5GISL

Crystal structure of a fab fragment with its ligand peptide
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
211
structure length
211
Chain Sequence
DIVLIQSPATLSVTPGDSVSLSCRASQRISNNLHWYQQKSHESPRLLIRYTSQSISGIPSRFSGSGSGTDFTLSINSVETEDFGMYFCQQSNSWPFTFGSGTKLEMKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heavy chain of Fab fragment
publication title Structural basis for multi-specific peptide recognition by the anti-IDH1/2 monoclonal antibody, MsMab-1.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 55
structure length 211
sequence length 211
ec nomenclature
pdb deposition date 2016-06-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5gisL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5gisL01
2H2PD 2DQEH 4PTUB 4ELMB 3QIUC 1J1XH 4FN0A 4FP8H 3QDMD 4V1DB 1Z0MA 1L9NA 3IT8D 1X5XA 3ARXA 5AG8A 2WBJB 5IBTH 4XRCA 5CGMA 4KKCD 4LRIC 3L3KA 4MXQC 4GUPA 4HUVA 1OW0C 2BOBB 2UZXB 4KQ3H 3UP1A 2DLGA 5E2WH 2JKXA 1TVBA 3RL2B 1MCJA 4R4BB 4PJBA 1FZKB 3OKLA 2FSEB 4CMMA 3LPFA 3NAAL 3TO4A 5BV7L 2BNRD 5IW3A 2CDEA 3CH1B 1DFBH 4NO3A 3CXHK 4P4RA 3X13B 1FFNB 1U92A 3O6FC 3QCVL 1BEYL 3B3IB 2Z31C 4APQB 4LHJB 4D0DA 4K07A 1VPOH 4MS8D 3FT3B 5I1AB 1WFOA 3QO1B 4MMXC 5EPMA 3GMNB 3CVIL 1MCRA 4KXZH 3KXFD 4YHMH 1I1FA 3SGDI 2E9JA 3MLRH 3P0VL 1MCLA 2YZ8A 1CG9B 4LSUH 4YC2C 1OTTD 5ESQB 3RA7H 5CD3B 3EOYG 4X7CC 4EN3C 5BO1H 4WGVB 4BFIB 2ICEB 3QQ3A 1A64A 2HT4D 2EYRB 4MAYB 1UM4H 2OL3L 2VQTA 2J8UF 3MGTB 4JR9H 2HFGL 5GZNC 1S9VA 3WS3A 4UTAH 1SEQL 3ZDXF 1OCWL 1IC7L 4YUEH 6CGTA 5JO5A 2GSGB 3DTXA 2XOTA 3O6ML 3MFFB 5D7JC 3U48A 1SVCP 5CIPA 1KTDB 1UKTA 1S9YA 5K59F 1WZKA 3TO2B 2Y36H 1HYRC 4TN9A 4WHYH 2QQLL 4RSVA 3DNKA 3TBSB 3QNZB 2J4WH 3L5XH 4HT1H 5T1MB 3O3EA 4NN5B 3CMGA 3K8MA 4LPCA 3C5SA 3MLSH 3STZA 1PSKH 4Y5VC 4OSUH 2YD7A 2R15A 5C86A 1CTNA 2H45A 4OM1L 4R4FL 2GUOB 4Y5XA 5D2NB 3MRJB 3GDBA 4XMPL 5FYJD 1EO5A 2ESVA 4XMLH 3GHBH 1HEZA 2IC2A 4G9FE 4A6YH 1TZHA 1H3VA 3NIDF 3EHBD 2EH8L 5IHUL 1L7TL 2MQ0A 4XNUH 3OHXB 3V0WH 5IMMB 3MRNA 4JG1H 5IJVA 5DD3H 3QJHB 2H8PB 4NQCB 1YN6A 1HK6A 5AYUH 5JDSB 4HCRH 3AM8A 1RUML 1A4KA 1NCDH 4FQXB 5IR1A 1KEGH 5DUMH 1G9ML 3B9KA 3WIHL 5D96C 3WKNA 5BXFB 3T4YA 3K2UL 2C1PA 1XH3A 3A6BH 2F8XC 1T1ZB 3EFFB 5IFJA 4QXWA 2D7MA 1I75A 4YWGH 2W9LA 4NFBA 5HHVL 3QDGA 1HWHB 2VE6A 1AFVL 3QT2A 3I6GA 5T33L 1JF1B 2DQHH 4X0KB 5FIEA 1VKXA 2W9DL 1TJHL 5HHNB 4Z95H 3C8KA 4H0GA 1S7UB 4X4ZA 4E0RA 3QI9C 4ZAKB 1LEGB 4FMKA 3MLYH 4KDVA 2WSKA 2C1OB 5I15H 1I1AA 5L2KB 1UVQA 2YWYA 2BSRA 1FIEA 2R23B 1P7HL 1CFTB 1KFAH 2D7PA 3ULVF 1OARL 5A16B 1ZLSH 1AC6A 5HYSA 4AMKH 2FGWH 4NDMB 1NMAH 1QLFA 1WC7B 1I9EA 3WNNA 4G8FB 4IMKC 3E6FB 2AEWA 2AJSH 3IDMA 4W81A 1T03L 2NCMA 1LQSR 2IWGA 5IG7B 2NY4D 3ULUH 1BZ9B 3GGWB 2OQJB 4JM4L 4P23C 3W82A 4Z7QE 5E94A 1MIEH 4WFHD 1WT5C 2YA1A 4X6EA 4ELMF 3GHEH 2Q8AL 3EOTL 5INDA 4DGVH 2G75B 1CXKA 1T3FB 5E8DH 4JFED 5FYKH 3NFNB 4MXWL 4EN3A 3DO7A 2ZCLL 5CEZH 5H94B 1OY3B 4WW2B 1OQXA 4BELD 2H41A 3GSQA 4NRYA 2FJGB 3LEYH 5TDNB 3L3DA 2A6DA 5SX4H 1U8JB 4XNMA 4PGEA 4KJPD 3B9AA 2VDNH 1RI8A 3L5WB 1RUKL 3BP7B 4NM4H 3U6RA 4Z7VE 2R4SL 3SBWC 3TA3B 1UACL 1CLOH 4OCXL 1H3PH 4OAWB 4PRPD 4PS4L 3DXAB 3ARGB 3MNWA 1EBPA 5FM4A 3DX7B 4OIIL 3FT4A 2Q8BL 1CFSA 1T5WB 5DT1H 4GRWE 3MNZA 5KVMC 3ZKMD 3VD9A 4HKBA 3LV3A 4Y5VA 4R9HA 5C0IB 1Q9LB 1RZJC 3SKUD 4JHZA 3MTRA 2YK1L 3QULA 1QBLL 3WS6A 1DR9A 4TYUA 3OF6A 4OZFA 3EOAB 5DTFA 5EIIA 1PZUB 3FAXA 3RX5A 3PGCA 4QTHB 3WD5H 1DN0B 2IBZX 3U36B 5KSAB 4CADB 1T1XA 4ZNEE 4QCIA 2YPVL 2HN7A 5TH2B 4JE4B 1NBVL 2X40A 3HNSH 1YUHB 3V0VB 4YHKH 3F7YA 3C9NB 1YMMB 4G9FA 3EYUH 1FYTD 5FYLH 3VGAC 1T89A 4PJEE 1F90L 5ELIA 2VZ1A 4PP2A 1WFNA 5D4QA 3BZFA 3BIBX 4ERSH 3BH8B 1KCUH 4RRPA 4O2CB 3MC0A 3G9VA 5AUMB 1XT5A 4HEME 4K2UH 1A7OL 1DVFC 1VADB 3MRGB 5C08E 2O61A 3MA9H 2FEEI 2WBWB 4I5BB 5INCA 2OS7A 2DWDA 4OT1H 3RNKB 4U1KB 3RWEA 1S3KL 4JO3H 2WLYA 3F7QA 3CIQA 4RFOH 1U8MA 3CLEH 4QNPF 4FXKA 5KSBB 4F7MB 3BUYA 4LLDB 3CGTA 1KN4L 1U41A 1CFNA 2IPKB 1RJCA 1RK0B 2VDMH 4JB9L 1BAFH 1FZMA 2ID5A 1YEFL 3RUGE 1BBJB 3VXMD 2ATKA 1UM6L 3RWCB 3WBDA 1I85A 2XWJA 3HB3C 5F9OH 1F3JB 1MREH 4M9OA 4M7ZB 4ZUWA 3JUZA 3VFGH 5MHSE 5HPMB 2HTKC 2CRZA 5FYJL 4D9LL 1BPVA 2D03H 5IVZB 4OGAC 2J8UA 3U4BH 4OQTA 3BYYA 2J6EH 1AQDB 5GGUA 1XF3B 3P9MA 5BV7B 3BAEL 4PGZA 5DZLA 4HFUL 3PQYA 4JRYD 3IJSA 5AAWA 3QWRA 3ARFA 3H3PL 5CZXC 4P23A 2CLRB 3PF2A 4AM0A 2Y5TA 4PJ9C 4LU5H 4CMHC 1EBAA 1UA6L 4RCAA 4H20H 1AE6L 1P7QD 2HJLA 3UJJL 2AABH 4XVTH 1DDHA 1CDJA 1D5MA 2YKLH 1A7QH 5EA0H 4X4YA 5KAQF 4JQIL 3EJJX 1G7HB 2OSLB 3UBXI 4FS0A 1EERB 1B6UA 5J1SC 3MRQB 3MLPA 1UJ3B 4P4KD 4I48B 1KJ2L 4MXVE 3ZE1E 5IHZA 3IDNA 3NTCH 2C3WA 1KGCE 2IADA 1QFWH 1UXWB 3IGAB 1S7TA 4KKAC 1Q9OA 4HPOH 3MV7E 3JVGC 1II4E 4ALAH 4DKEL 1BGXL 1IGML 35C8L 5F7WC 2OL3B 5CEYB 5D70H 4QRRB 3QZWA 4O9HH 1MF2L 2AJZA 2X89A 4BKLA 4CRPA 5DSCA 5DURB 2XZQL 4F15C 5CZVH 2VAAB 1CFQB 2XY2A 4LSRL 3TN0A 5FUOL 4LKXB 3N1QC 3V5DB 3FB7B 1IKFL 3BKJH 2RBLA 4J1UA 4GLRH 1WBYB 5BW7C 3DHJA 3FQTA 3GMRA 1QSEB 1FQ9C 1EHAA 1M6OA 2VXVH 1CS6A 3FCTA 4HF5L 3HE6C 3JWOC 3QEUB 5GGTA 3E0GA 4M00A 2VO5A 1LO3L 4PJXE 5D2LB 5IQ9A 4LLYB 4WW2F 1HN1A 5AG9A 1N59A 5EZJA 1ADQL 1UWGL 1Y18A 2UZIL 3QBTB 4XP4H 5GRUL 1TTGA 4LEXH 4QHUA 4WFED 4FNLL 4P9MH 3TBVA 4JO2H 5ITFA 1NCTA 4X4ME 1QTYT 4ZNEA 2ZSVA 4PY7A 2CUHA 3MGOA 3U4EA 4ONHB 3AS0A 5ENWA 1SJEB 4KV5E 1S78D 4U7KA 1LE5B 2GW5A 3EOBA 3QIWD 3BKCH 4WU5A 1V5JA 3IFOA 1CU4L 1A4JA 1R0AH 4J3TA 3CXDH 5LG1A 4PJEA 4JO4L 2FEDD 4UDTB 1DVFA 3I2CH 4XPTH 1K2DA 5IBLD 5LKNA 1KG0B 1HQ4A 4JFXA 5GSVA 3DSFH 1GZQB 3VFVA 1GC1C 4FRWA 4N9GA 3FQWA 3PWPB 4I3SL 4LAQH 1OP3H 4F57L 4LOUD 4J12A 5C08A 2Z9TA 5JPMB 3T2PA 4ELMA 3X14A 4Z0XA 4HKXB 4O58H 2WBJA 4XNQB 3UTSE 4NYLB 5KZCB 4ESKA 5D1ZB 1I3GL 4JRXE 2NY3C 2BOBA 1X5YA 3CDGB 1YJDL 2VUOA 4OZHE 5I73C 1FZKA 1KCVH 3QHFL 5IMOB 3ZKND 2B2XL 1J0YA 1JF5A 1INQB 1LK3H 1SY6L 3VGGA 4U0RC 3MSPA 4M6OH 3T2OA 3LDBC 4UOW0 5E00A 5FUCE 3ILPB 3MUZ1 1FFNA 3MLWH 4HUXA 3RVWD 3IXTA 3QDAA 2FB4H 4H5SB 1FORH 2XG4A 1H15A 5FOBB 4MWFB 3IFPB 1UADC 3MBEC 3MFGB 1RPQA 3MRKA 4NHCH 1KLUA 5EU7C 1MCHA 5FUCC 5I1AA 4LMQI 4NN7C 1J1OL 3QO1A 1T4KB 1TXKA 2ADFL 5ALCL 3GMNA 1J88A 1JMZA 1GAFL 5KSBF 5JQ6H 1B0GA 2KBGA 3ZHDA 3OR6B 4FQLL 4LDLB 1CG9A 5B39B 5SWSE 1ZVSB 3P2TA 5L9DL 1G7MA 1Z9OA 1EEUA 5CD3A 5HVHC 3LKOB 2MCPH 2BNQD 2P5WD 4F9PC 4BFIA 1ZHBB 4PD4J 5HY9B 2QJDA 1RZ7L 3QDMB 1A6PA 4MAYA 4ZPVB 3UTTD 2PO6D 3MGTA 1RULL 4P2CG 3O4OC 2VLME 3MV7A 4OJFL 3P3YA 2YPKA 4AIOA 5TE4L 1RZKH 3QUYD 3T4AB 3LIZL 3VG0H 2GTZB 1MCOH 1AD9B 3KDMA 3D3VD 5T1DL 3AREC 3QAZB 3KJ6L 4RMQA 5IMKB 4ZTPH 2NW3B 3TO2A 2BNRB 2F53D 5GGTH 2OTWB 4NM8H 3TBSA 4JFHE 5I1IL 5T1MA 2VLKD 5GHWH 1KCSL 4Q0XL 5IQ7L 5TFSL 4EUPB 3D9AL 2VDQH 4IOFD 2APXA 1WGOA 3D69B 4LMQE 3MYJB 43C9B 3O2WH 2RB8A 1KTRL 3MRJA 1D6VL 4RX4D 3CFKB 4R4ND 5T3XH 3KXFB 4GKNA 1XGQB 4AIXA 4K8RH 4H8WC 5EN2A 2VZOA 3SE4C 3MO1B 1MAJA 1M4KA 5H37H 1YPZE 3UBXA 5LCVH 3ULVH 2VRAA 3FONB 4E9LA 5IMMA 3FQUB 1KC5L 1JFQL 5EU5B 5HI5D 2X4OA 4WEMB 2H8PA 4NQCA 4UQ2A 1DQQB 4DW2H 2BRRL 4RMSA 2CJUH 4FQXA 3UPRB 2XTJE 5TQ0H 3QHTC 5AD0A 5BXFA 1AIFA 2K7QA 5E6ID 3QXUA 3FN9A 4HC1H 4YFLF 4YXHL 1QQDB 3DUUB 4RA3A 3O6KL 3S8WA 5D2LF 3OGOE 1RZFH 5EUKA 2XTJC 3OJMB 4HWBA 4O02H 2EC9U 3H7BB 2H1PH 4KK9C 4I3RL 5C2BL 5JUEL 4X0KA 4Z7UB 3FN0L 2FYYA 4NNPL 1OAUL 4LLQB 1S7UA 1FLRH 3WCYA 4JRXA 1LEGA 2XG5A 4KRPB 1IFHL 3OKMB 3PABB 2EXWC 3V6BR 2NY2D 3TC9A 15C8L 1CFTA 4H88L 4ENEC 4LSQH 1I3VA 4KTYA 2X4NB 4L8CB 4NDMA 4J3SA 2GJZB 1WC7A 3C8DA 4TULL 1LDSA 4HW6A 1CF8L 5F6HI 5CZKA 2DMKA 4XTRC 5IG7A 5J0BA 4FMFA 4JFDD 3BQUD 2OQJA 5FCUH 3RGVC 3LB6C 1FYHB 1BIIB 1JNJA 1HI6A 4POZC 2G75A 1MJ8H 2VN7A 3JV5A 1T3FA 1EZVY 3D85D 3WHE1 1RUAH 3R06A 1HQRA 4K7PY 4KHXL 4F9PA 2HMIC 5J9PB 4NOBA 1HH6A 4WW2A 1NSNH 1CLZH 4P9HH 2BVQB 2FJGA 2KH2B 2ZNXA 4ONOA 5TDNA 4HGKC 1A6ZB 1WCBB 1W72L 3DUSB 3WE6A 3H8NA 1T2XA 4XNYH 5E9DD 1E6OH 3BP7A 1F11A 4UOJA 3TVMD 3RJQB 4QRTB 3HZVB 3DXAA 1YNKH 1WZ1H 2DQDL 4NC1E 4OZGB 3BVNB 3DX7A 2UY6A 3O6FB 3SDAD 1AXTH 4UBDC 3AREA 2P24B 3MLZL 3SQOH 5FFLA 1T5WA 3RHWK 4TUJB 3S88H 1NCAL 2ZUVA 4HUKB 4NC1C 3S35X 3E8UH 3I6KA 5BRZE 3QSKB 4M8QA 3MLUL 2XWTB 4MZ2A 1IC5L 4ODHH 5C0IA 2YN3A 4LSDA 4HH9A 3MRDB 3CSYB 2NXYC 4LPYA 2QQQA 4P2YA 4DQOH 5IIEA 4Y19E 5C0GA 2XN9D 5IEKB 4I4WA 2NY4B 4DVBB 4M7JL 3H0TB 4QTHA 3TBWB 1GGCL 3U36A 5KSAA 5I18L 3QUZC 3L3IB 4WO4D 3R0MA 3CUPA 5EBGA 3H42H 4M3KB 1UGNA 1C12B 3HR6A 4JFEB 1LD9A 3ZT7A 1CZ8H 3LQAH 3C9NA 1KACB 1EEQA 1F02I 1IGFL 4M62L 4WI9A 5AWNL 1YEDA 3CFCH 4XPAL 4I18C 3AMKA 3UJTL 3BXNA 1NLBL 3RVUD 3BH8A 3EYOA 4LGRB 1JTPA 2B0SL 5SWZD 2W59A 5AUMA 1UWEL 3A67L 1F00I 4Y16C 1WVZA 4LLVB 1PAMA 4PRPB 3MRRA 1XIWC 3MRGA 5I1GH 4I5BA 4GW1A 5L6YH 1MQ8A 2E9IA 3RNKA 4U1KA 3JXAA 4ETQB 2XQBL 4N8PA 1T1YB 1KEML 1FDLL 3T04D 4PP1D 5C6WH 1RFDH 4MVBD 2IAND 4NUGH 1N5YL 3OR7B 2IPKA 4L8SC 1RK0A 1LK2B 2ZKHH 4XMKL 4OCWL 3U46B 4G8GE 4EOWH 5F9JB 1NLDH 2PF6A 3RWCA 4DTGL 2I60H 4NC0B 1BVKB 1F3JA 2AXGB 2IFFH 2HLFC 4POYA 4TNVK 5JIHA 2BJMH 2QSCH 4AG4L 2CK0L 2QSTA 5CSGA 3PV6B 1X6LA 1JHLL 1IEBA 1TJIH 1Q1JH 5GRXG 3CNKA 1SMOA 4S0SD 1FYTB 5HI4C 2QADC 4NRZB 3W0WE 4KMTL 4QRPD 5E08H 2RFXA 1MQKL 5EZLA 2QQKH 5F6IC 4C55A 5H37G 1FRGH 1EHLH 4Z7UF 5KVGL 1G7HA 2W0KA 5DGRA 3H6JA 4O2EB 1MVUB 3GFUA 3MRQA 2AEPL 4I48A 2I5YL 2MSPA 4HJ0D 1IRAY 3QDME 3IGAA 4KK6C 2P8MB 2ICWJ 4Y5YB 2IPTH 4KVCL 5KVFH 1BVZA 1ZLUH 4XVUC 1TQCB 2OL3A 4JY5L 5CEYA 3WXWH 2Z91A 3VXMB 5F7UA 3QG7H 4HWNA 2RR3A 2FHCA 4QHMB 1ZT1A 3S37L 4YDKL 3HZMA 1C7SA 2VAAA 4FQIH 2BRQA 3HG1E 2VQ1B 5J57B 2R0ZL 3V5DA 3FB7A 5DRZB 1DE4B 3UXFA 2NZ9C 3T2NH 1WBYA 5FYKU 3OKEB 1T6VN 1QSEA 4AEFA 1DBBL 4ZFOL 2AV1A 4JRYB 1E4XI 5BRZA 5A2IH 3QEUA 4QXTA 5J11C 5HHMD 1CLYH 4OGXL 4CKVX 4LLYA 5JXAL 3KXFE 3N9GL 1EEZB 4HV8A 4Y19A 3GSXB 1P7QB 3CCHB 4OGYH 3KPRD 3RVTC 3SGKA 4YH6A 3NMEA 3D0LA 3SE8L 1I7UB 1U6AL 2FATH 4I18A 2VDOH 3OAUH 4ONHA 4P4KB 4OZGF 3C60D 4KTEH 3GIVB 1LE5A 1ETZB 1OM3L 3OMZA 4JFQA 1OTTC 5IF0B 2ED8A 3S36L 1AD0A 4PGDB 4UDTA 1UEMA 3HS0A 1XIWA 3EUUA 1KG0A 5L7XH 1S7QB 2NXZD 3BDYH 4GQ9H 4XP5H 4XXCC 1GZQA 1FL3A 4HS8L 1JNHB 1P1ZB 3WIHA 1REIA 5LXGL 1J1PL 1N5AB 4OLWL 5JPMA 4QXUL 1N64L 3DX9B 4L8SA 5DMIL 3TNMB 1J7VR 4PJ5E 1FVEB 2AK1L 4GO6B 4XH2B 3SKOB 5I9QB 1OTUD 1NUFA 5D1ZA 3ZKXC 2V5RA 3ILQC 4HJGA 1T21B 5D7LE 1EHNA 1QLEL 2Y07L 2IBBA 3QISA 5IMOA 2ICWB 5BV7H 1X7QB 3DGCR 3B2VL 1INQA 1BJ8A 5EUOE 1LWRA 5CBEA 5HI3C 3B5HA 3QCVH 1BEYH 1ZT4B 3VXTB 5I1JL 3ILPA 4FFVD 4N0CC 1NAKL 1LP9E 3PXHA 1AGEA 3ZSSA 2HTLD 4F7TA 2XNAB 5FOBA 4MWFA 4N0YH 4LIQL 4TNWK 3QIWB 1VEMA 1MY7A 3BO8B 4MQXD 3W0WA 2A6JB 1MCWW 1Q0XH 4H1LB 2H26A 5ESAA 3RTQD 3SO5A 2P8LB 4HUUA 5IB3B 4PJFB 4JG0H 2A1WL 3SO3C 2ZG3A 1BBDL 1X5FA 5K9QG 2NY5L 2JELL 2K9UA 3LKOA 1MCQA 1ZHBA 1SYVA 1J0HA 2OL3H 3V2AR 3QDMA 4ZPVA 1ZHKA 2HFGH 1U8QB 2Y23A 4LSTL 1A3LL 1W72B 3RI5K 2KZ1B 4XNXH 3IXAB 1OCWH 1IC7H 4Z7WB 5KAQG 2AJUL 1FSKB 3RWIA 1PQZB 3O6MH 2GTZA 3TZVC 3MJ9L 1X5JA 4X7DC 2OTUA 3ARBD 4FXLA 3L3HB 1HKLH 2P44B 5HGBB 1BZ7A 1A6VL 2QQLH 5IMKA 3HG1A 1DLHA 3NCEB 5KW9L 4HS3B 4EIZC 2OTWA 3G04B 2BDNL 5C0DB 3RWHB 1IEAB 1PDKA 5FEBA 2UWEB 4PIRF 4L9LC 4EUPA 3VG9C 4OM1H 3F8UB 4MD4A 4R4FH 3UTPD 3ZT5A 5JXED 43C9A 4LCIL 4U6VL 4UILL 3NCFB 3MREA 4JFEE 3KXFA 1XGQA 3SOBL 5CILL 2EH8H 5IHUH 1L7TH 1G7LB 5IM7B 5MENB 2EE6A 2VQUA 4P5KB 2X4QB 3X11B 3KPLA 1XCTB 4PJHE 1UWXK 2ZPKL 3SY0A 3U30B 2CKBA 3BD5A 4KZDL 2P5WB 3HZKB 2C4FU 3PWVB 3FQUA 4RGMB 5J89A 5EU5A 1RUMH 4ORGA 4JDTL 4OCSL 4U3HA 5HBBA 1G9MH 2X42A 3J7HA 4AQOA 3WIHH 4PRPE 2PO6B 5EIQA 3K2UH 5GS0D 3UPRA 5EU3B 4HJJL 4YPGB 2ZSWA 3HI1B 3CD4A 2V5TA 2ITCA 5I8KL 3BOVA 2A0LC 3BIAX 5HHVH 2NY0D 3QCUL 3BN9C 4K71C 4Q7DA 2PCPA 4P2QD 5T33H 5IW1B 1K6QL 3HKFA 1JGVL 3H7BA 4G42B 4OLYH 4P57B 1TJHH 3N06B 3BESR 1MCIA 2F53B 4Z7UA 2LTQB 1P84J 2R29L 4LBEA 3VFTB 5C09E 4QOKD 2VLKB 3B83A 3T0ED 4PJCE 2BVPB 4XZUA 2FX7H 1RQ5A 3O3AB 5IWLC 3CK0L 3F5WB 2YMXH 4F9LA 5I1DA 3V4UL 4N0RA 1OARH 1JWSB 1S9WA 1WSST 1PBYA 1XGTB 4L8CA 1E4KC 3QO0B 5ICYB 1T03H 5KTEH 4KFZC 2E7LC 2GJZA 3VFNB 3F65A 4OFPA 3P30L 1T7ZA 5JMRA 1LP9A 4JM4H 3MYZA 5IBUG 4JPKH 4XT1C 1EH9A 1NC2B 2Z8WC 2Q8AH 3EOTH 1WZMA 5MEPA 1BIIA 2DBJA 2WBKA 2D3VA 2Z8RA 1ZAGA 2Y72A 4KJQD 1CL7L 1NCWL 3WFCL 1PGRB 3ECBA 3I84A 4KAQL 3C2SA 1UKQA 3KG5A 1VCAA 4JO1L 1T80A 1XZ0A 4KKLC 3UEZA 4S1DD 5J9PA 3BH9B 3F6LA 3WHXA 3CSGA 3N1GC 4OZIB 1KJ2A 1OGAE 3BWAB 5D7SL 4IDLA 5BJTB 1A6ZA 2A6KB 4P2RE 4X5XA 1WCBA 5CJOL 2R4SH 3DUSA 4WCYH 3P4LA 1UACH 4AIZB 4OV5B 4PS4H 4QRTA 3HZVA 4OIIH 5DFTA 2EXYC 4HQQL 5IFHL 3D87B 1YEHH 4OI9A 3LEVH 4OZGA 1N4XL 2DI8A 1EPFA 4M48L 1A3QA 5IVNA 5T3ZD 2XZCL 4H26A 4IRJD 3LMJL 5EZOH 1X5GA 1S5IL 4UAOC 4DEPC 4NZTL 4EUPH 1QBLH 2XWTA 4L9LA 1NEZG 2YC1A 4E41D 5IJKA 3MRDA 4ZFOB 4PJFF 3UDWC 3CSYA 2GAZB 3NCBB 3DVIA 3V8OA 5CHNB 4J3OC 3WLWD 5D93B 5AEAA 3LHPH 2R2BB 3ARWA 4OUOA 4GKOA 5D7IB 3TBWA 2YPVH 1LMKA 1NBVH 1ADQA 4WV1B 1QUNA 1M7XA 3MACL 3VFUB 4CNIB 5B3JF 4I77L 1YDPB 1RUPL 1C12A 3HFMH 3D85B 4JFEA 5C71A 1F90H 4Z7WF 3JWDC 3DIFB 1TCRB 3TWCL 5ISZD 3IFNH 4LP5A 5DD1L 3QUXD 4GRLC 5A2JH 1AC0A 3QG6B 4HX1B 1A7OH 2JJTA 3GNML 3TVMB 4PJAE 4CVXA 4I2XE 1PYWB 4LLVA 4PRPA 1S3KH 2NR6D 2UWEF 1FC1A 2DQGL 3SDAB 3RY6A 1JGDB 2MQ3A 5C0BD 4JFFE 4ETQA 3TIDB 4N8VB 1T1YA 1KN4H 3ALPA 5HHXL 4D8PA 1U8LA 2E6QA 4NJAH 3OZ9H 2FCBA 2AEIT 1WBZA 4MHHG 1LK2A 1UM6H 3TPKA 1RV6X 3VI3E 5DFVC 3BSZH 2GJJA 4TVPH 5JTWA 4XWOD 1BVKA 2XN9B 5FYJH 2AXGA 4D9LH 4PJCA 1ZT7B 2VZTA 4JZOA 1SY6A 4KI1A 1H5BC 3PV6A 4WO4B 2EE3A 1JTTA 3TF7C 4HIXH 1JRHI 4FXGB 2O5ZL 1UA6H 1OD9A 1AE6H 1K5NA 4G9DB 4P5TC 3UJJH 3O3DB 4M8VA 3FRPA 5SWZB 5HYQB 2E5EA 5GS0L 5I0ZA 4BH8B 4HIIB 4OF3A 5F9WC 3CJJA 2E9BA 4O2EA 5ITBH 1MVUA 4PJGB 3RBGA 3BEVA 5DK2B 3UPCA 2BVYA 4BUHA 4I9WE 2DIBA 2IH3B 4IOIB 1ES0A 1ZLWH 4GXUM 1BGXH 1IGMH 35C8H 4W68A 2IANB 5K93A 2A73B 1MF2H 4P2RA 1YQVL 5FGBC 1KXVC 2ADGB 3JUYA 5E6ZA 4DOHB 3VXMA 2XZQH 3FFDB 1KTLB 1R3KB 1FG9C 2CR3A 4DWHA 5CJBA 4LSRH 5FUOH 1CGXA 5CLWA 5LWYL 1P2CB 3WJLC 2OZ4A 4NWTL 3UJIL 2ITDB 5DRZA 3S4SA 2AJXL 1DE4A 4LCCC 4ZSOE 4WWKD 4DK6A 5EO0B 5DJXB 1CXIA 1RZIB 1CXEA 1LO3H 1IBGL 4KRLB 3TH4T 3FQRA 4Y4FD 3MUHL 4N8CL 2WLZA 1ADQH 2DJSA 1T22B 2UZIH 4OZIF 1LO2L 3SCMD 4QRPB 4FNLH 1EEZA 2VIRB 4TUKL 5D1QD 3GSXA 3VGHA 1P7QA 1QBBA 2JJSA 3CCHA 2B4CC 3CZFA 3VXSE 2YPLD 4D9RD 4Q9RL 2BZDA 1SEBB 4JFZL 2JB6A 5DUBB 1I7UA 4LNRA 5EBMA 2BNQE 1CU4H 4P4KA 3GIVA 5B39G 1HDMA 3CX2A 3NACH 5GJSL 3MBXL 3N50A 4OD1L 3UTTE 1EXUB 3X3GL 1KENL 3HPLB 4PGDA 4U33A 1SM3H 5B38B 2CR6A 2J88L 2PTUA 3RKDD 1S7QA 4XVSL 1P1ZA 3D3VE 4F57H 1ZLWK 3HNTL 4MA7L 4FQJL 4PJAA 5AZEH 4I2XA 2FZ3B 5T3ZL 4HSQA 1R3HA 1N5AA 3CU1A 2CRYA 5GS1C 3DX9A 5C0ND 3TNMA 2W07A 4JFFA 4PRNA 1FVEA 5D5MB 1N2RA 5D7IF 4RGOL 1FAIL 2P45B 2VLKE 3QIBC 4F7EB 3VRJA 3SKOA 4QY8B 1VERA 4LCYB 1YJDH 1IAOB 1NUNB 1IZKA 1WTGT 1C5DA 1T21A 3SGDH 4DKFL 3QHFH 3RX8A 2B2XH 4Q2ZB 3J8F7 3S9DB 3RWDB 1N6UA 1YN7B 5HHMB 2VXSL 4OKDA 4NSKB 3DRQB 4EUPG 2ICWA 1X7QA 2X6MA 3B8SA 1K85A 5F7FA 1H5BA 4IS6A 5J4MA 1IAKA 3FL7A 1ZT4A 3KPRB 3GM8A 3G5XB 3BT2L 4PRBA 4R4NC 1I8LA 2WUCL 1P4BL 3ARRA 3NFPB 1QFHA 5F1NB 4LHUD 4AEIH 4YHYC 5FKPB 3HR5B 1J1OH 3C60B 4JQVA 2FNBA 2ADFH 4ODTL 3QIWA 4DVRL 3R8BB 1GAFH 3BO8A 2N4IA 2FBOJ 3CSBA 1U91B 1HZHL 4FQLH 1ZWIB 1XGUA 3B6SA 5AAMA 1U3YA 2W92A 1T20B 3QJFA 4YR6A 2NXZB 4PJFA 2C4XA 1RU9L 5JW5A 4ODXB 5DWUL 2YUVA 5E6IC 1LNUB 1E28B 3FFCD 1RZ7H 4AY0A 3O8XD 2DKUA 1LO4L 3ROLB 1U8QA 5HSFA 1PKQE 4OJFH 3HC0B 1W72A 3VMPA 1UH2A 5IV2B 1IZJA 5TE4H 4M7LL 1J8KA 3F58L 3LIZH 4Z7WA 3VFOB 2HT3D 4POUB 4RBPK 3VXPB 1CFVL 5T1DH 3P0YH 4NBXB 3MLVL 4YHPA 4GJTB 2HFEB 4JZNB 4EI5D 2X1OA 1OAKH 2M8XA 3KJ6H 1EJOL 3L3HA 2V7NA 4M02A 3PWJA 5HGBA 3FZUC 5I1IH 2P8PA 4HS3A 5IB2B 1KCSH 2NY2C 3G04A 3KPSE 4Q0XH 3D9AH 1IGIH 5L8JB 4NNYB 4NC2B 2UWEA 2LAAA 4IHOA 5FECA 4JFDE 4PJGF 4ZPTA 2ZCHL 4G6FD 5CINL 1Z5LB 1YYLL 3GSNL 1I8IB 2P7TA 3ETBF 4C83B 3BZ4B 4CVWA 1ACZA 4FTVE 3BP5B 1HHHB 1AGFA 1BWWA 3BQUC 3QHZH 3A0OA 4TSBL 1U95B 3RTQB 3VXSA 3P9LB 1G7LA 4MNGB 3IJHA 5J3HC 5IM7A 1NBZB 5DVMA 3MRPA 1KC5H 4ZS7L 4MNQE 3X12A 3UAJC 2AQ2A 3CMOH 3KS0J 5EU4B 5BCAA 1BM3L 2P5WA 2BNQA 2X10A 3DBXB 4QWWC 5DJ6A 3PWVA 2BRRH 5E9DE 2DQFB 3GMQA 4BQ9A 4MCYB 2W0PA 5I8CB 3T1WA 2DF3A 3UTTA 2PO6A 2R1WB 4QHLB 1VGKB 1U3HC 3W81A 5J13C 5EU3A 4K3GA 3MRHB 2E8YA 4YXHH 1A1NA 3HI1A 3O6KH 3LRHA 3KPOB 5GS1A 4HG4K 3QUYA 4ZUVB 3D3VA 1LEIB 2OX5A 4I3RH 1R5WB 5F1OB 3ARBB 5C2BH 1Q9KB 3KYMB 5JUEH 1A5FL 4ZODA 4P57A 4UU9B 4NNPH 5B4MC 1OAUH 4NWUL 1FGVL 1GGBL 4Q6IB 3V5HB 5DI8A 3RL1B 4M6ML 3WDIA 4ELKB 3VFTA 2E27L 2VISB 2VLKA 3JTTB 4G7VL 4HBQA 4JGMA 4S1QL 4XHJC 3UYPA 2BVPA 2ZUSA 4K3JL 1XGYL 5ADPL 1L6ZA 3O3AA 3B9DA 5DLML 1TZGL 15C8H 4WFFE 2HJKA 3QNYA 1T2QH 4H88H 1JWSA 5JORB 1LHZA 4WNQB 5DHVB 2XPGB 1XGTA 4LLWB 5EOCL 2X1XR 3MV01 5CKGA 4HGWA 1CF8H 5I75B 5C07D 3VFNA 4XPHL 4R97C 2BVEA 3NPSC 5CSZB 4UINL 3MV9D 1F4WL 4UUJB 1CICD 4H1LH 4JPVL 2WWMC 1FNGB 1O7VA 3V6ZB 2W9EL 4DFIA 1KB5A 3EJZC 4WDIB 4LAJH 5HGDA 4LCUB 3RVUC 1U0QA 2D7OA 5D5MF 4DFHA 2E3VA 4KRMB 1M71B 4KHXH 1VFBB 5E6IA 4HEPG 3BH9A 1HCVA 2NY0B 5DJDB 2OXGA 4OZIA 5FO8B 3NCMA 1D9KD 6FABL 4P2QB 4WU7B 5BJTA 2A6KA 1VPOL 1I9IL 2QV2A 3OJDB 2VOTA 1KPUB 3QRFM 3GJEB 4L4TD 3MJ8B 3L6FA 3QDJE 2DQDH 5JZ7D 2VSCA 4OZ4B 5CD5D 4MVBC 2DLHA 2VKWA 2DOCA 1PKQA 4KJYA 3IRPX 3MZTA 4QOKB 2J5LB 5J6GB 3T0EB 2EDKA 4LARH 4F7PB 2R9HD 4NUJA 5F7YC 3THMH 3F12B 3MJ6A 3SEPA 1BLNB 3FB5B 3EDKA 3EYVB 3MLUH 5FYLD 4BH7B 1IC5H 3UYOD 3LPWA 2F5BL 4FQHA 2AJ3B 4MA3B 3BP4B 1FC2D 5KVDL 3ZZ1A 1QA9B 5GIRA 1ROWA 1XF5B 2GHWB 1BMGA 4M7JH 1IL1A 2XI9A 5CHNA 3IDIA 3BPNB 5HYJD 4PLOB 4UTAL 1GGCH 2Y1VA 1DBAL 5HGHB 4JFDA 5I18H 1MHEB 3BQUA 2WIIB 3GMLB 3C6SA 5DA4A 3VJ6B 1M7IB 5KVEH 4WV1A 3H9SE 4NFCA 1RUQH 2A2QT 4JHWL 2DL2A 5IB5B 4CNIA 3FRPG 1YDPA 4FTVA 3DYMA 1A8JH 1T1WA 3M8OL 1U8NB 4M62H 1IGFH 5AWNH 4EKXA 3I3DA 3FO2B 1HH9B 3DIFA 3UJTH 5DK3A 2J4WL 1NLBH 4HT1L 3QWOB 5KSVB 2B0SH 2I24N 1Q38A 2VXUH 2WINB 1TVHB 3RVVC 5EOQL 1S7XB 1U3HA 1CDUA 1UWEH 5JOFB 2NX5D 3TNNA 5E9DA 3NIFF 3TVMA 1NFDB 5CJXA 1PYWA 4WI8A 4Y89A 4GKZB 2NY7L 4FFWD 2ATPB 2XQBH 2EDWA 1KEMH 1JGDA 4A6YL 5TE7L 3E2HB 1FDLH 5C7XL 7CGTA 1N5YH 4N8VA 4K7PH 4NCC1 4L4JA 4ZFZB 3LD8B 1RVFH 5BOPA 2EEDA 1CE6A 5HHOE 4UTBL 2V9QA 2M1KA 4OCWH 2ZNWA 3G5ZB 2EE2A 1YYML 5DD3L 5EO1B 4YZFE 4RAHA 4DTGH 3KLHC 5I1EL 4WUUD 4E41B 5D7KD 2BXZA 2LU4A 1EFQA 2PN5A 5SV4A 3BJ91 4MJID 1CDGA 2V6HA 3LN5B 2XN9A 2ARJA 4AG4H 1G0XA 5A2LH 2CK0H 1ZT7A 4RMTA 3KPRE 3A6BL 5DQJA 1P4LA 1Y0LA 2W60B 5ACZB 3BRGC 1JHLH 2B5IC 3DVGB 3HA0A 3T3PF 4RIRB 4WO4A 5IFAL 1MHCA 4GAGH 4HAGA 4KMTH 4ZFGL 3V95A 2X4UB 4HMCA 2Z92A 1INEL 2V2TA 5ISZB 3MRFB 1MQKH 1WK0A 4NO5B 5SWZA 4DJMA 4GKSB 2DYPD 3QUKB 3T8XB 3RIFF 4BH8A 4K94C 4U05A 4LVOB 4D0CB 2GJ6D 2I5YH 4M7LT 4RNRA 4PJGA 5JW4Q 5DK2A 1Q72L 4U0QB 4N0UE 4G6AD 4IOIA 1UB6A 4JZJC 5C0BB 3O4LE 4KUCD 5KOVC 4PRAA 1KIRB 4CN6A 1G0DA 4Y2OA 2V5YA 4JY5H 2A73A 3FMGL 4GRMB 1AO7B 3S35L 3S37H 2BNUB 3HI6L 1T0MB 4YDKH 3FFDA 1KTLA 3BISA 2QBWA 3DWTA 4PB9L 4DGVL 5EOCJ 5F7EL 3VWKC 3QUML 2VSDA 4FQ1L 2R0ZH 3LKRB 5KS9B 4G43B 3MJ9A 1QFOA 2ITDA 1C08A 1V05A 4P2OD 3PL6D 5EO0A 5I6XB 3Q3GB 4N90E 5DJXA 3SGEI 5EU6E 3IS0X 1F5WA 2OCFD 4LSPH 3VFMB 4ZYKB 4N5ED 2HH0L 1O7SA 4L4VD 1CFBA 5FAAA 3L9RB 2YUWA 2CMRL 3PDDA 3GSNB 5GSRA 3OX8B 3O9WC 2VIRA 5T1LB 2EDYA 5CEXB 2AK4D 3SE8H 3TP4A 1P5UA 4EZMA 1SEBA 3AVEA 1U6AH 1NC4D 5F7DA 1ZEAL 4CU6A 3U2SB 4H1LG 2VL5B 1FL5B 1JHTB 1ND0B 1P6AB 1M1SA 5GGSY 2X4PB 3AB0B 3GMOB 5I1HL 3S36H 4P49A 3G5VA 3CFEB 2VZSA 1EXUA 3PGDB 3PHQB 3BHBB 3QXAB 4ZQKA 2MTPA 4XCYA 4ODUB 4HS8H 4JKKA 2X05A 2HFFA 4WGWB 1MFEH 5LXGH 5IKCB 2VR9A 5T1KD 4DEPB 4JPWL 3GMPA 4WI3A 1VESA 3MCKA 1O5DT 4CN4A 2C3GA 3KPPB 4OLWH 4QXUH 5DMIH 2FZ3A 3MMEA 2VLRE 4NN6B 3BZDA 1KYOJ 4KK8D 4NQSA 3OKKB 1RZGA 2AK1H 3LQZB 3EYUL 2VLJD 5FYLL 4Z7NE 2C3HA 1SJVA 5B21A 2VITB 1ZLVK 4F7EA 4WWKB 3QFJD 4QY8A 1K8IB 4U1SA 5HHOA 4LCYA 1IAOA 2Y07H 3UTPE 2XKNB 5DJAB 1DTUA 2FHBA 2D7NA 4Y4FB 1EFXD 3IVKB 1OTSC 4Q2ZA 3B2VH 1GRWA 3RWDA 1YN7A 2ZOLB 4OLXL 4XC1H 1U2CA 3DRQA 4NSKA 3WV0A 2EC8A 3DUHA 3TEUA 3SCMB 1CDBA 1AGDB 1XGPB 5DD0L 3SDXE 5I1JH 5D1QB 4WFGD 5GJTL 4R7DB 3DETC 1BD2E 2YPLB 1QEWA 3KPRA 4GRLB 1UB5B 4YNYA 3WO3B 3AS1A 3G5XA 4HZAA 2DLTA 1NFDF 2AJVL 3UMTA 4LIQH 3NFPA 4GBXD 5F1NA 5FKPA 3HR5A 2FJHA 1EIBA 3C60A 3T1FA 5JIIA 3GO1H 3MRBB 3RDTC 1QYGL 1A0QL 1U91A 3H7LA 5F9OL 4B7IA 1BBDH 4KI5E 1T20A 2NY5H 2JELH 2J6EL 4ZXBD 5FYJU 3A6CL 4ETYA 2CXKA 4YGAB 1E28A 4XGZB 4HIJB 3C5ZC 5E99L 1L9MA 4KI5C 1FCCA 1A3LH 4HLZG 4LSTH 4QRUA 3VFSB 3O4LA 4BK5A 3HC0A 4QOKE 3MXWL 2RGSA 2AABL 5ACLA 3NGBC 4UT6H 3ISWA 5DO2C 3PWUA 3VXPA 3MJ9H 1A7QL 4N68A 4CVUA 2F15A 4JZNA 1BFTA 3RZCC 1ZA6B 1A6VH 4PB0L 4NQVB 3L95B 3NTCL 3IETB 4C58B 4P5TB 5F8QC 2BDNH 5EO9A 4HZLB 3ULVD 4KY1L 2IAMD 3K4DA 5FGCE 1MVFA 5EC1A 3ZTNL 4NNYA 1P5VA 1D5IH 4LHUB 4R2GC 5DC0A 4LCIH 4U6VH 2SEBA 3O9WA 4UILH 4YDVB 1Z5LA 5EU6A 4CW1A 4K9EC 2ENYA 3R1GH 3V6FB 4KDTC 1IKNC 3DOSA 4C83A 4Y4KD 4AT6B 3SOBH 5JNYA 5CZVL 1JZ8A 5EDXA 3KWWB 3KPQB 4PJ7E 1MI5D 4YIQB 3WHE0 2F8OA 3BP5A 1HHHA 3NA9H 4C57C 3RTQA 5FB8B 3P9LA 4KGJA 1FHGA 5FCSH 4MNGA 4PGCB 3WFHA 1NBZA 2ZPKH 4KZDH 4PG9B 2FECI 1HYSC 4JDTH 2D9CA 2Y06L 5DJZA 4OCSH 3FFCB 3DBXA 3O8XB 5T5NF 3BKYL 4LVNC 5KS9F 3ZDZE 4L8DA 4JREB 4HJJH 1G9NL 3QXWA 2RQ8A 1MWAA 3ULSA 3OXSA 3QCUH 1WISA 3KPOA 4JO2L 4Y2DC 5BQ7B 1CD9B 1K6QH 4WVRA 1JGVH 4FG6D 4EI5B 4B0MM 1LEIA 4A6YB 5C92A 1R5WA 2PYEE 1E0OB 1Q9KA 3KYMA 5JLZB 3KR3H 4BSWA 4UU9A 4HBCH 4X5WB 1TFHA 1R0AL 3UTZB 2BVTA 4IRJC 4R3SB 1H3XA 3V5HA 4LCWB 5ANME 5TQ2H 2VISA 3I2CL 3HUJE 3JTTA 3CH8A 4G6FB 4KZEL 3V4UH 2Y9RT 3MV8E 4PRHE 5CJQH 5JXEA 4PJDB 4R0LB 2FO4A 5D71L 3UTQA 3ZL4L 4LAQL 1U8IB 3ZYZA 4WNQA 2PKDA 3QQ9D 5DHVA 3SDXA 1JE6A 5E2TH 1JV5B 1JGEA 1OAZL 3P30H 3WO4B 1JN6B 3LKPA 4O51B 1MRDL 3RDTA 4S2SB 5E4EC 4NGHL 5CSZA 4RGND 4UUJA 1LDPL 4J4PD 3V6ZA 5A40E 2PXYC 3D39E 4WDIA 1NCWH 3WFCH 4KAQH 4LCUA 3QUXC 1KNOB 4JO1H 4BZ1L 5BS0E 4Y0GA 4JY4A 3QIBB 4Y1AD 2F74A 5FDWA 3HTLX 5D7SH 2BY3A 5DJDA 5I1KL 3QQ4B 5CJOH 3BD3A 3O3BB 3SE3C 5FO8A 1QPXA 2EKSB 4P2QA 1PZ5A 4JKMA 4WU7A 4UIKL 4NPYA 2HFTA 4N8VG 5CMAB 4HQQH 2Q20A 5IFHH 3MJ8A 4L3CA 2VXQL 1X44A 5BZWB 2Y25A 4AEHL 5JQ6L 4M48H 2Y5EA 5CGYD 4QOKA 4PBXA 5J6GA 3T0EA 5F88B 2XZCH 3LMJH 5GGRY 1OP9A 3QUMB 4HS6A 4DGIH 1S5IH 3FTGB 1FG2B 3OB8A 4C56D 1BLNA 3FB5A 2D2OA 3NIGF 4NZTH 5D1XB 3UTOA 2FLRT 4BH7A 1QRNE 1CQKA 2V17L 3M1BA 1A7NL 1TPXB 3GRWA 1JYNA 2I07B 2FH8A 3BP4A 3TPUB 4WW1B 1A3RH 1T7VA 3GKZA 1QA9A 5C07B 3VE0A 1XF5A 2E7MA 3WFDL 1WAAE 1IKNA 2EYSB 2R1YB 1PFCA 3T2QA 2PW1B 3MV9B 4JFPB 2XICA 1CICB 5HGHA 1RZKL 1X4ZA 4XI5C 3W5NA 2WIIA 5DDHB 3BPLC 3DMMD 3MACH 1DANT 4JLRB 3VJ6A 5I0DA 5C0CD 4WI2A 1RUPH 1M7IA 5HD8C 2BSTB 4CN1A 2DQTL 4PJ7A 4ZTPL 2CIKB 5D6DC 2ZG2A 3TWCH 1FV1B 4YK4B 3ARDC 1JPSH 5I1LB 4BYHA 4QEGA 2B39A 3FO2A 1ONQB 1R24B 1DL7L 4OKVB 5DD1H 2EH7L 4ZAKD 5KSVA 5C9KA 1IGTA 3HMXL 2WINA 4AENB 1TVHA 2EIEA 1D9KB 1MUJB 3IYLW 1S7XA 4EI6B 4U1IB 2DQCL 4PREB 4Z76B 3DROB 5A3IC 4L4TB 3ZE0F 3O2WL 3SQBA 3VWJC 1U58B 4JJ5A 3ESVF 5BVJB 1NFDA 3G5YB 2X2YA 2DQGH 1KPVA 3N1PC 1L6XA 4WRLA 1V3MA 1OB1A 3REVA 1WCQA 1UM5L 2MKLC 5HHXH 5M7QA 3QQNA 5JHLL 1CGYA 1S8DB 4P46B 1JF6A 4IRJA 4ZFZA 3ULVL 3NCYS 1HNFA 2EO1A 3LSOB 3Q5OA 3G5ZA 3GSVB 1DUYB 5IB4A 1IGYA 4DW2L 4KXZI 1GGUA 1QVOB 4HK0B 3VGDA 4YBHA 5TQ0L 3ZTJH 4LSVL 1A7RL 1A6AB 5GZOC 5HYJB 3LN5A 5HYIA 5CS7A 4HC1L 4IRSC 1V7NL 2W60A 2Y4SA 1IM3A 4RZCA 5FA3A 3ZYOA 1KJ3H 2H1PL 5EG6C 1VFOA 3TA3D 5HVGB 2O5ZH 3T77B 4FFZH 4L3EE 3G6DL 1QHOA 1FO0L 1CT8B 3BUTA 5FF6B 2PTTB 4GG6E 1MCSA 2H9GB 1FLRL 1EZVX 5GS0H 1RAMA 1L0QA 5DRXA 3QUXA 3VGEA 3IRZA 2KUTA 3OAYK 2NX5B 3QUKA 3D39A 4YBQC 4D0CA 3W9EB 1P69B 3TBYA 2ADJB 5FOJA 3PDGA 1NGWA 2D31A 2R2HB 3M17B 5B38G 5CP7A 1HHIB 4GH7B 3EAKA 2D4FA 1A47A 5IESL 3F7VB 4Z7OF 2NY1C 1E4XH 3LH2L 1RHFA 2HT2D 3C09B 2I9LB 2BSSB 4PJDF 3S6CA 2IJ0C 1CE1L 1FCGA 3LS4L 5ICZB 4GRMA 1EO7A 1BOGB 1VEOA 3KS0H 5MERB 4XBPB 3RIFK 1T0MA 1YEJH 5GGSB 5LWYH 4WUUB 5I76B 1MJ8L 4ZUTA 4NWTH 3UJIH 4UIMA 3HE7C 1ITCA 5JOPD 3DI3B 4JM2C 3WL9A 4J8RB 1N8ZB 4KROD 3U0TA 5E6YA 3WMSA 1D5ZB 1IBGH 1U8KA 3IDJB 3Q3GA 3RU8H 4N8CH 3SDCC 1XMWA 1XCQA 3DX6A 3VFMA 1U8PB 5GGQH 4ZYKA 5BZDA 3BP6B 1LO2H 3MR9B 1AHWB 5I8EA 2Y6SC 3L9RA 2N7BA 4Q9RH 1KB9J 4PGBB 2Z4QB 1WAAA 5IHLB 4JDZA 3KPTA 3GSNA 3OX8A 3OJVC 3SQOL 1V3LA 5CEXA 2OP4L 1HXYB 3IDXL 2DYPB 2CDFB 2JCCB 4D9QE 4PV8A 5E03A 2GJ6B 2H3NA 3U2SA 3G6JB 2AGJL 1FL5A 1JHTA 1ND0A 5C3LD 5GJSH 3MBXH 4ODHL 3QEGL 3X3GH 1KENH 3GMOA 4X7FC 3IDYB 3VWJA 12E8L 2F54D 2YXFA 3PGDA 2J88H 3BHBA 3PHQA 2IG2L 4ODUA 4XVSH 3HNTH 4MA7H 3VDCA 5IKCA 4YPJA 1NFIB 5SX5H 1SBBA 4JEGB 3IU4L 4P3WA 5T3ZH 5HVFB 2FIRT 5F3BB 3INUL 3H42L 3KPPA 3ALWA 2ZUWA 2ZUXA 5DMGC 3NFSH 3V6OA 5KN5A 2CIIB 1CXHA 2J1KA 4RGOH 1FAIH 5EBWB 2VITA 4WI7A 3HN3A 4P2OB 2OMBA 5F7HA 1DBJL 3PL6B 4U6HB 1Q94A 1J18A 3EDEA 1K8IA 4DKFH 3IAPA 2IFGA 2A9NL 2VXSH 2XT1B 2XKNA 5DJAA 4JQXA 3IVKA 4Y4FA 4L4VB 5EBLB 2O93L 1I1YB 2ZOLA 1NGXB 5FDYA 1CIUA 3WEXB 3H9HB 3ZHKA 3L7EA 5D1QA 5ICXB 1PG7X 4ZS6D 3BT2H 3GBNL 1P4BH 3TFKC 5GGVY 1NC4B 5DVOA 4QRSA 5KJRL 2KQNA 4ODTH 1BQHB 4JPIB 5IK3B 5E8PB 4DVRH 4M1DL 3FT2A 1U3JA 3PJSA 4EVNB 3MRBA 1BFVL 2XIDA 4RFNC 1JZ4A 2YD9A 3GMMB 3S34H 2I60L 4GG6A 4KJWD 4XVJH 1U8HB 3NBNA 4NO2B 5IROA 4IIQB 4KVNL 1RU9H 3TO4C 5T1KB 5L2JA 5DWUH 3K4AA 5EC2A 5C6PB 3MJ7B 4ZFFB 3Q6GH 1Q1JL 4XCFL 4XGZA 4I0PD 2J7LA 4MSWA 2BC4B 2DS4A 3ULUE 5I74C 2VLJB 3VXUB 1CGSL 1KLGB 5SX5K 4M7LH 2X70B 3QFJB 1CFVH 2GKIA 5ETUA 4M3JA 1U8OB 1W0WB 3ULUC 5FYKE 1EJOH 2EDNA 1EFXB 5DRWB 3ZLQC 1T5XB 3CDFA 5CEZE 1TQBC 1CK0L 4B50A 3ARUA 4UQ3A 5FM5O 4RISL 5CBAA 4NQVA 1J12A 1BP3B 1EAPB 1CBVL 4E42B 4DCQA 4HZLA 1BFOB 3SDCA 4U31A 2BHZA 4OCMC 1T0NB 5IB1B 4EJ1C 2CUIA 2OI9B 2IPTL 3ZTJG 1CR9L 4XX1E 2GEEA 4HHAB 4QO1A 2ZCHH 1XEDA 4XB7A 3GSNH 2JF1A 1S9KC 2V5SA 4LHUA 5C0JB 4EDXB 3QXDB 1KCKA 2F5AL 4YDVA 3KLAB 4G8IA 4HGMA 4DGYH 4OI8A 3BZEB 3KWWA 4FQIL 4TSBH 4OV6F 4YIQA 1KJMB 4XAWH 2I27N 5HGAB 3MRIB 2G9HA 4A2MA 4PGCA 1QZ1A 3T2NL 4ZS7H 4QHNB 4JDVB 4ZXBB 3U0PA 4PG9A 4P3DA 1PX3A 2N7AA 3O81A 3FFCA 1JWUB 3V4PL 1IM9A 4X6FB 4L4TE 2ESVE 4K55A 1BJ1J 3HZYB 5DJCA 4LK4A 4U1HB 4ZDHB 4OGYL 3BJLA 2ORBL 4NT6A 5BQ7A 4OFDA 4LVHB 4GAJL 1A5FH 3QEQE 2FATL 5FYLE 4A6YA 2VDOL 1U3ZA 4LGPB 2VDKL 4WHCA 1MIML 5JLZA 4NWUH 5FO7A 1U9KA 4Y4HC 1FGVH 1GGBH 2J3SA 2R9HC 2VABB 1YEGH 4M6MH 4NRXB 4TVSa 3UTZA 2E27H 4G7VH 5J06A 2IAMB 1Y6MR 4S1QH 1Z6JT 1QSFD 2JCCF 4K3JH 1XGYH 4ZTOL 5ADPH 1F6LL 3TCLA 3AM8C 3C6LC 4PLKD 3G6JF 4HCRA 1TZGH 5DLMH 3WN5B 3ROOB 3QDGE 4GQ9L 32C2B 1M05A 3OGCB 4PR5B 4U1LB 4PJDA 1S7SA 1T0PB 4R0LA 4Y4KB 1GGTA 4KUCF 4JHBA 5I19L 4CDGC 3DX8A 5EOCH 1P7KB 1U8IA 4YGVB 1MI5B 4MJ2A 3I6LE 4IBLT 1IAIM 4O2FB 4M93B 4XPHH 1JV5A 5DJYB 4NZUL 1MCWM 5GGRB 4MAUL 3VXQB 1JN6A 4UINH 3LVEA 1F4WH 1WBXA 4JPVH 2ERJB 3B5GA 2LVCA 3ES6B 25C8L 2W9EH 1FO0B 5GRVL 1KIPB 4FABL 4M43L 5E56A 2OTPA 1K4DA 1JPTL 5JW4R 4PV9A 2V7HB 3GSOB 4PLJD 2DTSA 3TJHC 4BQCA 2JJWA 5JHDD 1I1AC 5DQ9B 2IGFL 2DJ4A 1J8HB 2NTFA 4NQEB 2MNUA 5GS2D 3VXRE 6FABH 3P9WB 1UZ6F 3QQ4A 3IDGB 1I9IH 4HKJB 5LGJA 3NPZB 4N0YL 1A14L 5TE6L 1YY9C 5FO9B 2BVOA 3LN4B 3STLB 2DMCA 4PUBH 1I7RB 3BE1L 3E1F1 4OCYL 4MJIE 1Q0XL 2VB5A 5HPOA 1NGZB 5I17A 2W65B 4JG0L 2H2SD 5MI0B 3QUMA 5DJ0B 1LGVA 1ZA3A 3FTGA 3MOAL 1G7IB 4LP4A 4I0CC 2VJXA 1QSZA 2F5BH 5H35B 1XAUA 2WV3A 5KVDH 1MRFH 4YBLB 1MJJA 4NQDD 2I07A 5IVXB 2IH1B 3TPUA 3BPOB 4WW1A 1NL0L 2CLZB 4K3EL 2EZ0C 4XNXL 1DBAH 2R1YA 3JTSB 3S5LG 3VI4E 3U82B 5HDOA 4YHNB 4RGNB 2PW1A 3BDBA 3MV9A 2ADIA 2R0KL 4IJ3C 1CICA 1MH5A 4JHAL 4FA8A 1LILA 2NYYC 4HFWB 5DDHA 5I2IA 4JKWA 3CFJA 4JHWH 4JLRA 1CGUA 5TF1H 1H0DB 2BSTA 3M8OH 1FVCA 1HKLL 3IFLL 3RVXC 3UCRA 2CIKA 1FV1A 3FO0L 4Y1AB 5I1LA 4KHTL 1ONQA 5IW6B 1R24A 1YEIL 3QPQC 4XAKD 4R90L 5EOQH 2EDDA 4Q74A 1J05B 4KRPD 3KGRA 3WS6C 4AENA 1MUJA 4TVPD 4F33A 2J8HA 1KLFA 3LCYA 3UO1H 3SDDD 3I02B 1I1CA 4Z76A 4DK3A 5C0EB 1DSFL 3DROA 1W0YT 2BK8A 4L4TA 1U58A 2NY7H 4PJIF 5DEGA 3RPIB 2DIAA 4X8JB 2A83A 5TE7H 4EEEA 5C7XH 3LAFA 4RMRA 4OIAA 4Y4HA 1JRHH 1S8DA 3B9KD 2B4CH 4C56B 4UTBH 3MOBL 1T89C 1YYMH 4ISVB 3QEQA 1JIBA 5T5NG 3WXVL 3LSOA 3QIUD 3GSVA 5I1EH 3C6LA 5CAYB 1DUYA 4X98A 2MKWA 1IVLA 3MOQA 3GBML 4L4VE 1F4AA 1QVOA 4OLUL 4HK0A 3F7PC 1RIHL 2AI0L 1Z0NA 5L0QB 1A6AA 4WEUD 5C70A 5HYJA 5E5UB 4MXQD 2AK4E 4N0FA 2ZUQB 2EDRA 1EEYB 4GS7B 1TETL 3KYOA 3OKNB 3DMMB 5C0CB 1LO0L 1VGEL 1HINL 5IFAH 1FVDB 4ONFL 3NZHL 3TLRA 3Q48A 4ZFGH 4OLYL 1OOAA 4O00A 1INEH 4DKDC 3O6FD 1CT8A 5FF6A 2PTTA 5EB9A 2H9GA 2Z31D 4Y2DB 2J8UE 4UDUB 2FX7L 4KPHH 2MWCA 1I85C 4MLSA 4OD3L 5SWQB 2R2CA 2YMXL 3T08A 2KKQA 4XNZC 2GT9A 3PQYE 4R96B 3ZDXE 5C6TL 1IE5A 3W9EA 1Q72H 2PW2A 2R2HA 3CX5K 3G08B 3M17A 2GK0B 3L3JB 1HHIA 4YAQA 4JKLA 4LLMB 2J6EA 1GOFA 2HKHL 5KTEL 4N9OB 5K59E 3OJ2C 5E8OB 3ARFC 3FMGH 3VXRA 2I9LA 2BSSA 1F4HA 4X7TB 1C16B 1YY8B 3S35H 4JPKL 4EN3D 5ICZA 3HI6H 4YHLL 4MA1C 1BOGA 4PB9H 1I3RB 4U6XB 5F7EH 3QUMH 4XBPA 4DZ8B 4FQ1H 4QF1B 4TUOB 3IB4A 4WUUA 5I76A 5AYQA 3IJYB 5GZND 4OLEA 1ODAA 3FO9B 1K3ZA 5IOPA 4MJIA 2UVFA 2XQYG 3C5JB 1QPPA 5E4EB 1KT2B 1QO3B 5J12C 5JIPA 2NPLX 1KPRB 4FHBD 3NIDE 4G5ZL 5F7LB 5D7JD 1ZGLP 5BOZG 3WNKA 3IDJA 1T7WA 4LKCA 4P0DA 4WCYL 2HH0H 3AXLB 3G6AB 1A02N 3GB7B 1KELH 2AS5M 1U8PA 2CMRH 4FQ2L 3BP6A 5ABDE 3MR9A 1AHWA 2OK0L 1YEHL 1E4JA 3LEVL 4MJ5B 4PGBA 4GBXC 4UZGA 4M1GH 2NW2B 3KJ4C 1YC8A 4PRDB 1G9EA 3VU2A 1ZEAH 3AS3A 3OF6D 3TN0C 5EZOL 2CDFA 1FZOB 3LEXA 2DI9A 3V5KB 4X9IA 3G6JA 3S7GA 5C0FB 4XPBL 5I1HH 2NY6C 1FL6B 3NN8B 1A1OA 1BJMA 4G80B 4YDLC 3VH8B 3LHPL 2YUXA 4G9FD 4HPYL 4JPWH 5DEZA 2C9AA 1IQWL 5T3XE 4ZOEA 3WIFA 1NFIA 5IVXF 4ODWB 2CDGB 3LOWA 5LBSL 1YZZA 5IBUB 1L0YA 5F3BA 3HFML 1JCKA 2IF7A 2XXCB 1QP1A 3CPLB 4IEFB 1MCNA 4K8RC 1HXMA 4P2OA 3IFNL 4KKBD 4KROB 1NMCB 1HSBB 3PL6A 4U1GC 3DRTA 5DEFB 4N5UA 1GOGA 4M1CD 4BA8A 4OLXH 5KANG 3CFDB 2EECA 1A2YB 4L4VA 3PE9A 3OB0H 4ELME 3LS5L 5DD0H 4V1DE 5GJTH 1NGXA 4LHUG 1MI5E 3WEXA 1CD1A 1HSAA 3KNBA 4LRNL 3QI9D 1NGQH 1MCPL 5ICXA 2EDOA 5E8EB 3JBG7 4OBRA 2AK4A 2DKMA 2AJVH 3L3OB 1NC4A 5HJ3A 4NJAL 2BFVH 3OZ9L 1BQHA 2WBJC 5F3HB 3GSWB 5IK3A 5E8PA 2QQNL 3UYRL 1QYGH 1A0QH 4MD0B 4R26L 3BSZL 2X9YA 4TVPL 3ARVA 2QL1A 4W6YB 5F7KC 3MZGB 5JDJA 5DFWH 3MLTA 3GMMA 4H25B 2F54B 3OKDB 1NEZB 1U8HA 3KPMB 2BOCB 1MEXL 4NO2A 4U3XA 4U6YB 4MD5B 4IIQA 4MQSB 1MPAH 3A6CH 5T1KA 3NABL 5E99H 2EO9A 3MJ7A 4ZFFA 1QNZH 2W0FA 4HIXL 5E2VL 1B2WH 3ORJA 4X6CB 4APQC 5AZ2H 4S0TD 2ZZUT 1JK8A 2VLJA 3BGAA 3MXWH 4L29B 4FG6C 1AI1L 3FOMB 1KLGA 4TTDC 3VA6A 4NKQB 1ED3B 3QFJA 2HYMA 4M6AA 3PP4L 2AXJA 1U8OA 2KZWA 4GG8B 1UXSA 1Z9SA 4PB0H 3SJVB 4KMQA 1EFXA 3V8CA 4L3AA 1T5XA 5ITBL 2LVEA 3O0RL 4KY1H 3BW9B 2Y7QA 5K9QI 3ZTNH 1T0NA 3DVNA 2GK2A 1CVSC 4HHAA 1RK1B 3OB0K 4MAYC 1I4FB 2A6IB 1FFQA 3QQ9C 4GBXA 4P9HC 4EDXA 3QXDA 2P4AB 3P4MB 2A77L 4HK3J 1I8MB 2E6PA 1MLCA 3BYTA 3OQ3B 3BZEA 4OD2A 5J56B 2NNAB 2QEJA 4Q9QL 2ZWLT 4OTXL 4MJ6B 4X6DB 5K9OA 4QHNA 2Y06H 4ZXBA 4QNPE 1B3JA 3PIQA 4NQXB 3BKYH 1AKJD 5D2NE 4UNUA 2P1YA 4NN5C 3QRGL 4I0PB 1JWUA 1CIDA 5EOTB 1G9NH 1QR4A 2X4SB 3HMXA 3W11C 3I75B 3QA3A 3HZYA 4KRNA 3TGXA 4U1HA 1D5XB 4LASL 4K3DH 5D2NC 4ZDHA 3E6HB 3K8KA 3O41B 4X7EC 2WW8A 4PJ8B 4NKMB 1DVFD 2Z93A 5DYOB 2HJFB 3P4NB 4P5MA 4NQCE 2VZUA 4QTIL 1G7JB 1X4XA 2G5BB 4XPFL 3NACL 3L1OL 4NRXA 4PYHA 1JPFB 1MRCL 3LQAC 4MLIA 2IAMA 5C08D 1VSCA 2Q6WA 1SM3L 4KZEH 5F21B 3QNXA 4FQXC 2Q86B 1DBKL 1NJ9B 3WN5A 3ROOA 1U2HA 5D71H 4QRQB 3ZL4H 4PR5A 4U1LA 2NLJB 5K9KB 1Y6NR 2X1QA 4QXGL 5AZEL 4Y4KA 3CC5B 4PTUA 4PY8J 3ZDYF 3HB3D 4HC1A 4V1DA 4YO0B 1P7KA 4J3WA 1OAZH 1MI5A 4YGVA 4IDJL 4K7FB 2HTKD 2DLFL 1MRDH 4O2FA 1PD6A 2HKFL 4OGAD 4NP4L 3LN9A 5DJYA 3VD7A 4NGHH 3MNVB 3VXQA 2YD3A 4XHQA 5C9JB 1LDPH 4ACPA 4AEEA 5L2KE 5MHSD 1FO0A 1BHGA 3RL2A 1KIPA 4R4BA 1EHXA 5CZXD 2EDTA 3N0PB 5B8CB 1UC6A 2FSEA 4ZAKC 1QD0A 4PJ9D 4BZ1H 4X99B 4XWGH 1QOKA 4TPRL 5DQ9A 3CH1A 4Z9KB 1GIGL 1S9XB 3X13A 1F6FB 5I1KH 5DC9B 2LE9A 3SKJH 3B3IA 4APQA 3M07A 2KQMA 3ARZA 4Q9BA 2QR0B 4UIKH 1ORSB 3DYOA 4HKJA 1JNLL 3P73B 4AEIL 3MRCB 3FT3A 1MFAL 2Z35B 1MNUL 2VXQH 2ZOKB 1YNTB 5FO9A 2ED9A 3STLA 4AEHH 1MFBL 4KKAD 2B1AH 4U7MA 1QSFB 3VA2C 5MEND 4XP9H 1KGCD 3EYQC 2XXMB 3H9YA 5ESQA 2W65A 1DJSA 4XRCB 4YHIB 1OLZA 1KJVB 2ICEA 3QPXL 1G7IA 2V17H 1WTLA 1A7NH 4WW2C 5FM5M 2W91A 3L3KB 2EYRA 2YOCA 4HUVB 1OT1A 3DXAE 5MEOB 1G7QB 1WITA 1TVBB 3WFDH 5GXBB 2IH1A 4PJBB 3G9AB 3OKLB 1OP3K 3M45A 4WWID 4OQTL 4CMMB 3R0NA 4R8WL 3Q1SH 3T65B 3VD4A 3TA3C 1K8DB 4YHNA 2CDEB 2GSGA 2EDHA 3HE6D 3ARGC 4J4PA 4P4RB 4XP1L 1U92B 3P0YL 3MFFA 2WP3T 4X6CF 2NTSP 5BVPL 1NUGA 1OAKL 2DQTH 4XCCL 1KTDA 3O6LL 1H0DA 5JHDB 3OAZH 4U49A 3ELAT 3QNZA 1DL7H 2EH7H 3O2DH 4Y1AA 4L8BB 5E7BA 3HMXH 5IW6A 1IGIL 1I1FB 1J05A 2DQCH 3VD5A 2GUOA 5D2NA 2BY0A 1KB9K 2DWEB 5F1SA 3I02A 5C0EA 1NPUA 4X8JA 3ME0A 1YMME 5KSAC 5EZIL 1UM5H 3QHZL 3QQ3B 3AGVA 2R0LH 5JHLH 1HHGB 1TJGL 2DQJL 3OHXA 1UT9A 5J7CC 5TGBB 1NC2D 3GUTB 3HAEG 3U7WL 1FZJB 2DM4A 3CMOL 3QJHA 3DURB 5JDSA 1J87A 1HIML 4NQDB 2O5XL 4NHUB 4LSVH 1A7RH 4X6DF 1MJUL 4U7SA 1RZJL 1V7ML 4ZMAT 5CIPB 1F3DJ 2D4DA 1B88A 1V7NH 1KF9B 1T1ZA 3EFFA 5KSBE 1RZ8B 2NY3D 3O3EB 1ZGLB 4XCNB 3UTSD 4JKPL 3DMMA 4Z8FH 5C0CA 3KYKH 2DI7A 1JF1A 1FVDA 2AW2A 3G6DH 1PEZA 2ZUYA 1FO0H 5HHNA 1P4IL 3B8YA 4Y5XB 5J1AB 5I71B 2DRUA 5E2UL 1DQML 4FOMA 4ZAKA 1NQBA 4MHHI 3TM6A 2C1OA 1IEHA 3MBED 1TZHB 2F19L 3OAZK 4IRZL 5SWQA 5L2KA 1UEYA 2EDJA 5F89B 3RWGB 3SDDB 2R23A 4M7ZC 1F45A 1T2QL 5HDBF 5A16A 2YZ1A 1JP5A 3W2DL 1G84A 1J0ZA 4JANB 5IESH 5DMKB 5IJVB 1OHQA 1IT9L 2GITB 3LH2H 5BV7C 4G6JH 4G8FA 4LLMA 3E6FA 3BGFB 1A4KB 5E8OA 1CE1H 3LS4H 1BZ9A 1XF1A 3B9KB 3GGWA 1C16A 1AJ7L 2APTA 3T4YB 3UC0L 1AXSB 1QRKA 2C1PB 4F58H 3QIUB 4O4YL 4U6XA 5SWSD 3P11L 5M94B 1Z3GH 4DZ8A 4QF1A 1TZIB 3NFNA 3ZYIA 3BX7C 3IJYA 1BJ1H 3I6GB 1UCTA 4K23L 5H94A 3FO9A 4YE4L 1VKXB 1NAML 3C5JA 1UJ3C 1QO3A 2VDRL 3C8KB 1U8JA 2E8ZA 2VLMD 4QRRE 1I8KB 3AFLA 4PFEA 3EFDL 3ARED 3L5WA 4OCLC 3TT3L 3PUCA 3AXLA 5IP4A 3G6AA 3TA3A 4OAWA 1X5HA 1ZOXA 4DZBB 1FBIH 3ARGA 2BSRB 4OCNC 1X5LA 2OR8A 1QKZH 5DUPH 3LQMA 3EJYC 4WJ5B 1BQHG 2R39A 2Z31B 2OP4H 4LARL 1NDMB 4F8QA 5HYSB 2NW2A 3IDXH 3AU1B 3KYAA 1QLFB 1QSEE 4KK5D 4PRDA 3THML 4FQCL 1A6TB 4QYOB 1BFSA 3IDMB 3K46A 1FZOA 2AGJH 3OL2A 1KCLA 3RP1A 3V5KA 3EO9L 1W2KT 1Q9LA 1WFTA 3QEGH 5D2LE 5E94B 5C0FA 3HC3L 4X6EB 1FL6A 3WKMH 3NN8A 3EOAA 12E8H 5INDB 4YC2B 1WWBX 2IG2H 4GXUN 4MQ7B 1RIUL 3VXOB 1DN0A 2EEAA 4EN3B 1MLBB 3K80A 2FEEL 1PG7W 4CADA 1YNLL 3IU4H 2C3XA 1F42A 3INUH 5TH2A 4PJBF 1EK3A 3L3DB 3SGKC 5KVEL 1RUQL 1YUHA 3V0VA 2FH6A 4XNMB 4K9EH 1YMMA 1KV3A 4AL8H 2D0FA 3U6RB 3AUVA 3BKMH 3K3QA 3CPLA 1DBJH 2V2WB 2JIXD 3MNWB 4O2CA 2VXUL 2XTJD 4FFYL 4WI6A 2A9NH 2RHEA 5D7JB 5BMFL 5DEFA 4KK9D 1CFSB 3PWPE 1IGJB 3FHQA 2I25N 1VADA 3CFDA 1A2YA 1T6WA 4HKBB 1H9VA 1G9MC 4Q58C 3RPKA 3LV3B 4Y5VB 3GBNH 3CLFL 4YXLL 3QULB 5E8EA 5KSBA 1D5BB 4F7MA 5A43C 4K7PL 3VGFA 1U93B 4LLDA 5KJRH 2EXWD 4IMLB 4OZFB 5DTFB 5EIIB 3L3OA 4MDJB 2FBJL 1RVFL 4LQFL 4M1DH 1BOYA 1BBJA 2HWZL 4UT9L 4ENED 2FX9L 5F3HA 3MCLL 3GSWA 1BFVH 3EGSB 3DO3A 43CAB 4MD0A 5D1ZC 1T1XB 4UV4L 3L5IA 1ERNA 1QBML 4J3VA 3PP3H 2DQUL 2PYFB 2W1NA 5HPMA 2K7PA 4XTRD 3F7YB 1UYWL 5CLTA 5IVZA 3OKDA 1NEZA 5LGKA 4KVNH 4G9FB 1H3TA 3RGVD 1AQDA 3LB6D 1XF3A 4MD5A 4U6YA 1A6UL 3RJDA 1FP5A 1QFWM 4XCFH 4X9BA 1KIQB 1GC1L 5D96B 3GSRB 3EDDA 4YDJB 2CLRA 4GAGL 1CGSH 2HMID 1NBYB 3P4OB 2YXMA 4YHOH 2WUBH 3U1SH 2O61B 3FOLB 5INCB 2D9QB 5IHBA 2DWDB 1B90A 4HWBL 1F2XK 2DM3A 2OSLA 1CLCA 1U8MB 1CK0H 1UJ3A 5ID1B 4RISH 1CBVH 1C1EL 1OAXH 4X9HA 1P53A 5ERWB 1FZMB 1UXWA 3D25B 4UBDD 4RDQF 3QI9B 4GW5B 3HPJB 4OLVL 1CR9H 1TCMA 2H2PC 4C4KT 3T0VA 1QFPA 1RK1A 2F5AH 1I4FA 4QRRA 1G7PB 2IBGA 1AR2A 2HA1A 3VCLB 1DLFL 4YXKH 4LF3B 4KKCC 3PHOB 1I8MA 1CFQA 2BNRE 4LKXA 3OPZL 3ZE2F 1B0RB 4P23B 3L5JA 3TYGL 2DQIL 1ZANL 4AM0B 2Y5TB 3QAZC 4MJ6A 4X6DA 5HHQB 2LV4A 3QUZD 4Y19D 4DUWA 3PP3K 3V4PH 3VRLF 1UCBH 1DDHB 5D2LA 1D5MB 4TOYL 4LSPL 4I0PA 1EJ6A 3RQ3A 1Q8MA 4LLAA 2MMXA 2X4SA 3I75A 1CYGA 4MS8C 3GIZH 2ORBH 2COQA 3IDNB 2IADB 3BI9X 3O41A 4NCDA 3L5HA 1NCNA 4GAJH 1S7TB 1CI5A 2DKSA 2WWKT 4Y16D 1Q9OB 2VDKH 3EW3B 4NKMA 1SJEA 1MIMH 4LPTA 1XIWD 5DYOA 2HJFA 1ZVHA 3PWNB 1G7JA 2W38A 2G5BA 2I26N 2L7UA 1TTUA 4Z7VB 3S97C 4BKLB 1IMHC 4ZTOH 4LVEA 4YEFA 1KSRA 1PG7L 2DLIA 2MHAB 4CJ1A 2VZVA 1QFUH 2HT4C 5A1AA 1MSPA 3LKQB 1I3UA 1FAKT 3ZKQD 4G6ML 4D94A 2Q86A 1DANU 1MFEL 1NJ9A 3PWPA 4GRWB 3D2UD 5F8RC 3FQTB 5I19H 3CFBB 1M6OB 3JV0A 1PY9A 4PTTB 1ZLUK 4Z7UE 3WUWG 4YO0A 2HRPL 3MCG1 5DRNB 3WUZA 2HLFD 4NZUH 4HKXA 4MAUH 1CDYA 4Q97A 4XNQA 4NYLA 5IQ9B 4G8GD 2FD6H 5GISL 1OWWA 4H8WL 25C8H 5EZJB 4LLUB 4FABH 4M43H 4NBYB 4QHUB 3V7AG 1ZV5A 1TDQA 3CDGA 4TVPE 8FABB 1JPTH 1AKJB 2J12B 3TBVB 4YFEA 3WSQL 3RAJL 3VGAB 5B8CA 1VFAB 5FYJE 5HI4D 2QADD 1JMXA 2IGFH 1F8TL 2ZSVB 4XC1L 4PY7B 4Z18A 4TTGA 3U4EB 4F9LC 5H8DA 4WU5B 3IFOB 1OD7A 4U1GB 4H5SA 4PJEB 4HD9A 3W0WD 3IFPA 5A2FA 2QR0A 1A14H 1ORSA 1DVFB 5TE6H 3P73A 1K2DB 3EHBC 3MRCA 3L3GB 2Z35A 4JFXB 1T4KA 4FQQB 3VFVB 3GO1L 2ZOKA 3KAAA 3BE1H 4KK6D 4OCYH 4WTXA 2AEQL 4YHZH 5K9JL 5C08B 3OR6A 1QSFA 5B39A 4OUUB 2NMSA 4XVUD 3X14B 1ZVSA 3SN6N 5FUZL 3MOAH 4Z0XB 1PKOA 2V2XB 4YHIA 1CWVA 1KJVA 2BERA 5FHBL 1NAMB 5HY9A 3K0WA 1A9BB 2WP3O 3MUJA 5IGXL 5C2UB 2BX5A 4HWZB 4WUKL 1NL0H 3RUGB 3LPGA 5MEOA 4OZGE 1G7QA 4K3EH 1MFNA 2NZ9D 4V2BA 2VLLB 2R0KH 3HG1D 1XR8B 1JVKA 3LKSB 3T65A 4UT6L 4JHAH 3T4AA 1K8DA 1AD9A 5E00B 4HUXB 4M7KH 3IXTB 1M7DB 1QHPA 1ZS8B 3IFLH 4LL9A 1B4JH 5F44A 1H15B 1VB9A 4PJ9B 4BZYA 4CMHB 3I3EA 2NW3A 2BNRA 4U1MB 3FO0H 5JHDA 5GRVK 3O2VL 3MRKB 4KHTH 2XA3A 1KLUB 1YEIH 3RVTD 3ZYJA 4R90H 4L8BA 2DTML 1NH6A 3D6GA 4G6KL 1B0GB 2GTWB 3GJFB 4WHDA 3D69A 4WFHE 5IJKC 1D5IL 3MYJA 1Q0YL 3QEHB 3IAQA 1DSFH 3R1GL 2DWEA 3ARQA 3CFKA 2ICES 2NY4C 3B4NA 4BFEA 1G7MB 1A22B 3K2MC 2PR4L 1ZVYA 2YD2A 3NA9L 3MO1A 5HDQH 3R8QA 1HHGA 3PWLB 4NQUA 3MOBH 1X9QA 3FONA 5E5RB 5TGBA 2BHYA 3HI5L 3WXVH 3GUTA 3MV7B 4F15B 1FZJA 1CD0A 4GFTB 4BUGA 2YPKB 3DURA 1DQQA 3GBMH 4LDEB 3SE9L 1FPTL 4QHKI 4OLUH 3KDMB 3WJJC 4NQDA 3ZHLA 1RIHH 2AI0H 4ZO9A 4NHUA 3A6OA 3WFBH 4KJPC 1BQSA 2JJTC 1OAQL 5JW4N 4X80L 1QQDA 3DUUA 5K33A 1TETH 3ILQD 1RZ8A 3HE6B 4PJ5D 4Z7QF 1LO0H 1VGEH 1HINH 5E4IA 3RY6C 5CJ5A 1ZGLA 3V52L 1NANI 4ONFH 4XCNA 3NZHH 3V7MA 4MB3A 3KR3L 5HI3D 3ZKMC 4HBCL 4UT7H 5D7LD 1ZSDB 4LLQA 2WK2A 4PJXB 5J1AA 4I13B 4N0CD 5TQ2L 1W8OA 1HHJB 4GKNB 4NZRL 4OD3H 3OKMA 3PABA 5EN2B 5JPNB 5C6TH 5CJQL 4XCEB 5F89A 3RWGA 3SDDA 3GM0A 3UBXB 1YJDC 1JL8A 4Z7VF 3VH8G 2C5DC 2X4NA 4JANA 1GHFH 2HKHH 1FYTE 5DMKA 2EDXA 1S7VB 2GITA 2X4OB 5E2TL 2HLAB 4ZD3H 4UQ2B 4GRWF 3PHSA 1GVIA 2QSQA 3D1MC 5AD0B 4YHLH 1AIFB 1AXSA 3WIIL 1HOCB 1N7MH 3QIUA 5C0AD 1YA5A 1MCKA 2A74B 5EUKB 4KKBC 1TZIA 4AH2B 2OR9L 1TLKA 4LRIA 1CVRA 4M1CC 4GAYB 1CDIA 2NY3B 1OW0A 4IM8A 2BVQA 4G5ZH 2FYYB 1Z2KA 1FE8L 5HYEA 3TZVD 2Q1EA 5I73B 3UTSB 4GSDH 5CCKL 1I8KA 3HLAB 3VXME 4U0RB 4JRXB 4NKIL 4Y5YC 4FQ2H 3LDBB 3LKNB 4WTWA 2OK0H 4DZBA 1I1RA 3BVNA 4OZHB 4XB8A 3O6FA 1TQCC 4PJEF 4WJ5A 2P24A 2Z31A 4UV7L 1DQTA 3DV4B 4TUJA 1NDMA 3MBEB 3AU1A 4J3UA 1T83C 1A6TA 5C3TA 4DGIL 5GS2H 4NN7B 4QYOA 4JRYE 2VKXA 5DHYB 2I9TB 4XPBH 4TSCH 4OF8A 1FFOB 1MFDH 2E7CA 1A3RL 2ICWI 1HI6B 2X4TB 5IEKA 4DVBA 3H0TA 3T3ME 4HPYH 4MQ7A 1JHKH 1IQWH 2KPNA 1HQRB 3R06B 3VXOA 5HVHB 1MCCA 3ABZA 1MLBA 3SGJC 3RHWF 3QXVA 1HH6B 3L3IA 3Q6FB 5LBSH 3RUGF 2JJSC 5SWSB 4KH2A 4OM0L 1YEEL 3O4OB 1OAYL 4OF0A 3WE6B 2M2DA 1JPSL 1F11B 2A0LD 4P4KC 1N0XL 3BN9D 1EMTL 5B3NA 2V2WA 4Y88A 3WJJA 3ET9F 3WFEL 1BX2B 3FAWA 3DJ9A 1RY7B 1AY1H 5CIPH 3AREB 2GY7B 5D7JA 1H3WM 1A9EB 5GRJH 1IGJA 3LS5H 4MMZC 4LRNH 3I6KB 3BFOA 1MCPH 4M8QB 1QSVA 2JB5H 1CDCA 2JK5B 4HH9B 1D5BA 3OR7A 1U93A 1H8NA 4IMLA 5IIEB 1AO7D 5C09D 5C0GB 5JOEA 4MDJA 1IQDB 4LDOB 2QQNH 4I4WB 2FRGP 3UYRH 1TENA 4R26H 3ZE1F 4MXVF 3U46A 3EGSA 5F9JA 4OFYD 43CAA 2FR4B 5I9QC 4CGTA 3CUPB 1NFKA 3SKMB 4WFEE 2IQ9L 3MRLB 1MEXH 2PYFA 1LD9B 2CLVB 1YEKL 2YS4A 2Q87A 2CKBL 4U4BA 5JW3H 1YEDB 3FKUS 3NABH 3BXNB 1YPZB 1P6FA 2MFNA 3EYOB 1KJ3L 3U7AA 5E2VH 1KIQA 3GSRA 4YDJA 1I8LC 1FYTA 4FFZL 4NRZA 1AI1H 4KKLD 1NBYA 3P4OA 4Y7MA 5T1LD 4JQVC 2VMFA 4Z77B 3MRRB 1S78C 2JIXB 4HMDA 2WM0A 3FOLA 3QIWC 2XTJB 1S5HB 3PP4H 4GW1B 4URTB 4PJFE 2YD5A 4TNVF 4C4KO 4KUZL 2FEDC 5ILTH 5F6HJ 2X44D 1OGAD 2EXYD 5ID1A 4PJXF 5IBLC 2OJEB 3O0RH 5JIKA 4P2RD 5T5FH 1MAMH 3K81A 5ERWA 3D25A 2R8SH 3QI9A 2P8MA 5B3JE 4GW5A 4Y5YA 3HPJA 1E4XL 3K1KC 4LOUC 1C7TA 2P46B 4Z7WE 2D7TH 5TPWL 3RWJB 1NUDA 4WHYG 7FABL 2A77H 1F13A 1G7PA 3V79C 3VCLA 4QHMA 4KV5F 3UPAA 3U0WL 4LF3A 1YEJL 3PHOA 1FSKC 1T83A 3RWFB 2VQ1A 2D7QA 1HHKB 1F4YL 4IMKA 4Q9QH 4O5LL 1IEBB 3T0BA 5DR5L 2ZG1A 4OTXH 1F3DH 1B0RA 4PD4K 4RAVB 1CD8A 3ZMRA 3ZKNC 3RGVB 2UWEE 4OBSA 3OKEA 1WT5A 3ARPA 5HHQA 4LFHD 4JRYA 2RFXB 3QRGH 4CVZB 5EZLB 3RU8L 2WWKO 3RVWC 5GGQL 4QT5B 3SGJA 4M5YH 3BIKB 3GI9L 1T04B 4OFKA 5F72S 1WF5A 4LASH 4M03A 4GRLD 4N1EA 5MENE 2OBGA 4JGJA 2X7LB 5GRYA 2DLEA 3SBWA 2P5WE 4QTIH 4OZHF 1ETZA 3NCJL 3PWNA 4XPFH 2GCYB 2MPAH 3L1OH 2XKUA 1MRCH 2Z91B 5IF0A 3FN3A 1ZT1B 3U30C 4Z7VA 5GPRA 4RGMC 3UX9B 3HZMB 2MHAA 4GMTL 1EV2E 2MJWA 4ZOCA 1DBKH 3LKQA 2PO6C 5E1HB 4MCZB 1JNHA 4JFFD 1OP5H 4F37F 4QXGH 5DFVD 1V3KA 5DMJB 3CFBA 4OZFH 4JN1L 2NXYB 4IDJH 4F3FB 2AV1B 3QUYC 2F53E 3NFSL 4PTTA 2DLFH 5BRZB 2HKFH 5DRNA 4NP4H 5TDOB 4QXTB 4DN4H 3DV6B 3VRIB 4BFBD 4XH2A 4MDIB 3QUZB 4HV8B 4FZ8L 4Y19B 2LQRA 4LLUA 2LTQC 8FABA 1PY4A 1AKJA 4DAGL 2VH5H