5GISL

Crystal structure of a fab fragment with its ligand peptide
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
211
structure length
211
Chain Sequence
DIVLIQSPATLSVTPGDSVSLSCRASQRISNNLHWYQQKSHESPRLLIRYTSQSISGIPSRFSGSGSGTDFTLSINSVETEDFGMYFCQQSNSWPFTFGSGTKLEMKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for multi-specific peptide recognition by the anti-IDH1/2 monoclonal antibody, MsMab-1.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Heavy chain of Fab fragment
total genus 55
structure length 211
sequence length 211
ec nomenclature
pdb deposition date 2016-06-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5gisL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5gisL01
4J3OC 3I2CL 4HUNB 1NANI 3VGBA 5EU7E 1RFDL 3MOAH 1CE1H 1LE5A 4XP4H 4P3DB 1AGBB 4KY1H 5DJ2A 4N5UA 4Y19B 4P4KA 4K07A 4CVWA 1E4JA 1LO0L 3P9MA 2VUOA 5GJTH 4U3CA 3QWRD 3BGAA 1F90L 3QUZA 4YHMH 3F62A 3E8UL 5IR1B 5CCKH 1KN4H 3NH7H 4OGYH 3RVWC 5EZOH 5IVZB 3OHXA 4H8WL 4X4YB 1MJ8L 1YMMB 4OFYA 5HDQH 4OZIA 5KS9B 4DAGL 4RMTA 4GW5A 3B6SA 5MP6H 1NSNH 4I5BA 4MJIB 4GW4B 1SVCP 3P9LA 1D5MA 1CFVL 1MEXH 5IV2A 3ELAT 3FRUB 1CR9H 4JPKL 1U2CA 4K8RC 1JRHI 4ZFOA 6FABL 4Z0BL 3B3IA 1VFAB 4M62H 4DVBA 3E3QC 5A16A 4LLUB 5ETUA 1T0NA 1OWWA 4OLEA 1QO3B 5IT2H 5B3NA 5FUZH 2ENSA 5BS0D 3D39E 2OS7A 2VE6B 4YXHH 1A9EB 4LCIL 5IF0A 1FZOA 2FHCA 4KGLA 4NNPL 2ZPKH 2EH7H 4GAJL 4JCLA 3KVQA 1G9MC 3BFOA 4O5LL 3WIHH 5DTFA 1BQHB 4PREB 4V1DD 1A21A 4ZXBC 1UM4H 7FABH 2RQ8A 5JHDB 4P5TC 2OBGA 4DKAA 4RBPH 5CZKA 4ZUWB 4MXVF 5JORA 3SPVB 1ZEAL 1JGVH 4FNLH 4Z7WE 2HKHL 3STZA 4Z7QF 3U9UB 3GMOB 2X44D 4X5XB 3DRQB 4ETYA 2YKLH 1ODAA 3SQOH 1B2WH 4LGPB 2DM4A 4NBYB 4R8WL 5JOFA 4Y5YA 2LABA 5SWSB 2Y9RT 3VI3F 1ACZA 5E8EB 4X4XA 4R3SB 4UDUA 2PXYB 3GJFH 1ZA3B 2GK0B 3OSKA 3FT4A 4TTDC 2Q86B 1EO8L 2BVPA 4M6OL 5DTFB 4WFGD 2MCG1 3MNZA 5HGDA 5ENWB 4N0RA 3GJFB 3GHEH 2X5PA 4U1IA 1A02N 2ICWA 3QRFM 4D2NA 2FL5B 4YHYB 1MRCL 1EVUA 1FYHB 2YS4A 5IB1A 4JQVA 5ELIA 1XT5A 1OAXL 5J6GA 4C58B 1INQB 4MQTB 3ZDYE 1H15B 2IAMA 4XB7A 5GS2D 1NFKA 5IVZA 2IBBA 1AJ7L 5C2BH 2R56H 3BQUC 3C6LA 1D5BA 3S96B 5ISZE 1DUYA 5BRZB 2AJXL 4CVZB 1CLOH 3DRTA 3QUYA 1RUQL 2XKUA 3DARA 5E6IC 3FB6B 3P4OA 3F7VA 2D7TH 4Y2DC 3OB0K 2YEZA 3BO8A 1MH5A 3DSFH 3H9SE 1WBZB 3RWCA 3BPOC 4F7EA 2Z0BA 5H2BA 5C09E 2DQGH 3AS0A 4PJ5B 4ETQA 2IAMC 3GRWA 3FONB 4N9GB 1NCDH 2RCSL 1HH6A 3ZHKA 5E99L 4L8CA 5E2TH 3TLRA 2P46B 2Z4QB 3DYOA 3N85L 3QUKB 1YMHA 3DTXA 3SJVE 4K9EL 3REVB 3WFCH 2ICWJ 3GHBH 4V2BA 2R8SL 2DN7A 3C8HA 1T3FB 1YQVL 3TJHD 5CD5D 3MYZA 2BNUA 1JGLL 4MX7A 5JNYA 4U0RB 1IGCL 3MGOB 1O7SA 3LEVL 4NO3A 3KDMA 1IE5A 4PJFA 1QFWH 3MV7A 3MNZB 1GOHA 4RISL 4KVNL 4KJQD 3QO0B 5LAXB 2FYYA 4P23A 1EPFA 1Q9OA 1L7TL 4M6MH 3KPSE 4JFEB 2EDJA 4YQXH 4OIAA 3RTQA 1IC5L 3OG6B 3VFVA 1R3IL 2AABL 4PBVC 3PG2A 1T3FA 3U2SB 2F58H 1V3MA 1A9BA 3HG1D 5FO9B 1A3RL 4HS3A 5E6IB 4HUKB 1F6AA 3VG9B 4MCZB 2EICA 3ARPA 1YN7A 3L5IA 5E94B 2PYEE 3KPLA 4U6YA 5CSGA 2HRPH 4WFGE 1TFHA 1YYMH 3ULUL 3PQYD 4O2EB 4CVZA 1VADA 1IM9A 1Z6JT 4MA7H 5ANME 4XX1G 5ISZA 2VIRA 3A6CL 3IXTB 3R4DA 2VH5L 4K3DL 3U0TA 1CICA 4WI9A 1KB5A 4OLXL 3SE3C 3CMOL 4CU7A 2F8OA 2NY3B 1TVBA 3QEQA 4IS6B 2MNUA 3OQ3B 1CFVH 2V2WB 4U1NB 4Z7VF 5D1QC 3FFDB 2YUWA 3OWEA 3VGAC 5B3JE 1HSAB 5KVFH 3OR6B 4WFHE 1OF2B 3GMRA 4YE4L 1KB5H 2VLME 5HYSA 3GB7A 2FGWH 1H3WM 2VXSH 3MODH 1T21A 5F1OB 1MAKA 5GGRB 4KUCF 3U30B 1MCJA 3L7EB 1F90H 5I30H 3JV4A 4FP8L 4HIEA 1F11B 2C4FT 4JG0L 3LQMA 2B7DT 2GT9B 1KXTB 4P46D 3VXTA 5CJQL 1HSBA 2J1KA 2DLTA 5T1DL 3ALPA 1H5BA 1YNKL 2OJEB 4NKQB 1FNLA 3AAZA 4FFWD 1OP5H 4X83A 4BKLA 3QUXC 1MI5E 4W81A 5J1AB 2W07A 3KNBB 3IXAA 1A4JA 4K23L 4HWZA 3WE6B 2XKNA 4H0IA 4HAFA 2D2OA 3C87A 3B9KC 3P3YA 3VFNA 3W11D 3IFOA 3U46B 2AJVH 4UBDD 1MJJA 2IANB 2FJGA 1WK0A 3CFJA 4OLUL 1P69B 1FZJA 4AIOA 5GRUL 3GBML 2ADGB 4ZAKD 3HZMA 4P59H 3QEUA 3ZKXB 1F2XK 3EYOA 3V5DA 3K7UA 1BJMA 3BWAB 4LBEA 2OTWB 5TE6H 4UZGA 3R0MA 3VXQA 3MA9L 3T0XA 4KRLB 5CD5C 1PG7W 3ARGB 4MA8L 2VN4A 2NNAA 2GSIB 5SV3A 3G6JB 3QJHB 3U0TB 4I48A 1LDPH 3FN0L 4O2CB 5IESL 4JR9L 1RUKL 3MODL 2DL9A 2FGWL 3THML 4WEBH 3LQAH 5DYOB 5JW3H 4O2FB 3IDUA 5BZDA 5CP7B 4HS6A 2X10A 1LK2A 3S36L 1EO5A 2XWTA 1A0QH 3JTSB 3SY0B 3ZHLA 4Q97A 5BQ7A 4CVXA 5SV4A 4Z77B 4D0DB 1FFNA 4KKBC 4HBCL 4PRDA 4F7PA 1B6DA 3T2NH 1H0DA 1BIHA 1H8SA 4L3ED 2BVYA 4NQCE 2G2RB 2IQAA 4KKBD 1LO2H 3H2WA 5CJ5A 4RSVA 1E27B 1RJYB 3AFLA 2V5RA 3BN3B 1HWHB 5D7LB 1MIEH 1UB5A 4KDWA 2H2PD 1CDUA 3P9MB 5C0JA 4OGXL 1NMAH 1CD1A 5I19L 3ULVH 5D70H 4U1SA 4YDLB 1GC1L 4XBEL 2Y07H 5FKPB 5DEGB 3G5XA 5D7KE 1G7PB 1OPGH 2W65B 4P57B 1JPSH 5CBAB 4K9EC 3N9GH 2VZSA 1FAIL 3OB0H 4GG6E 1YEGL 4Z7WB 3WSQL 5E8DH 3ZE0E 4BK4A 3NVQA 4WU7A 3H7LA 3NTCL 3RIAF 1QR4A 4G6KH 4GRLC 3LD8C 3RI5K 3QDJA 2Q3ZA 2YMXH 5TH2B 4RGMC 3H9ZA 2IAND 2BOBB 1YUHB 4L3EB 3TVMC 1C5CL 1G7LA 1WWBX 2JIXD 3DIFA 3QNXB 4MVBD 1BBJB 3C5JA 1DBKH 2AXGB 3QH3A 3GIZH 1S5HA 4AEEA 4M6OH 4HFWA 4F8QA 1H3PL 3E3QE 1NLBL 4JRWA 4XP5L 4ELME 3PXHA 4ZXBD 2IEPA 1IT9H 2ZCLL 4NNXA 5D71L 3UXFA 4U1JA 1KJ3H 4PV9A 5E8OB 1HEZA 2VL5B 3DX6A 4MJIE 3KJ6L 1K8DB 1A1MB 3I6GB 4EI5D 4WWKD 3G6AA 3O3BA 3P77A 3TBWA 1C5BH 3VXRE 5E4IA 4EZMA 3DVNA 3D87B 1QSFA 2V9TA 3D3VB 4YR6B 4RA3A 3E2HC 5J6HA 1KEGL 5I74B 4LSTH 5AEAA 2PETA 2WWMD 2H3NB 5TPWH 1MFEL 3S36H 4AM0B 3TBVB 4I3SL 4L1HA 1PAMA 1MOEA 4MAYB 1XR8A 4NZTH 1DEDA 3RL1A 2X7LB 4Y16D 1S7TB 1P7QA 3WDHA 2EO1A 4L3EE 2H6PB 4OCYL 3GHEL 2VISA 3BRGC 4P4RA 1JGUL 5L9DH 4RIRA 1N8ZB 5HDQL 3N1PC 4KROB 3VFOA 1S9YB 2YA1A 2VTFA 2AKRA 1OOAA 4ELMB 2X4NB 3NCYS 1DSFL 4HUWB 4XVUD 1AGCA 2FWOB 4U1MB 1RZIB 5DQDH 1XF1A 4G3YL 2C1OB 5E9DE 1D5XB 3MO1B 5I75B 1R5IB 4IHOB 3ULVE 2YKLL 3FOMB 1UM6H 3EHBC 2PR4H 1KELH 2OQJA 3MOAL 1LP9A 3W39A 1JPFA 4S1RL 4PJAA 4Y5VA 2I26N 2GCYB 3VWKC 4KI5F 4S1RH 2FO4B 1AH1A 4NO2B 2YD3A 4PG9A 3QIUD 3AY4A 5CGYD 3BQUA 1EEYB 4CAGA 2OSLA 3FT2B 4PJIB 3OGCB 2I60H 2AJ3B 3OZ9H 3QXWA 3DOSA 1B88A 3H9SD 4PGDB 2JJSA 1FVCB 5I9QC 4Q2ZB 1YPZA 1IEAA 5E6ID 4ZPTA 1HXYB 4J3TA 3T4YA 1QP1A 5I1LB 3RFZC 4DTGL 3TBYB 4S1QL 2VLJE 4F9LA 4B41A 5ALCL 3EOTL 1KCLA 5J6HB 1KFAH 1LDPL 4GG8B 5EIIA 1EEYA 1MHEA 3TBVA 4P3DA 3OJVC 4NZTL 5LAXA 3HE6A 1HINH 4LL9A 4MJ6B 1AP2A 4ELMF 3QQ9C 3K4AA 1T22B 5H35A 3ZE2E 1AKJA 4DVRH 1MIMH 3G6DL 2G2RA 1ZVSB 2IQAB 3QNZA 2CMRH 4XB8A 4Z7OF 4J2XA 1U8QA 4CADA 3PGDA 4P2OA 2X6MA 4LDLB 1CE1L 3MRQB 4IRJC 3SE4C 2XA8H 2YXMA 2WINA 5DHVH 2FHBA 1QSFD 3MRHB 4XMLH 4PR5A 1X4ZA 1LNUB 1TVHA 2J8HA 2D7NA 3H6JA 2Z92B 4XWGH 2VAAA 1HILA 5DJYA 1R5IA 4A2MA 5L2KD 4Q9BA 3MCLH 3PWLB 5I1DB 2DWEA 4IDLA 5DT1H 3WS3A 1SEQH 3MV9A 1DN0A 3L3IB 2F53D 2DS4A 2P8PB 4P9HL 4TSCH 4ZAKB 1UH3A 1F2QA 4KAQL 1D9KB 2ERJB 2YN3A 2ZKHH 3HUJA 3PL6A 3O3AA 3OKNA 4MXWL 2P5WB 5TQ2L 5KSAB 1EX0A 3N0PB 1CFNA 1CL7I 2WINB 5EUOA 3MJGX 1KB5L 5B39G 4QHMA 4M3JA 3WIFA 4D0BB 4F33B 5I17B 5JW5B 3MLTA 5MEND 1UWGH 3O81A 4JG1L 4WW2F 4HAGA 5F7LB 3TZVD 2AXJA 5B22A 4X7FC 1OGTB 1MRFH 3QHZL 4K55A 1ZVYA 4P2RD 4PGDA 1KJVA 1OAQH 4RCAA 2XZQL 2MCPH 3S5LA 4H25A 1I9IH 5GIRA 1ZT4A 4Y5VC 3MLSH 3KNBA 3RVTC 1Y0LA 3GBNL 2VDQH 3KPRE 4FABH 4BKLB 5F6IB 5C08A 1C12A 1JL8A 2N7BA 4W6WB 3ILQD 3GMPB 3VFRB 1S9XA 1GL4B 4XCNA 4M7ZC 4XPGH 2BC4B 5CJ8A 3HI5H 2R69H 3RHWK 2QSCL 4X6BB 3BN9C 3R8BB 1I7ZB 4LSSH 5DUPH 4Y1AB 1JUFB 3O41B 4BK5A 5F3HB 3SCMC 5IG7A 5DDHA 1H8NA 1ZOXA 4U1JB 4AENA 2CXKA 3WEXA 5DVMA 1MUJB 4AIZA 1WAAE 3ALXA 2MJWA 1FO0L 2XA3A 4QT5B 5KVDL 4L8SA 1MH5B 4Y88A 2FEDC 4L9LB 4I18B 3UBXA 4O58H 4OKDA 4JQXA 5D6CB 4G43A 3L1OH 3DRTB 3KS0H 5BZDB 1BD2D 2ATKA 4XCNB 4LF3A 3ZKND 3IF1B 2CSPA 3C60C 5IIEA 5EOTB 2PYEB 1TLKA 3LSOB 4GAGL 5C0CB 3EJJX 1CE6A 2HTKC 1S7RB 3MUJA 1I1CA 2YMXL 5E9DD 3OAZH 1U93A 3DYPA 3ZDXE 2AI0H 3ARFB 3LKRB 4UQ2B 3N85H 1KULA 4YX2L 1LE9A 4DKEL 4HKZA 4F58L 4RAVB 2VC2H 1WWWX 4K3EL 4O2EA 3PHSA 5A40E 5JA9A 2VWEE 5DJ8A 1CDHA 4OLZL 1U95B 1RZJL 4M48L 5DD6B 1TVBB 1KCVH 1NBVH 5FECA 1ZLVK 2JJTA 2VDPH 2Q7NA 3DBXA 3IJSA 1EDQA 1I1AC 3VFUA 3GSRB 3H9SB 2NZ9C 2ZSWA 4JCMA 5JQ6L 1DBAH 2NTFA 3TVMA 3IKKA 3FFCA 4JO2L 1NAKL 1F11A 4HS3B 2H2PC 1FN4B 3W5NA 1BQLL 5HGHB 1TETH 2F54E 1YEFH 5EZIL 2FR4B 3K46A 1NH6A 1KCRL 5CEZH 4Y4KC 1EUUA 1G84A 1YNLH 3QIWD 1E6JL 4KMTL 4R4ND 3VG0H 4OGAC 4PRHD 3SGEI 2HTLD 2QADD 2HT4C 3CVHA 1FGVH 2YK1L 1DEEB 4J3XA 3WO4C 2R9HC 4YHKH 5J13C 5DD5H 4F3FA 3ARGC 3REWB 5JXAL 4F37F 1HZHL 4M7LT 4OFPA 1T22A 2WQ8A 1MJ7L 3U0WL 1VEOA 5DMKA 1JN6B 2NPLX 5GJTL 1BEYH 5ISZB 3WJJA 1JIBA 3QXTA 4HHAB 4Z7OE 4F15B 1JHKH 4XNYH 4Q9RH 1IMHC 3GJFA 5HVHB 3SEPA 1YN6B 4X80L 1IKFH 4X0KB 4EN3C 3D18A 5MEPA 4WDIB 2A74B 1UM4L 4YPJA 2NNAB 3KLHC 3BMVA 3VWJC 1B6UA 3EDEA 3EZJB 1KLGA 3TH3T 4MCYA 3CPLA 5L0QB 3QFDA 2D03L 5FIEA 4U6VH 2JIXA 4OF8A 2ZPKL 2OR8A 1MQKL 3F12A 3VRLE 1T0MB 5FM5M 4YXHL 2VL4A 1J7VR 3D25A 4HH9B 4HHAA 4JRXD 4M7JH 3TWCL 1VA9A 2BMKB 2CRZA 1KGCE 4P23C 5T3ZD 3BXNB 2DQJH 1MCLA 4QOKA 3TA3B 3H42H 4XBGB 4Y4FC 4YBLC 2IADB 3BH9A 5IROA 2XTJC 1ETZB 4MYWB 5C0RL 2V2TA 1N4XL 1W72H 2AJSL 3VRIB 3CH1A 5D7JB 3QI9B 1T4KB 5E1AB 3PWVA 5FXCH 4YDJA 3C08L 3LEVH 1W72B 4GS7B 4Q9CA 5DA4A 4DAGH 2DQEL 1NAMA 4Q6YA 4EQ2A 2ICWI 1GGCH 2FR4A 2FWOA 4HZLA 3D3VD 2GW5A 4E5XA 2EEBA 3MGTA 1MVUB 5GS3A 1A7NH 3HRPA 1DVFB 4LHUG 2O5ZL 2B1AL 2RFXA 4YFLF 4MNQE 1UZ8A 3O6LH 5AZ2H 5E2TL 3SE4A 3MTRA 2JB5L 3M8OL 1EAJA 4MSWB 1D5IH 4MJ2A 3ZDYF 4G5ZL 4R4BB 3BPCB 1AGFB 5GQBA 4WUKL 2YA0A 1RHHA 5ERWB 3DGGA 3SE9L 4JDTH 5I1HH 2G5BB 3H42L 3HLAA 4NC2B 4YFEA 3GBLA 2VRAA 4PRPE 4WU7B 1NFDA 2GUOA 4H26B 3ZTJG 4XP9L 1MRDH 1JE6A 1HH9B 5EA0H 5ICZA 2CK0H 3NZHH 5FM4A 3UO1H 1S9KC 1RUQH 2P5WE 1T83C 1HCFX 4K3JH 4Y89A 1UZ8B 5HHXH 2BHUA 3DUUB 1RJLB 3CDGA 1JNLH 2R1YA 4GSDL 2F8XC 1J5OL 4K71B 4JDTL 1T1YA 5JPNA 1NCBH 2XTJB 1I7TB 2E9JA 5J11B 2PXYA 4HFUH 3T1FA 1E27A 5KOMC 1J05B 5JOPE 4F2MA 1OAXH 1P4IL 3D25B 5CILH 1HEZB 4Q6IB 3PE9A 3MRFA 4KI1A 3HI6H 1M7DB 3E6HB 1Y6MR 4X7TA 1CG9A 5HI4C 3L3JB 2NZIA 4PJGB 5JMRA 2V2TB 5D7SL 3BP6A 5GRVL 1UXSB 1NGWA 3BH9B 5GPRA 1MFDL 1A64A 4RWHA 1T83A 3EOYG 1ZLSL 3BIBX 4WI7A 5DZOA 1SM3H 1F13A 3U4EB 1AR1C 4QEGA 1OSZA 4NBZB 5DS8B 4E41B 4X5WA 3RAJH 2CIIB 5AWNL 3C5ZA 2GEEA 4FFVC 4NGHH 3ZKSD 1LE5B 3UZQA 2Y72A 3VDCA 4DGVL 2NZ9D 5C7XL 2VAAB 3MXWH 4KTEH 4YUEH 2JELH 5TJWK 1MCIA 5D1XA 4PR5B 1XGRB 1NAML 3AU1B 5E8PB 1FIGL 4YHNB 2GJZA 1J1PL 1J10A 3DV4A 4DZ8B 4KFZC 1S8DB 3O0RL 4PLKC 2AGJH 2VZ3A 4R26H 3FONA 3RNQB 4Y4FD 3G6JF 4JQVC 4YDKH 4MJIA 3WNMA 5E00A 3QBTB 5D8JL 1YJDL 2WBJB 3RIFF 1HOCA 3MLZL 2DBJA 1A6WH 4GRWB 4JFYB 4KXZI 4NKIL 2VZTA 5MI0C 3ARTA 1HH6B 4Z0XB 4BSVB 2PTVA 5C6TL 4E0RA 1UWXK 3KR3H 1MFNA 3DVGA 5GRZA 3WDIA 1FNGA 5D9SA 2NLJB 4IOIB 3DURB 5HHQA 1BREA 1Z0NA 1MPAH 4P4KD 4HMCA 3OAUH 1LO4L 2FBJH 4YDIH 5D2NE 3QPXL 1ZHLA 4PLNC 5ANMA 1HOCB 3QHTC 4XI5D 5TQ0H 2AP2A 4ZPVA 2DQCL 4P2QA 1YEKH 1KCKA 2JK5A 3VWJA 4PBXA 1NDGB 2G75B 5KSVA 1RIUH 4Z7UA 4R2GD 4HSQA 1IGIL 2WZPD 1IL1B 3RBSA 5IQ9B 3C6LC 4L4TD 4L4VE 5IJVB 4HUVA 3R0NA 3T09A 3V5HA 2I27N 3Q0HA 1A6WL 3IJYA 4P46B 5CGTA 4UOW0 2WM0A 2EYRB 2D3VA 1MPAL 2ZCHL 3S37H 5ISZD 5KTEL 1ES0A 3VRJA 5JIPA 4KROC 1K4DA 2NY1C 4N0CC 3WIHL 1IM9B 5HHXL 3RJQB 3LHPH 2X4NA 2IALA 1BFVL 2ATKB 4B0MM 1TJGL 4LK4A 3O0RH 4OLVH 4LEOB 2CUHA 3V4PH 2OTPA 1F3DH 4L9LA 4M6NH 5DFTA 5I8CB 3NCMA 4YHPB 1S7QA 4HIJA 4Z0BH 4U0QB 1MCPH 2HFTA 1T7YA 2YD2A 3B43A 3LSOA 1LMKA 1G7HB 3BRDA 4HIXL 3VXPB 3WN5C 4XPBH 3PGCB 3TN0D 5IB3B 4NQDB 4LHQB 4U3HA 4X5XA 3SQBA 1SJHA 3D85A 1KCSL 2A9ML 3O6LL 4N1HB 4QRQA 4NKDA 4JFED 2XOTA 1ZLSH 3LS5H 4OIBA 2LQRA 1I3RA 1CGSH 3QT2A 3WNOA 3BPCA 3V4UL 5ECJE 4JFDB 5T5FL 1IAOB 3GEWB 1WT5A 2HLAB 3BKJL 1JGDB 4JO3H 2OZ4H 3NIDE 4LMQE 1MHPH 5CJXC 5KVEH 1GZQA 5CINL 1RZ7H 3T0ED 1YY8A 2QSTA 3GI9H 3X13A 4WHTA 2WWKO 3HZVA 4APQB 4ELKA 3MV9E 3F7RA 5A2JH 5IJVA 4JM2B 1ZT7A 1M6OA 4DW2L 1H3VA 1Q9KB 3DYMA 1UKTA 4N8PA 1R6VA 2HLFD 3AM8A 3TYGL 2WLYA 3LIZH 4PJEB 4LIQL 3EDKA 2R69L 3EYQD 1FCGA 1MQKH 2K1MA 4H25B 3RHWF 1RIVL 2Z93B 5EFIB 4PTUB 2FZ3B 5C0AA 3TIDB 3FRUA 2AEQH 2BOCB 5GXBB 1NFDE 1DLHA 4MXVE 1SQ2N 4FG6C 1CGTA 1GAFH 3FQRB 1UADC 4M7KH 3IFPB 1EGJL 2CD0A 1AR2A 1INEL 1IEHA 1QKZL 3DO7A 1OP9A 1OM3L 3MZGB 3GSXA 4YHYC 3RU8L 1N7ML 3JWOH 5DMKB 1A6UH 1C16B 1EGJH 1AKJD 1HZHH 3QDMB 3E1F1 3NCJL 4KK8C 5K9OB 2ZKHL 4EKXA 3F12B 3BAEH 2V9QA 3D2UD 1RIVH 5T3XE 2A77L 2FECL 4ODBD 3MLWH 4WJ5A 4GKZB 3C5ZC 4OCSL 4PJXB 3UPRB 3IDGB 5F3BA 2J4WL 4OGZA 2X41A 3GSNH 3LKNA 4X7EC 2MPAL 1I4FA 5C0CA 4OB5H 3G6JE 1OHQA 4QOKE 1R3LB 4Y5XC 2NY2D 2X9YA 2XFXA 4R7NA 4PUBL 3GIVB 1AGCB 4P2RB 4U1MA 1DBAL 4K8RD 4X4ZA 5EPMA 3QFJB 4PFEA 3HG1E 5LVEA 1AGEA 2A0LC 2R1WB 4XGZB 4DN4L 2HG5A 4QHUB 1OAYL 5EC2B 4OFDA 2R2BB 3DPBA 5DRWB 1RK0B 1KLFA 3ARUA 3WXVL 5C0FA 1Q72L 3LQZA 3O11B 4B7LA 4JANA 4XCFL 3GMPA 3VFRA 1BD2E 2VZVA 1KIQB 1U3JA 2FEEL 5DK2B 2YR3A 3MRLB 3UAJC 1D5BB 1HINL 2VC2L 4K3EH 5DF0A 5HVHC 4LCUA 5EUKB 2HFGL 5F7YC 1NGYB 2R2HB 5A2FA 4G8IA 1E0OB 3EOTH 4CDGC 2IH1A 5CEXA 1GHFH 4OTXH 2A6KA 1X6NA 3M45A 3ZZ1A 4OZGB 1NMBH 1R5VA 3MRRA 5GGQH 5LCVH 1A1NB 4P3CH 2AV7B 4F9PA 2ZSVA 1EMTL 1L6XA 1RZGA 4FRWA 2UYLA 2MKWA 1GJIA 4NIKB 1KPRA 1H5BC 4MNQD 3FHQA 3SDXA 4OAWA 3QUZD 3L6FA 3I85A 3IETB 1VFBB 3AXLA 2VXVL 4Z7WF 2JCCB 4MD5A 4LCCA 4ORGA 1P2CA 3RVTD 1BVLB 2FSEB 4OI8A 2YBRB 2C3GA 1U95A 1HHIB 2ZCHH 3VD7A 4FMFA 5F96H 4OZGA 1MVFA 5EU5B 3JV4B 4W70A 2WNGA 4KQ3L 3RWFA 3DI3B 4Z7UE 1G9NC 2XXCB 2XYCA 4LSSL 2ZSVB 1P9MA 3NCBB 5DJZB 1CFTB 1YZZA 3UTPE 4CU6A 5I8EA 3VMPA 3EO9L 2P7TB 1IT9L 5D71H 1P7QD 5SX5H 2F5AL 3GSUA 3PWUB 1OT2A 1RZKH 1XCQA 5DR5L 2XFXB 1RZJH 1WICA 2MWCA 1B4JL 4MD5B 4ORGB 3F65A 5HYSG 4J4PD 1NEUA 3ARGD 3VJ6A 4OZFG 4XPHH 15C8L 1JV5A 1OGAA 1MHHA 3OAUL 4RGND 2CPCA 4Y19D 1JGUH 5GGVH 4PB9L 4OCYH 3AGVA 3HR5A 1RK0A 1DQMH 5C0FB 3BWAA 3OPZH 1IGFL 4J8RA 4R0LA 3QEGH 1I3GH 5FCUH 3V0WL 5FGBC 2VISB 3HC3L 1MLCA 4QLRA 3BXNA 3TESA 4DFIA 1AD9B 1TJHL 2MQ3A 3MX0A 5B3JF 4U6YB 4G8IB 4OZHE 5JW5A 5TPWL 3VGGA 3FOLB 5T5NG 2ESVE 2VLRA 4DGYL 1DVFD 1L9MA 3HNTL 4L3CB 4DKEH 3RWIB 3U2SA 1KSRA 3MFGB 1GC1H 2UYLB 4YX2H 5KN5B 4HIIB 5CMAB 5ITFA 1QLRA 2GTWB 2AXFA 2ZUVA 2P43B 4EQ3A 5FB8A 1YEIL 5DRXA 3BEWB 2ICCA 3GM0A 3LB6C 2J2ZA 5AYUL 3QI9D 2CK2A 4PJ7F 12E8H 2H9GB 4XWGL 4H20H 3L5XH 2A9NH 2LVCA 3MXWL 2VLJD 4KDTA 4PJ5E 4YO0B 5IB2A 3MJ6A 3SDYH 4MQXC 2EDKA 4ZQKB 4QRUB 1Z5LA 1JRHH 4ODHL 1BJ1J 3AROA 4ZTOH 4BFIB 4LP4A 5KVGL 4YHZH 2B0SL 2EYTA 4GRWH 2VDNL 3ESUF 4C55A 4AEFA 4QWWC 1U3HB 4JKPL 4X7SL 3T3ME 4DVRL 4MD0A 2DB8A 3C6SA 1XGUA 4I2XE 4PJHE 3NAAL 1J8HD 1C08B 3EJYD 3OF6D 2Y5TA 3PDDA 3UBXB 4POYA 1VADB 2WSKA 3BEVB 3THMH 3GJFK 3AY4C 2DMKA 3K2UL 3QNZB 4G7VL 2NR6D 4IRSB 5FYLH 3RI5F 3WSQH 4W4OC 4TVPL 1T03H 3WIIL 2WUBH 4ALAL 4ZMAT 4O4YL 3MLUH 2A73A 4Z7WA 1LNUA 1XGQB 1DR9A 1L7IL 4PJEE 3NFPB 4HCRH 4OT1H 4ACPA 4RMQA 3S36X 5AAWA 4GMTH 5LGHL 5FYLE 1ZA6B 4KJPD 3RGVC 1XR8B 1SEQL 4I48B 4G8GD 2NX5B 4OM0L 1B9ZA 3GO1H 4GKOA 1MCHA 5LWYL 3QR2A 4GKZA 4KKLC 5I8CA 1RD6A 3OJ2C 3UZVB 2VLRB 3HRZB 3TO4B 5E9DB 1TPXB 1UVQA 3ULSB 3BT2L 2ESVA 4QXTB 4HC1H 4F7MA 1D5IL 5MENE 1N5AB 1M7XA 2EEDA 4WW2C 1KCUL 5DJAA 1FYTD 3MRJA 1TZHB 3G5VA 1MCDA 3CC5B 2B1AH 4D0BA 4F33A 5I1EH 3VXMA 4OCXL 3RIFK 3ARED 4WI3A 1MIML 4QHMB 2NQCA 1P5UA 4NQDE 4R96A 3BHBB 1KTRL 1U92A 5C0NC 3EGSB 3EYUL 3BQUD 5B8CA 3WDJA 5BS0E 3SCMA 2UZXB 4NCC2 3I6LE 1RUKH 2BRRL 4OCRH 3GJEA 3IVKB 4WW1A 4S0SD 4HG4J 4AH2B 3B2VH 5ADOL 1NC2B 2EE3A 1DDHA 3BGFB 4QRRA 1CCZA 4Y1AA 5AUMA 1C08A 2FIKB 4XNUL 5L2JA 2NY0D 5C07B 5JIHA 2GQHA 3DI2B 4OM1H 1YNTB 3ARFD 4M7JL 4JREC 5BVPL 2CR3A 4MB4A 1AXIB 1LO3L 4HJGA 4JFXB 4L4VB 4NBXB 3TBTA 5C0DA 1VESA 4IM8A 3C8KB 2DM7A 3BWUC 4JFOB 5I8EB 4KPHH 5DO2C 2I9LB 4FFVD 1BZQK 3IDYB 5IEHB 1AR1D 3G5XB 4HC1A 1TTFA 1NDGA 2D9CA 5IEKB 5I1EL 3UTOA 4UILL 3DLQR 2AQ1A 1NGZB 1IAOA 4ZUTA 3QXVA 1HQ4A 5DUML 2XQYG 4G3YH 5C0CD 5KANG 4RISH 5MI0B 1UJ3B 1MJ7H 5DMYA 4KJYB 4OF3A 1NBYB 4IMLA 1CDCA 1BD2B 4TPRH 3WV0A 5SWZA 4Q58C 4NQSB 4DKFH 1F97A 2APFA 1Z3GH 3M1BA 4P57A 3TJEH 1NUDA 4MQXD 3E6FB 5E5MA 2A83B 4K9EH 1I9JH 5IVXB 5TF1H 4BZ2L 3OG4B 4HZLB 3FL7A 3TV3H 4F7CA 1JNHB 2NW2B 3K4ZA 1TZGL 4GQ9H 5T1MB 1I1RA 5KSBB 1ULVA 5L9DL 3T77A 4G9FD 4LLWB 5AD0B 4JFFA 4XH2B 4ZSOA 4FQCH 5D7LE 4XMKL 1OD9A 1I7UB 1Q94A 1U8KA 3PP3H 3GSVA 4G9FB 4MDIB 1T80A 1BLNA 3CSGA 1MIEL 1V3LA 2F58L 2Y4SA 5DRWA 3LH2L 3D85D 3WJLC 2C9AA 3V7AE 1BGXL 1JGDA 3D0VB 1MSPA 2DQFB 1L9NA 1UYWH 1BECA 2QQLL 3T0VA 2E6QA 1WLHA 2ID5A 1W8OA 4LSVL 4Z95L 4LEXH 43C9B 5BV7B 4OGAD 2NY0B 1X9QA 2GJ6D 4HLZH 2PO6A 4PRNA 2XZAL 5E2UL 5E70A 5IGXL 3WHE0 3MRIA 3FTGA 2VLKA 5F9DC 4D3CH 4PGCB 4F8TA 4UOW1 3U4BH 3VXUD 3T0EA 3LS4L 2FDBP 1RZGB 3LKQB 5EBLA 5CP7A 3L3KB 1FBIL 2GSGB 2XTJD 3U1SH 4Z8FL 5H2BB 4KKCC 4HIJB 1B0WA 4ZYKB 3BQUB 2BSSA 3MYJB 5EZJA 5CJBA 4UU9B 5T3XH 3RTQC 2EZ0D 3WFBH 4IBLT 3S3PA 3MJ7B 2VDKL 3PDOA 3MOBH 4PPTA 5ADPH 2A2QT 4L29B 1UYWL 3S6CA 2DQHL 2VIRB 2KH2B 5JOFB 4QNPE 1DQQA 5EO0B 4GRWF 2EE2A 1PLGH 3C5ZB 5F1NB 4PGJA 3QDGD 1ZHNB 2VLKE 5EU6D 2YD5A 4F7CB 4JFDA 5E2JA 1PY4A 4APQA 1ETZA 4ELMA 1X6LA 5DJZA 1YY9D 2AJZB 3HFMH 4YHLL 1S7WB 4OUUA 5D1XB 1FDLH 3SGEH 1IGYA 2XWBB 4LSVH 2B4CH 5DJ6B 2VWEC 3BZFA 4J1UB 1N2RA 2NXZD 3PDGA 4YK4C 1JPSL 4X99B 3MNVB 4WCYL 4DN3H 3T2NL 1UB6A 1H9VA 2OYPA 1LGVA 2UWEE 3WLBA 1KG0B 4UDUB 4PRBA 5D1QB 1YEJL 3DURA 3U7WL 1XGPA 1U6AH 1C7SA 4K7FB 4ISVA 1FGNL 4L4TA 1GYAA 5DI8A 4DOHE 3RBGA 1NSNL 5FV1L 2CUIA 1A7RH 2W0FB 4YE4H 5IJKC 3VWJB 3UTZA 1HHGA 3DX9B 4PJ8D 2ED9A 3EYQC 1KN4L 2DKUA 2DJSA 1HI6A 5DWUH 4TSBL 1MJJB 1IAKA 3V6ZA 1CXIA 1VEMA 3MJ9L 4P3WA 2GITB 1RAMA 3WS6C 1CICB 3WKMH 1WIOA 3DX6B 4LSPH 1MWAH 3LZFL 5IOPB 4PGEA 1RFDH 2X4UB 3UCRA 2Z9TA 4UNVA 2DMCA 3ULUH 4UQ3B 4M6AA 5DJDB 1EHAA 4HGKC 5AUMB 3EFFA 3B9KB 5C1MB 2GT9A 4M1CD 4WTZG 5ACMA 5IQ9A 4QRSA 3GSQB 4XNXL 3RUGE 1A3RH 3L7EA 5EO1B 5EC1B 3KPSB 2CMRL 4P4KB 4ETQB 1RY7B 2C4FU 2HP4A 4ZO7A 2XZCH 3ULVC 2AABH 3PABB 3BZEB 4TQEH 1OTUC 2X89A 2VMFA 3D1MC 3MOQA 4Y7MA 2P42B 2NY4B 1RJZB 3FB6A 3P4OB 4U31A 4MWFA 4JVWA 3REVA 3MREA 4ESKA 2EDTA 1G7QA 5EN2A 3P4MB 1OL0A 3AMKA 1SYSA 4IJ3C 2LTQB 5EZLA 1RZ8A 3O9WA 4IMKA 3FFCB 4S1QH 3GUTB 4DTGH 4MJ4A 4AY0A 3CX2A 5JLZB 1YEEL 3GI8H 3OGOE 3QWQB 1EA9C 1VFAA 4PRAA 1ZLVH 3CGTA 3GSOB 2QR0B 4DUWA 3H9YA 3Q3GA 3EYFA 2IPTH 1CS6A 3WJLA 4JG0H 1BF2A 3AU1A 4LPWA 4HJJL 4HQQL 1K2DA 3G5YB 1KB9K 3STLB 1WSST 4TTGA 2HLFC 3P4MA 3QIWA 1HXMA 1KNOA 1PQZA 3DV4B 3BZDA 5IOPA 4K7PH 1QFUL 2HRPL 3QDGB 2O93L 5HGAA 2EDDA 3I3BA 2V2XA 1ZVHA 3NABH 2Z8SA 4KK9D 4TNWF 4PRAB 3ARFA 1OAZH 3UTPD 4DK6A 1E4XI 4YNYA 3QULA 1H3GA 3U0PA 1CDGA 4L8DB 5FGCE 5DFVC 4JM2C 1ADQA 1ZGLA 1BLNB 3ORJA 1ZV5A 3MMEB 4R96B 5FDWB 5CJOL 3RY6A 4XMPH 1FG9C 4OM0H 4XBGA 3PP3K 5DGRA 3EYSH 1FV1B 2Y36H 1X5YA 3CNKA 4OZFH 4ZYKA 2C4XA 3RUGA 5IB1B 2AS5M 1FNHA 5K33A 2QL1A 4OZFB 3MJ7A 5SWSE 4M6ML 4E42A 2JJSC 2VDKH 3W0WE 5A43C 4WFED 3MPCA 5DD3L 3SJVA 3U82B 4XC3H 4MMXC 1IILE 1ZHNA 3KYKL 5DD1H 1MHPL 1C5BL 1FORH 1F4YH 4Y19A 5DJAB 2APXA 4XCYB 3W2DL 2FRGP 4AT6A 4AM0A 2YD6A 5T5FH 3LV3A 4RWYL 4MAYC 1K2DB 2VXQH 3KJ6H 2A6JB 5C9JA 4FQ1H 3G04B 5D2NC 5C08E 4MNQB 3QDMD 5DK0B 4E9LA 5JA8B 4W4OA 1KCSH 2X4OB 4MSWA 5E6ZA 3OXSA 1JRHL 3QUMA 4ODHH 5I74C 5IP4A 4G80A 3SDYL 5FUCE 4WCYH 3HB3D 3EO1A 5EG6C 3I6GA 5KBNC 2JKXA 3RGVB 2CH8A 3U4AA 1G0XA 3MFFB 4BZ1L 3B3IB 1AC6A 3DTXB 1ZKAA 4WDIA 4N1EA 3HUJF 2PW1A 1YEIH 4GXVL 1TCMA 3UROR 5I17A 4UINL 1BFVH 2VE6A 3BDYH 4HWBH 5BV7L 4G6KL 4NZUH 3JVGC 2VXTH 2Z31D 1IGFH 5T1MA 1ORQB 5GGVL 5CBEB 4JO1H 2Y5TB 4HT1L 5D72L 1T03L 2I24N 3LOWA 5LQBL 3QI9C 4GUPB 3K80A 3TV3L 5JHDA 3HNVL 5FCSH 1NGWB 1AI1H 3BDBA 4TNVF 3S5LG 1S9XB 1A1OB 2PYFA 2Z8RA 3F7QA 1WVZA 4GAYB 5D7IB 2ERJC 1MRCH 3VFVB 1FQ9C 5GGVY 4G6AD 3QFDB 1T4KA 1BWMA 1YPZB 3D0VA 2HKHH 4ODTL 1Z3GL 4GKSA 1U8OB 1J18A 4YDVB 4WNQB 5JIKA 3BP7B 4PS4H 4TSAL 3EFDL 3FO2A 2DD8L 1YA5A 1B4JH 3QZWA 2FJFB 4OFYD 4HGWA 1FL6B 2FX7L 5F7WC 4W6XB 2VDOH 3QDGE 2DKMA 4PJ8B 2O61A 1UH4A 3DO3A 3BUYB 1HK6A 1NFDF 3JV6A 4EN3D 4Y5VB 1JWUB 2RR3A 1KJ2A 2O5YL 5ID0A 2Q7YB 5I71B 3CSYA 4YHNA 4IMKC 3L3HB 1GZPA 2C3WA 4EOWL 4PG2C 2C7UA 1UEYA 3WNKA 2IGFL 2VLMD 3RPKA 2J8UA 3VH8G 3BZEA 2DBLL 1XZ0A 2B39A 3T77B 4AG4H 3C9NA 4QWWD 4LVOB 3JUZA 2BSRB 1CLYL 4N0UA 4R26L 4FQCL 3LRSB 4YXLH 5MP6L 4Q2ZA 3DUSB 5IB5A 2CDGB 2X1PA 3ROOA 1CVRA 1WBZA 3FOLA 1HYRC 1UZ6F 4DZBA 3JXAA 3V52H 5D1XD 5DSCB 1VKXA 1T0PB 2FJHA 3MCKA 4OLUH 1LD9A 3C5ZD 3U79A 4X6CE 5GGUB 3M17A 2VZ1A 1BBDL 4S1DC 1U8MB 2DQUL 2G60L 3OJMB 5I73B 3K1KC 3WFDL 1NMCB 4LRNH 1JHTA 4PJFE 1MCQA 1XMWA 4HEPG 4CNIA 1R5WA 4OGYL 1QACA 3CSPA 5DGQA 1FLTX 1FFRA 2OX5A 2YZ1A 1FZJB 1ED3B 1P7KA 4OB5L 1A14L 2NXYD 4KKLD 2GSGA 4Y4HC 3IDJB 1H3TA 3ARZA 3VFWA 3JVGA 3S98A 4ERSL 5GIRB 2FX8H 3MBXH 1IC7H 4ZD3H 4L4TB 1D6VL 3KPMA 4JGUA 1DE4B 4HH8A 1NCCL 2BVQA 3NFSH 2PCPA 3WKNA 3UAJD 1KJMB 4EI5C 1GIGL 2FX9L 3MO1A 1JVKA 1NBQA 5HYQA 5TE7H 4P5MA 2UV3A 1Q1JH 4IRSA 5C0AE 1PX3A 1UFUA 2AJUH 2EC9T 3MRMA 1R5VB 1JZ8A 2JB6A 2R4RL 5KZCD 1E6OH 2IH1B 5E2VH 4M5YH 5BQ7B 2EDRA 1KPRB 3PWPE 1X5HA 4RIRB 3PL6C 1A3LL 2ARJQ 1PFCA 4WTWA 1VPOL 3BAEL 3T04D 1WIUA 4R4FH 3P0VL 5KJRH 4Y4HA 3LRSA 4M9PA 4WWID 4P2OD 4YH6A 1BVKB 4QCIB 4Y1AE 2OSLB 2WUBL 3FT2A 3UMTA 3QG6A 2J8UB 4C83A 1M71B 4XVSH 1P2CB 4ENEC 3U7AA 3ZLQC 3FQNB 4FQHA 1D5ZB 3HAEB 1J12A 1PKQA 2HFGH 3B4NA 4XPFH 2NY0C 1MWAB 4HXBH 2NW2A 5F7EL 5HYJE 3NA9L 1KN2L 4NN6C 4Z7NE 4OZHA 2F53A 4I9WE 5EU6A 1F6LL 5DUBA 4HXAL 1D9KC 2NMSA 1I1FA 5HD8C 4WO4D 3MRCB 2JJTC 5C70A 3DXAD 2F74B 3VA2C 3KJ4C 1ZHBA 32C2A 3WL9B 3BP5A 1CFTA 5CEZD 1KF9B 3JV0A 4G42B 1FNFA 3QIBA 5KSUB 1LQSR 4HIHB 1G6VK 1P53A 4XPTH 4PJDB 4U6XB 4LPUA 1QHPA 1A9BB 2EC8A 5FO9A 5C0ND 4M61A 3OKYA 4DN4H 5F9AC 2OXHA 3EGSA 4WI6A 3LKPB 2J8UF 4H5SB 4MNHB 3DVGB 4N8CL 3X11A 1CGUA 4N0FA 5TH2A 2OJEA 4BH8A 4HGMA 4X6FB 3FZUD 3BPOB 3MRGB 3QXDA 2R8SH 1AGDB 4PJAE 1G9NL 4GUPA 2CLRB 1RUMH 3MRPB 2F53E 5FYKU 2Z92A 1BBDH 2X1XR 3I84A 1AO7A 3O45A 1WCQA 1AIFB 3GSXB 4EJ1C 4XVSL 4DGYH 4P9ML 5F9WB 2YOCA 1O0VA 5IMKB 25C8L 4PV9B 5E8OA 3IFPA 4M9OA 5IBTH 1FFQA 4YFDB 3FAXA 1A6UL 4K94L 4PJBE 3OMZA 2XV6B 1JF1A 4LARL 3WO3B 4G7VH 1YDPA 1U8PA 1A1MA 2AV1B 3K2UH 3RA7L 4I0PD 4NQCB 4MXQD 2LFGA 2D7TL 4ZOAA 1N5YL 4LBEB 1QKZH 1IRAY 3IU3A 1S3KH 1DQDH 1T1ZA 1V7NH 5FYJU 2A6IA 2G75A 4MAUH 5JR1L 4ONFH 2VERN 4X7SH 4J6RL 1PSKH 4LASH 1UKSA 4YNYB 3WUZA 2VABB 1MCPL 1JHLH 4YHZL 2A38A 4JDVA 4DQOH 1RZFH 2BZDA 4YO0A 5IB2B 3VG0L 1WC7A 2Y25A 3OAYK 1OAKL 4ODVL 4MD4B 1OLZA 1RUPH 3UTTE 1T20A 2DL2A 5E1HB 1YEFL 5EZIH 1ADQL 3CFDB 4P5KA 2HG5B 4QHUA 3TT1L 3KLAB 4KVCH 4R7DB 4F37K 3KYMB 5IB3A 4FQXD 4JKKA 2DLFL 1DBBH 2X7LA 2DKSA 5JXEC 4FQIL 4Q6IA 2EDHA 3BUYA 1C12B 4JFEA 1WBXA 1A22B 4JM2A 2FBJL 4YDIL 2W60B 4XXDA 3L3HA 2Y06H 4HIHA 3U46A 1BP3B 2AKRB 2K3TA 1I7RB 2VXVH 3ESVF 1WFTA 5FK9B 5T3XD 1RULH 1MFCL 1W0VB 3OX8A 3RWFB 1KPVA 4LCUB 3BJLA 1KIRA 4GG6A 3LV3B 5D96B 3SQOL 4JFQB 2IANE 1AGDA 1LP9E 3T8XA 2E7BA 5D5ME 1CD1B 4AJ0A 4O2CA 4HX1B 1TQBC 3MRGA 5I1KL 5TQ0L 4KJPC 3P2TA 4Z6AT 2L0DA 4ZUVB 5C9JB 4PJAB 1IGTB 1YJDH 1MFAL 3NACH 1FPTH 1JYWA 4LVHB 1I1AB 1T2QH 3DX7B 3U48A 3BVNB 1Q9LB 2I5YH 1A7OH 5C6WH 1KT2A 5IFJA 4GAJH 1ZSDA 4WI8A 2WUCL 5D4QA 4L3EA 4PRDB 3HPJA 4PJDE 3K8LA 2EIZA 1H8OA 1V05A 3U36A 4PP1D 3RL2A 1S5IH 2ZUUA 3QUML 3CU1A 4CVXB 3V4PL 3GKZA 4CW1A 3C5JB 3MLXL 1Q72H 1FNGB 3HI1A 1VEPA 5J7CC 4WTZA 4J4PC 3NGBC 5F7HA 5E08L 4KZEH 1RZFL 4CGTA 1J8KA 3CXHJ 1TNNA 4QGTA 4BH7B 2DQTL 1J86A 1U2HA 4AL8L 5HJ3A 5D7JD 4OF7A 5ANMB 4NUGH 2HJFA 3LKOA 2H9GA 4NQXA 1N5YH 4NO5A 3HI6L 2A77H 2W9LA 3TA3D 4H0GA 2IJ0C 8CGTA 2QADB 2YD8A 1T5XA 1B0RA 4OD2A 2DDQH 4OZ4B 4QRRE 1V8HA 3QAZC 4GQPH 2VDQL 2CRMA 3IJYB 3A6BL 1K6QL 3BP7A 1S7SB 4P2QE 5CEZE 5JO5B 3VGHA 2NYYD 3LRHA 5I75C 3TBSA 4LAJH 2RAMA 3N1QC 1JWUA 3ZT5A 4CUCA 3QG7L 5K9OA 5D93C 1DN0B 2MHAB 4C59B 4KI5D 4I0PA 2H26B 3S34H 4L4TE 5ABDE 2I07A 1L0XA 3CZFA 1RMFL 1S9WA 2CRYA 2FX9H 1S5HB 3BO8B 5D6DC 3NFNB 1FFPA 3NFSL 5TGBB 1TVDA 3MLYL 4IRSC 1K8DA 2HRLA 3NZ8B 1KLUB 1WEJH 3D0LB 1M05A 2FX8L 3TF7C 2ATPA 2J6EH 4OZGF 4N9GA 2BY3A 5HTSA 5B8CC 1BJ1H 1A14H 2VQUA 3B9DA 2K9UA 1FAKT 1MFBL 3G08B 4HV8A 3QJFB 4OCWH 2PN5A 1GGCL 4G7YH 3NOIA 3SKMB 4PP2A 1GGTA 2F15A 1FC2D 2A83A 1IAIH 3MLWL 3MGOA 4RFOL 1J0HA 1J88A 4XPFL 1D6EA 4KH2A 1WUNT 3O6FA 1CXLA 5A3IC 2YRZA 5AWNH 4HGWB 4QHLB 3MLVL 5DK3A 3QAZB 3U7YH 3KPQB 3SDAD 1IKNC 1MCWM 1NQBA 2BVEA 2CO7B 1G0DA 4LFHD 4PJ9A 5E0QA 3VXSE 2X1QA 3UJTH 4MA3B 5E03A 4LOUD 2DLEA 5GGRY 3V5KA 4Z7VB 3BYYA 2GFBA 1UT9A 2EDWA 4D9RE 3ARRA 4O51A 5BOZG 1T5XB 3DX8A 2VR5A 1CFQB 1PBYA 1NMCC 4M7KL 4XMPL 1MLBA 5IQ7H 1X7QB 5JQHC 4AQOA 2QBWA 1OAUH 3HCVB 1OT1A 5D7IE 1B90A 4HLJA 2WP3O 5MENA 1JNLL 3PWNA 4ZUUA 1U3HC 1KB5B 4LLQA 1WZMA 1IC7L 4POUB 4ZD3L 5C0IB 1JHKL 3IXTA 5HI5D 3VXME 5EOTA 3TCLB 5J12B 3UYRH 3V6BR 4LF3B 5CWSB 3LIZL 4P46A 2X4OA 5H37G 3IDYC 3SPVA 3CVIH 1T7VA 3GDBA 4WHYH 1FFPB 5CFHA 1FFOB 2VZOA 1K6QH 5EZJB 1EZVX 4I0KA 2CIKA 4QTIL 4JN2A 4OBSA 1DJSA 4JAMB 3O6MH 1UM6L 4XNYL 4PRPB 1XIWB 5CINH 3FZUC 2ADIB 1XIWC 3DXAB 1MI5B 2O5ZH 4BSVA 1G7MB 4FZ8L 3FB8A 1ORSB 2KBGA 5DQ9B 1I7TA 3QEHB 5HGAB 3HHRB 3JTTA 2JJVA 3VWKB 4M43L 2QR0A 4JPVL 3CXDL 2C5DC 1Q0XH 1ZANH 1U8NB 3EJZC 4HX1A 4OQTH 4HWEH 3FQTB 4PV8B 3DWTA 5E4EB 3RGHA 4Z7UB 1EUTA 1J1XH 2V7HB 2VLLA 2ZOKB 4HG4K 3LKSA 5BZWB 2OL3A 3ULUF 5C86A 4Q0XH 5IUSA 3NIFE 4X4MA 3RUGF 4P2QB 4HIXH 4IDJH 5E7FA 3TT1H 2FJGB 2GFBB 4U33A 5FGRA 4N1CA 4KGJA 1BQLH 4GRMA 3BIAX 3FO2B 5MEOB 4K7FA 1P4LA 3QUMH 1QQDA 3HG1A 2E27H 3VXSA 1PEWA 5JDJA 1D5MB 2ITDA 4LPXA 1F4XL 5DD0H 4K3GA 4ENED 3VFTA 3MRLA 1HHJA 4F58H 1YMMD 3GGWA 5F44A 3W9EB 1ZS8B 3DJ9A 3WN5B 3MJ9A 4PTTA 4Y4KD 3B8YA 1FE8H 3HFML 1UCBH 1Z9SA 2AI0L 4F7EB 3GRWL 5C09A 2GIYA 5INDA 4FXKB 1ZGLB 4Y19E 5B21A 1PLGL 2D7PA 4UIKH 4KK5D 3O8XA 3BUTA 1A6VH 2CUMA 5I1KH 1RIHL 2CKBH 3RZCC 3VD4A 3CZJA 1MWAL 4JO4H 3I3EA 4EXKA 1NEZA 1RIUL 4KC3B 2ZCLH 3ULUC 3VFTB 5E94A 4NGHL 1YEKL 4YEFA 1PG7L 3EIFA 1CIDA 5DWUL 1TZIA 4LCWA 3RKDD 4NQCA 3MXVH 1A6PA 4LLUA 5ETUB 1PVHA 2PO6B 3VXMB 1WFUA 3EDJA 3DV6B 5F1IB 4M93C 2HH0L 3MR9A 1II4E 1QSEA 5I1GL 4KV5E 3KLHD 5D2LA 1FJ1A 4K2UL 1YNLL 1IC4H 1JBJA 1HHKB 3L3KA 2HKFL 1JPGB 1ADQH 1LE9B 5IGXH 2GTZA 5A3ID 4PJHF 2CQVA 1JTTA 1CD0A 5CJOH 1NAKH 3WJJC 2XN9B 1MY5A 1OD7A 4Y16B 3QIBD 4GO6B 2CDFB 4XH2A 2GAZB 2VLLB 4ZTPL 3O4LA 4LP5A 1RPQA 3RTQB 2GI7A 3NIFF 5D70L 4EI6B 3F6LA 1KPUB 2VDPL 3TPUA 1IBGL 2DQIH 2QQKL 2UY7A 4HS8L 2BY1A 2BOCA 4F57H 1T2XA 3DMMA 2OP4L 3ECBB 4L8SB 4RMUA 4V1DA 4ZFFB 4HZAA 1XF2B 4OD3H 4X7CC 3GSOA 2GTZB 1WZ1H 2F74A 1I3VA 1QYGL 3CDFA 4MQSB 5CZVH 1LEKA 2Q6WB 2IALB 1FORL 4WTXA 3O8XB 2LU7A 4FS0A 5IFJB 1G9MH 5JUEL 2DM2A 1YNTA 1DTUA 5TF1L 1BZ7B 1I8KA 4PJCE 3RGVD 5J56B 1A4KA 3AM8C 1NFDB 4PRBB 2IH3B 4MQ7A 1YPZF 1DEEA 3MCLL 2EIZB 1YEEH 1RJLA 3GI8L 3PIQB 1CGVA 1QUNA 5CJXA 1CXEA 2LV4A 4YHIA 1W0YT 3TNNA 2HWZH 1EV2E 3O2DL 3U0PB 1I8MA 1YECL 2HA1A 5ALBH 3KWWA 2FO1A 1P6AB 1T1YB 3HE7B 3KAAA 3CDCA 2HJKB 3DHMA 3V5KB 1CWVA 1K5NB 1NGPL 5IHZB 5HHOE 1HI6B 4HPOH 1NCBL 4QY8A 1S7XA 1N4XH 4FTVE 5T1LA 2EEAA 3QWRA 4ERSH 2X42A 3AVEA 1T04A 5KAQF 1E4WH 4EUPG 2ILLA 1EFXB 1OTTD 3Q2CA 2FH6A 3H8NA 3MUGA 3S34L 3MRFB 5JHLH 3O8XD 1AGBA 1RHFA 1F00I 3T1WA 4KK6C 4QXUL 1UWEL 4NQXB 5MEPB 1IGTA 2BCKB 5I6XC 1FVDA 4DOHB 2VDMH 3H3KA 2RIKA 4D8PA 1JWSA 5JHDD 2BNQE 2BMKA 4XTRC 5T1DH 4JPIA 1I9IL 2MCPL 4L1DA 4KRPB 1I9JL 4YBQC 2F54D 4X8JB 3QA3A 2GJZB 5I18H 4ISVB 5ADOH 1E6OL 1S7UA 5ID1B 3QIWC 4FP8H 4X7DC 1LWRA 3L5JA 1CLYH 4I18A 4NO0B 1RQ5A 5F6HJ 1KFAL 1HIMH 1BM3L 2I07B 2FJHB 2B2XL 4F7MB 4OI9A 4W6YB 1HE7A 1QRNA 5EIQA 4RBPK 3NFNA 4UI2A 3KYAA 1NGXB 2EDBA 3MLXH 4PLKD 2EIBA 4BUGA 5C0RH 1U8PB 1YMME 2AV1A 2XPGA 4BSWB 2VDOL 4UT9H 4PTTB 4EI5A 4P0DA 5HI4D 1S5IL 4OKVA 3TBYA 2JCCA 5T3ZL 3VE0B 1ZT1B 3PHOA 3UTSB 2LTQC 5BW7A 4Z0XA 1D6EB 5DMIH 3N50A 3WFHA 4XMLL 1P4BL 3QWOB 4UT7H 5I1CH 3KPOA 1F6FB 1S7SA 5BMFH 5JDSA 2FLRT 5D5MB 5D2LE 5IMMB 3BKYL 5J1SC 3BE1L 2WIMA 5DVKA 2EXYD 2O5XL 5AAMA 3X14B 3MYJA 1F3JB 1ZLUH 5FKAB 4JQXC 4NQEA 1JFQH 2YRLA 3MQIA 5DHVA 4Y4KB 2MHAA 1I1YA 5EZLB 4U6HB 1FSKC 3WIIH 1FLRL 4JB9L 3SKOA 1CDJA 4HJ0D 3L3GB 5KG9A 5T3XL 3OR7A 5TGBA 4ODWB 4PY7B 4JFXA 3RWDB 3GMQB 2X70B 1BAFH 1GGUA 5D1XC 4P48A 3SKNB 2P8LA 2BSTB 4FQXA 5L88H 3D48R 4RRPG 4KHXH 4N68A 3TVMD 5EU6E 4CBPA 1CIUA 3QFJD 3WFCL 3QNXA 4WIQA 3V79C 5KSBE 3MZTA 2YSSA 3F7VB 3DGCR 4GRLD 5T1LD 3OKOB 3WS3B 1F42A 4OZ4A 3ILQC 4HUMB 4BSJA 2QQLH 4WEMB 4JHBA 1BD2A 5JO5A 1T1WB 4HUWA 1YEHL 1C5CH 5A16B 4DVBB 4YGAB 1H3UA 5I1JH 4JHWL 4LIQE 2BX5A 5FA4A 3ILPB 3WD5H 4UIMA 1P9MC 2MTPA 1CFQA 1X5KA 1HCVA 4FMKA 2BXZA 4PY8J 5D5MA 4ALAH 3RZWA 4MAYA 1TZGH 5DMGC 2OL3H 3NIGE 5GGSA 1AJ7H 3WFBL 4WI2A 3JTTB 3VWKA 5J06A 4IJ3B 5JOPD 2H3NA 3PNWB 2XTJE 1FL3B 2BNRB 1RURH 5F21B 5K59F 3SDXE 1VGKA 3EYSL 2X4TA 4ZPTB 4MHHG 3U9UA 4UT6H 1S7XB 1HKFA 2DLGA 2R0ZL 3SGDI 2Z93A 4HK0B 4JM2F 5IG7B 1NBZA 2AEWA 1LO2L 5D93B 5TQ2H 2BSTA 3H3BC 3D2UA 3CU7A 3IDJA 3VFWB 2R2EB 2XZAH 4P9HH 4TSCL 5GSRB 1FP5A 4UT9L 1T5WB 2DTML 2OXGA 2FSEA 2JF1A 1B2WL 3P73B 4G8FA 4CMMB 1QSED 2R1XB 2PYEA 1QLEL 1U8JB 3OKOA 2E5EA 5TFSL 1QR1A 3IF1A 3LN4A 1NUNB 4HUVB 4M1DL 1IZJA 4LCWD 5JW3L 2EDQA 2KKQA 2WMPA 1NBZB 2Z35A 4Z9KB 1K3IA 5H94A 1AO7E 1DBMH 1WTGT 2DRUA 3KXFA 4G80B 5GHWL 2V9RA 1F4WL 1JGEA 4QRPE 2BOBA 5IROC 4NNPH 4LFHG 4RX4A 2DWEB 3AREC 1EJOH 1RUAL 4JB9H 5IMOB 1UA6H 2P4AB 3IDNA 4MLIA 1JZ3A 1KENH 1KEMH 2B20A 4OBRA 2A1WH 4I3GA 4R4FL 1JWMA 4DUXA 5DHYA 5AYQA 4NHCH 1PY9A 3FN0H 4M7LH 1A1OA 1ZE3C 3PNWA 3RZCD 1N0XH 1AXTL 4BQCA 4F15C 3ALWA 1FVEA 5H35B 3WNPA 3F58L 3QHFL 4Q7DA 4H8WH 4GKNA 5GS0H 2RGSA 3BKML 4OZFA 1AGEB 1OPGL 4FQQB 2R1WA 5T3ZH 32C2B 3WL9A 1D6VH 2V5MA 4RNRA 5B39B 3GBMH 4XBEH 1MJUH 4MX7B 3VI4E 5JNYB 4KKCD 2CLZB 3I75B 3UTSA 3JBG7 3GZKA 4UB0L 1ES0B 3VRJB 2B4CC 3QZWB 4BFIA 5EOCJ 5FB8B 1G0YR 4NN7C 5DVLA 4X6FA 4NKMA 4KKNA 3UDWA 4JY6A 3ARGA 3CLEH 1MJUL 3OJDA 3P4LA 3TNMA 5EUKA 4WNQA 5K9KA 3C6SB 3I2CH 2ZJSH 5D1ZA 4LAQH 4HUUB 2ZJSL 3T08A 1Q9WA 1ZWIB 4U1GC 1JZ7A 1QEWA 4I2XB 1GOGA 4PJHB 5KVFL 3GO1L 3BP4B 1LEKB 4LKCA 4ZQKA 5CJQH 4G6JL 3RKPA 1J0JA 3OAYH 4PJEA 3P0YL 4OCSH 4PRID 2CDEB 1AIFA 2P5EE 3KXFB 4NN5C 2Z35B 1ZHKB 5B38A 4OAWB 1DBJH 2N7AA 5FGCB 1IARB 4CN4A 4KKAD 3MLUL 1UJ3A 1EJOL 1RUAH 3GGWB 1QD0A 2J5LB 1XZ0B 3QCVL 1OTSD 3CC5A 4MDJB 1LK3H 3K3QA 1VCAA 4OCNC 1Q0YH 4FTVA 5DHYB 5FHAL 1VFBA 3AXLB 1A6TA 3HR6A 3RX5A 5BO1H 4AG4L 3RVVD 4NRXA 5LGJB 3UPAA 1N7MH 4YXKH 2X4PB 4AEHH 2Q8BH 1QBLL 2N4IA 2V17L 4JRYB 3O2DA 4EOWH 2IFFH 4NC0B 2WW8A 1ZXQA 1KJVB 4TQEL 3W81A 3NBNA 3LKRA 5IVXF 2HLAA 3TJHC 5BOPA 2MKLC 4QHNA 3TZVC 1CD8A 1Q9KA 4M8QA 3IU4L 3NCCB 1G7QB 2W0LA 5HHNB 3BD5A 1NPUA 3PWUA 1BOYA 3HR5B 5EUOE 3CFKB 3MV8B 3RWGA 1PKQB 1CK0L 1JNNH 4PJ9D 3FO1A 2ORBH 5F70A 1TDQA 2F5BL 1PYWB 3ZE0F 2YWYA 1CYGA 1F4AA 2Z8VC 1HNFA 4E41D 4YQXL 4OZIF 1QLEH 4ZOBA 1T1XB 3ARYA 5EBGA 4J7RA 1K4DB 5CZXD 1S9VB 3MJ9H 1F6AB 2VKXA 5EFIA 5C0CE 4OF6A 3MGTB 1HILB 5DJYB 1I8IA 3F5WB 1QFWL 2GHWB 3HNVH 5LQBH 5HI3C 1DANT 3RDTA 3QPQD 2X4TB 3QCUH 4FQXC 1IL1A 1UZ6E 4Z8FH 1DBKL 3X3GL 2R0ZH 4PGBA 2BDNL 1YQVH 4ZXBA 1JYNA 4F9PC 2CGRH 3QG6B 4PJ7E 1ZTXH 5FGSA 4GXVH 2R2EA 3QQ9D 4OLXH 3VCLB 4Y4HB 1XGYL 4I9WD 2BSSB 4M1CC 4OQTA 2VDRH 4FXGA 1FZKB 2GJ6A 4NRZB 1CXFA 1FHGA 1NKOA 3DUUA 4D9LH 1M4KA 1QRKA 4LSTL 2A6KB 4N0CD 4GW1B 2L7JA 1B0GA 3FQUB 2AEQL 3QDAA 4U3XA 4TUOA 1PG7X 1UG9A 5I1JL 1V3JA 5F3BB 2CKBB 2A9NL 2H2SC 4OZGE 2JJUA 1EK3A 1FG2A 2CR6A 2N56A 3AAZB 2XRAL 1YEHH 1WITA 5F96L 4BM7A 5EOCL 3UJJH 4E41A 2XWBA 1KJ2H 1BOGB 4PJ7B 3MGAA 3BKCH 2E8YA 1EFQA 3GMQA 3ARQA 3KYKH 5DD1L 4XC3L 2C7UB 5EUOF 5DD3H 1WZKA 4JFEE 5KG9B 4NO3B 4ODXA 5F72S 2JJWA 1XEDA 3BDXA 1YY8B 1UACL 1EMTH 2DQCH 2G9HA 2HVKB 3FOMA 1G7PA 4JZOB 5AD0A 2NX5D 4P3CL 3QI9A 3C09B 4OKVB 5EOQL 4D3CL 1N6QH 1NFIB 1H15A 2IAMB 1Z0MA 5DSCA 5DK0A 2MOVA 5I0ZA 1CDYA 5IVXA 3OV6A 3MRDB 4O5LH 1PG7H 2DMBA 1QHOA 4G6FD 3KPOB 1YYLL 3CZFB 4JM4L 1X4XA 3N9GL 4HS6B 2DQGL 1F3JA 1BGXH 4FNLL 1OP3K 4NKIH 1JFQL 1GH7A 3CPLB 3MBED 4RMWA 1DLHB 2NY1B 1KJMA 4NSKA 4JGJA 4D0DA 3L6FB 5C92A 1UENA 5D1ZC 4P2RE 4X0KA 5IQ7L 3GKWH 3QIWB 3T0AA 1OAYH 1OSPH 4O02H 2E8ZA 2QHRL 3D5OF 3G9VA 2L7UA 4WFFD 1HSBB 2NR6C 2ZG3A 3JUYA 4D0CA 2NY6D 1I1FB 1WZLA 1QSZA 5GJSL 4LHUB 1KTLA 5C0JB 1J8HE 3G6AB 3RQ3A 4P5TD 1QFOA 4J23A 3MRNB 4PJFF 4WUUB 2E7LA 5BJTA 3OKDB 5C7XH 5KS9F 4XNQB 3I6LD 3PV7A 1IVLA 3BSZH 4GKSB 1FZMB 2FH8A 3GUTA 3RWHA 4KY1L 1QA9B 1W0WB 3VE0A 3NCJH 5EN2B 4FZEL 4BJLA 2FHFA 4WEBL 5FDYA 1EO8H 3ET9F 5ESQB 1BVKA 3O2WL 2VDML 3T0EE 5D7SH 3HKFA 1KBGL 2F9BT 3WFEL 2B8OT 4AZ8A 1A7PL 4OUUB 2H45A 2D31B 1MCNA 2QQQA 1BFOB 5ITBL 2WV3A 1A4JB 1AGFA 1VFUA 1VGEH 5DJXA 2VNCA 1WEJL 3WXWL 3B6SB 3FRPG 5T5NF 3DNKA 4CKVX 1X5IA 1HH9A 3HZYA 2DIBA 4H8WC 1VB9A 1J5OH 4LHJB 1KG0A 3FQXB 1GZPB 4HPOL 3ZL4L 4F80A 2ED8A 3PGCA 4LSQL 2ZCKL 1CTOA 4XVTL 3QO1A 4LCIH 3TYFB 4YBQD 3BZFB 4J1UA 1FNEA 2X4RB 3S88L 1AXSA 4JFZH 1A6AA 1SY6H 5M94B 1L7IH 2MPAH 1NAMH 1IC1A 2IWGA 3WKML 2WWKT 3SE9H 1OGTA 1L7TH 3U7YL 4KVNH 4HH9A 2ZWLT 1RZ7L 2ZOKA 1G9ML 1GOFA 5ALBL 2VXSL 1IAIL 1M05B 1J0YA 4RFOH 2OZ4L 5EBMA 3ROLA 1IGCH 2Q6WA 3OKDA 1TNMA 1YC7A 3STZB 3OF6A 4MWFB 1EEZA 2HVJA 4JFHD 4QRPB 1P84J 4KV5F 4ZUWA 2Y7QA 3PQYA 3QUZB 1U91A 4YGVB 1CLZL 3BI9X 2ADJA 3Q1SL 2DQEH 3D39D 2NCMA 2J8UE 4JDVB 5I18L 2YXFA 4KZEL 2VH5H 3EUUA 1W2KT 4X4ME 4HDIA 4ZO6A 3WEXB 3ABZA 2XQYK 4Y8AA 4NUJB 5DDHB 5CKAA 2G5RA 3BT2H 3VXNB 4H20L 5D1ZB 2VLKB 5J1TC 3ARBA 2QKIA 3QCTH 4TRPH 3DECA 5INCB 1B4RA 5CSZB 4RGOL 5FV2A 3STBA 4WU5B 4YDJB 3CD4A 4HMDA 3DSNA 3FQWB 5E5RB 5EU4A 5IB4B 1QLFA 1AHWC 3A67L 1AKJB 4M03A 3QDJD 1D9KD 3DX8B 1QZ1A 4JFYA 3UDWC 2EXYC 2BP3A 4G6ML 4GLRH 3GSNB 1E4WL 4J3VA 5GISL 2HT2D 3MOBL 4WEUD 3RVVC 1TJHH 1AY1L 5C0AD 2NYYC 5FAAA 5T1KA 5KVEL 2E7HA 2HT4D 4R4BA 5HPOA 5ESVB 1EHXA 1G7HA 2NY2B 2P24A 3TO4C 5HXMA 3VXTB 3O2WH 4KZDH 3T1FB 4C57C 3RWCB 5JXAH 2OR9L 4HJ0C 4JKPH 2FIRT 2OJZH 4NWTH 5HHPB 5F7FA 4L8CB 4G42A 2AJZA 1NUFA 1EEZB 2HVJB 4N0YL 2NTFB 3TVMB 1IFHL 3PV6A 4X99A 4U49A 5L2KB 3ZO0A 2IMMA 1QEWB 2F5AH 2R39A 4JJ5A 3KR3L 2UWEF 3VFMA 4LEXL 2WQRA 1MCOL 4KVCL 5HYFA 2UZIL 4TOYH 3DROB 3EYVB 1Q9LA 3MRDA 1RUPL 2D9QB 3TN0A 5CZVL 4WRLA 1U41A 1JGVL 3C2AL 4JFOA 5L7XL 4JFFD 3ZE1F 1IAMA 4LSRL 2XXMB 1INQA 5D1QA 4NHUA 4OLVL 3IFLL 5E2WH 5DFWH 4JKMA 1UCBL 3RL2B 1HHGB 3DX9A 5I8KH 3Q48A 4OSUL 4UTAH 4UAOB 2HJFB 3LKOB 4KWUA 5BJTB 3IFLH 5E2WL 3F5WA 1U8LB 1U8HB 1BF8A 3PL6D 4RGNE 4MNQA 1PEZA 3IKCB 5J4MA 1CBVL 1JYXA 1S9WB 5IT2L 2YEZB 2X89D 1J11A 1MCEA 1D7FA 4Q9RL 2P8MB 4J3WA 2BERA 2QQNH 1NMBL 4LPVA 1FL5B 4LCCB 1BEYL 4Q0XL 1IGJB 3ARWA 4KTDH 1SBBA 1A7OL 3L7FB 5C6PB 3O3AB 3OKNB 1DQML 5J8OA 2Q76B 1NBYA 1MHCA 4I77L 3FTGB 4JM2D 4NO5B 4LNRA 1QO3A 3WYRA 3CXDH 3T3PF 1G9NH 4N8VA 5J3HD 1W8NA 5L6YH 2HJKA 4HV8B 3O3DB 4JHAH 4CJ0A 3LPFA 4TNVK 5IBLC 1KCRH 5HHVH 1FIEA 5L8KB 2ESVB 2APTA 4QXTA 3SHSA 4PG2A 1HSAA 1IQDA 1G6RA 3ZKMD 3HMXL 5HGDB 4XP4L 2V2WA 1BIIA 3VMOA 4MDIA 4PRHA 4P5KB 5I15L 1JJUA 4UU9A 2BY0A 1LVEA 3O8XC 3K8MA 5JQ6H 1WBXB 4QKXB 3N1GC 5EO0A 3L95A 3P40A 2XTLA 2VAJA 4D9QE 3UYRL 1GGBL 3UO1L 2ARJA 4RAHA 2DAVA 3S35H 4KDVA 1F4XH 5DD0L 5F3HA 2RFXB 3X3FL 1MHEB 3MRHA 4OLZH 2J88L 5IR1A 5IBTL 4E5XB 3BZ4B 1QPXA 3RL1B 3QUYB 4LCCC 4NOFA 4WUUD 3W9DA 5I2IB 4D9RD 4KTEL 1PZUB 1AO7D 3RNKA 3B2VL 3PWLA 3LKQA 4Z78A 4G5ZH 4HIIA 5CMAA 3MLVH 1MEXL 3O4LB 5CD3B 1A3LH 4EIGB 2FD6H 1JMXA 5K9QG 1Z2KA 3D69A 4JLRB 5TDPB 1KC5L 1QFPA 3L3DA 3MRBB 4IRJB 5GRJL 2OJZL 3PGDB 2OLDA 3T0WA 1ITBB 2FATL 1PJ9A 3AREA 1FN4A 3C09C 2UWEA 4URTB 4F3FB 3UTZB 3ARBD 1XAUA 4ONGH 3SGKA 3GMNB 2W0FA 1KCUH 1JN6A 3HE6C 4Z7VA 1XR9B 1J0IA 1WFOA 3LN4B 2HYMA 5IW3A 3WFHB 2JTDA 1D5ZA 2J7LA 3IDIA 1CICD 4IRJD 2L4OA 5JMOC 3WUWA 5IKCB 3L3OA 4OCWL 5DQ9A 4ZXBB 5B4MD 2PXYD 1LD9B 3EKCA 4G8GA 3BP5B 2C3XA 1DQJA 2F5BH 3C60B 3VFSB 3ARBC 5I66A 1N2RB 5DJ2B 3GMOA 3S4SG 3O11A 4XI5C 3SGDH 4M61B 2ZUQC 1FVCA 3W0WD 5BVJA 3NCEB 1LO5A 4FXGB 1G6RL 3LPGA 3HMXA 4FQ2L 1MCWW 1GGIH 1RU9H 1SBSH 1F45A 3QXDB 3A6BH 4HBQA 4MZ2A 4X80H 1FCCA 2R2CA 3GSWB 1RMFH 4KMQA 3U6RA 4P99A 1UEMA 4OD2B 5H94B 3RWDA 3X11B 3OKLA 4NFDA 5DJ0A 5CHNB 5GRJH 4H88H 1DE4A 3HZVB 3JZ7A 5LG1A 1YC8A 5ITBH 4KK8D 3HC4H 3KJ4B 4YXKL 1EHLH 1ONQA 2Z91A 1IAKB 2CLRA 4QOKB 3TA3A 4XPBL 4ZAKC 3WMSA 1CQYA 2R0LL 3I75A 4I0PB 4NQCD 5KVGH 5D7LD 5I16A 4R0LB 3VXSD 4AENB 5I1AB 4FN0A 3H9HB 4MJID 4NZJA 5FO8B 4X9IA 3FO9B 4QF1A 3FFCE 3MA7B 3NCFB 3QUXD 4G6JH 3TIEA 3IDMB 5DT1L 2AJ3A 4PJBA 3S4SB 1SY6L 5KTEH 3S37L 2YPLB 2YD9A 4KRPD 3O6FB 2IBZX 5L8LB 2OMNA 2QV2A 3WFDH 3HUJB 3SCMB 5IHZA 4U6VL 4OZHB 3ZTNL 4PP2B 3MBXL 5I1AA 2AEPL 1ORQA 2CJUH 5K9KB 1MFAH 1NDMA 1U42A 4WW1B 3HAEH 4M48H 8FABA 3U9PL 4P5TA 2IF7A 3ULUE 4I0CC 1QOKA 3V52L 4C56A 4MDJA 4A6YB 1SJEB 4NZRH 4NP4L 3LY6A 1A7QH 1KTDB 1T6WA 4HT1H 5D72H 4ZDHB 1J87A 1XCTB 2KZ1B 2OZ4A 5EU7C 4U1LB 4ODXB 2HT2C 2MFNA 3GM8A 5C07A 3SE8L 5K59E 1OGAB 3C60D 4NWUL 4XRCA 5SX4I 4JRXB 1NKRA 4D0CB 4PJCA 4XCEB 2QSQA 1LDSA 1P7HL 3VD5A 3D2UB 3HE7D 4C4KT 1CBVH 4M6NL 2NY3C 2E3VA 4H1LH 4MJ5A 3MRKA 1KT2B 4MNGA 3O41A 3KPRB 5TE4L 1EHNA 4X4YA 3FJTA 3OL2A 2AEPH 4JZJB 3R8QA 1S7TA 4KJYA 4BFEA 1NJ9A 1KJ2B 5GHWH 3CK0H 4BUHA 3SDAC 2E9BA 4CN6A 2OK0H 4WI5A 3D6GA 1HQ4B 5ITFB 1MI5D 3TIEB 3MRCA 2QHRH 2DJUA 4XWOC 3NFPA 2FB4L 5HYJA 5L0QC 2R29H 2E6PA 2R4SH 3TZVB 5TFSH 3O4LE 4PB0L 1H3XA 4U1HB 1T1ZB 2VJXA 2MMXA 4LPCA 3AS1A 1AO7B 1K4CB 3RX7A 1XF4A 4UBDC 3VXUE 2AK1H 3K74B 4KHTL 4X6CF 3WHE1 2BNUB 4K94H 3SDCC 1SHMA 1FV1A 4QHKJ 4L5FL 1WQVT 2GCYA 5L6YL 25C8H 4MNGE 1Z9MA 1CDBA 4NWTL 5F7KC 1JF6A 3K1DA 3UZEA 1NDMB 3NZ8A 2NXYB 3H0TA 5EU3A 4D9LL 1XGTB 3SDCD 4Z77A 4UT6L 1U8MA 3ARXA 1T1WA 2J6EA 3HPLA 2I5YL 4NWUH 1KTDA 1BMGA 1I8IB 4LSDA 4KTDL 1F8TH 3BDYL 1GC1C 5BV7H 1N6QL 4YLQT 4Z78B 3NTCH 2XN9D 4R0LC 4M1GH 4HFUL 4AIZB 2NY7L 1MELA 2FZ3A 1FAIH 4JRXA 2GY7B 3MLZH 4LQ1A 1HXYA 3OR7B 4P4RB 2C3VA 3MACL 4GSDH 4LKXA 1AC0A 5D9SB 5TDOA 3H0TB 1YUHA 3ARFC 4MJ5B 4RDQF 3NPSB 3ROLB 2W38A 1Y6NR 3N1MC 4JHWH 3SKNA 3BKCL 1HHJB 3VGDA 4MXQC 3BGMB 5D2NB 2ITCA 3W0WA 3FRPA 4APQD 2C1OA 5C3LD 1HYSD 4WV1B 1X5AA 3FB5A 1R3JB 4QY8B 2XRAH 4L3CA 4CMHC 4DEPB 5L7XH 3IKCA 1UM5H 3F7YA 4WI4A 1QFUH 1T7WA 5DVOA 2EDFA 1JNNL 1RZKC 4TNWK 4YUEL 3MLRL 4XC1H 3FAWA 2Q76A 3QDMA 3C8DA 1U93B 2FGZA 4KU1A 3BEWA 5A2KH 1Q8MA 2FECI 4XHQA 3RX8A 2DICA 4C83B 1T5WA 5DMGD 2FLBT 3X12B 3QXAB 3T4AB 1CXKA 2QKIB 3GBNH 3IS0X 4N8VB 4KHXL 4Z7NF 3ME0A 1L6ZA 1HDMB 4LHUD 5TDNB 4JFPA 1DFBH 5M95B 4X6DF 3TPKA 35C8L 2WAHA 3MLPA 4PIRF 4KUZL 3VFGH 2FD6L 3NMEA 3VA6A 5IM7A 3QFJA 3I6KA 5F6HI 2PYFB 4JG1H 43CAA 5E8DL 5HYEA 4NQUA 5IVXE 1U91B 4YGVA 1UKQA 2KPNA 4L4JA 4NO0A 3M07A 4NN5B 1SBSL 3BIKA 1WGOA 4PJIE 3LEXB 4GH7B 4XGZA 1DZBA 5LXGL 1GSMA 4K3JL 1N6UA 4XCCL 1AFVH 4M5YL 1I85C 2KL6A 1PX4A 4LSQH 5DURB 5JW4N 4Z76A 3V2AR 1KIQA 3Q6FB 4PJGE 5HGBB 1XFPA 2W9EL 5CEYA 3MV9D 1NGYA 4IRZH 2IAMD 3EZ8A 1OP5K 1IKFL 5GS2H 4LAQL 3HCVA 1GZQB 1SJXA 2A6JA 4OFKA 1R24B 1I1YB 4XAWH 4JJ5B 3HMXH 2JB5H 3M8OH 3PHOB 3AB0C 4HKBB 4LLDA 4GW5B 2IH3A 3VXOA 5EBWA 2PTUA 5ESAB 2P5WD 2YC1A 5KSAD 4MCZA 5I30L 1A7PH 2QEJA 4IRJA 4TSBH 1XF5B 4HXAH 4B5EA 4ODSL 4JLRA 4GJTB 4LVNC 4PTUA 5GS0L 3KPMB 4NCDA 1T66D 3ROOB 3JTSA 3IDNB 2AXGA 1OLLA 3QH3B 3GSNA 3S35X 4YHKL 4AEHL 4EDWH 2DQUH 2G60H 1OARH 4TUKL 1H0DB 4U6HA 2BSRA 2XG4A 5DJXB 1MCBA 5D5MF 5I73C 3MCKB 1MCKA 3QEQE 1DL7L 1QRND 2PF6A 3VFPA 2AJSH 1UC6A 3PJSB 3QCVH 2WBJD 2IPTL 3SKMA 4KK9C 3FFDA 4CRPA 1EVTC 1C16A 3Q5YA 4EXPX 4X9HA 3QEQB 3A6CH 1UB5B 1BQHA 1KENL 2FCBA 1OGAD 2X1OA 4KDTC 3MUHL 5LKNA 5ILTL 3M17B 4YXLL 2BVUA 2NY5H 1M7IA 2F54A 3HE6D 2BRQA 2BY2A 3PV6B 3UC0H 1RJZA 5SWZD 2YSSB 2V5YA 4GAFB 4PJIF 2H1PL 1NCCH 4JPIB 2YD1A 3WLWD 2HFFA 4WW2B 4ODUB 2O5YH 1G7LB 5IBUB 1CG9B 4FA8A 3H9SA 3GIVA 1IQWL 4P2RA 5BRZA 2BXYA 3HC0B 3UTSD 2AVGA 3I9GH 4OCMC 5ICXA 1R3LA 2X4SB 4MGXA 4LOUC 4Y2DA 1AHWB 4OZHF 2F19H 5D96C 1RI8A 1WCBA 5MEQB 5FO7B 3BKMH 3SO3C 4M7ZB 1UGNA 1EERB 2BNQD 4OJFH 2ADFH 2E9IA 1FL5A 3IJHB 3T0DA 1G7JB 1N59A 4U05A 4PJ5A 3O9WC 4A6YL 2ADGA 4M7LL 3O6FD 5DQJA 5I76B 2X05A 3BSZL 4XZUA 2FNBA 3HTLX 3P4NB 1G1CA 1NGXA 5C6TH 4YPGB 2RJMA 3MV8D 5I9QB 5T33H 1X5FA 3G6JA 1K8IB 2XWJB 2OTUA 1PZ5A 3U83A 1QBMH 1P84K 1YEGH 4JO2H 2R23A 3VXQB 3MMEA 4ZS6D 2RB8A 4DGIL 3RPIB 4Y16C 3OB8A 3QUZC 1CICC 1ZT1A 3DXAA 4WU5A 5ACZA 1U8IA 4LDOB 2BSED 3DMMC 3VI4F 3U6RB 1KYOJ 2DIJA 4GBXC 4HDIB 4HWBL 1HNGA 2P44B 1SY6A 1VERA 3EDDA 3U7WH 3BESR 4EEEA 5B38G 3DVFA 4M02A 3HN3A 4N9OB 5A2LH 3NIGF 1CFSA 1AE6H 3KPPA 3BH8B 4LSRH 5DRZB 3JWDL 1J1OH 2XWTB 4JDZB 3WO4B 4HUXB 1R3IH 4S2SA 2OL3B 4L8BA 4FABL 1TCRA 3BD3A 1KJ3L 1BWWA 3MLSL 4MAYD 5EC1A 5E8NB 2EIDA 2Q3AA 1J8HB 1JUFA 1E28B 1EBAA 1XGYH 2BVPB 3RWGB 5F7NC 4Z7UF 5IKCA 1H3PH 3CAFA 3EFDH 2X4SA 2CGRL 2MQCA 4A6YH 3HC0A 3MUGB 43C9A 5L88L 4UDTB 4PJEF 4RWYH 5I1GH 4KZDL 5CUSH 3FN9A 2WANA 5DEGA 3B9KD 4NNYA 1F4YL 2H32A 3OXSB 3QUMB 4XVJL 4PP1C 3IJHA 1A6ZA 2XQBH 2VLJA 1UXWB 1AY1H 3QZWG 5FUOL 1IEBB 3G04A 1AI1L 5KVDH 2QTEA 3QEHA 5DZLA 4Z95H 5JLZA 1BZ7A 1I8KB 5DQJB 3TM6A 3HZYB 3KPTA 4A2LA 1TITA 3C5SA 1G7JA 3QQNA 4YWGH 3FQTA 4PV8A 5GRUH 4UNTA 2V7NB 4NJ9L 1TIUA 3V7MA 3DHJA 5L2KA 4E0RB 1AE6L 1WAAA 4L8SC 3KYOB 3UC0L 5JORB 2OTUB 2BVOB 2W9DL 1DVFA 4YHPA 4Y5XB 3D18B 1KIPB 4HFWB 2G5BA 3TC9A 5M7QA 2EH7L 5CLTA 3HE7A 4BZ1H 5HVFB 3PABA 3G08A 2NY5L 1P4BH 4QHLA 1OQOA 3BPLB 2R56L 5I1HL 1T0MA 4ZPVB 3KPSA 4TULH 2EKSA 5GSVA 3RKDC 1ZHLB 1TJIL 2AK4D 4BZ2H 4HUUA 2YPKA 1YQ2A 4HBCH 2H8PA 2Y7QB 3PQYB 4HJJH 4HQQH 5EU3B 2DWDB 2LU3A 1QBLH 3Q1SH 2XNAB 3PWPD 1CU4L 1A0QL 1I3UA 1IZKA 2Z4QA 3QUKA 3BW9A 3ZE2F 2PTTB 4XMKH 2W0PA 2VXQL 1WF5A 1UWXH