5GIRB

Crystal structure of a fab fragment with its ligand peptide
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
211
structure length
211
Chain Sequence
DIVLIQSPATLSVTPGDSVSLSCRASQRISNNLHWYQQKSHESPRLLIRYTSQSISGIPSRFSGSGSGTDFTLSINSVETEDFGMYFCQQSNSWPFTFGSGTKLEMKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for multi-specific peptide recognition by the anti-IDH1/2 monoclonal antibody, MsMab-1.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Heavy chain of Fab fragment
total genus 47
structure length 211
sequence length 211
chains with identical sequence L
ec nomenclature
pdb deposition date 2016-06-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5girB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5girB01
2BY1A 1KPVB 3U9PH 4F3FA 4Y4HC 1S78D 3FFDA 2ESVD 1EUTA 4YIQA 3G6JE 4U6XA 3VXSD 1KF9B 3EHBD 1R3JA 4U1IA 4PJDA 4RMQA 5E6ZA 1PD6A 1AR2A 1FC1A 1QSFA 5IMKA 1I3GH 3L3KA 4WEBL 4DGIL 2CUHA 2KPNA 1CBVL 4ODXA 4RMSA 5D1QC 1ACZA 1WJ3A 2YK1L 5FYKD 5D7JB 5DA0B 2XZQL 4JKPH 4IDJL 3UROR 2ERJC 5JR1L 4YGAB 4DAGH 2BOBB 4Y1AB 1IARB 5F9AC 4PJFA 4YHMH 3PHQA 5FDWB 2P5WA 2W9DL 2A6KA 4YNYB 5EB9A 4R0LB 3RWJA 5JNYB 1AD9A 3ARGD 1DTUA 1TCRB 3P73A 4XAKD 1WFNA 3MV9E 2NY2B 2C1PB 2ICWJ 4Q0XH 4XB7A 1JK8B 3ZE2E 3M1BA 4S1RH 2XN9A 5IB2B 3U4BH 4Z7NE 4IMLA 2VL4A 5IOPB 3EYUH 2V7NB 3OXSA 5I8KH 3PQYB 3ILPA 4PD4K 3F7RA 5CIPA 4PFEA 4EXPX 4EUPA 1BZ7B 1QSEA 3UPRA 4JLRB 4P5KB 2MCPH 4WENB 1YEIH 4YDLB 3QO0A 4HPOH 1JF5A 4Z77A 5AD0A 3GSRA 5E5MB 4ZUSB 3SE8L 4GAFB 3PHQB 1L0YA 3F5WB 4KXZH 3L6FA 2R9HC 5J9PB 1MREH 4I9WE 1LO3L 2BCKA 4MJID 1BGXL 2ESVB 1DLFH 2V7HB 3AFLA 3G04A 1T4KA 4N90D 3VJ6A 4YC2B 3DRTA 3LZFH 1MI5E 2WANA 1LEIA 4J3SA 3VRJA 1WBYA 2AJ3A 3MA9H 3B9KA 3ARBB 4O51B 5JPNB 1YEDB 1HSAB 5J3HC 2HVJB 4FFVD 5ESAA 4LMQI 4CMMB 4TUJB 4CU8A 1YY8A 3VGHA 4W68A 4U1MB 5GSRB 3RBSA 1QSFB 3HE7B 3MCG1 5IMKB 2EEBA 3GGWA 5ACMA 2ED7A 5TF1L 4NRXA 5CZXD 1LK3H 2V5SA 4H20H 4MAYB 4X5XA 4XMKH 3KLAA 3JBG7 4JDTL 2R2EB 4R2GC 3SDYL 4PGCA 4D0DB 3GMPA 4ELKA 4PG2C 4OM0L 3C9NA 4MZ3A 3H7BB 5D7IA 3T8XB 3G5ZA 4IRJC 5L2KA 3PNWB 4NQEA 4KHXH 4ZD3H 3M17A 3ULUL 3MUHL 2LTQC 4NZUH 3MV8A 3GJFK 4NO5A 1PQZA 4KTEH 1RHHB 3W2DH 2VTFA 4F58L 2VIRB 5CZKA 4OB5H 2HVKB 1JMXA 5JTWA 1M7DB 3PWVB 2HKHH 1E4XI 5GS1A 5E99L 4QXGH 3P30H 4L4TA 3NCJH 3OKYA 4OQTL 2QSQA 3MRFB 5FYJD 5DRZA 4MS8D 1MFBL 1O0VA 4N9GB 5C0GA 4U1KB 5FDYA 3F62A 3TJHC 3H9HA 5F7YC 1MFAH 1DUYA 4GT7A 2ADJB 3QHZH 3MNVA 5JHLL 2D4FA 2YS4A 2F54D 1UT9A 4HIJB 5D7KE 4LLVB 2PETA 4NKQB 4FQ1L 3SDXE 5JHDE 1JNNH 1G7HA 3WFEH 1YEFH 5HHNB 3H8NA 1RU9L 5DFWH 4RA3A 2QEJA 4DVRL 1B0GB 4ELMF 4JG0H 3DJ9A 3G5XA 3QQ9C 1KEGL 2N7AA 4KMLB 2JCCA 1S7UA 1A3RL 5GPRA 4BQCA 3QRFM 4EUPB 3WHE0 4NCC1 2ADIA 4MD5A 1HH6A 3VFOA 4ZUUA 2DQHH 4KKNA 1DSFH 1MJ8L 1MQ8A 4PRIA 1ZS8B 2HA1A 5F3HB 1OGTA 3RZCC 3V6ZA 3MRNA 4LLYB 3C08H 3PHSA 3OJVC 2NNAA 5H37G 3W82A 3P4NB 2WBJA 1EXUA 1CG9A 2NY7L 3RNKB 2IMNA 2WBKA 4F9LA 3JSSA 2CKNA 5DJ0A 4HG4J 1G9NC 2A9ML 4QNPF 1U8KA 5CP3A 5CIPH 5JW4N 4JO1L 3WFBL 5D1XD 4NFDA 1BJ1H 1U8MA 3MYJA 4NQVB 5E8NB 1F6FB 3HG1E 1MHHA 1RFDL 1DQDH 2AAVA 3GSQB 5CGTA 2F15A 3MRRB 4HWZB 1A6VH 3BIAX 1XGRA 5MEPB 4JRYA 4PRDA 5HDOA 2YD3A 4AH2B 1FRGH 1TQCB 5ECJE 2ZUYA 4KHTL 2AK1H 4ENEC 3L3KB 3N9GL 3BEWA 5SWQB 1RUKH 2IAMB 5DHVH 4IRZH 1PFCA 4U1IB 1CICD 4ONGH 5DJXB 1S9WB 3LEVH 3RL2B 4U6XB 5C7XH 1OTUD 2CKBB 2YXFA 4EVNA 1KB9K 1G6RB 1DVFB 3WNLA 5AWNH 3QCUH 2YN3A 2FWOA 4ZUVA 3QCTH 2O5YH 3KWWB 5EZLB 1RUAL 4Y19B 4GG6B 3SY0A 4NQCE 5L6YL 2W59A 3DURB 4ZUVB 3D18B 4LNRA 4NWTH 4JEGB 4H0IA 3T0WA 4L29A 1BLNB 4YK4C 5KW9L 2XKSA 4BQ9A 4YDVB 1GOGA 2QADB 4XWOD 5TGBB 3TA3B 2ITDA 1BZ9A 4X80L 3WEXB 1PLGH 3MV7A 1N5AA 4F15B 1MVFA 1LK2B 4N8VA 3OKDB 3EKCA 2FLBT 1DANT 1F13A 2EXWD 3MCLH 4UDTA 3OXRA 1NAMA 1IKNA 3V5HB 3IFLL 4KFZC 1KCUL 1OOAA 2AEPH 4ZUTA 3U30C 1EAPA 3FONB 4M1CC 1FNAA 3SJVD 2ZNXA 4PJBB 5HY9B 2QHRH 1EFQA 3MJ9H 1FDLL 3MRPA 4PGZA 1PSKH 1AXTH 4Z8FL 2AJXL 4WFFD 2UUDK 32C2A 2HRLA 4PJGA 2D0FA 4KQ3H 2VH5L 1AHWC 4LCIL 3P4MA 1X5AA 4PIRF 1I3VA 3QFJB 5BV7C 4MB3A 3MJ7A 2W60B 1RZKH 1KB5L 3BHBB 4GAJH 5M95B 3DXAD 1KSRA 4WW2A 1NFIA 2ICEA 5CEZH 4YGVA 4DZ8B 2DM3A 2H26A 5HYJA 1WCBB 4AEHL 4HHAA 2DQGH 4P2OC 4HKBA 3CJJA 3Q5OA 4UDTB 3AU1A 3S4SG 4LVNC 4P2QA 3IFOA 2HWZL 5GRUH 2AK4D 3ZKSD 4X98B 1CGXA 1YPZF 4WGWB 1ZLUH 2F5BL 5E8EA 5F1NA 4JANB 3JWOH 5CD3A 1MCIA 1INEL 1VEOA 4MSWB 5IT2H 1CFNA 1D5BA 5BMFL 4A2MA 1T22A 1IGFH 1JE6A 1EHNA 5L9DH 1UZ8B 3EAKA 5CCKL 5IEHA 3ARTA 1CI5A 4MXVF 1FL5B 3PQYE 4EUPH 4LPTA 3AMKA 2P42B 4GG6A 3THML 4WU7A 1INDL 4P9HH 1U8HB 3WDHA 1YA5A 5HBBA 5I1AB 1R5IA 3MLVH 5L8LB 3H9YA 5SWSD 3RDTD 5ADOH 3OKOB 1LO0L 3T4YA 3ZSSA 4RGMB 3ZKMD 4MQ7A 1N6QH 2XQYG 3RTQA 4NFBA 2PW2A 3OKKB 3TBYA 4OZGF 4PBVC 1ZA6A 3V6BR 1HXMA 1NGZA 4LDOB 4L8BA 4R97B 1YEJH 3GRWA 1SBBA 2QLVB 1H5BB 1A64A 1AHWA 2XZCL 3DRQA 3QXDB 1NQBA 1JPFA 3HE6D 5DTFB 3QNZB 2DM4A 2VDRH 3LV3A 3MYJB 1X7QA 4N0FA 3RY4A 3PWLB 4J8RB 2WW8A 5E8EB 5F1NB 4PV8A 4PTUB 3WSQH 4XPTH 1A6WH 4L4VB 3IFOB 1T7YA 2N56A 1YN6A 2WBJB 4OF5A 2J6EA 3OQ3B 2NNAB 4QRTA 1KYOK 3FTGA 1ZLSL 1Q9LA 1S7VB 3ES6B 1CXHA 3QG7H 3AM8C 5I1JH 3V6ZB 3MUJA 1U93A 1GYAA 4GG8B 1YDPB 5I2IA 1OSPH 1UH3A 2FL5B 4P9MH 2VISB 1TJIH 4MDIB 4OCRH 3STBA 2B1AL 3BHBA 3IDUA 5SX4I 3U1SH 4WWKD 1LEKB 4BELD 1LWRA 4JLRA 3AC0A 5FGCB 4XBGB 3SDAC 2IAMD 1YJDH 1Q94B 5I71C 3P77B 2Y6SD 1OGAB 1N8ZB 4M1GH 4GH7B 1CFVL 4UV7L 4URTB 3V6OA 4K8RH 4L3CB 5DT1H 1ERNA 1FJ1B 5IOPA 2R29L 4O4YL 2XNAA 1MCQA 4F57L 4OD3H 3MGTB 2B1HH 3FT2A 1RURH 4HBQA 3VFNB 4F9PA 5L88L 3DO7B 1S5HB 3VWKB 2R8SL 1BFOB 1MCFA 1AI1L 3GO1H 2XYCA 4XCEB 1U8PA 1CDHA 1R3IH 1T6WA 3ZE1E 5DQJB 5KVEH 4RMVA 2AI0H 4L8BB 3EGSB 4AM0A 3PWPB 4LFHD 3Q6GH 4PRID 1A5FL 4PRAA 3ZDZF 3VWJD 5I1DA 2E7BA 1MFCL 4K71B 3H42H 3E8UL 4UINL 4GLRI 4K7PH 4LVHB 5L2KE 3DV4B 5IR1B 1W0YT 2PO6B 4JZOB 2YPLD 3H2WA 5T1DH 4ONOA 3MPCA 3CDGB 1EEQA 1S9VA 4HFUH 5I19L 1KCVL 5GGTH 4NO0D 5L7XL 1V3MA 1E27B 2FWOB 3PDGA 3KLDA 3WNPA 1KTLA 5KN5B 2KL6A 4HUVA 5JIPA 5DJ6B 1R5VB 5DQ9B 2OJZL 3ZZ1A 2F58H 3IETB 4G8FB 4NNYA 2Q6WA 3VDBA 2PR4H 1XCQA 4JFPB 2QQQA 4Z76A 3WBDA 4ZTOH 5C0CD 4G6AC 1VFUA 3QUXA 3SDCB 1FZMA 2E3VA 3F7VB 3GSWB 3QRGL 5E94B 3BPNC 3VI4F 1OWWA 2F19H 4HWZA 1DLHB 2IPTL 5KVGH 5IHUH 1JUFB 2D7NA 4EDWH 4JPIB 5DUPL 3UTQA 2ZSWA 4XHJC 4DVBA 4TUOB 5C0CB 4L5FL 5TPWH 1MCCA 4UAOC 1I8IB 5HYQB 4R26L 1WAAF 5CLWA 3IF1B 2IQ9H 3D48R 1R0AL 4LDLB 4K3JL 2J1KA 4RX4A 4DN3L 5CHNB 1RZJH 2EE2A 1JYVA 1VERA 2X4OA 4PJGB 1KCKA 3UJIH 1PX4A 2Q86B 4E42A 5GS1C 2A0LC 2ATKA 2VN4A 4QOKA 1KIRB 4X6CA 3VFOB 5I1LB 1A3LL 1IM9B 5HHOB 1ZA3B 3VWJB 4LSUH 3HC0A 2AKRA 5ID1A 3QNXA 3DI3B 3FFCA 4A6YA 5MP6L 3TO2B 4CVZB 1NAMB 4TVSa 4D9QD 4J2XA 2Q8AL 1FGNL 1N3NA 3JV4B 3OGOE 2A6KB 2VXQH 3WN5C 1OF2B 4JR9L 5J6GB 4TNWF 4HIEB 4PRPD 3EYQC 1K8IA 3MLZH 1HI6B 3QUYA 3QUXD 2JKXA 3VGDA 5EUKB 4R8WL 4RFOH 1AQKH 4P3DA 1UEMA 4X6FA 1G0DA 1WEJL 5HHPA 3UEZA 1I4FA 4MWFB 3FQRA 1I8KA 3TCXA 4PJ8A 3SKNB 3QUZB 1TETH 2JB5H 3BPLC 5E2TL 3MRGA 2VQ1A 3S37H 3MA7B 4Z7VE 2VDKH 2EDJA 3QWRD 3BIKB 4NYLA 1G6RA 3TPKA 3F58H 3V0WH 3SE3A 1MCJA 3GHEH 1HWGB 1MH5A 2P47B 2YXMA 3I6KB 1QVOA 5HGBA 3CLEH 1QSED 3U7WL 1P5UA 3SKMB 3DYOA 2FX9L 5E56A 1DEDA 2HKFL 2UWEF 1H0DA 4OTXL 1H3VA 4TNVK 2NY2D 4JHBA 3IAPA 4GS7B 4GO6B 3C60D 3G08B 3KLAB 5EU7E 3FQUB 4TVPH 4OQTA 5DJCB 1XF1A 5I1EH 2V6HA 4NRXB 1FG2A 4K2UL 3A6OA 4U7SA 3T0DA 3R8BB 1TENA 1NBZB 2R69L 3MOBH 1A6PA 1CT8A 3MRCB 5GRWA 4HPYL 3BP4A 3VXOB 2H9GB 5D7JD 5D2NC 1EGJH 2X2YA 3U7YL 1WBYB 4M7JH 5IVXE 2Z35B 4XT1C 4BUGA 2XI9A 3ARED 4XNYL 2RCSL 4YK4B 1FVCB 1VKXB 2ZCHL 5EA0L 5F21B 3UTTA 3ZHDA 5I1CL 1LE9B 1P7QA 5T33H 2PCPA 3VMNA 1JWMA 3EOTL 3MMEB 3GSRB 4ZUSA 3EUUA 4XC3L 4D8PA 3NMEA 4JQXC 1KYOJ 3BUYA 4JHZA 3C2AH 4WUUB 5DDHA 4LPYA 3KPRD 4X6BA 5BS0B 5IM7A 2PO6C 2AGJL 4PJ9A 2OBGA 3IU4L 1L9NA 2AJSL 1D5XB 3MGAA 1AE6L 1OAUL 2GITB 3MLSH 2KDGA 5JDJA 1KENH 2HFGH 3LKQA 3MBED 1NMBL 1XIWA 4FQQA 1XF5A 2OTWB 1GC1C 4Y0GA 3VH8G 5K9JH 2HAZA 3FO1A 1DQJB 2H2SD 2YD8A 1YNKL 5GS2H 5GQBA 3K81A 1AQDB 4MA8H 3TZVC 1YYMH 4X83A 4J3TA 4NJ9H 1KELL 2YUWA 2AK4B 3SE9L 5D7LE 4MCYA 1AGBA 1G7PB 2PYEE 4GRLA 3ALPA 1WWAX 4CVUA 4PJHA 2CXGA 5DJCA 2R0KL 2FIKB 4NQXA 3F7VA 5BW7C 2IG2L 4DTGH 5FGCE 5IQ9A 2VABA 2DKUA 1WTLA 1PG7W 2ZSVA 1T1YB 3C8HA 2Y7QA 2FGZA 1FVEB 2HG5B 2YD2A 4KROB 3WIFB 2O61B 3CK0L 3ILQC 2L7JA 1C16B 4DGVL 3QDGD 5T1MB 2FBJH 1CGTA 1ZVHA 5EIVA 4YXKH 1DFBL 4YO0B 5D71L 3SBWA 3TO4C 1MRCL 4B0MM 1GL4B 3HI5L 3P0VH 1U8NB 2W65A 1UXSA 1WV7T 1KEMH 5D4QA 4UNTA 1BHGA 3D39B 1BEYH 5DJDA 4R4ND 1NBVL 3VGAB 4PS4L 1OP5K 4QYOB 1F11B 1HSBB 4FQLH 3OF6D 1A1NB 1AXIB 3KR3H 4YXHL 2B4CL 3TGXA 2EKJA 2HLAB 4TSCH 4M6MH 4LHUB 4V1DD 3WD5L 4X5LA 5C2BH 4ZYKB 3CFEB 1A6ZA 4Z7NF 2VLRE 1IVLA 4M62L 3RWIA 1NGQL 4HXBH 3EFFA 3FFCB 5DQDH 5HHME 3DO7A 3FFCE 2WAHA 1N0LA 3OKMA 4FRWA 1I1AD 3MBXL 1QBMH 1ZGLA 2AJZB 2ATKB 3E0GA 2DTML 2DDQL 4KK9D 1Q38A 5ID0B 5DLMH 5BXFB 4I9WD 1N8ZA 2H41A 3K4DA 3QXTA 1FBIH 5HXMA 4XP6H 2BC4A 3C6LB 4PY8I 4QKXB 4XCCH 4ODHH 4TPRL 3BEVA 4RFEA 5E6IB 1T04B 3KYOA 5DJZB 1U2HA 3D6GA 2Z31C 1KCRH 1NLDH 3MLYH 1I8IA 3MRIA 3LB6C 3O0RH 4ZO7A 4QXTA 2W07A 4RIRB 4MA1C 5GS0D 4L8DA 2CXKA 3AM8A 2BJML 4I0PA 4D9RE 3FFCD 4OT1H 4IRJA 5JPMB 1NUDA 3CVHB 4MA7H 4HUUA 1RK0A 5JORB 3NCBB 1FZOB 4MNQA 3LRSB 2G9HA 5KG9B 1W0VB 1K8DA 4HMCA 4S1SL 1QFHA 1XGUB 1IGMH 4PJDB 2K9UA 3IKCA 4PJ7E 4ZFFB 3ZDYF 2FBOJ 3CPLA 3QDJB 5FF6B 5HHOE 4M6OL 4G8GE 1E27A 4PGJA 2H45A 2IQAB 4G8EB 3MNWA 1G9NL 4QF1A 5T5NG 4JFFA 2EDRA 2CRIA 4WUKH 4WV1A 4ODUA 1PJ9A 2W38A 2O5ZL 1WZLA 4BFIB 1JZ6A 3PDDA 3RVWC 1U3YA 1U6AL 4WNQA 4FFWC 3ZE0F 4WU7B 4HF5H 1MVUA 2EZ0C 5D2NA 2R56H 4PRAB 3BKMH 5L2JA 4XI5C 4WWKC 4JFHE 3BISA 1MLBB 3B5TA 1RV6X 5LXGL 1FO0H 5FECB 4PTTB 5E94A 3TBWB 5FO8A 1RVFH 5C6TL 1KLUB 5FM8A 4JANA 3FRPG 4G9FE 4XC1H 2BXYA 3GB7B 5IG7A 2HMID 3I9GH 4L4TE 4QHLA 1XCTB 1RMFL 3VWKC 3U4AA 4P2QB 4PRHD 5A43C 4CGTA 1HQ4B 1U8IA 4OCWH 2B2XL 4KGJA 4UILH 2GAZA 4U6VH 1CLYL 5FCUL 2BFVH 2JELL 1OGAA 5IHLB 4GAGL 5I15L 4FTVD 5DRNB 3SEPA 4L8SC 2Q7NA 2G60H 4XBEH 4C56B 1L0QA 3F12B 4I48A 1RJCA 3HR5B 3CCHA 1VEMA 3VFMA 4QXUH 3RUGF 3STLA 1S7SA 3TBTA 5CSZB 1RIVH 4R2GB 3I50L 4YLQT 4GRWB 3CVHL 3L3GA 4PJAA 1FV1B 1FSKC 4LASL 5ENWA 1NMAL 4E0RB 3IDXH 3FQWA 5F7EL 4AEFA 1NFDF 1F6LL 4U7KA 5CGYD 1IEHA 1Q1JL 2QSTA 4JRXD 4WTZG 4BKLB 5EC2B 3QPQC 1F4YH 2H2PC 1T80A 3EJZC 1HILA 4XCFL 2LAAA 1C5CH 2WWKO 5GGSA 4OCXH 2YWYA 2NY5C 5CILL 1NJ9A 2A73A 5CMAB 2W0KA 3CFBB 4UMGA 2JJTC 5KAQF 4PJEB 3K2UL 4QOKD 2VDPH 2EH8H 1YEGH 5KSUA 1A1MA 2RAMA 3L5WA 1UKSA 4YR6A 2HLFD 4KKCC 3LQAL 4WW1A 1A9EA 2CLVB 1V3JA 4RMRA 3UPAA 3Q48A 1DJSA 4KZEL 1V7NL 2JJSC 1I9RL 1T03L 4UTBL 3JTSA 1ZHBA 1NLBL 2Q8BL 4ZO8A 1FFPA 5FM5M 1YECL 4NZTH 3NFPA 2VC2L 1B6UA 3ARGB 1KG0A 3CU7A 4RISH 2D7OA 1J0JA 3TT3L 5CJQL 1N6UA 2CIKB 4XVTH 4L4VE 3WUWA 5CD3B 35C8H 5MEPA 3EDFA 1LNUB 2R1XB 2X4NA 1A6AA 1DN0A 3V7AG 5EBWA 4MA1B 3NA9L 4M7KL 5KVFL 2DF3A 1RZ7L 4MS8C 4PD4J 1O7VA 2CLRA 3S5LB 3QEQD 3ARVA 1PYWB 3K8LA 3MC0A 3KPNB 5FO7A 3L3JB 1KN4H 3GSUB 2E27L 4C59B 4WI5A 5ADPH 3C5JB 4HHAB 4XZUA 1QTYT 1X5JA 2DL2A 4QRPD 1J0YA 2EE6A 3TH4T 2VLJB 4PGDA 2VAJA 5F6IC 5HVHC 2NY1C 1YJDC 2BVEA 4UQ3A 5A2FA 4M8VA 2OCFD 5KSAC 1P7KB 4YPJA 3CXHK 4XNUL 3CFBA 5BV7L 5MEOB 4Z7WB 1UYWL 3JWNC 1IC7L 5GGSB 4YQXH 5DRWA 3RWCB 1JZ8A 3HZKB 3ZKXC 1T0PB 5B39B 3NA4A 4L9LC 1RZFH 4Y5XC 4ONFH 1B0GA 4ZS6C 1FZOA 3HUJB 3DVGA 4JO2L 1YPZE 2BSRB 5CWSB 5M94B 3LQZB 2HTKD 4RIRA 5B8CB 5KJRL 1IGJB 4PJXA 3BAEL 3LKRB 3JV5A 2QQLH 1N59A 1XF4A 3L5IA 3KPSD 5KANG 1XZ0B 1C12B 4UT7L 5JA8B 3IXAB 4CNIB 4ZFZB 5ETUB 3MRIB 4G6MH 2Y5EA 3U6RA 1IFHL 2C1OB 1QFWI 1U42A 2FD6L 3QAZB 2P4AB 1NFIB 1ZKAA 5AG8A 3T0EB 3A67L 5IEKB 5D9SA 3T0EE 4CRPA 3RU8H 3ZKNC 5FYJH 2IALA 1CDIA 1LO4L 2AXFB 3C6LA 5C08A 1MCHA 1X4YA 4XP9L 2ED9A 1V5JA 1IGCH 3MXWL 1NAMH 3ZL4L 2FX8H 4CMHC 1EFXA 2FO4B 4PG2A 1W8OA 5T3ZD 1JTTA 1UG9A 5T3ZH 2Z92B 5DJXA 4M1DH 4X5WB 3GB7A 5DJYB 1INQA 3EFFB 4S2SA 3MJGX 3OXRB 3OAZH 4F80A 1K4CA 1OW0C 2OR9H 3BD5A 4XBPB 2SEBB 2YA2A 4NOBA 1AO7A 4YHYB 5KBNC 5C0NC 5E08L 2YOCA 1MLBA 3QUMB 4HJJL 1J8HB 4NM8L 5E00B 1WIOA 4JZJA 4KK8D 1X5GA 3UTSD 5JA9A 3DMMA 3EYFA 3FQNB 4OCYL 4M00A 3FMGH 1NCBH 1BOYA 1D5ZB 2X4SA 3OAUL 4WJ5A 4CVXA 4PJ8C 1BQUA 4YDVA 3VXPB 5FYJU 1VSCA 4KDTC 1VFAB 4NO2B 1F6AB 4M9OA 3GNMH 2BXZA 3ZSTA 1MELA 3DUSB 5CJXC 3KPTA 5J57B 4X7SL 3BW9A 4X7FC 4Y4KB 1MCSA 1JN6A 5IV2A 3UAJD 4GW1B 1WUNT 4PRIB 1L7TL 2YUXA 5EBMA 3ME0A 3QDGE 2F9BT 4ZPVA 1IKFL 3UTSA 4LEOA 4ZUUB 3B5HA 2DTSA 3D69A 4XPHH 3UZQA 4P2RA 3T4AA 1I7UA 3BP7A 4JG1H 1PZUB 3KS0H 4HMDA 2UZXB 1EGJA 2FYYA 3QFJE 2R0WH 1Q72L 5E6ID 3BQUD 2FZ3B 2WWMC 3MREB 3HE7C 1IM3A 3LQAC 1D6EA 5KS9F 2P8PA 3D2UB 4N5EC 4M7LT 1G6VK 1A14H 1E6OL 2I5YH 4XPAL 3TN0C 1LHZA 4GBXA 4ORGB 4BFEA 4NKIL 1ODAA 1MCOL 5LGHH 2DQIH 2B5IC 3VXMB 5DJZA 3VXME 3ECBA 4JJ5A 2J5LB 2G5RA 4AIZB 4Y1AA 1XMWA 4M8QA 5C2UB 3WO4C 1IGIH 4NN7B 4DEPC 5J3HD 4WI3A 1CQKA 3OG4B 5IJVA 3BH9B 4FQQB 4KWUA 3Q1SL 1MAML 5F97E 5B38G 5IIEA 1MPAH 3RL1B 2V2TA 2EEAA 4M93C 2ARJQ 2DQCH 1G7IB 1C8PA 4F7PB 1BQLH 3P0YH 3PWUB 1YQVL 5FYLE 3GSNL 1VGEH 2GW5A 3AAZB 5EZJB 1DQQB 3E3QE 2OP4L 4FQJL 3REVA 4IJ3B 4DKEH 5DR5H 4EI6B 2J6EL 5HHNA 1EPFA 4DN4H 4OCSL 2HJLA 2NX5A 5B3NA 4LPXA 4HCRL 3GGWB 4YEFA 4FS0A 1A8JH 1F4XH 3QH3A 1FVCA 4LKXA 4MNQD 1ED3B 4CMMA 4CVXB 1AIFA 3GRWL 4Y8AA 1D5MA 4LSSL 4HUMB 5TE6H 1VDGA 2QTEA 2X4RA 5E6IC 4O02L 5FFLA 3VXUD 2A0LD 5HGAB 3DIFB 5D1ZA 3I84A 3RVTD 3HNTH 1B6DA 2DICA 4MD4B 4KH2A 1I7RA 2E8ZA 1NFDA 5IW3A 2L4OA 3MV8B 4JKWA 1JHLL 1SMAA 5AYUH 5T1LB 2VMFA 3HC3L 3ZT7A 5L2KD 4U3CA 1GGCL 1QP1A 3HMXA 1DQLL 4G3YL 3MV8D 2O5XL 3BIKA 4NYLB 2OK0L 1QLEL 4KMTL 1GC1H 3T77A 4A6YH 1YNLH 3O11B 4OGXH 5F89A 5DUMH 5IJVB 2VLLB 5AZ2L 3QUZA 1ZANH 3MRQB 5EIQA 2GT9B 4JKMA 1J10A 4OUOA 3TV3L 5GISH 4NWUH 4ONHB 4PRHB 4P3CL 4LLUB 3H0TB 2BDNL 1XF2B 1Z0NA 4ODVH 5EZOH 3GDBA 2JJUA 1UCBH 5DJ2A 4TQEL 1QLFA 1YC7A 2EDHA 2YEZA 3DARA 2FEEI 4WUUD 5KVDH 2HFTA 1ES0B 3GM8A 2NY5L 2YRLA 2J12B 1DBAH 3NIGF 3WJLA 1UCTA 3N1MC 1UJ3A 4ZO6A 4U49A 3DHJA 1SMOA 1Y18A 1JZ7A 2BSSB 1RD6A 1UB5A 4WO4D 4I0PC 3MUY1 3LS5L 2XTLA 1QNZL 1NC2B 1J1OH 3ZKND 5LBSH 4FZEL 3WXWL 3V4VL 5IBTH 4LAQH 1AGCB 3MMEA 3EJYC 1JHKH 1CE6A 5HDLA 1LE9A 4O5LH 4U2YA 3EO9L 5CJXA 3IRPX 1TJGL 5F7LB 3VI3E 5AAWA 1YC8A 1VFAA 3L5HA 3OJ2C 5EZIL 3T0AA 4GOSA 2WK2A 1MCWW 4PGDB 1VADA 5CEYA 4I4WB 2COQA 4M4RA 1TNMA 4MD4A 3HPLA 4ISVA 2NTFA 5DVOA 5GGUA 4J3VA 1CT8B 5C6PB 5C0CA 5CP3H 1F4HA 1VFMA 4ZUWB 2AV1B 5IW1A 1YYLL 4MNGE 5IHZB 2CLRB 3BN3B 3S3JA 3ARRA 3U2SA 2EC9T 1Q8MA 4PRBB 2Y07H 3W9EB 4J6RL 4PJ9C 1DBML 2CR3A 2GJZB 1Q0YL 2NYYD 3GSWA 4RAVA 4N8CH 4O2FB 2NY3B 3WUWB 1U91B 3L3IB 2GSGB 3CX5K 1DBBH 2C4FT 3U82B 1JRHH 1QQDA 3D2UD 3NH7H 4HQQH 3LEXB 3IDMB 2AJUH 3NFPB 4J7RA 4C54A 5DWUH 2W0LA 2IH3A 5DVKA 3T65A 3MRGB 2LAGB 4NKMA 3PWJA 3TJEL 5I18H 2NX5E 2LE9A 5GIRB 4WW1B 1BOGA 3KPOA 1MWAL 3U79A 4KJPD 3TPUB 1RJYB 5KS9B 2VL5B 1I8MA 2VSCA 1E6JL 4LSQL 4KKAC 3MSPA 1G6RH 3L5XL 5F96H 1WBXB 4BH7A 3DTXB 5DJ2B 3RWDB 5B8CA 5DK2A 5CWSA 4Z0XA 4KVNH 1QR1B 5C0AE 4E5XA 5E8DL 5IVXA 3WJLC 5C0BA 3HC0B 2QSVA 2FJHB 4K3DL 4BH8B 4P2CG 1SM3L 4L9LB 2W9EH 4YPGB 4I18C 5MERA 2ZKHH 3SDDD 3FO2B 3RGVC 5MEOA 3RVUC 3NZ8A 4N0YL 1DVFC 1FYTA 2P46B 4NNPH 1KCSL 3GSXA 3L95B 1H5BC 4P4RB 4NRYB 4N9OB 3DROB 4S10A 5EN2B 4JY4A 4D9QE 5IW6B 4IRSB 3BESR 2YKLH 1C5DB 2BRRL 4MD0A 4JVPA 2H1PL 1NCUA 4EEEA 4PP2B 1R24B 5T1KA 3WN5B 1IC1A 2MQ3A 5C0JB 2NTSP 2XRAH 1Q9LB 4K3EL 4LSVL 2IAND 3DUSA 2VJXA 3UTQB 4YXLH 3U0PA 4P49A 5FOJA 3W9DB 3CFCH 4V2BA 1XCTA 3VU2A 5GRZA 2Z4QB 4JFXA 2X4NB 3GJFA 4NQCB 2X70B 5T3XD 2J4WL 3RAJL 3RKPA 5DMKA 1J8HA 1MCBA 3OX8B 4X6DA 4M7LH 4Y2DC 1LO5A 4NNYB 1QSFD 3PWNA 3ARGA 2SEBA 1K85A 3ULUC 4YHLH 3S36X 1YY9C 4JREB 1X6LA 3DPBA 4TSBL 4HUWB 4XNQB 4JN1H 5HDQH 4PY7B 3K7UA 5ACZB 1OAXH 2ZCLH 4L3AA 2HH0H 4N5ED 3GJEB 4HUXA 3DVFA 4JRXE 3IU3A 3RNQA 1JHTB 1AGEB 2NLJB 3EFDH 5C9JA 1Z6JT 2WWMD 1I7ZA 4G6JL 3UJJH 1A1MB 1JGLL 2F74B 3KYKL 4K94L 1VACB 1KJ2A 3ARBD 4KKBD 3PP3K 4QOKE 4X6CE 2D0HA 1CDYA 3LSOA 4M4PA 2VXSH 1FP5A 1HE7A 2HT4C 4F15C 3QA3B 2D31A 4ZFFA 3MXVH 4R3SA 4YAQA 4IOFC 4G7VH 5TE7H 4QCIB 1RIHH 1T66D 1MAKA 3FRPA 3HR6A 1X5XA 5JPMA 3D9AL 4O58H 4NBYB 3D3VB 2VAAB 4NSKB 2IADA 3RVWD 4LQFL 4BZ1L 2DBJA 3BGMA 5TQ2H 5F8RC 3F7YA 2OX5A 2ZG3A 3EW3B 5TE4L 3WNMA 2X5PA 3B2UC 4OAWA 1KB5B 1MCPH 4DKFH 1Q94A 3U9UA 4F7CB 1LEGA 1BJ1J 5ELIA 3CLFH 3IDNB 1LEKA 1QBLH 3IJSA 4I77L 3VG9B 4Z7VA 5IB1B 4M5YH 2RBLA 3WIIH 4XVSL 1U93B 1A7QH 2DWEB 1VGKA 4Y4KA 2X1XR 3QEQA 3SO3B 5FA4A 2GAZB 3FCTB 5HGHB 4P2YA 1FPTH 3H7LA 1NDGA 4DUVA 5JZ7C 2AJYL 5E5RB 2F8OA 4OZHE 1EH9A 5GHWH 5E8OA 1A22B 1HHJA 3BPCA 1S9KC 1AD0A 3VFUA 3DHMA 3L3JA 3OPZL 4XCYA 1UWEH 4D0CB 3PL6B 3QIUD 4PTTA 4NZRL 1P4BH 3OG6B 4NP4H 2HLAA 4Q9QH 4HBCH 4OFVA 2VXTH 1GGYA 1OP5H 3MLRH 1C1EL 4E41A 3MV7B 2X1OA 1GZQA 1QFWL 2Z93A 3QO1B 4J3WA 1DQML 4P99A 5ITFB 3O3DA 4YWGL 5GS2D 4ODWA 2N4IA 4APQC 3R1GH 4WTWA 1P4LB 3EYOA 5FGBA 1AR1D 3DMMC 3BWUC 2F53D 5F1OB 2DRUA 1MNUH 4MA3B 2YZ8A 1ZEAH 5T1LD 3Q3GB 4GLRH 4QRSB 4UTAL 1WZ1H 1O5DT 5LWYL 3GKZA 3U0TB 1IC4H 5GJSH 3BDYL 2GQHA 5KS9E 2FLRT 3JVGA 2MHAB 4JPVL 4JY4B 1OLZA 4MB4A 3FN3A 3V5DB 1Q9OB 2BVPA 3U9UB 4F7CA 2HRPL 3K74B 4P4RA 1TZGL 4TSAH 2CRMA 3DXAB 1MUJB 1FH5H 1ORSB 5DMIL 3TWCL 1JI1A 3OGCA 5D2NE 3RFZC 1NANH 5MERB 4YHOL 1NFDE 3MRRA 4LVOC 1CU4L 1W72A 4I2XE 3WLWD 4WWID 4OLXL 3FN0H 5E8NA 2CD0A 4GXVH 2FX7H 3AU1B 3C09B 2XWTA 1CE1H 1QHPA 3TT1H 3FAXA 2DAVA 4KPHL 5D7IF 1F45A 5H94B 4NPYB 2X9WA 1WZKA 5LAXA 3WFCL 4L1HA 4IRJD 5DD0H 6FABL 1EHXA 5GGSY 4PJCE 4G8GA 1KIQA 4HS6B 1NGWB 1AQDA 2UZIL 3CFKB 4OZFB 3WJJC 3LDBB 4GKNB 1KPRB 2RFXA 2BVOB 5D72H 3CVIH 2ZJSL 4PLKC 2VSDA 2YR3A 2NZ9D 4PRPA 1JCKA 1QFUL 3LKQB 3E1F1 4PB0H 5E2VL 4CL7A 1WF5A 2NW3B 4LKCA 1U41A 4LSRH 2MCG1 3PDOA 3NAAH 2DQUH 3SGDH 1I8LC 4GW5A 5K93A 1ORQB 1DBKH 5IM7B 2XKNA 3P40A 1CIUA 4OLVL 4LLDA 4QY8A 3VXMD 3C6SB 3ZHLA 1TVHB 4K55A 1MCLA 3KPLB 2IBGA 1KPUB 4UOJA 4HIJA 1F11A 1HSBA 3UYOD 1RIUH 1LO2H 1C5BL 3Q6FA 1BVLA 3D39A 1M71A 1MCRA 3U2SB 5DHVB 3ULSA 1ZSDB 4XVJL 3K1KC 3BQUB 1CBVH 2FECL 5EBLB 3B9EA 4YDIH 2YK1H 3G6JB 2HVKA 3B4NA 4OD1H 4U1NB 3B9KC 3IDYB 5DK3A 4I5BB 4QTHA 5JR1H 5INCA 1FFNA 1PQZB 2CH8A 3PV7A 3GMRA 4HZLA 4R90H 3T3PF 3UCRA 2OSLA 3KNBA 1U0QA 2CO7B 2W9DH 3C5ZB 1GHFH 2IANA 3J8F7 1XR9A 4GAYA 3HG1A 4PJEA 2NY4B 4WWKB 2EYRA 2VKWA 1CK0H 1T6VN 5EU5B 1PVHA 3VI3F 3C5SA 3KYMB 1H15A 5HHQA 3V4PH 2CDFA 4LSTH 4H1LA 3X3GH 4NN6B 5HHXL 4LDEB 1N7MH 1BQHA 3KPQA 2OJEA 4PP1C 1K6QL 1T5XB 4QTIL 4ZNEA 3L7FA 1QR1A 2Q20A 3V5KA 4Z0XB 3IAGC 2LABA 2AK4A 5TDNA 3ZTNL 5A1AA 2MCPL 1KJ3L 1PKQB 2NY2C 3KPPA 1CGVA 4BH7B 3VFVB 1TPXC 1D5IH 5ACLA 3QDGB 3BT2L 5FK9A 3O3BA 3MRNB 4LLYA 2JTDA 4MNQE 3D39D 1XF5B 1ZTXL 2OTWA 2VL5A 25C8L 4ONHA 3ULVC 4WO4B 1G84A 3VD5A 2P8LB 5E6IA 4A6YB 4HJ0D 1GSMA 3LZFL 4P5KA 5HHVH 5TFSH 1GOHA 3UPRB 3P11H 3E6FA 5F7MC 4Q6YA 1A4JB 1KJMA 1VPOL 1IAIH 1MI5D 3T77B 1SVZA 1QA9A 2P7TB 5H37H 3T0ED 4ZO9A 2WUBL 3BWAA 5JQHC 1LK3L 1LDSA 1OP3H 5HYJD 4HS8H 3V0VA 4P23D 2J8HA 5C08E 4K9EH 5EO9B 1CLZL 4MQXD 2IPUK 4XVUC 4NM4H 4KDTA 3BPNB 2D03L 2M1KA 5DZLA 2PF6A 3X3FL 1KLFA 4ZD3L 2BNQE 1HYSD 2BOCA 4Z7WF 4NUJA 4IEFB 3TIDB 4LLWA 1NCNA 4HIHA 1FORH 1NDMB 4QGYA 4U1HB 5DD1H 1WWWX 3AROA 5K33A 2DYPB 4OFPA 4RMWA 3VXQA 1NUGA 3DSFH 3P30L 4PRNB 2HT3D 5FM4A 4MCZB 1DCLA 4RDQG 4NQEB 3IFNH 4JN2A 3QDMA 1CE6B 2FGWL 4H0HB 2HJKA 2VZ3A 2YWZA 3MBEB 4X0KA 5HVWA 2ICWB 3O4LB 1NGPL 4LPWA 3O3UN 1U3ZA 2VLJD 5KSAA 2D7PA 4Z7UF 4X5XB 4WI8A 1PAMA 2MSPA 4FQ1H 4QRPB 3MV9A 2DQTH 3GK8L 3MRMA 3T3MF 3JUZA 3TP4A 1YEFL 4I3RH 2Y1VA 3WJJA 1T0MB 1A7OL 1OD7A 3HRZB 4JZNB 4DVRH 4JG0L 2XZAH 3KPRB 4Z7VF 2YC1B 1QG3A 4KJWC 3FB8B 4K23L 3DYPA 3N85H 5EFIB 1NDMA 1RULL 4QLRA 1LEIB 2K3TA 3QIBD 4KJWD 1GPOH 3MRBA 2E7LA 5J12B 4G6FD 5A2JH 1FZKB 2E9IA 5CGMA 3QUMH 1OF2A 1Q0XL 4Q2ZA 5JXEA 3TVMC 5IESL 2LQRA 4WI7A 1FVDA 4Q97A 2PXYD 1QLRB 2OMNA 2XG4A 4RFEB 2XWBA 3CFJA 5E6YA 1F3JB 5ITBH 1QSEB 1I1YB 3VRIB 1KNOB 1IEBB 1UACL 2WZPD 5FUOL 4BSWA 5I6XC 1FFOA 2FZ3A 4YHKH 5FYKH 3X11A 4BM7A 1URLA 4HG4K 1HXYB 1BJMA 4JPWL 1AGFA 5DVMA 5DMGD 5JDSA 2JJSA 3SGDI 4UI2A 3KVQA 1FRGL 2JIXA 4HSQA 3N9GH 1WVZA 3IF1A 2F5AH 4YNYA 4Q2ZB 4C58B 4DKDC 1LP9F 3QUKA 2NW2A 3QUZD 1XGYH 4MQXC 5D2LA 1CXLA 1N4XL 4P23C 3QCUL 1CL7I 3QCTL 4UU9A 2FATL 4L4VA 4NKOA 5SWZE 4ODBD 5TDNB 2EDKA 4X7CC 3NCYP 5TDOB 3CDFA 5EFIA 2D7TH 4Y5VB 4CN4A 2LU3A 4OF8A 4PV8B 1TVBB 1E4XH 4NWTL 2YC1A 1IAMA 4OLYH 2DLFL 3RZWA 5KW9H 1NKRA 1XF3B 1T0MA 5CEXB 4CBPA 4WCYL 1P1ZA 2Q6WB 5T3XL 2WP3O 1G9MH 2WIIA 1PLGL 3HAEA 3OKKA 1AJ7H 4RGOL 5D1ZD 4FTVB 4AJ0A 2QQKL 4JGJA 3TZVD 5D5MF 2EDOA 3E2HB 5JIKA 2H2SC 2H8PA 2M26A 4C55A 3HCVB 4W6XB 4BK4A 2CK2A 2X4TB 2UVEA 3RL1A 2V2TB 4GRLC 5CLTA 1KXTB 2BZDA 3T2QA 2HTLC 1P2CB 4PJFF 3C87A 4IHOA 2VWEC 4P4KC 1WWCA 3TCLB 1WIUA 3WS6C 4C83A 4EZMA 1JGEA 4GKZB 3L3OA 2AJXH 1I4FB 3B8SA 3HE6C 5I76A 3VXMA 1KTKE 2VH5H 1NUFA 4MB5A 1Z9SA 2ZNWA 4XCEA 2L7UA 2NQCA 4KY1L 5DD3H 3T1WA 1M05B 1K4DB 4JHWL 4ORGA 5JXAL 1JNLL 3IXAA 3SDCD 3W0WD 1SJXA 3BKJL 3GMNB 3RI5F 2X1QA 2F54E 3QQ3A 3PGFH 3A6CH 2PTUA 3LQZA 5GRJL 1CDBA 2P48B 4K07A 3RKDD 2WM0A 3DVGB 3GIVB 4RCAA 1G7LB 1B2WL 4M7ZB 4P46B 1E28A 4OGAD 3V7AE 4DFHA 2X7LA 3SDDB 4PB9H 4H0GA 5KOVC 4UAOB 2AKRB 5GXBB 5ID1B 3B9KD 3DYMA 4PUBL 3C60C 3LIZH 5DVNA 4AENA 5IT2L 5ICXB 2OYPA 4X7TA 5I2IB 2ZCKL 4JM2D 1ZAGA 1T83A 2X40A 2OI9C 4XXDA 2C5DC 4ZXBB 5C0IB 1P7QB 1JNHA 2EH7H 3BO8A 4ALAL 1EJ6A 1HN1A 5DZNA 2OMBA 3RUGE 4YDKH 1PY9A 2YPVH 1CXKA 2W0FA 1EEYA 3QXAA 4AQ1B 1CN4A 1INDH 1RJLA 2EYTB 4KVCL 3S88L 4GKSB 5B3JF 2B5IB 2H9GA 4U1LB 3NN8B 4CW1A 2UY6A 3MRCA 2XXCB 5F9JA 5JO5B 3MLUL 4H25B 1JZ2A 3O6FB 3MLVL 1NBZA 1JJUA 1HYSC 5EU4A 1RJZB 4OJFH 1N6QL 1H5BA 3DVIA 1JFQL 1JWUA 2FDBP 4KAQL 1BM3L 5D1QA 4JGUA 5D7IE 2VDLH 1CDGA 3TIEA 4CVWA 3BGFB 4MJ6B 2XKUA 3QR2A 3VE0A 4TYUA 4X6CF 5DJAB 2BNQA 3N06B 3HHRB 3HZMB 3LEYL 4EOWL 3LD8C 1HHJB 2ZUXA 2VDRL 4QWWD 1RAMA 1X3DA 3GMOB 3GMQB 3RA7H 4HK3J 2NY3D 1FO0A 5I1AA 5KN5A 4QRSA 3QEQB 2X4PB 1F58L 1QEWA 3MV01 5TH2A 4XPTL 2Y72A 4NT6A 1OGAD 5JW5A 3H9SD 1MIML 3TLRA 1V3LA 2ADGB 4OZGB 4ZFGL 3L5WB 1P4LA 3EYOB 3I3BA 1D5BB 3CU1A 3RPIA 4OF7A 4LBEB 4OCRL 1B4JL 3BZFB 3ARPA 5EWIH 3PGCB 3B8YA 3U1SL 4HIXH 3UZEA 1ETZA 2GHWB 4JFEE 1HHHB 2JE8A 3O6KH 5DRXB 2PXYB 4AG4H 5HGDA 1DL7L 1IAKA 1U58A 5DT1L 2APFA 4H8WH 4WIQA 3HAEG 4IOIB 1LMKA 3O6FA 3D85D 4PP1D 2ZZUT 4M5ZL 5F9JB 4TTDD 2CK0H 4LVNB 4OCNC 4GKSA 3VFNA 2YZ1A 1OL0A 1BAFL 1RUQL 3QXUA 5E8OB 3GBML 4FZ8L 1A6UL 3RWCA 3INUL 2UWEA 4QOKB 4X6CB 5C09A 4Z7WA 5BVPH 1FJ1A 2ORBH 1UVQA 2Q86A 1CICC 2GTZA 2RIKA 3LOWA 5KVEL 1OT1A 3HMXL 5LCVH 1T1WB 4ENED 2AI0L 3HR5A 4XPFH 2DMBA 4KUZL 2J88H 4JRXB 5SWZA 5KTEH 3B3IB 2KQNA 1U36A 3O4LD 1TPXB 1JHTA 5DVLA 3Q6GL 3FOLB 1FAKT 3REWB 5HY9A 2ADIB 4MD5B 5T5FH 1PEZA 1MFCH 3GJEA 4ZOEA 5BS0E 3AGVA 2Y5TA 4D9LL 2J8OA 1K3ZA 4PY7A 4TULL 4NFCA 5F9OL 4M02A 1U8IB 3EYSH 4XWGL 4ZS7H 5T1DL 2E6PA 2VAAA 1LK2A 4MJ5A 5JQ6H 2Y36H 4F37K 3V6FA 3QIWA 4Q6IB 3MODL 4X8XA 2F58L 2QKIB 1PW3A 3ARFC 1Y6KR 5E2UL 4HWBA 4LBEA 3VD7A 2DQDH 3V79C 4WRLA 2JK5A 2KZ1B 4LARL 3HMWL 3V5DA 3VA6A 4R3SB 1KG0B 1QPXA 3BGFC 5HVHB 1FNHA 5MENA 3H3KA 5ESVB 3W39A 5JW5B 1W72L 1IQDA 5FIEA 1U8OB 5DUPH 2UYLB 3VFTB 3OKEA 2P5EE 1N64H 2IBZY 5IGXL 2VITB 3BMWA 1B4RA 3TFKC 5IK3B 3CMOL 3ARXA 1GGIH 4NRYA 4FQ2L 1P9MC 2VDMH 4PLKD 4JRYE 2Z31A 5F3BA 4PJHE 1H3GA 3NZHH 1ND0B 3UO1H 1XGRB 1NJ9B 5CMAA 3LKSA 4JFFE 4HV8B 1KJVA 4JO4H 1CXIA 4FXKB 5GGRA 3MOAH 5IUSA 4UT6L 3UJIL 3SO5A 3UZVB 4BKLA 3PL6A 4TOYH 3HC4H 1M7XA 4TVPE 1IBGL 4XPGL 3V52L 3VFUB 2VRAA 1A3LH 5FHAH 4KUCF 3VGGA 2WLYA 2CDEA 5E0QA 5DGQA 3U0WL 3RNKA 1FN4A 2A6IB 4MXWL 4RNRA 3SKOB 2GJ6E 2ZOKB 2ZOLA 1CG9B 3DTXA 3RWDA 3GHBL 1KC5L 2HFEA 1J8KA 4GMTL 4U7MA 1ADQA 1FGNH 1KN2H 1XH3A 2A77H 3DX7B 4ZTPL 5FAAA 3SKJL 4BUHA 3F5WA 1I8MB 4XXDB 4Y5VC 2UV3A 4OGZA 4S0TD 3WIHL 1UKQA 1F2XK 3MLPA 1CICA 1JGDA 1T21B 4N0UE 2BHUA 1PKOA 5BVJA 4JRXA 1CICB 1JGDB 2AV7A 3MCKA 1AQKL 4JFZH 2VR9A 4UT9L 1UXWB 4KZDL 3LS4H 1WEJH 4TNWK 4WY7H 3OXSB 1OTSD 1V8HA 3RWFA 1MFEL 1YN6B 4N8VG 1DEEA 2X4UB 3LKPA 4DOHE 5C07B 3QQ3B 2AW2A 1I1YA 2R1YB 4EI5D 5IG7B 1LILA 4BQ8A 4NNXA 5HVFB 3ZYOA 3VXSE 3Q5TA 3F58L 1IGYB 5TF0A 2LTQB 1X7QB 2BNRA 1X5FA 2D2OA 5DD5H 3QISA 3TBWA 5IQ7L 1RUMH 1J0IA 1IAKB 2P24B 1IT9L 4MAUL 5GGRB 4MLIA 4S1QH 4OTXH 2R0ZH 1HNGA 4JDZB 1CTOA 1BFVL 3QI9A 3WNKA 5IW1B 1N5AB 3SE3C 1UC6A 2EDWA 1IC5H 2C9AA 3CMGA 4F33B 2PW2B 3WEXA 2NY0D 2QQNH 2VLMD 4ISVB 2VIRA 5I1EL 1MRDH 1UM4H 2ITDB 5E9DE 3WUZA 1VADB 1UQSB 2R1WA 1JF1B 2BVTA 1NPUA 1H3UA 1QRNE 4ZQKA 2R69H 5GIRA 1KLGA 1M7IA 4HPYH 4NOFA 4W4NA 4NKMB 1CDJA 3IJYA 4OLUH 3MNZB 5FCSH 2EIBA 4Y19A 1TMCB 1CGWA 3JV0A 2X4PA 2YD9A 4HUWA 4N90E 4PJ7B 2RCSH 3QDJA 1TCMA 5JHDB 4XMPL 1B0WA 1G7QA 3CH1A 5DO2D 3S35H 1MHPL 3R0MA 4HWEH 2BNQD 5I1CH 3DUUA 5HTSA 3C8DA 2YN5A 1A7BA 1S8DA 1OAKL 3LPWA 1OB1A 2RJMA 3CSYA 5GGRY 4ZDHA 4L4JA 4NQTA 4OF0A 3VFSA 1HSAA 1M6OA 2AGJH 1KTRL 2FSEA 4FQXC 4IRJB 3W9EA 4NQUA 3BKYH 3RZCB 3IB4A 5IP4A 4YHPA 3PGDA 3B9VA 4KJPC 1QSVA 4XTRC 1OAQH 3GBLA 1KENL 3CDYA 4KROD 1XAUA 4NGHH 3H9SE 2K7QA 1NMBH 1YEHH 1MF2H 3W5MA 1KFAH 1LGVA 3OB0H 5B4MC 4JHAH 2ARJA 3TH3T 3U46A 4MA8L 3S9DB 5CJBA 4B7IA 1NBYA 4NHCH 1EAJA 3CNKA 5C86A 5EU3B 5F7DA 4NJ9L 4NO0B 3VFWB 5K59E 3MJ7B 4L1DA 2E7HA 1T1WA 5JDSB 4Y1AE 3RP1A 4P4KA 3VFPA 3ARBC 3ULVE 3X11B 1YUHA 1JYNA 1EVUA 1AH1A 3NZ8B 5EDXA 3O3AB 5IF0A 12E8H 1AY1L 5EOQH 3IXTA 1IEBA 3OHXA 5DFVC 4NO3A 5FYKE 3V7MA 4FXGB 3PWPD 5E1AA 1J1XL 2AABH 3H6JA 4ELMA 5CEZD 1NBYB 4NHUA 3KJ4C 3ULUD 1EMTH 4KI5F 3WKML 2BSTB 3CIQA 1X4XA 3QZWG 5HGAA 1T89A 4ESKA 1SBSL 4XP4H 5DO2C 5A16B 3WFDL 1DUYB 4NZDA 3NFSH 1ZT1B 4POZC 3GI8H 1DFBH 5D71H 4U1SB 5F1KC 2A6DA 5FUZL 4OLZL 3HI5H 1M7DA 3L5JA 3QBTB 4JFQB 3C2SA 3D0LB 3RUGA 5T1MA 1OAYH 1NBVH 2PKDA 4DJMA 1MCDA 1XGPA 4KJQC 4U05A 2B4CH 3GMOA 3QHTC 4TSCL 4JY5H 2F8XC 2CKBL 5E24E 4ORZC 4I3SH 4WHTA 1G7IA 3O4OC 1E4WH 3UP1A 5DQDL 4D0DA 4L4VD 2IPKB 3SDDC 3EZ8A 1JWUB 4HXAL 4HWUA 3B5GA 3NPSB 4LAJH 1YY8B 3WCYA 4HWBH 1DBJH 1P7HL 5ESAB 1GAFH 4S0SD 1D5MB 2OL3L 1MHCA 2CGRH 4NCDA 4NDMA 3W11D 4OKDA 4XP6L 5DUBA 1JP5A 1CL7L 5C0AB 4XCCL 4ODHL 4TPRH 4FP8L 4D9RD 1IGYA 4XB8A 1R5WB 2G5BA 3MLWH 4R97C 3UJTL 3FAWA 4F9PC 1OTTC 2R1YA 3FRUB 2EXYD 1T0NB 2XA3A 3QXWA 1N3NB 3JV4A 5SWSB 4MNHB 3RDTB 2VDNH 3CD4A 3RWFB 1H3WM 1I3RB 3MQIA 2Z0BA 4TVPD 4FG6C 2V17L 1U2CA 4H1LG 3KPRE 5GS0L 2BJMH 4LRNL 4DKAA 2X1WL 3S96B 2GJ6B 3HFML 3ILPB 3IXTB 5I73C 5HJ3A 5BJTB 1ITCA 4X6BB 5BS0A 3G5XB 5GSVA 1E28B 1L7IH 3BD4A 4LIQL 4QRQB 1DR9A 2VERN 1AKJA 2VDOH 4PRPB 3QDGA 1NCCL 4GKNA 4UNUA 4PJCB 3VI4E 3VFRA 1HHIA 1VKXA 4JRYD 1QFPA 2HFEB 1GGBH 1BVZA 2ADJA 5MHSE 1M05A 4R2GD 1FVDB 4H8WC 3C5ZC 4HCRA 1G9NH 4Z7WE 4IBLT 4PJFB 4WUKL 1MHCB 5I76B 4G8IA 1R3HB 3G9VA 3LHPH 1T1XB 1JPTH 3VW3H 2GT9A 2EC8A 2YPKA 1JUFA 5F89B 1MY5A 5IWLA 4JFOB 1QFWM 5IVOA 5C3LD 4YHZH 3OAYH 4O2CA 1UWXK 3BGAA 3HRZA 3QFJD 1CFQA 2IANB 1HIML 1FO0L 1Q9OA 2BVPB 3LD8B 1RVFL 3IETA 4G8FA 4IJ3C 4UIKL 4Z7QE 1FCCA 1JV5A 5IJKC 1FIGL 1BWWA 3LRGA 5D70L 4XC1L 1T1ZA 5JUEL 1WBZB 4L3EA 4U1NA 3N0PB 2BHYA 4WO4C 2Q7YB 1YEEL 1N2RB 4OBSA 4U6VL 4GMSH 3QFDA 3FT4B 4DQOL 4PG9A 1TVBA 4WJ5B 4BJLA 1CZ8L 4GAGH 3UTPE 5I71B 3NCFB 3QEHB 5I75B 4FFZH 2B0SH 5A16A 2G60L 4U2ZA 5D8JL 3KXFD 1K8IB 1XF4B 3VDCA 3B2VL 1AXSA 3ARDC 4O9HH 2NW2B 3VMPA 3ULVL 1T7VA 3O2VL 4OGYH 3MV7E 4EJ1C 3GSNA 4FMFA 2V2XB 1TJHH 4XBPA 7FABH 1N5YL 1NC4A 4ELMB 5E7BA 5JW4R 5CJOL 2YSSB 3TO2A 4UNVA 2Q3AA 3CZJA 2ILLA 4NNXB 1NBQA 3L1OH 1NGYB 3HZKA 3IDXL 4MXVE 2R2HB 4PYGA 3RX5A 1MRFL 3PWUA 3QWRA 5EPMB 1ZHLB 5F7EH 4Q6IC 1CR9L 2NY4C 4U1GC 1X44A 2IWGA 1MJUL 3DX8B 2I9TA 5AZEL 4L8SA 2NY4D 1T7ZA 3BH9A 1UXWA 2FHCA 2JB6A 3KPMA 4UQ3B 3GI9H 1A4JA 1KJMB 5J89A 4LP4A 4YFLI 3IDIB 1A0QH 1C5CL 3BD3A 4DW2H 2XN9B 5IB2A 4KTDL 2XA8H 4XP1H 4FOMA 2OS7A 4JO3L 5F7DB 2EO1A 2VWEE 4WO4A 1EO8H 4PJHF 4FQIL 1FGVH 4JVUA 2MWCA 5IEKA 3IVKA 4AZ8A 1RZIB 3O2DL 3T2NL 4RGNE 1XH3B 3DX7A 2VXUL 1HZHL 3EDEA 43C9B 1IAII 1ACYH 3GEWB 4R6UA 1V7NH 4JPIA 4HT1H 4PYHA 5DEFA 1T03H 4UTBH 3UTSE 1HINH 5HGDB 4NC1E 1EA9C 3RIFF 3DBXB 5A2IH 1KB9J 3GKWH 4JREC 4OIIL 3ROOA 1WTGT 1MUJA 3BVNB 5FHBL 3DUHA 1E4KA 3LKNA 4F7TA 5IB4A 2B39A 3KPSE 3BZDA 5IVZB 3S98A 4XVTL 2DQFA 1WC7A 4LCWE 1FAIL 1BJ8A 1I9IH 1CFTB 1J86A 2ADGA 1R5VA 2GTWB 35C8L 4KRPD 3O4LA 1FFPB 1HHKA 2X9YA 4G80B 5ABDE 4GW1A 5EU7C 4G42B 2WUCH 4P9HC 1FL6B 2ZUUA 5C0DB 2VB5A 4JB9H 1CF8H 3ET9F 5K9QG 2V5TA 5C0DA 3G6AB 2R1WB 3JWDH 3S36H 2VLJA 1OCWL 4GSDH 4GKOA 2X4SB 3O3DB 1FE8L 3GMLB 4G6KH 4XZUB 4Q9RL 4HX1B 4MJIA 1FLRH 2PTTB 3BXNA 5ESVA 2CJUL 3FHQA 1MCKA 4WI4A 1BMGA 4R4BA 4ZSOB 3QEGH 3PIQB 3ULSB 1YEKL 5DEGB 4ZAKC 3OTTA 3ARFA 3LPFA 3HA0A 4UV4L 4M03A 2XPGB 5BV7H 2UZYB 4OD2A 4DOHB 1R3LB 3RIAK 1R6VA 3VXRB 5IFAL 3EJJX 2FB4L 3NIDE 1RJLB 4CUCA 1IZKA 4QHUB 4FABH 5I1GH 5DEFB 1BIIA 3IDGA 3VH8A 1RZFL 5D6CA 2KBGA 5KSVB 2P7TA 2XTJD 2DJSA 3BPOC 3VFGL 5J13B 4FQXB 3MZGB 3RKDC 3CFDB 2BNUA 1R24A 5T1KB 3HI6L 3O6ML 5JW3H 4XBGA 4POYA 4X7EC 2QQLL 4ODSL 5ICXA 2CMRL 3GIZL 4RWYL 3HNVH 2P8LA 4IRSA 2DBLL 2W60A 2C7UB 1E4JA 1OWRM 5EN2A 2FD6H 3PP3H 3TYFA 5I30H 5GRXG 1SY6H 4G8GD 4XRCA 3MUGA 2Z8VC 3F65A 1SJHB 3ZE1F 1XZ0A 4MXQD 3KPPB 1TITA 3GIVA 4NQSA 4YBLB 4PJXB 2I60L 5I8OH 3LKOB 5LAXB 1RPQA 1OPGH 1ADQH 5C0FB 2G2RA 1IGCL 3MXWH 2CPCA 3FKUS 3JVGC 2ZUTA 3N50A 3ZDZE 1Y6MR 3H3PL 5M7QA 2AXHA 1LVEA 1JYXA 1NSNL 4PJBF 4OM1L 3QHFH 1OSZB 1WISA 3LMJL 5FO9A 1Z2KA 4N68A 1WAAE 1ND0A 3SBWC 3PGCA 3K8MA 4XRCB 4OQ1A 1KCLA 1WSST 3WLBA 1KXQE 3KLHC 2I25N 3SJVB 1F02I 3IFPB 4TTDC 4PG9B 2DM2A 2MHAA 1OGAE 1KACB 1HHGA 3MFFA 2F53A 3QIUA 3VGFA 2Y06H 3QPQD 1Q9WA 4XNXH 1EJOL 4G8EA 5TH2B 4YDJA 2CDGB 1HYRC 5F6IB 4GUPA 3L3HA 3TZVA 3I2CH 2OZ4H 3FL7A 3SQOL 5BQ7A 4C4KO 2ATPA 3JTTB 2W91A 4POZD 3DETC 3U9PL 2HJFA 5FOBA 2A9NH 2QKIA 1U91A 2D7QA 4NC1C 1IKFH 5BRZA 3O41A 2DN7A 3ISWA 3ZDXE 4XPHL 3K0WA 3FJTA 4JG1L 1T2QH 3KJ6L 1FZJB 1I3GL 4WEBH 5F7WC 4DGIH 1QKZH 3O2WL 4QY8B 2AV1A 4KMQA 1JPSL 3W0WA 2WBWB 4UUJA 4PJ7F 2BX5A 4WHYH 3UXFA 1N0XH 3UTZA 4Y4KC 2NMSA 1Q9WB 3M8OH 5DA4A 3F7QA 1A14L 4DAGL 3IVKB 3O6LL 1QBAA 1V7MH 2CO6B 4WW2B 3VGAC 5BZWA 1NDGB 43CAA 3P4NA 1A9EB 2CLVA 4M93B 4YZFF 3BH8B 5IW6A 5F44A 3P4OB 4NKIH 2X89D 2VDQH 2ZUQC 1OARL 5L0QB 3ZMRA 1MCOH 5LGHL 2AS5M 4M43H 5MI0B 5A2KH 1JVKA 3T3PE 5LGJA 2VLKA 1CXEA 2GY5A 4GW4A 2H32B 2R4RL 5B38A 4S1RL 5BZDB 1IGIL 3ARSA 3P9LA 4CADB 3LKNB 3QCVL 4Y16C 3EYUL 4XI5D 2AEIT 4P46A 4LGSB 4KROC 1A7PH 3T3ME 1X5KA 2BSED 4CDHA 3CVHA 3P0YL 1U3HB 3G6DL 3RTQC 3QNYB 4XPBL 4N8VB 1MFNA 2DD8H 3X12A 3AREA 2MKLC 1PKQE 4KDWA 3FB5B 4JM2B 4TUKH 5HHOD 1YEIL 1YNTB 5H35A 4DN4L 4OCSH 1I1CA 1J8HD 4MJ2A 3K3QA 1UA6H 1BZ9B 5DUBB 5F9WB 3STLB 1MJ7H 3T2PA 4KJYB 1FNEA 1LO3H 3RVVD 2D31B 1BLNA 4N0CD 1IJ9A 5GS1B 4P46D 4C83B 1I1FB 3O3EB 1OM3L 1RUPL 1J88A 1A6TB 1QZ1A 1KBGL 3GSVB 1JIBA 4J1UB 5GRYA 2V5MA 2CKBA 5SX5K 1JL8A 1L6ZA 1AGEA 2NLJA 3M17B 3HNTL 5IKCB 3HCVA 4HUXB 5ESQA 4H20L 4Q74A 5I16A 1OAZH 4FXLA 5I1HH 1I1RA 4JDTH 3SDYH 1P53A 3H7BA 5D7IB 3T8XA 1CFQB 4K94C 1GGTA 1KLUA 4OM0H 1JHLH 2DLTA 4O2FA 1EZVX 4WTZA 1A6ZB 3Q2CA 3MZTA 5IVXF 4HS3B 5DEGA 3MO1B 4P4KD 4V2CB 3QWOB 3NCEB 4KHXL 1FYTE 1QFOA 5ILTH 4NZUL 5CS7A 3OMZA 4ZUWA 2OK0H 5CGYC 1NL0L 2W92A 4Y4HA 3S3SA 4A6YL 1YNLL 4UQ2B 2GUOB 3U30B 5DJ0B 1MIEL 4G5ZL 1ZT1A 1U8NA 2W65B 5FYLH 2YPLB 4F37F 5E99H 4QXGL 5GISL 5E95B 1SEQH 3R06A 1JI2A 3FCTA 4LCUB 5HGHA 4P3CH 3VXTB 3ZHKA 1I1AC 2QJDA 4L3EB 4ODVL 5IMLA 1T1ZB 4ZXBA 2VLRD 2EKSA 4KV5E 4Y2DB 2BSTA 5E5MA 5I1IH 1MFAL 1C16A 1A7RL 4MD0B 3FT3B 5D96C 4QRQA 4Y8DC 2C26A 5E2WL 1FVEA 2HG5A 1DUZA 4MX7B 2EYSB 4MQSB 1LEGB 1JNNL 5EZJA 5CIPB 4FMKA 1D9KD 1RU9H 1W0VA 2JCCB 3T04D 15C8L 2X7LB 3QG6A 2JJWA 3UTPD 1NCAL 2OXGA 4XMLL 1UJ3B 4P5MA 2OLDA 4IMLB 5SWSA 3RDTA 4Y4FC 3VWKD 5E4EC 2IADB 2FJHA 3LS5H 4YZFE 3UTTB 5IVXB 1DSFL 1MJ8H 4PJ5D 3STZA 2E7MA 1T1XA 3DMMD 3WXWH 43C9A 3P73B 2ARJB 1ONQB 3C08L 1CLOH 1RZIA 5FDWA 3V5KB 4NDMB 1K9TA 4G9FD 2ZPKL 2WBJD 4PV9B 5EZIH 5I8EB 3UBXG 1WT5C 2P44B 4XP5H 1W8NA 1RHFA 4LU5L 4YHPB 5D7JA 3C5SB 3HN3A 4Q9BA 3K2MC 2BP3A 4XCNA 4NQDD 1M6OB 1XGTB 1NH6A 4NO5B 2XWJA 3QG6B 3O8XC 3CSYB 3CSGA 4KI5D 1XR9B 3HE6B 3HNSH 1XGQA 4ERSL 1IEAA 3FQXA 2Y07L 4XXCA 1NGYA 1HOCA 1DUZB 4ZFOB 2JJVA 1T5WA 1I3RA 4LEXH 4DK6A 3FB6A 1JRHL 4NJAL 4LVEA 3O9WD 1Z9LA 3NH7L 4OSUH 3OX8A 2AJUL 5C7XL 5CEXA 1RZ8A 4HKXB 4RMUA 3QPXL 4X9FA 5DGRA 4Z95H 2NY6B 1R5WA 2X6MA 5DWUL 3DGGB 3ZT6A 4GRWF 1IGTA 4GRMA 3BIBX 1LP9E 2O5YL 3CC5A 1S3KH 5L6YH 5TDOA 3BP4B 3VXOA 2J8UA 5ISZA 4JFFD 2YMXH 1S7TB 4P0DA 4P48A 4OZFG 4NQDB 2DKMA 2PW1A 1J7VR 3BFOA 4ZAKD 3GMMB 3LB6D 2NTFB 3QUKB 5GGUB 3VA2C 5C0BD 1J1PL 5K59F 5F96L 4NQED 1ZLWK 5TQ0H 2PTVA 3LPGA 1KOAA 1TZIB 4S2SB 2VR5A 4N8PA 2APWA 3REVB 2P43B 4FNLH 3HI1A 5GRVK 1BBDL 5C07A 1GOFA 2I07A 5T5NF 1L6XA 4XHQA 3IFLH 2V7NA 2XWJB 4JQVA 5DURD 1QA9B 1XGTA 4WFGD 1QYGH 1A7NL 3DSNA 3ZO0A 5D7JC 1Y0LB 5CD5C 2W9EL 2ZKHL 1S9YB 1F3JA 4Y4FD 2AJVL 4JGMA 1AXTL 4Z8FH 1I8KB 1JK8A 4LHQB 4N0YH 2E9WA 1CDCA 3PXHA 4NNPL 1KCSH 2E7LC 4X6FB 5EOCH 4D2NA 4LCIH 5JNYA 1MEXL 4G9DA 1KGCE 5DK2B 4PRIE 4UOW1 4MVBD 4WHCA 4ZPTA 4Z78B 3MFGB 4GAJL 3MRHA 5LGKA 4TNVF 2IF7A 1HCVA 3VXUB 5EIIA 1FLTX 3ZDYE 1W72B 5DC0A 4L3ED 3OZ9H 1XF2A 5C0RH 1MFDH 3B9DA 1XIWB 2DQGL 4LLUA 1MQKL 4LSPH 3VFSB 4HGMA 4ODXB 2OJEB 4LVHC 5IFHL 4JZNA 2IFGA 2DQJL 1AFVH 3O81A 3BP7B 5DD6A 5ISZE 3MRMB 1XCQB 4PJ9B 2F5BH 1IM9A 4V1DA 1UEYA 5BZDA 3JWOL 3ZE0E 1G7QB 2J4WH 3CH1B 3RAJH 3NCCB 4X0KB 3KHOA 4PJ7A 1YN7A 4D8PB 2EIZB 5GGVH 2Z31B 2AP2A 4X4XB 1T0NA 3WHXB 1IGFL 1IRAY 1I1AA 5AUMB 1CGSL 4ZOCA 3SJVE 3QDJD 4ZQKB 4Y88A 4OZ4B 4Y19D 4ODWB 2NR6D 1JGVL 4LL9A 1DVFD 3H9SA 2XQBL 2VXVL 5IMMB 4HFWA 3KPNA 2X10A 1DDHB 1LDPH 1JGLH 1S7TA 4OBRA 3S5LA 4LIQE 1KJ2L 3SCMD 1ZWIB 5KSBF 4TTGA 4QHNB 4KK5C 3OJDB 5GGQH 1B0RB 4GBXC 1S5IL 1VCAA 3MLXL 3S35X 3MXVL 2WV3A 1YEJL 3KJ4B 3VXSA 1NEZA 4EIGB 5ESQB 3V8OA 4BZ2L 1DE4A 5DS8A 3LVEA 1UJTA 1R3KA 1I7TA 5DJ6A 2I24N 3EDJA 5DJ8A 4GUPB 4GQ9H 4M6AA 1BP3B 4N5UA 3DX9B 1A6WL 2VQ1B 4B53A 4JKPL 4IDJH 5IR1A 2IALB 4NBZB 4K7FB 1ZVSA 3A6BH 5HHPB 5D9SB 5I66B 5ICYA 1T66C 2VLRA 4XCNB 5FK9B 1TJIL 3EHBC 2BVOA 3TBSA 4CNIA 3SCMC 3FTGB 3VFVA 2HT4D 1QHOA 1AKJD 1FC2D 4JZJC 1IGJA 3PL6C 3ECBB 4XVSH 2C3WA 3BN9D 1CD1A 1X6NA 3GSOA 4M1GL 4UV7H 4XAWH 3U4BL 1J5OL 4LCYA 2YPLE 4QRRA 1FPTL 2R29H 3SE4A 5E1AB 2B1HL 3VWKA 2NZ9C 3FQTA 5I8KL 1JZ5A 5DMYA 3CXDH 4HW6A 4F7EA 1AI1H 1HWHB 2WBJC 3GO1L 4PJAB 1UWEL 1IQWL 5F6HJ 3QQ4B 1OLLA 1R3IL 4NZRH 4NUGL 3VWJC 4HBCL 4C56E 5DHYA 1T20A 3SE8H 2NXZD 2OQJA 2BMKA 3UBXB 3MLRL 3VCLA 2OXHA 4JRWA 4WHYG 5HYSA 43CAB 1BGXH 1R5IB 4Z7OE 1DLFL 1G9MC 3AB0B 3V9FA 5HHMB 5K9KA 2DI7A 1A5FH 1NFDB 3B83A 4M61A 3TYGL 3DX9A 3UTTE 3ZDXF 1HDMA 1CIDA 2ADFH 1PX3A 4NO2A 2R2BA 3MYZA 1D9KC 4RGMC 4HFUL 5I19H 4I0PD 2I9LB 1AIFB 5TF1H 4PPTA 1JBJA 1WZ1L 5ITFA 1CFNB 3C8KB 4XMKL 2FIRT 5F6HI 4ACPA 4FQCL 1ZLVK 1B0RA 3S37X 3QNZA 5FGBC 2HRPH 4DUXA 2IAMC 1NFKA 1TZGH 4AQOA 3ARZA 1WZMA 1FH5L 1AO7B 3U0PB 2F8VA 4RA0C 3ULUH 2EO9A 4IMKA 2YD6A 1HDMB 2F19L 5C08D 2RHEA 4YHOH 4HDIA 4KTEL 1SYSA 1CU4H 5IHUL 1MVUB 4F7MB 2ITCA 1BD2B 4GXVL 4OB5L 4EN3A 1S7WA 4OIBA 5IIEB 4ODUB 1BPVA 4L5FH 4YHIA 2UUDH 3NCJL 4LNVA 4OQTH 3SJVA 4R26H 3RWHA 4W4OC 1J0ZA 1R0AH 6FABH 2FNBA 1YN7B 5DD0L 3QQ4A 3CFKA 4OZFA 4DN3H 4M8QB 4MXQC 3RHWF 4G8GB 5D72L 1L9MA 4N0RA 4OZHB 1BIHA 1J05B 5J06A 4NPYA 5LKNA 1E4KC 1QFUH 4ZUTB 5HDBF 3V4UL 1EEUA 4U1GB 2CQVA 3M07A 4XHJD 1T89C 2C3HA 2M8XA 1KEGH 3SGKC 3ZKMC 3FT2B 1GZPA 1DBKL 3ABZA 2BSRA 3PQYD 4WI9A 5CJ8A 3UDWA 2DQHL 2Q8AH 1ORSA 4LLAA 3RVVC 3SGEH 4G6AD 4U3XA 4LLMA 4DZ8A 1KT2B 2IJ0C 5KS9A 5BOZG 3P9LB 4CADA 2VLKD 3GBNL 4W6WB 3KDMB 1RIUL 5FUCC 5BRZD 4GKZA 2NXZB 3GFUA 4LGPB 5AEAA 5DI8B 5EUOA 1VACA 2MKWA 2A9MH 4JKLA 2X4QA 2JIXD 3BH8A 3JV6A 5D6DC 3HRPA 1ZLUK 4OD1L 4JM2F 2KKQA 1BIIB 3IDGB 2GFBB 5EPMA 1H3PH 2H3NB 5F7NC 3S37L 3HUJE 3TA3C 1BZQK 1CYGA 3MRKB 1RFDH 3BEWB 2DKSA 4NC2B 5CSBA 4HDIB 3VXSB 4UB0H 5FB8A 3L3IA 3V0WL 1GZQB 4OLWL 5B21A 4JZJB 2GJZA 3ARFB 3ZKQD 4PJXE 4F8TA 2P5EB 2FX9H 1GHFL 2Z91B 3SGEI 2BY0A 4ONGL 1U8MB 2NY1B 4X9BA 3GJFB 4XVUD 4JQXA 5ISZB 1AD0B 1RUAH 5TGBA 4K2UH 2GFBA 3CC5B 3OKOA 3QFDB 2W0FB 5E1HB 4EKXA 2CIIA 3F6LA 4L29B 3TN0D 1K6QH 5BO1H 3B43A 3KPSA 4JFDB 3NIGE 3SCMA 4HKXA 5FA4B 3D18A 1ZHBB 1IMHC 3U7YH 4H26B 1NAKL 5CUSH 2Y6SC 1LP9A 4X7TB 1MI5A 2B7DT 5K9KB 3HB3D 4C56D 5I1KH 3WDIA 3G5YB 3KDMA 1T22B 3CZFA 4YFLF 1ZTXH 1KT2A 1XGUA 3CUPB 5DHYB 5HI4C 25C8H 2VABB 1UB5B 4OAWB 4D0BB 2X44D 4LK4A 5C8JB 3C60A 3MCLL 5FO9B 4BSWB 3L7EB 4JFOA 1RZKC 3EO1B 3IU4H 1KCUH 5D7SH 1GZPB 1AE6H 4BH8A 1VPOH 2Q1EA 1OAUH 4U0RB 5EOTA 2FCBA 5IROA 1I9JL 5E2JA 2HFGL 5I8EA 4J12A 3HUJA 1G7PA 1FDLH 1PSKL 1QLRA 4QRRB 5D7LA 3NVQA 2EYTA 4HS8L 3BUTA 3GSOB 2K7PA 1G0YR 4PRHA 5ENWB 4JQIH 2VE6B 3RVUD 3RGVD 4KK8C 1RZKL 1KB5H 3VFRB 2D03H 1KELH 1S9YA 4UZGA 3JWOC 2BC4B 4Q7DA 4Y5YA 1KIPA 1EUUA 1IL1B 1RHHA 3ARDD 1H8NA 4AEHH 2FO1A 5F7KC 2X4TA 2DIJA 4Y2OA 4EN3B 3ULVF 3EOAB 2R0KH 3ZTJG 3IRZA 4U6YA 2BNUB 4F7MA 2EYSA 1EAPB 2HWZH 2I26N 5GRUL 1HH9A 3T65B 5ACZA 5HYFA 1A21A 2IG2H 4DTGL 4AMKL 3K4ZA 2WIIB 5HD8D 2V2XA 1FNSL 1Z3GL 4Z0BH 5T3XE 1LO5B 1P1ZB 4H1LH 2PCPB 4QO1A 2CSPA 1A1NA 4LCWB 3RTQD 5BMFH 3GMNA 1T7WA 5SV4A 3CK0H 1S7RB 5FXCH 4PRNA 5L9DL 4HAFA 1B9ZA 3C8KA 5C0GB 2FBJL 3P9WB 2JF1A 2DQTL 3GK8H 4Y5VA 2I9LA 3NOIA 5DRZB 2Y9RT 5E5UB 1A7OH 3BZEB 4P9HL 2XN9E 1MRCH 1TZHB 3TIDA 1FG2B 4J3OC 4P2OD 5ADOL 3LH2H 5J56B 1BEYL 1PEWA 2IPKA 1H3TA 5J11C 5IB3B 4NN5C 4QGTA 3UMTA 3KR3L 4YXHH 2B20A 3G9AB 4ZFOA 1D7FA 2W1NA 4M6ML 3DROA 1YMMD 2XZCH 3SGKA 4IMKC 4I13B 4M62H 1UADC 3TBVB 5ITBL 3AY4A 4J1UA 1HILB 3GSQA 3WKNA 4W6YB 5ALCL 1QBML 5ISZD 3FHAA 1JMZA 2WMPA 3TO4B 1CXFA 1JGUH 3GUTB 4DUWA 1ZLSH 4LOUC 1FBIL 4S1DD 4Z18A 2P5WB 2VUOA 3NGBC 3QDHA 3QG7L 1KXVC 4X9GA 1OSPL 4P9ML 1NKOA 4KRPC 2AERT 1WICA 2YD7A 3AMLA 5EH1A 1KCRL 1NLDL 5CINL 3O9WB 1HEZB 3D0VA 3BRDA 3EDDA 3ZKXB 4CN6A 4NHUB 2R4SL 1CFVH 4AENB 2E6QA 3KYOB 4K8RL 3WNNA 4C56A 4CVZA 4W70A 5GSVB 4K7FA 1NMCC 3ZYZA 4O4YH 2GJ6A 4JAMB 4OD3L 4F57H 2D7TL 5CZXC 2BNRE 4QHMB 5GGTA 4R0LC 3D69B 4MA7L 3UBXI 2C3XA 5A3IC 5KAQG 5L88H 4MJ4A 1FFOB 3CH8A 4S1SH 3RI5K 1AR1C 1ZHLA 3V6OC 5IMLB 4WFED 5JXED 5FYKU 2YHGA 3VFWA 5F88A 1D9KA 1F6AA 3SE4C 4HIIB 4E41D 1NCDL 4G9FB 5D93B 5IB5A 4YBQC 2OR8A 1K5NB 5L0QC 4HLJA 4X4YB 1EX0A 2C3VB 4R96B 5FA3A 5IHBA 4PJIA 4BA8A 3H42L 2ED8A 4IIQB 2O5ZH 1FQ9C 5DZOA 4UINH 4FFYL 1U6AH 4IIQA 5C0CE 3MTRA 3HPLB 2R56L 3BPLB 1UFUA 5DJDB 5I74C 1M71B 3T0BA 2FSEB 2ZG1A 4U6HB 5GGTL 3NCMA 5L7XH 4OF3A 4WDIA 2Q7YA 1G1YA 3QH3B 5EO9A 1D9KB 4HC1L 2OJZH 2FRGP 3WHXA 2CR6A 5I17B 4EIZC 1QVOB 1TVHA 1WK0A 1AGCA 2A6JA 3H9ZA 3HLAB 4JHWH 2EDEA 5C6TH 1MH5B 3BWAB 5DQ9A 4ZTOL 2YD5A 3HB3C 3D39E 4N1CA 1U8LA 3L9RA 3LN4B 2R2EA 4G43A 3SOBL 3QRGH 4GFTB 1DQQA 3QDMB 3QYCA 4PJ5E 2IPTH 5F9WC 5CAYB 6CGTA 5KVGL 4JAMA 4PJ8B 3SKNA 1QPPA 4EDWL 2W9LA 4UILL 5BS0D 5EORL 4MNQB 1CLYH 1AO7D 5FCUH 4U6HA 1D6VH 1UQSA 3X14A 4U1HA 5I15H 5TPWL 1NCWL 4Y5YB 1CD9B 4NKOB 5D1QD 4OZHF 3RQ3A 1QUNA 4W81A 2IQ9L 5E9DD 1SYVA 4XBEL 4K3JH 4JM2A 4QXUL 2CLZA 3AREB 1K3IA 3L6FB 1EBAA 1RK1B 3CGTA 3IS0X 1BECA 3I50H 5FKAB 4X6EA 1TFHA 3NFNB 4LCCA 4LASH 1NMAH 5F88B 1G7JB 2IFFH 4K3HA 4PJCA 2X09A 1NANI 2GI7A 2A1WH 4KKBC 4M6NH 3HTLX 2X4UA 3KYMA 4LSUL 4OV5A 5BXFA 4AL8H 1KIRA 4FQPA 2R0LL 2QADD 2JJTA 3C60B 5MP6H 4GRWH 2GITA 1N26A 4R4FL 5GS3A 3VRIA 3E6FB 2VXQL 3HI1B 4OCXL 1A4KA 4JR9H 1WCQA 3GMRB 3N1QC 5IB3A 1WWBX 3MLZL 2VDPL 2FHBA 5J1SC 3U46B 4MNHA 4JE4B 5HYQA 5DK0B 5F70A 4EOWH 4R8WH 4FQXA 5B8CC 1V05A 1F90L 5AYQA 5FO7B 2F54A 1ZV5A 3VG9C 4KZEH 5C71A 2LU4A 5HDBE 1F3DJ 2J8UB 1FZJA 5EOCJ 4OZIA 4HJGB 1BF2A 5E2TH 5EBWB 5K9OA 2DIBA 3GUTA 2A83A 5JOFA 3PP4L 4IIQC 2VDKL 2H6PB 3I02B 1T5XA 1YECH 4NZTL 2CUIA 5EUOE 3WFZA 4POUB 4Y7MA 1S7RA 2XPGA 3QUXB 3SDCA 4RISL 3VXRE 3PV6B 2CIKA 5F9DC 3S34H 5DTFA 3ROLB 4H1LB 2YD4A 3TT3H 3BSZL 3CLEL 3U7WH 1B4JH 3MO1A 3QQNA 5EWIL 3LKSB 4RRPA 4HIXL 2PNDA 3SGJA 1VA9A 3O6KL 3BXNB 3NA9H 4GAYB 4M7KH 3OKLA 4ETYA 2FEEL 4N1EA 3BRFA 1DL7H 2DL9A 3C5ZA 4TVPL 3I6KA 4X8JB 1GIGH 1IM9D 5ICZA 4MCZA 1RQ5A 3PHOA 3WE6A 1KN4L 3U48A 1IKNC 4ODTL 2UYLA 3VFTA 4P2OA 3QEUB 1YQ2A 1ZVYA 2J3SA 2XY1A 3MOBL 1FYTD 5C07D 4G42A 4NC0B 4M7JL 3PWPA 3DGCR 1TZHA 4PV9A 3IJSB 5CBEA 2ZCHH 4IDLA 5EA0H 1ZT4B 2EICA 4LPCA 3HMXH 5T33L 1HQRB 3EOTH 1ONQA 4KUZH 2J88L 3Q6FB 5ETUA 5D7LB 1ZK9A 2NXYD 4HGWB 4MMZC 1C12A 1F8TL 4KKLD 1N59B 3FB5A 4XAKE 4HIEA 4X98A 5IWLC 2EDFA 2AJSH 1M1SA 1SVCP 2JCCE 4YX2L 1XFPA 5F9OH 5D96B 3BDBA 4O2EA 1ORQA 1WCBA 1VENA 4YGVB 3TYFB 2AV7B 3BAEH 2ICES 3CCHB 5E03A 4CU7A 3QA3A 1YNKH 3LN5A 5E9DB 1T21A 2MQ0A 5SWZB 1CWVA 2NXZC 1JNJA 1Z5LA 3PG2A 3VGBA 1JN6B 4LARH 3BP5B 3CFDA 3JXAA 4H26A 4F9LC 2GKIA 2DMCA 3SE9H 4NO0A 4ZS6D 3QZWB 4JM4L 2UWEB 5BZWB 1NGXA 2X1PA 2YPLA 1BD2A 2Z35A 4QHLB 4QXWA 2OZ4A 3FO0L 4FQHA 1NAML 3ZL4H 1GVIA 3GSUA 1N64L 5IGXH 2RGSA 5ALBH 3KPQB 3BKCL 4LRIC 5KSAD 3CMOH 5D5MA 5DC4B 1JPFB 4DEPB 1T3FB 3BZ4A 3QWOA 4XNZC 5EOTB 2Q3ZA 4NBXB 4PREA 5EU5A 1DN0B 1VFBA 3KAAA 2EYRB 2OR9L 4EDXB 2HN7B 3TBYB 4B50A 4HX1A 1UWGH 4MJIB 3QXVA 1X5LA 4JFXB 3HKFA 4BSJA 4MQ7B 3MOAL 5I16B 2ATPB 3EJYD 4NM8H 3SDAA 5IK3A 3HC4L 2APTA 3T0XA 4GQPH 4YXKL 4DGYL 3L3HB 4X9HA 5BW7A 1KTDA 2IH1B 3UYRL 3FMGL 4XTRD 1NCBL 1LP9B 2GJJA 3P0VL 4YDJB 3OAUH 1U8JA 3DO3A 8CGTA 5DI8A 3IJYB 5EUOB 1XIWC 5FV2A