4I18C 1IC5L 4XXDB 2JJSA 1EGJA 2VWEE 1OP3H 3VFSB 3FFCE 4IDJH 4JM2D 4MJ2A 3PWNB 3QO0A 2OLDA 1K9TA 4XAKD 5CIPH 3MCG1 3KAAA 2XA8L 3OAYK 1MPAH 1U8IA 4LSUH 1YEEH 3WIHL 1HHGB 5DFVC 3V79C 2FR4A 3OSKA 1H0DA 1WZLA 3A6BL 3WFCH 1P2CA 4NKMA 4Y0GA 5EOTA 3HNTL 4OFIA 3ET9F 3ZHDA 2ZUXA 3P0GB 4LLVB 1M7DA 3BPOC 3LD8C 5F3BA 3WNMA 1SJVA 4LRNH 3NPZB 5F7UA 4XCEA 1BGXL 2X44D 1QSEA 3QFDA 3TT1H 43C9B 2L7JA 1A4KA 1S9KC 1JF1B 1CGYA 4HV8B 3BAEL 5A3ID 3U2SB 1B0RB 4PJBB 5DD3H 2FL5A 2WWMC 1EH9A 4R4BB 1QVOA 3EGSB 1I8LC 2VDRH 4O9HH 4I48B 4ZUUA 1PKQE 1KJ2B 4M6MH 1A9BB 3DBXA 1V7ML 1GH7A 4FQXB 4YHML 3LQMA 5T1KA 3GIZL 4OD3L 5CJOL 2K1MA 3T0EB 4M7LH 4MXWL 3GHBL 4YIQB 3INUL 5FA4B 5JW5A 4MVBD 2YD3A 1Q8MA 5D6DC 1IZJA 2EYTB 4KRPB 1X4ZA 4PRIA 4F7TA 1T3FB 3JWDL 2B1HH 2VZTA 1AJ7H 2VL4A 3TO2B 5IQ9B 1BQLH 3KYAA 2KDGA 4TUOA 4H1LG 3P9MB 5I1JL 2BDNL 3B8YA 4HV8A 1T1YA 2H32H 3G6JA 4LSVL 5DC0A 2COQA 1FGVL 4F2MB 4RGND 1DUYB 4FHBD 3FFCA 1QBMH 5DQ9A 3CXHJ 3CNKA 5HGBB 4YGAB 1TJIL 5E8NA 3W2DL 1MREL 4H8WL 4GW4A 3SBWA 5FHBL 3ARWA 5KZCD 1PX4A 2Q76A 3QUKB 1ZGLM 5TQ0H 1A9BA 2CDGB 5SWSD 2W0LA 1HNFA 1SQ2N 5F1NA 1KJ2H 3K46A 1HKFA 1EO8H 1UXWA 3DSFH 4WHTB 1EK3A 2CLZB 5IB5A 1AHWA 1FNGA 4LFHD 4YC2C 2X9YA 1TFHA 3BP6A 4ODHH 3FB7A 4OQTA 5GS3A 4HZLB 4Q6IA 7CGTA 5LGJA 4LIQL 4D0CA 2HLFD 1ACYL 4IRZL 4MMZC 4Y5VA 3DARA 2NY2D 2ZOKA 4I9WE 4GXUN 4I2XB 4MNHB 1MF2L 4F7CA 1KCSH 1QSED 3MRQA 3QO1B 1FGNH 3ZTNH 1YYMH 3EYSH 4QNPF 1VEMA 2Q76B 3QUKA 1LMKA 4OAWB 1ZT7B 5LWYH 3BEWA 4YHIB 3MRBA 4X6CA 3P0VL 4TTGA 1KYOK 4XWOC 2P46B 1YC7A 4XRCB 3O3BA 2EXYC 5GS1B 3HMWL 1LO5A 2ZCKL 3Q6FA 4BZ1H 2F15A 1FORH 4IOFC 5FCSH 5C0GB 1XGYH 3BW9A 1UZ6E 2QQNH 3GSXA 3OXSB 3MLYL 2XICA 3FB7B 5FDYA 5I1CH 4M4PA 1FJ1B 3FQUA 4HZLA 4Q6IB 5F9DC 1JGUH 3OJVC 4M61B 3AU1B 5CKAA 4OJFH 5EH1A 4X7SH 1AIFB 1V7NL 1HH9A 1U91B 2C1OB 4JEGB 2EDJA 4XNYH 5JO5B 4YEFA 4JDVB 4KHXH 1Z3GH 1TQCC 1M71B 5DQDH 5E8PA 3LVEA 2EIZB 4ODTH 2R29L 3DHMA 2OR8A 3IDYB 1BP3B 5EU5A 3RIAK 4XI5C 2FJGB 4N9GB 2H8PB 5DA0B 5GRJL 4XPHL 4LCYA 5A3IC 4QOKE 5J12C 1AQKL 5IV2A 4WHYH 2IANA 3OXSA 3IKKA 4NPYA 4X8XA 4P3CL 1A7NH 3NACL 4OD2B 4U0QB 3GFUA 4HBCL 4DEPB 3LZFL 1MEXL 3WS6A 3D2UA 4LPUA 4F37F 4HWBL 3IXTB 5JW3H 3BGFB 1YYLL 4CW1B 2AJUH 4GXVH 3SE9H 3ABZA 2Z92A 5FB8A 1EEQA 4OUUA 1Z0MA 2HT3C 2BOBA 4YHZL 1J1XL 5BS0B 2NY3D 1I8IA 1TITA 2V2XA 3VGEA 1RULH 1HDMB 1U8KB 2I5YL 4JJHA 4UB0L 5T1DL 2XY1A 3MV8A 3QA3B 4RBPH 2X09A 5B21A 4Z6AT 1KENH 2UYLB 1OAUL 4QTIL 3NCBB 1S9WA 2Q7YA 4X5XA 1MCJA 1UWGL 1JNNH 3PGCB 3S4SG 1FFPB 4FTVD 5K93A 5D2LA 1NAKL 4OUOA 3VRLF 5KBNC 4P4RB 4Z7VF 1FIGL 1A1NB 4RWHA 5I66B 5D6CB 3KNBB 4O58L 2WANA 4GAYB 2P5EA 3K4DA 4NN5C 5CZKA 4N8VA 2AV1B 1W2KT 3L3GB 3QQ4B 1EGJH 4KK5D 5FA3B 4JQIL 1S7XA 4ZAKB 3RY6C 3WS6C 1NFIB 3IRPX 3GI9L 4B7LA 4ENEC 1F4XL 3RGVC 3N9GH 2BNRB 2YHGA 3GSUB 4Y4FC 2CJUH 4DKFL 2XWJB 1WWAX 2BOCB 5IHUL 3RZCA 4LAQL 5ADPH 2DQEH 1J11A 5F44A 4HKXA 2JK5A 2XQBH 1NH6A 2DICA 2PCPB 3S96B 3HC3H 3TP4A 4PB0L 5TF0A 3D25B 4RISL 3QUZA 5KS9B 5DT1H 2VUYA 3QPQC 4Q7DA 5HSFA 1IGFH 4ZDHB 3UBXG 3CX5J 1T89C 2YA0A 2E7MA 3O4OB 5BJTB 6CGTA 2D7TL 2X9WA 4L8CB 1P5VA 2DLIA 3WIIL 5IJKA 5GHWH 1KN2H 4KJQC 3CLFH 1HEZA 5HYQB 2OR9H 4BK4A 1NGYA 3T0XA 5I6XB 3LPFA 1D5IL 4NQED 1RIVL 5CZVL 1D5BA 3EO1B 4K2UL 1L0QA 3U4AA 2VXVH 3PWPD 1G7LB 1UCBL 4WJ5B 4PJAB 5IHZB 4HIJA 3KWWB 1CFQB 1A6WL 3P30L 1UWEL 5DJ2B 1PDKA 2HRLA 3DVNB 5ADOL 3QNXA 2NZ9C 3C60C 4ZG1A 5GRXG 5J11B 3ZLQC 5IW6A 3SE8L 2QSVA 5DDHA 4OZFG 4FTVA 3TEUA 1BF8A 2OTWB 4ELKA 3KJ6H 2BZDA 3PDOB 3WXVL 2AJZA 1KLGB 3L3KA 3S36X 1C5CH 2W9EH 1YJDC 4P2YA 4F7MB 4EEEA 4KJYA 3UYOD 4NJAL 2YPLD 1GHFH 1NCCL 1I85A 5JW4R 4QRTA 1D5BB 3EO1A 4FQIL 4POZC 3DETD 2V9QA 3WUWB 3OF6D 1T03H 5CEZL 2D03L 1M05A 2V2WA 4Z78B 2XTJB 3WEXA 4M93C 5DJ2A 3I02B 4PJHF 3VXUB 4NQTA 2X4UA 2AXGA 3LV3B 5FYLD 3LDBC 3HPJA 4N1CA 2VITA 5T3XH 4HH9B 1YEJH 3ARDC 3PWLA 3U7WH 1T5XB 5EIIA 5A1AA 4YXKL 3CD4A 2D9CA 4HLZH 1MJUH 4PJGB 2QR0B 1HH6B 2DQGH 4ZXBC 3TJHD 2DS4A 5K9JL 5DF0A 4I13B 4Z7NF 4O5LL 3EJYC 1HCFX 3KPRB 1NMBL 4QRPE 1MCSA 5HHPB 5GGRY 1H3WM 4HSQA 4MNQD 5ILTL 3FONB 5DEGB 3LOWA 4HD9A 1SY6A 2NX5E 5JDSB 5EOCH 3V9FA 1GAFL 3MV9B 1LHZA 3RL1B 3OAUL 4NQEA 4L8BB 1Q9KB 4WFHE 5I1DA 1I9EA 3B5TA 5J9PA 4XMPH 1S3KL 1S9XB 2A83B 4OLUH 5HI3D 2HRPL 3QUMA 1MVUA 2EDEA 4IRJD 2Q8BL 4L4TD 5HGAB 3ZDYE 4GG6B 4NNPH 3E1F1 2B2XL 2CK2A 4O02L 4AM0A 1QNZL 3IDNB 3H3KA 1LO4L 3OXRA 5ACLA 4FZEL 1HH6A 2IH1A 1VA9A 1Z2KA 3P73A 4UQ2A 1K85A 2R4SL 4M6OL 4HLJA 1XGUA 1QSFD 3FZUD 4Y4FB 5FECA 4M1GH 3VWJA 3RQ3A 1OQOA 1FNFA 3QEGH 4LVHC 1OWWA 3MC0A 4JPKL 1CZ8H 3EYOB 3KPRD 4LKXA 1RJLA 4WV1C 1CD8A 5EBGA 3C5JA 1YDPB 1A1OA 4C4KT 4JFED 1Z9OA 2DWEA 5C2BH 2ZUUA 4JAMB 4QHKJ 5ERWA 1R3IL 5DVLA 1FSKB 3H9SD 1RFDH 4E42A 2UZIL 1B90A 2EYTA 1OLZA 1CLOL 3OR6A 1FVEB 4POZD 5EUOE 3FQWA 4OKVB 1HIML 3U7YL 2W9LA 1WFTA 4G6AD 3IF1A 2ADIA 4EI6B 1WZKA 5BZDB 2X4SA 4AEIL 3FB8A 1TMCB 2C7UB 3ECBB 4NO3A 4EBQH 1G9MH 3I2CL 4UT9L 2R0KH 2NXYD 3RWIB 1CE1L 2JJWA 1UJ3B 1JRHI 1R24A 3O45B 3GK8H 2XRAH 3QIUB 1GCFA 1FNSH