5GJTH

Crystal structure of h1 hemagglutinin from a/washington/05/2011 in complex with a neutralizing antibody 3e1
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
221
structure length
211
Chain Sequence
b'QVQLQESGPGLVKPSETLSLTCSVSGASISSYYWIWIRQPGKGLEWIGRFYTSGSPNYNPSLRSRVTMSVDTSKNQFSLKLTSVTAADTAVYYCAREEHITFGGVIVRYWGQGTLVTVSPASTKGPSVFPLAPTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGQTYICNVNHKPSNTKVDKKVEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hemagglutinin
publication title Human antibody 3E1 targets the HA stem region of H1N1 and H5N6 influenza A viruses
pubmed doi rcsb
source organism Influenza a virus
molecule tags Immune system
total genus 40
structure length 211
sequence length 221
ec nomenclature
pdb deposition date 2016-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5gjtH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5gjtH01
4L8SC 1FYTB 1H5BA 2R29H 4Y1AE 4XC1H 3RFZC 1TCRB 3GJEA 2W38A 4XMKL 3GSRA 1UJ3A 2V2XB 2NY5L 3BP5B 1LP9F 2ZJSH 3FFDA 4V1DA 2BHZA 4ZO8A 5HVHC 3K81A 4JM2A 5AD0A 1DLHA 2H26B 1IM9D 4PJ5A 2ESVE 4K3JL 2ZCHL 5BV7H 5DRXA 2QEJA 3ARGB 3QDHA 2PO6D 5D2LF 2IG2L 4GRMB 1UWXK 3HE6A 2VAJA 1AGCA 5HHMD 3W5NA 3T3PF 5C6TH 4MXVE 4X6CA 2PYEE 4KFZC 1HNGA 3TNMA 3TO4D 1BGXH 1Q94A 1OPGL 3VDBA 5EN2B 3MGOB 3U4AA 3F58H 1M7XA 4EEEA 2MKLC 5J1TC 4YBLB 2DQCL 2W0LA 4LVNB 5GGSY 3ZL4L 1J12A 1T66C 4N0UE 2WWMD 2ZWLT 1IRAY 4WW1B 4JQVC 2E7CA 5ELIA 3SOBH 5CGTA 1AC6A 1N2RA 1T7XA 2PN5A 3FB8B 3LRSB 3QXTA 4S1DC 2YBRA 1F2QA 4Y2DB 3BPLC 1CL7I 2Q86A 4EQ2A 3GMLB 4LBEA 1P9MC 5JOFB 2XKNA 3N06B 3RGVD 4R7NA 3VXNA 3ZTNH 4P46A 4GQ9H 25C8L 4LHUG 4NQXB 2LU3A 4CN1A 2F19H 3PWVA 1S7QB 3ARDB 4PRHB 1LO2H 3BO8B 2HJKB 2V9TA 5L2KB 1FNSL 4QHMA 3OAZK 5DRZB 1WCBA 1U8OA 4HXBH 5E2TL 4JANB 1JFQH 3CFKA 2FZ3A 3H9SB 1BFOB 1QBML 1V3KA 1JE6A 2R9HC 2C7UB 4TQEH 3BH9B 4QXGH 4ZFFB 3HB3C 5CINL 1OTUC 4X9GA 2B5IC 5HI3C 1MJJB 3MA9H 5FGBA 1R6VA 4FQCL 2Z35A 2RFXA 1G6VK 2MOVA 5DXWA 2A83A 4HGWA 3I9GL 1EFXD 2G75A 4QHNA 4WI8A 3UTTD 3F6LA 2UYLB 5BRZB 2IQAB 4J7RA 1FV1B 1T5XB 2VOTA 3KLSA 4ZAKD 1J1XL 2QHRH 1KCSL 1OP5K 1HN1A 1JHKL 3IS1X 5CBEB 1Q1JH 3L9RB 1KC5H 5EOQH 4JVPA 3ZYOA 2J8UA 3CDGA 5JPMB 1I1FA 3CK0H 2PW1B 3ARFD 4WCYH 3H42H 1TVHA 5KSBA 1KCKA 3JTTB 3RKDC 4NWUL 4PJBF 2BNQE 3HI5L 5C6PB 4FP8L 2FX9L 3GSXB 4GT7A 1HOCB 5FHBL 3H3KA 4Y5VA 3DYPA 1EPFA 4ODTH 4ZO7A 1O7VA 5J4MA 5JTWA 1FNGA 3BKML 3D3VE 3VGGA 4HUVB 1LD9B 4PP2A 5BZDB 4MLIA 4OD2B 2OI9C 2OJEB 4UAOB 1S9WA 1FLRH 5KAQF 1T2JA 3WBDA 1F4HA 4X80L 1DE4A 1ZLSL 2EYTB 2FIRT 4I5BA 4Y4KA 2EKJA 2IAMD 4JKPL 4NDMA 3LQAC 5EOCH 2GITA 3Q2CA 1X5LA 4F9PA 1AQKL 3ZKXB 4JR9L 5I1KL 5JORA 2F5AH 4BFEA 3B2UC 1CQYA 3JBG7 3B2VH 1LEGB 4OGZA 3UTSD 1PX3A 4QRUB 4LCIH 5GRXG 3OMZA 1B90A 4Q58C 5IMKA 5MI0B 2RB8A 3O8XA 5C0BA 4ZFOL 5JA9A 5B39B 4NHUA 2DQDH 2DLTA 1PSKH 1WIPA 1ZS8B 4NQCB 3LCYA 3KJ6L 4POZD 1INDH 2F74B 4PJIF 2IALB 4TRPL 3GMPB 1NLBH 1CE1L 3KLHC 3WNKA 4HUKB 4LP4A 3QNXA 4QYOB 1Z9SA 4EN3C 2YN5A 5EBLA 3SGDH 4D9LH 2W9LA 1Z5LA 3FN0H 4X8JB 4IJ3C 2DKSA 3OKLB 3RVVC 4PRAB 3VXUD 3ULVC 4RIRB 4NQEE 5GSRB 1XR9A 5T1LA 5C0FA 4G9FA 1J87A 1IAIH 1G7HA 4HUUA 3IXTA 1YY8B 5T33L 4PY8I 3MYJA 1FZJA 1OVZA 4HIJB 4EI5C 4Z7QE 5CMAA 4HW6A 1I9RH 1MCRA 2A0LC 5I8CA 1FHGA 3BVNA 1GYAA 3B8YA 4G7VH 4HWBL 4N8CH 3KPRD 1Z0NA 2MPAH 4LQFH 5KTEL 2HLFC 1U8KA 2R0ZH 4CBPA 1HH6A 2C3VA 4LVOB 3TO4B 4M8QB 3FQNB 3P40A 4QY8A 2CUIA 4PJFB 5CZXC 5D6CA 2OK0H 3V4UH 5IR1B 4PJAE 2VJXA 1IQDB 3D2UA 4DAGH 3MNZA 2X10A 4C55A 4CDHA 5TPWL 2YRLA 5SWSE 2EDEA 1CD8A 1I3RA 1FAIL 3TCLA 4DGYH 3LEVL 1YECL 3QDJD 1M7IA 2OX5A 1BJ1J 3OV6A 4Q6IB 4U1JA 1XCTB 1YNLL 4P5MA 2ZNXA 3HG1A 4GG6B 3GO1L 4Y4FA 5ANME 3MO1B 3V5KA 1BF2A 3QI9C 4KH2A 4KVNH 4BH8A 4WFHD 4NKIH 1FJ1A 3RGVB 1CLOH 2YD9A 1OAZL 1Q0XL 3RX5A 1I1AC 3CFCH 3IGAB 3TZVC 4N0CD 4YDJB 1WEJL 4K2UL 5HHQB 4FFWC 3QYCA 3VG0H 4N9GB 4HPOH 1DEEB 4OM1H 3AREA 2BNUA 2DYPD 1HHKA 3BPCA 3L3KB 3DVFA 5I1IH 4O58H 4HDIB 5E94A 5HDBF 1IC5L 4QO1A 2UUDK 3WE6A 1S78D 2VDPL 5HPMA 3PGFH 4GW5A 1CFQA 5KSUA 4ERSL 2VN7A 4FTVA 5B8CB 1D6EA 5C0RH 3NIDF 2R2BB 4X7TB 4JREC 4J3SA 3QIWD 1P69B 3ESVF 3IKCB 1TZIB 4TPRH 1KPRB 1EFXB 2HRPL 5DHVA 4XNYL 3D9AL 3K7UA 3T0EA 4O4YL 4U0RB 3PF2A 5EORL 5T1KD 5D6DC 5GJSL 3QIUC 2LABA 2BVOA 3OJDA 2LE9A 1P7QD 3O2WH 4MAUH 1N6VA 5I1AA 1MCWM 3QH3B 3V6FB 3I2CH 1R24A 1E4XH 4PJ9C 5K9QG 2V7HA 1B0RB 4TUOB 2BY2A 4FQXD 4JG0L 5ABDE 4Y19D 1AO7B 5DD5L 5J56B 4UINH 5D2NC 1TQCC 1AE6L 5DJ6B 5E00B 3EDKA 4AH2B 3PDOA 4P2QD 1FC1A 2JJWA 2DI8A 1MFAH 3B9KD 5T5NF 4N0YH 2RCSL 1J9CT 3JV0A 4Q9BA 5ESVB 5GRWA 5KN5A 3ULVF 4L9LA 2X1QA 3FO0L 1DQDH 1K8DA 2B0SL 3EOTL 2ERJC 3IFNH 3I50L 1FCGA 1U6AH 4PBXA 2DQHH 2X7LB 3MOBL 4M9OA 5FUCC 3VRLF 5C70A 5JMOC 3MV8A 4MD5B 2E9IA 2C1PA 5E2JA 4Z7WF 2UZXB 3UTSB 5C0AA 4BZ2H 4PRNB 1CGUA 1U3ZA 3ULUC 5IGXH 4QRPA 3B5TA 2OM5A 1S7RA 1DVFA 2EC9T 2I07B 4U2YA 2AJSH 3GIVA 2JKXA 1RJYB 3TP4A 2CDEB 2NY5C 4ELMF 4HG4K 4RGMB 4QHLA 5EZJB 2E9WA 4AIXA 1EXUA 2QHLA 3QXDB 3U2SA 1I8MA 2PTTB 2D31B 3C2AH 3ELAT 3IDYB 1KJ2B 2G5BA 1F3DJ 2K7PA 3LKRA 2OR7A 1ZVHA 3DVNA 4JRXD 3IDXL 4NRZA 1ZHKA 2QQNH 3VXQA 3PNWA 4O2CA 4KY1H 1HDMA 1SEBA 4U7SA 4PJDB 4GRLD 3EYSH 4XWOC 4M7ZB 3SJVD 2VLKD 4UDUB 5DJYB 2A74A 1IAMA 3CUPA 4HH9B 1CWVA 2P42B 4IM8A 3TA3A 1KV3A 2Q87A 1GZQB 4G6AC 2FYYA 3MRQA 32C2A 2V2WB 1NMAL 1SJHA 3O2DA 1I7ZB 1HINH 5KJRL 4OF3A 4BZ1L 5DVKA 3ARRA 3HN3A 1F4XH 1YYLL 3QJFA 1N3NA 5IB5B 2HMIC 4I4WA 4Z5RA 3QDJB 3QIBC 4PREB 4X4YB 3HR6A 4WI7A 5GSVA 4R4NC 3MGTB 1NAML 4KUZL 5HGAB 2A1WH 5DUBA 1X5JA 2ICWA 3QFDB 1CDIA 4OLWH 5ISZD 4PG2C 5IVNA 4IRSA 4L4TB 3C9NB 5KVDL 5ITFA 2J8OA 4RX4D 3PP3K 2VDRH 1MOEA 4QNPF 4PGEA 1DTUA 5D7IA 3WO4B 3LN4A 3ZYZA 1FFPB 4XMLH 3SDCD 4TSAH 4CVZB 1WBZA 3TBVA 5C0CD 4RAHA 1OF2A 1QOKA 3T04D 2DYPB 2V2TB 3CZFA 1JN6A 4MA7H 1V7MH 1CFTA 4LU5L 1NMBL 4XCYB 4XX1E 4HUXB 5F72S 1MCPH 1VPOL 4PJ8D 4CADA 5EZIH 3U1SH 5DTFB 3ZDXF 4R8WL 4NZRH 1AGDA 3WD5L 4Y5XB 35C8L 5LXGH 3DMMD 5F3HB 2R1WA 1F6FB 1HSBB 2IPKA 2NZIA 2NY2B 2R29L 4XC1L 5MEND 2EDWA 2R0KH 4JDTH 1EEZA 2FL5A 1S3KL 5HDLA 3WIIH 2DMBA 2VLJE 3T0XA 4HBCH 5CZVL 5LWYL 2D7NA 3T2NH 4Y8AA 1P7QB 2MCPL 2M1KA 1MRDH 1I3GH 5I74B 2ZJSL 4IOFC 3QWQB 4NSKA 3MRFB 1WFNA 1I9EA 1G7PA 2V7NA 1MUJA 1UH3A 1WUNT 3FZUC 5J11B 3P0YL 2Q7NA 5BV7L 4ZXBA 3CFBB 4MJ5B 4PRPA 2NXZB 5CJ8A 2GFBB 4WUKL 1S7VA 3TPUB 2ZUUA 4WEMB 4FXKA 4QOKE 4P2QB 1M71B 5FHAL 3SEPA 5FM5O 2RJMA 2PR4H 2QV2A 4P23C 4L5FL 1LK2A 1UZ6E 3Q0HA 4JFFB 1CFNA 3F58L 5EC1B 4M6NH 1QSEB 5E8NA 3SGKC 4YBQC 3AS2A 4PJCA 2RGSA 3DROA 5D7LD 4DK3A 3UC0H 4UIKH 4KK5D 2DM7A 5EBWB 4J3VA 4XRCB 1W8NA 3DLQR 1N5AA 3I6GB 2MKWA 4JJ5B 4D0BB 3LDBC 1U3HC 2HRLA 5ESQA 5CGYD 4OCNC 3QQ3A 4LCCA 4QEGA 1KCUH 4M48H 2EYRA 1RUKL 3ZTNL 2R23A 2P5WE 2Z0BA 1FCCA 4J8RA 3SN6N 43CAA 1IEHA 1ED3B 1MVUB 1ZANH 4YK4B 1S9VB 3TJEH 4L8CA 3K4DA 1LO2L 1R3LB 5DFVC 1R3KB 3BW9B 5I15H 4PB9H 4OI7A 1UCTA 5KOMC 4HXBL 2Q6WB 3PWPD 2HT2D 3KXFD 4X6EB 1FZKA 4ODWA 4D9QD 3GKWH 3G9AB 4FN0A 4HKZB 4LEXL 2QTEA 2YRPA 3MREB 4OFIA 3JTSB 2CGRH 4GMSL 4TQEL 4JHAH 1N59A 1RIVH 3GB7B 4QXGL 1QKZH 5TE7L 3MXWH 2H8PA 5IVOA 5LVEA 1FH5H 2CKBA 5FYKH 3MA9L 5TDNA 1P4BH 2GJ6D 2AKRB 1AIFA 3C87A 4PJGB 1J18A 2FO1A 1KTLA 4HSQA 4KV5F 3PV6A 1AR1D 1BMGA 4YIQB 1OT2A 3I3DA 2DWEA 3WFBL 4PP1C 4KKLD 2ADIA 2VLKB 2QHRL 3S3JA 3QDME 2X2YA 2DI9A 1YPZA 3RIAF 4ZUSA 1DZBA 4XMPH 5ICZB 1NBYB 3GSVB 1E4WL 1GOGA 3N85H 4HIHB 4XZUA 1LWRA 2YN3A 3HMXL 3UBXI 1EIBA 4ZS6C 2PXYA 2BOBB 3EZJB 4WCYL 1W72A 1OW0C 1F6AB 4Z7UF 3T0BA 2GUOB 2NY4B 2X4UB 3EJYD 5F9WB 4YUEH 1ZEAH 1OP9A 3AFLA 1F00I 4WWKA 1A3LH 5TDPA 5I9QC 4RFNC 1E6OH 1KT2A 1G7JB 1KLFA 4P4KC 3O9WC 4WEUD 3QEGL 2MCG1 3VXME 4D0DB 1I3UA 4JN1L 5DJXB 4MNQB 5FOJA 3OB0K 1TZHB 1TZGH 2NCMA 4A6YL 4QWWD 1BQHB 4LF3A 2AK4A 3I6LE 4OM0H 4XI5D 5EOCL 5F7YC 4ENEC 4NN7B 4HIEA 4NKOA 5JNYB 4FMFA 4NQDA 5EC2B 1MAJA 2DL9A 4OZIA 4DUWA 3STZB 4MGXA 15C8L 5C0CB 4M7JH 3VXRA 3RVUC 2Z4QA 4DKDC 5ACZA 5C07D 3V6OE 2LTQC 2DQDL 1N4XH 3WLBB 3ARPA 2RR3A 1URLA 1G9ML 4MDJA 5E1AA 2X4TA 1PSKL 1YQVL 3MUGA 4RWYH 4YNYA 5EIIA 2FEEI 4JFDA 4S10A 1WV7T 3VXTA 5CILH 1YPZF 4MXWH 4GAJH 3ZYJA 4BH7B 3DMMB 2IANE 4TSCH 5EO0A 4D9LL 1EVTC 4NC1C 3PWLB 4F33B 3VWKD 2CIKA 1YC8A 3C6LC 5CEXB 3GJFB 1KPVB 1ULVA 2VERN 5IQ9B 1VGKA 4P5TC 4PLKC 4GG8A 4APQC 3A6BL 2Z91B 1RUAH 1A6AA 1I7UB 5JW4N 1CXLA 2IADB 3H9YA 1I9RL 1P4LA 4PJXF 4Z6AT 2WIIA 1SHMA 4I18B 2MPAL 5FK9B 4LQFL 4XAWH 3QG6A 5F9OL 2R0ZL 1EHAA 4Z77B 1IAKA 1BJ1H 3OKOA 4L29B 3VE0A 3KPSD 3RUGB 2IFFH 1NMCB 2YEZA 3AY4A 3GEWB 4NHCL 2Y9RT 3BSZH 3V4UL 4DAGL 1H9VA 1KB9J 1KTRL 3WV0A 3O4LB 5ICXA 1HZHH 3FT2A 2MHAB 1RJCA 4MD0B 5GGRB 3RVTD 4FG6D 4U1MA 4MA1C 1RHHA 3PQYD 3OAYK 1GRWA 3HAEG 4YBLC 4KVNL 3MZTA 2X09A 1JTPA 2FWOA 2HT4C 4NYLB 3EYUL 2AEPL 3MOQA 1OAUH 4OTXL 3REVB 5A40E 4JLRB 3FMGH 4YQXH 5F1KC 3QEQE 2V5RA 4CW1A 2UY6A 3O3EB 4LLWA 4RA0C 4HPOL 5LGKA 1MF2H 1UB5B 5DVMA 3TYFB 3H3PH 3SKOB 4W4OC 4OM1L 5F8QC 2W9EH 2APXA 3ES6A 3PWPB 3ARVA 4Y19E 1BQSA 1BFTA 2P5EE 3KXFB 2B1AH 1NCWH 1X4ZA 3NCEB 3OXRB 3UP1A 4GBXC 4LLQB 2XZCL 3CH1B 1TCRA 4Z7VA 1ZHBB 3H2WA 3ZO0A 1KTDB 5IROA 1WIOA 2V2XA 1X5IA 3BP5A 1VB9A 4YO0B 2XZAH 2OP4H 4ZODA 4TPRL 2W07A 2WV3A 2H26A 5JOPD 1Y18B 3B9AA 4HZLB 4RMSA 1D9KD 1QSFD 1C7SA 4KI1A 5IT2L 5IUSA 5K9OB 3ROLB 3ARGA 2JJSC 4L3ED 5IW3A 5B3NA 3G5YB 3OHXB 4GRMA 4MAUL 1XT5A 1OAQH 3CDYA 1J8HD 5D7KD 3KPMB 1E27B 4JY6B 4OZFH 5DD3L 5EN2A 3FTGB 2E9JA 3MGOA 5DEGB 4PY7B 3VU2A 1JYXA 3ZKSD 4IEFB 1NBVH 4UINL 4GOSA 5F7EH 1WSST 2HKHH 4PYHA 5J06A 1YEDB 4X7EC 4WW1A 5D71L 3NZ8B 3RWJB 3FB8A 3LRSA 1V5JA 3ZMRA 5I8OL 4Y2DA 1QG3A 1DQDL 1RK0B 3V9FA 1JZ8A 3VA2C 2HWZL 1OAKH 3GMLA 4EKXA 2VISB 3W81A 5JOFA 2DQHL 1CGVA 3IDIB 5FA4B 4NQXA 1NCDH 4WU7B 1S7QA 3ARDA 1E0OB 4YWGH 4MNGB 4PRHA 3SGDI 1HSAB 5BS0E 3BO8A 5C3LD 2BXYA 1KGCD 2HJKA 5L2KA 3S6CA 3MFGB 1QFWH 5DRZA 4QXUL 3AS1A 2AVGA 4BZ2L 1HQ4B 4PGCB 3V8OA 4CGTA 2E6QA 4JANA 4UDTB 2F8VA 2ZUSA 3DUSB 1KLUB 4YC2B 4U31A 5C07B 3NGBC 5IGXL 3SJVE 1BFOA 1IAII 3OF6D 4PJHB 1Z3GL 5JHLL 3NA4A 1HCVA 4J1UB 3C5ZC 2C7UA 5DHXB 3BH9A 4ZFFA 2AJSL 1P4IH 3BP7B 1LDPL 1MJJA 4JFXB 4F7TB 5E08H 3V79C 3QUMH 5IW6B 3JWDH 4NKMA 5FCSH 5JUEH 4YDIH 2UYLA 5BRZA 2IQAA 3VWKB 2WINB 5I8KH 3NFSL 5IBLD 2V5TA 2ARJQ 1FV1A 1T5XA 4ZUWB 4GQPH 2P8LB 5BV7C 3RTQC 4XHJD 2XZQH 1T2QH 3ZDZE 1XGRB 2GY5A 2F54E 4WV1B 1CTOA 2BHUA 3V4PL 4D2NA 3L9RA 2QQNL 3EFFB 5GPRA 5JPMA 2WANA 2PW1A 4WDIA 5DC9B 4KY1L 4LNVA 3JTTA 5ERWB 1NCBH 2QLVB 5ADOL 4HUMB 5I1EH 1R5WB 5DRNA 3GSXA 3K1KC 1HOCA 1T4KB 3GSUB 2X9YA 2QBWA 3A6CL 3MLWL 1GPOH 2EYSB 4N8PA 4HUVA 4FFYH 2BY1A 4KAQH 2FEDD 3KPSB 4S1QL 1LD9A 5AAMA 5BZDA 4DUXA 1LE5B 4OD2A 4HK3J 3TBWA 2OJEA 1A4JB 1HINL 1RV6X 2PO6C 2PKDA 1JPST 1RU9L 4YGAB 2Q7YB 1HH9B 4PJ7B 1F4XL 2EYTA 5E7FA 2EC9U 1QBLH 4LVOC 3C8KB 1D5IL 4KUCF 3TO4C 1A14L 3L5WB 5IVZA 3T0WA 3CFEB 2VLRA 3O2VL 3WN5B 1A47A 3PQYB 4JPVH 2XKSA 3E3QC 4Y16D 1RIUH 1IGIL 3UYOD 5E2WH 1LEGA 4QRUA 2JJTC 4OLWL 3MCLH 2WWMC 5E7BA 1R3HB 4G6FD 1JWMB 5DJAB 3WJLA 5B39A 4NCC1 4I0KA 1X3DA 3PHQB 1AR2A 1JWSB 4EDXB 2O5YH 3KLAB 3ARBD 4G8GE 3EYFB 3BYYA 4NQCA 4XMLL 2F74A 1SBBA 4TSAL 4PJAB 4WO4D 5IB3A 2IALA 2E6PA 3GMPA 5EG6C 3HI6H 3CZJA 4G42B 3OG6B 4BELD 4S1RL 3T0DA 1RZGB 4MA7L 2E7HA 4QYOA 2AEWA 3PL6D 4GAYB 3BKYH 1A7PH 1E4XI 2P43B 2YMXH 5EZIL 4PRAA 2MSPA 4RIRA 1PY9A 3V2AR 3ZE2E 4OI8A 5FB8B 5GSRA 4PGZA 1NAKH 2YSSB 4RWHA 2DQUH 4H1LB 4LRIC 2DI7A 1AGFB 1YY8A 2CLVA 4HIJA 1D9KB 5DT1H 2VDKH 1QSFB 3BZ4B 1LE9B 1ADQA 4M43H 2R0KL 4JDTL 3WIIL 2AI0H 1T1XB 2YUXA 4HBCL 4YDLB 5B8CC 1JGDB 4HKXB 4L3EB 3T2NL 4X6DF 3P0GB 4H1LG 1I3GL 2PUQT 1I85C 1ZTXH 4KQ3H 4M8QA 3FQTB 3GRWH 4KMTH 5J89A 4PJFA 5FYKE 5GISL 5IR1A 1IQDA 1YEFH 4OUOA 4BYHA 5JXED 4ZAKC 4H88L 4CKVX 5D72L 2OTPA 4ISVB 5JW4M 1F4WL 4OF8A 3RL2B 3ME0A 4YHPB 3LY6A 1CIUA 5HHOD 1AJ7H 2PR4L 3J8F7 5H2BB 1VEMA 4JFHD 1IGML 4Q6IA 3ARFC 3BPNB 4GG6A 3W0WD 1KACB 3MO1A 4HXAL 1MWAH 4KVCH 3HNSH 4HGKC 5BCAA 1U8HB 3BJ91 3UC0L 4E42B 3RGVA 4MA8H 3TJHD 1NANH 1EO5A 2R4SL 2UV3A 3IGAA 1XF4B 3G6JB 1T0NB 1OLZA 2BSSB 4LSQH 2BRRH 3KYNA 1IM3B 1G9MC 3LEYH 4BUGA 5HHQA 3RWFB 1X4XA 1FG9C 1DEEA 1T5WB 2IAMC 1KCUL 4M48L 5T1DH 2EIZB 1WAAA 4L8DB 4HDIA 4XNZC 4HFWB 4OFKA 3TJEL 2FD6H 1T1WB 1YJDL 3CFIC 1MREL 3WFDL 3P4LA 5I15L 1HNFA 3V5HB 2HLAB 3A0OA 3BKCH 4OFYD 4PB9L 5DVLA 4UV4L 5B8CA 2R2BA 4X7TA 1U92B 1A21A 3S35H 3IKCA 3GKWL 1KPRA 4KRMB 4PJFF 1SY6H 4M03A 4RGNE 1HXYB 1F8TL 3PE9A 4F58H 4POZC 3T4AB 1RIVL 1QKZL 2DJUA 5D4QA 4BJLA 2HN7B 2AEIT 4JHBA 3VXOB 4JDVB 5FYKL 4JB9H 3QH3A 3V6FA 4RGMC 5CP7B 1QBAA 1FO0H 1WZKA 1B0RA 4TUOA 2WNGA 4NN5B 1JV5B 5C09B 4KTEH 4KRPB 4F8TA 1AO7A 3UBXB 2QSCL 4HLZG 5DJ6A 5E00A 4AH2A 3IDNB 3BFOA 3QUKA 2E3VA 3V6ZB 3CU7A 3MJ8B 2Z31D 5ESVA 3GSNA 5J6GA 2GHWB 1FSKC 4R97B 2CIIB 1KULA 5EU3B 5ALCH 4M7ZC 3UBXG 1S5HA 3LVEA 2X7LA 5CIPH 3RPKA 4YUEL 2B7DT 3EZ8A 4XXCC 3LEXB 1EZVY 5B3JE 1A3LL 4P9HL 3EFDH 4MD5A 3INUH 3LZFH 2DWDB 4TVPD 3SY0B 4Y16B 3Q3GA 3UTSA 3U9UB 1MCOH 3S35X 1X5KA 4PRNA 1KB9K 4G6FB 1SMOA 1A6UL 4DKAA 2JLLA 3HI1B 2AAVA 3OPZL 1VSCA 2NZ9D 3P77B 3WHE0 1DN2A 3UJTH 4X7FC 2I07A 3DXAD 4WO4B 1JGUH 1KIRB 5F3BA 5KVFL 2NY6B 1MCJA 3BIKB 1RJYA 4PGBB 4M7JL 1LO5B 2CDEA 4WIQA 5SX4I 1CXHA 1N4XL 5EZJA 3PL6B 5I1JH 4N0CC 4NUJA 3GHBH 3WO4C 3AXLB 4RWYL 3GHEL 4OI9A 1DQQA 2ZUWA 4ODHH 3QXDA 3SKMB 1FLTX 4FQJH 3PWNB 1EAJA 3QR2A 2D31A 1MQKL 3T0VA 2MWCA 4MXWL 1KJ2A 3DUUB 4GAJL 3KPNB 3GK8L 5EB9A 2NY7H 4E41D 1N64L 1UCBL 2Y36H 1PZ5B 4HF5L 4PJDA 4J3TA 3IRPX 4B5EA 4KMQA 1TETH 4XPAH 4UDUA 3VFRB 4XPGH 3AB0C 2ZUQB 5DJYA 4HH9A 4LASH 3OGOE 3N1MC 5LQBH 3QIWC 1RUAL 4KDVA 4FA8A 1GZQA 3LAFA 3NIGE 2DRUA 5IB2B 2ZOKB 1I7ZA 3N9GH 1DLFL 3KNBB 3AVEA 4XAWL 2X4SB 2EIEA 5IB5A 1MAKA 3T3MF 1V3LA 5HHOB 3IRZA 5J11C 4PREA 2DIAA 1M6OA 4X4YA 4OCYL 3BSZL 4FQXC 4W70A 2YD3A 3MGTA 3W0WB 5HGAA 1RUML 4Q2ZB 5DSCA 4YDKH 1IT9L 1DUZB 1I7TB 1DSFL 1HZHL 2XN9E 4WW2B 4L4TA 3C9NA 1ORQB 2VC2H 1R3IH 3B9KC 5DC0A 3HR5B 2FH8A 3MRCB 1FFPA 1NGWB 2YWZA 5I73C 2FIKB 4CVZA 2DJ4A 1FBIH 4K7PH 2V2TA 4QOKB 2EDHA 3K4AA 3RRQA 1ZKAA 4XCYA 1KFAH 4HUXA 5IVXB 4TN9A 5ALBH 3FMGL 4YQXL 1J8HE 5D7KE 4PJDF 5DEFA 1MF2L 2M2DA 2W9EL 5DHYB 4G6MH 5TFSH 4Y5XA 4RISL 3QUYB 5E5MB 4XNQB 2QSTA 2XG5A 4EBQL 1HSBA 1PG7X 3BPOC 3BGMA 4H26B 2P24B 5GS2H 4XVTH 5EZLB 3WKMH 1P7QA 2F8OA 3MRPA 2FB4L 4XP6L 5EO1B 3MRFA 3MXVH 1MY7A 2XZAL 3FQWB 2VXVH 4IRJD 1OWRM 1IGYB 5IJKC 1EJ6A 3ARQA 3TBYB 4LMQE 1YEIH 3CFBA 4MJ5A 3CLEH 2GFBA 2OL3L 2DKUA 4LK4A 3TPUA 5A2LH 3MLSH 1KGCE 1A6VH 5INDB 3V52H 1M71A 2JCCB 2CXKA 5C6WH 1KTKE 3M17B 1PLGL 5GGTA 3GI8L 2XXCB 4JFFA 5EC1A 5MP6H 3MUJA 3OKNB 2R1YB 1QSEA 4ACPA 4GRLC 1JRHH 4Z8FL 1AKJD 4F80A 4OGAD 4ONGH 1JPTL 3NTCH 2L4OA 5EBWA 4C56E 4XRCA 3BH8B 1PQZB 3I6GA 4JJ5A 4QRQB 1LEKB 4D0BA 4YPJA 3U0WH 4EIZC 3BDYH 1JZ7A 4NO2B 4KHXL 4M1CC 1FGNL 2XI9A 4XGZA 3VGDA 1Q8MA 3STLA 4ZUUB 2QJDA 5JW3H 2VMFA 1ED3A 1MVUA 3EYVA 5I8EB 1S9VA 3K2MC 4I2XB 3ZSTA 4M93B 1R3LA 1R3KA 3BW9A 3NAAL 5FUZH 3LS5L 4LL9A 2Q6WA 3RWHB 1WWAX 4X6EA 5GS1C 5F93C 4NN7C 4HKZA 3DETD 1K9TA 1DQMH 3MREA 4PJEE 3JTSA 3GBNL 3ZZ1A 2O5ZH 3SDCC 4MJ4A 4G80B 3GM8A 3MLYL 1O7SA 2XA3A 3VXMB 5ADPL 5D96B 2AKRA 2WP3T 5CAYB 3MMEB 5E08L 2VAAB 2EDXA 1N6UA 2EDKA 2UZIH 3QUML 4XTRD 4PJGA 2P49B 5JUEL 3ILQD 4J4PD 4PRDB 1SQ2N 5I8KL 4PJ8C 1YZZA 4YIQA 1JZ3A 2H2SD 5A16B 3WS6A 4LPYA 5HY9B 1JNNH 3UJJH 3HE7D 5JZ7D 1Q72H 4OCSH 4UQ2B 1BAFH 3F7PC 4D94A 2CLZB 4BSVB 5ICZA 1NBYA 4HIHA 1OARH 4K3DH 3DYMA 1ONQB 1R5VB 2UWEE 1I7RB 2PW2A 4JFED 3L1OH 3IJYB 1BHGA 2ZKHL 5BW7C 2J7LA 1WICA 5KS9A 1F6AA 1NCBL 4L4JA 5I1EL 1HK6A 1A9EB 2C9AA 1BREA 1KB5H 2GUOA 2X4UA 1WK0A 1GPOL 1JK8B 1C5BH 2IANB 1G7JA 3GNMH 5TQ2H 2FATH 4YFLF 3FO9B 2F5BH 3C8HA 3G08B 4K8RH 2DICA 2E5EA 4D0DA 5T5FH 3BQUD 5DJXA 4MNQA 4DCQA 2Y6SC 4P2CG 3FT4B 1TZHA 2JJVA 3SKJL 3SE9H 1CR9H 2HFFB 4UT6H 3V4VH 2IBBA 4N90D 1BQHA 5GGQH 5FCUL 5JNYA 1FP5A 2OMBA 2Y07H 4JPVL 3STZA 1MPAH 1YJDC 1RIUL 3C60B 5E2WL 3MV7E 3F8UB 4MWFB 2Q8BH 1BIHA 4O9HL 4NPYB 3TGXA 3BEWB 4KK5C 3TT3H 3IU4H 1F6LL 4P2OD 1GGBH 5MEQB 1L6ZA 2XYCA 3WLBA 2O5YL 3DGCR 5DC4B 5C92A 3QHTC 1HYSD 1F58H 2EDQA 5HI4C 5H37G 5CGYC 4U3CA 2XFXB 1TITA 1A0QH 1NFDE 4KI5E 4BH7A 3DMMA 2IPUK 3FFCD 3R0MA 4UILH 3TF7C 1RZ7H 4KJQC 5C08E 2LAGB 3BKYL 2QADB 1A7PL 3WFCL 4JFHE 4LDLB 5I75C 3B9DA 3OGCA 5CEXA 3GJFA 3WFHB 1NAKL 3MRJB 1JHLL 5IQ9A 2WP3O 1A1MB 4OLVH 5EZOH 1VERA 1I7UA 3L3OB 1I8KB 2CRYA 2IADA 4K71B 2WBJD 4M43L 3OR7B 4I18A 4LCWD 5I16B 5EULV 3SDDB 5D70H 5FK9A 4YJZL 4OGXH 1CDGA 1UJTA 4HUNB 3GFUA 4OFDA 3R8QA 4Z77A 2XA8H 2NXYB 3O3AB 3RUGA 1ZLVH 2A6KB 4JVUA 3MRDB 1AR1C 4ZPTB 4P9HC 5ECJE 5AWNL 1K2DA 4RSVA 2AABL 1KPUB 3D39D 4OJFL 3QRGL 3BMWA 1HQRA 3B43A 5CUSL 1MHPL 1AKJB 1ETZB 2AJ3B 4KKLC 4JO2L 2GSGA 3O4LA 2XQBH 4R0LB 5IMMB 1QFWI 3T0AA 1L4IA 2MHAA 4MD0A 5GGRA 2OMNA 1AJ7L 1G0XA 2VDQH 5GRUL 1I1RA 4AYFA 3ECBB 1AQDB 4NOBA 1RSFA 1RMFH 3TVMB 4CMHB 1MNUH 1N0XL 5ICYB 4LAQH 5I0ZA 4V1DD 1AGEB 2CKNA 3GBMH 1BQUA 4JM2D 3EJYC 3Q1SH 5DUPL 4NYLA 4NN6C 4QRSB 4LMQI 5E4EC 4AL8L 4PJ5D 3NCCB 3REVA 2AEQH 4JLRA 4R90L 5I1GH 4RFOL 4WFGE 2WQ8A 4R9HA 3VGFA 1F4YH 3TYFA 1UB5A 3SKOA 3HE6D 3S5LG 1UH4A 1MHCB 4MJIE 5E8DH 3S7GA 3SE4C 4QWWC 4XI5C 4XH2B 1HHGB 3KXFA 3QDGB 1V05A 3OXRA 4LLQA 4OZHB 2Y06L 1XGYL 3OXSB 2FD6L 3AAZB 3CH1A 5HPOA 1ZHBA 4OCRH 3TN0C 1KTDA 2ED9A 4QF1B 4PY8J 4YO0A 5HGBB 4YR6B 3S35L 4RBPH 3RUGF 3QPQC 1SY6L 1Y18A 4HZLA 4X98B 3VI3F 2J4WL 5K9OA 1BX2B 4F58L 5I76B 1AHWC 3N1FC 4QHKI 4Y0GA 1C08B 5BS0B 3PXHA 3U4BH 2X4RB 3MSPA 3G5YA 3OHXA 3HE7B 1OCWH 5C0ND 4X7SL 4P46D 4JB9L 4MD4B 4EZMA 4HHAB 4JY6A 1E27A 5D1QD 3VFVB 4H25B 4F7EB 5KSVB 3FTGA 1NGXB 2OZ4A 5DEGA 1JCKA 4M3JA 4JFEB 2VXTH 4PY7A 4KTEL 4JEGB 2E7MA 3IT8D 5GGVY 3VWJC 5KZCB 1VFMA 5DURB 2Q3AA 2IF7A 4WV1C 3SE8H 1YEDA 1QNZH 3CD4A 3P4NB 4NFDA 3O6KL 3RWJA 1XEDA 2NY1D 1RK0A 5GS0H 1EHNA 2ICES 5ALCL 4CAGA 4XB7A 2VISA 3BQUB 4IRZL 4M9PA 2B4CH 3IDIA 2FHBA 3OJ2C 4WUUE 4EUPB 5FA4A 2F54B 1L7IH 4R2GD 3EFDL 4WU7A 3VRIB 3WIHA 4MA3B 3SE3C 3E6FA 4MNGA 1D6VL 4MB4A 4L3CB 1IGTB 3INUL 1HSAA 3LZFL 4LVEA 4MHHG 5L8JB 4E41E 2CDGB 5EUOE 1HQ4A 4PGCA 3GSOB 4EUPG 1AXIB 4UDTA 2FSEB 1T1YB 1KLUA 1CXEA 4XXDB 4P2OB 2R69H 1MY5A 4PJHA 2J8HA 4FG6C 4P3DB 4PRIE 1YUHB 4J1UA 2YRZA 1EHXA 3UPRA 3AU1B 3BP7A 4NJ9L 3MC0A 2W65B 4JFXA 4F7TA 2ZUTA 1ZWIB 3OG4B 1EGJA 4TVPL 4XC3H 5L7XL 4XNMB 3GHBL 3VWKA 2EO9A 5CEZD 1S7XB 3HUJE 2P8LA 3RWIB 3S34H 4DWHA 1A7OH 3FB5B 4K7FA 3U0PB 4Y4KD 2DQJL 4GUPB 5A2FA 4JO3H 2LQRA 1JTOA 3BESR 4O5LH 1LDSA 4JCMA 3ALWA 4KKBC 3EFFA 1U93B 2Y36L 4G8GB 2WBJB 3MACL 5TE6L 2OXGA 1I9IL 5ERWA 4LCWB 4LSVL 5GHWH 1R5WA 3NA9H 3LKQB 4X9FA 1E4KA 1T4KA 2VXSH 3DPBA 3GSUA 3BIAX 5LQBL 1RVFH 2FGZA 3F62A 1ORSB 2VSDA 2EYSA 4U3HA 4F37F 5KVMC 3KPSA 4OIAA 5CJOH 1YEEH 2NTFB 3S3SA 3QWRD 1LE5A 4XCFH 4MS8C 4XPBH 12E8H 3SGJA 1EHLH 1PG7L 3O4OC 1FN4B 1A4JA 4PG9B 2VR4A 4NZUL 4UUJB 2Q7YA 1HH9A 4PJ7A 3A67L 3VGBA 2AK1H 3C8KA 4PJHF 1JZ2A 3E8UL 1G6RB 2FR4A 3L5WA 3GJEB 3MBED 3WN5A 3PQYA 7FABH 4MVBD 1BVKB 3KJ4C 4G9FD 4YXHH 1R3HA 4JM2B 4JG1H 4LSSH 3D6GA 1R3IL 1JWMA 5DJAA 4EDXA 1JWSA 1TJIL 5L0QC 3KLAA 3EYFA 4FFVD 3QZWB 5EH1A 3GIZH 4HFUL 3IVKB 4PJAA 3UEZA 5EU6D 1WTGT 4DZBA 3MJGX 1J11A 4G42A 2ADJB 2J6EH 3MJ7B 1RZGA 1DBJL 4WNQA 3H0TB 2CK0L 1NKOA 1ZT4B 4QRRE 4WY7H 4GAYA 1MCFA 4GXUN 5IOPB 4LKCA 3DHMA 2VZ1A 2YSSA 1GGYA 1GOHA 3WJJA 2GJZB 2AXGB 1AGFA 4HCRL 1G9EA 3U48A 1N2RB 3OAUL 5C2UB 3BGAA 3BXNB 3HG1D 3LQZA 1CD0A 1D9KA 4Y4FD 2WUCL 1QSFA 3BZ4A 3QULB 2Q86B 1LE9A 1CGTA 1T1XA 4KKNA 4PJ7F 3D0VB 3NVQA 4HS3A 4WEBH 1JGDA 5I0DA 4HKXA 3WKML 1J88A 1YN7B 1T20B 2VXVL 1RI8A 5D1QB 2OLDA 3FQTA 4HC1H 3FQXA 2XICA 5IB4B 3IF1B 5IBLC 4QHMB 4NZTL 4KXZI 2Y23A 4XHJC 4PFEA 3RP1A 3MLSL 4ISVA 1FPTL 1A6VL 3RX8A 3RL2A 4YHPA 2KH2B 2JJUA 5H2BA 3QXAB 4KQ4H 1NDMB 3HMWH 3JV6B 4NN5C 1Q9WB 4WFFD 3MRHB 2FJFB 4FTVD 4L4VD 4YHMH 5MP6L 3MPCA 2I60L 2K1MA 5FUOH 4DKFH 1U8HA 2DD8H 4E42A 4JRYE 3V0WL 4DW2H 1DBAL 1ZGLA 3ALXA 2YWYA 4QHNB 3ULVH 3SBWA 3T0ED 2FEDC 2I26N 1XF4A 3TH2T 3G6JA 1T0NA 5C7XH 2BSSA 2HFTA 1FIGH 1IM3A 3BDYL 3RWFA 1KJVB 2DTMH 1JGLH 2P46B 4DOHE 5IKCB 1T5WA 1UXSB 3S37X 2GK2A 1F45A 3CVIL 2C4FT 2W0FB 4G6JL 2EIZA 4L8DA 5JW3L 1UWEL 2NX5D 5JDJA 1NBQA 4HFWA 2J8UB 3OF6A 1T1WA 1YEKH 4PLNC 4ALAH 4Y16C 3V5HA 2HLAA 5FUZL 2NY0D 4L1DA 2AJVH 1U92A 1JF1B 5DHVH 3K74B 5BO1L 4KDTC 1FNGB 4ODXB 1OSPL 4RMUA 4PP2B 1AXSB 3ARBC 2YD6A 1HXYA 5J12C 3UAJD 4WO4C 3U0TB 3IDGB 3C08H 5JO5B 1N8ZB 4CMMB 3VXOA 4Y4KB 4JDVA 2R1XB 4NDMB 3UROR 1W0YT 2XWTB 5D1ZA 5JW4Q 1XIWB 2UZIL 5D9SB 5CP7A 1QFPA 1IC7H 3PL6C 4N90E 1RFDH 4XNUH 4GRWF 5C09A 4X7CC 3ZSSA 3LIZH 3FKUS 3LRHA 1A1NB 4FOMA 1B2WH 3UBXA 5C0AD 2COQA 1Q72L 1BAFL 1GZPA 2N7BA 3GMOB 4QRPD 4JFYB 1DBKH 1YMME 3V6ZA 1WVZA 1OARL 3G6JF 3R1GH 4K3DL 2W0PA 1MJ8H 3MJ8A 3L5XH 3TV3L 3L1OL 2CIIA 5HGHA 5EU3A 2NPLX 4AEEA 6FABH 1UWGL 5C0DB 4JDZB 4BQ6A 2RIKA 4OSUH 4V2BA 5F1SA 1C5BL 3LD8B 1LO3H 2DTSA 2FATL 3QRFM 3MBEB 2DWDA 4K8RL 3SY0A 1XR9B 3W2DL 5LGHH 5FYJH 2JB5L 4C57C 3O3UN 5JXEC 1FL6B 5T5FL 3U9UA 3QPXL 1KSRA 1CR9L 4UT6L 1FG2B 3BP4B 3HI1A 1U3JA 2ED8A 4R4FL 5ESAB 1FVCB 3T3PE 1WBXB 3P77A 2Y07L 3BVNB 4U1IB 3LN5A 1MPAL 3SO3C 1KIRA 2Q8BL 5EU6B 4PGBA 1DBBL 1LO5A 4P2RE 5CWSB 2XTJE 1QLRB 2B39A 1G0YR 4I3RH 4PLJC 3CLFL 4OD3H 4XWGH 1INEH 1J1PL 2YUWA 4LEOB 3RIFK 3PHOA 3CCHB 4UOJA 3AXLA 1MAML 3MUY1 1F58L 3ZHDA 2AGJH 3DSFH 4JPWL 3PWNA 1RUQH 2VIRB 3CFDB 4N0FB 1WT5A 4X5LA 1A3RH 3MBXH 3D39E 3DUUA 2EH7H 4PJEF 3TH3T 3KPNA 1JGEB 1IGFH 3T8XB 2AJXH 2XN9B 4O51B 4HH8A 2OR8A 1RZ7L 3UZEA 1S7WB 1PZ5A 1BECA 1WIUA 4RGOH 5L6YH 3VFRA 4IRSD 3HCVA 1JRHI 2N4IA 4E5XB 2PNDA 4JGUA 3BGFB 5D5MB 4V1DE 1T7WA 3QXWA 3GJFK 4MQ7B 1W0VB 4OAWB 5IB2A 1PKQB 2ZOKA 5BJTB 1M1SA 2GYSA 4M5YH 4P5KB 5D70L 3MRRB 3KNBA 4OGXL 2UWEF 5I6XC 4OQTH 2X4SA 3WNPA 4HT1L 4S1SL 3MV9B 5E94B 2XA8L 4H5SB 3RAJL 1MHEB 1W2KT 5F7MC 5HHOA 2CXGA 3D1MC 2X4QA 4X6CE 4ZUVB 2C1OB 5CBAB 3W0WA 1A5FL 3NCMA 4FTVB 4L4VB 1MCKA 4Q2ZA 1RD6A 5FOBB 1RY7B 1ZGLP 1DUZA 1I7TA 2XQBL 4WW2A 5L2JB 1ORQA 1DQJB 2VKWA 4ZUTB 1FNHA 3ARWA 3HR5A 1T89A 3RPIB 1UH2A 1NC4B 2APWA 4K3JH 2Z31C 4MMZC 3O6FB 1CXFA 5D93C 3MRCA 1DANU 2L7JA 1NGWA 3CPLB 2IG2H 2FIKA 4LAQL 2AP2A 5SWZE 3GBML 5HHXL 2YXFA 4QOKA 2NX5B 4PJBE 1OPGH 3RDTA 3C09C 1PVHA 2BMKB 5IVXA 5CCKH 2AEQL 4ZXBD 4JKWA 1NUFA 3KDMA 4OCXL 2X05A 4OFYA 3ZL4H 3NCYS 5DHYA 5GIRB 1TJHL 1KNOB 4AK1A 3QUYA 5E5MA 4XNQA 3RVXD 4NFBA 4C56B 4LLYB 1Z0MA 1AXTH 2NZ9C 1J5OL 4CU7A 2P24A 1DN0B 5EZLA 2VDOH 2BVEA 3MQIA 2HA1A 1NLDH 1YMHB 5EO1A 1H3XA 3V95A 3FQWA 2EZ0D 5ID0B 1CT8B 2EO1A 5AZEH 4P3CH 3TBYA 4EOWL 1FNSH 2IPTH 2FGWL 3GKZA 1K5NA 4IMLA 4WW2F 1NUDA 5E2TH 5D96C 1OCWL 1J0HA 2FCBA 5DI8B 2LVEA 1U58A 5INDA 1F4AA 1QBMH 2JCCA 4LLAA 1H3WM 3QWOB 2C3XA 3M17A 3BKJH 4I77H 3BN9D 1T83C 3DJ9A 5CINH 3OKNA 5IMOB 2R1YA 4TSBH 1JWUB 1ND0B 5T3ZH 2R39A 4FQCH 4LPVA 3TBTB 3SE8L 5A3ID 3I9GH 3BH8A 3HC3L 4PV8A 5JHDD 1UM4L 3P3YA 3PIQB 4QRQA 1LEKA 5DVOA 4NO2A 1OQXA 1XZ0B 3RL1A 3T1FB 1RAMA 3B4NA 1J1XH 1FYHB 4HEPG 1EO8L 1A4KB 3LN9A 2B4CL 1LMKA 1Q0YH 1OAYL 1WISA 2A73B 2EC8A 2R8SH 1JHKH 4ZUUA 4LDEB 1J8KA 4NRZB 1TLKA 5HYJD 1NSNL 5I8EA 1RQ5A 4UI2A 4M7KL 3OR6B 3HI5H 3R06B 5KVEL 4FP8H 3VDAA 3CUPB 3HPLB 4MCZB 2AXFB 3RWHA 2DBLH 1N6QL 3WS3B 1NCUA 3GMRB 1JGVL 2FYYB 2NMSA 2R69L 2VH5L 1RURH 32C2B 3DSNA 3MRQB 4WHTB 4Z76A 5C0BE 5I71B 2PXYD 2X4PB 5TJWK 2IH1B 4X80H 1CZ8L 4G80A 1ZLSH 5HHNB 3VXMA 4XBGB 5I19L 1YDPB 3MMEA 4WWKD 3D5OF 4I4WB 4MX7B 5JQ6H 1IBGH 1GJIA 3LKPB 1J05A 5I1KH 4XC3L 4F2MB 2GQHA 4PRDA 1G0DA 1I4FB 5CSGA 1T83A 1IGCL 5FYLD 5HY9A 3S34L 3SDAB 1A7OL 2D4DA 4MAYC 3MV7B 4UQ2A 4JO3L 3UYRH 2CLZA 1RIHL 4BSVA 4UIMB 4ORGB 4G9FE 2VQUA 4NQDD 2VITA 5EOCJ 1W72H 3V6OA 5D7IB 2XY1A 1ONQA 1MWAB 1R5VA 5IB1A 1I7RA 3KJ6H 5HDBE 1TNMA 3VFWB 1PG7W 1BD2B 3TBVB 3NMEA 4M3KB 5GHWL 2XNAB 1A9EA 1DCLA 3KPQB 1RVFL 2PTVA 1ITBB 1JK8A 1IEBB 4IRJC 1DP0A 3NIDE 5CEZL 5CJOL 2IANA 4OF0A 1YEEL 4IIQC 3K8KA 4JFDD 1CFVL 4XCFL 4XPBL 12E8L 3FO9A 5CFHA 3G08A 1EHLL 2CR3A 3FT4A 1MFEL 3A6OA 2C4XA 3DVGB 2A9MH 2O26U 4M5ZL 3RWCB 4HWBH 3C60A 1J0IA 4OV6F 1LEIB 4MWFA 4OGAC 3RNKB 1HHIB 4NPYA 1JMXA 4YXHL 3BEWA 4GAGL 2SEBA 4U6HA 5MEQA 5GGUB 3TIEB 3SPVB 5EUOF 4TYUA 5J3HC 3VFUB 5BQ7B 3GIZL 4HKBB 2XFXA 5TPWH 3ULVE 3O0RL 3OJVC 1FAIH 8FABB 5AG8A 1FO0B 4RQQB 2A38A 2XQYG 1BWWA 5SX5K 4ELKB 5KVGH 5I1CH 1YNLH 1QPXA 4EVNB 5KANI 3VRLE 1KJ3H 1WQVT 4UTBH 3RY6A 2X4OB 4M00A 3R8BB 4MJ6B 4KJYB 5ETUB 4ODVL 3WFHA 3MRJA 1CFBA 4Z7WE 5J13B 1FZMB 1A1MA 1VENA 1OAZH 1Q0XH 3S37L 1S7SB 2E6JA 3L3OA 4TTGA 1I8KA 4K2UH 5ESQB 3VFMB 1CVRA 3UDWC 4YX2L 1XF2B 3G04B 3T0EE 3OR7A 5I16A 3GUTA 4WEBL 5CIPB 3SDDA 2XWBB 2ZUVA 2R23B 1P6FA 1VFUA 4MJIB 1IC5H 2NTSP 4XTRC 1VADB 4FQHB 3O3AA 4JQIL 3RX7A 2GT9B 3ILQC 2A6KA 2YC1B 3MRDA 4ZPTA 4ERSH 1KPUA 2DIBA 2H2SC 4PBVC 3GGWA 1AKJA 3HE7C 1ETZA 2AJ3A 5JZ7C 1QVOB 3E6HB 1FZKB 3VXSD 4R0LA 5IMMA 3O41B 5B21A 3HPJB 2HRPH 5JHDB 3HS0B 4XNYH 4KQ4L 1JPSL 3VFSB 4O4YH 3ECBA 1AQDA 2HG5B 2RQ8A 1BIIB 1DL7L 3TVMA 5ICYA 4ZDHB 4GJTB 2CKBB 1TPXC 3CFJA 4GMTL 1ODAA 5FUOL 5TDNB 3KYKH 4AG4L 4DKFL 3ISWA 1AGEA 5EO9B 5HDOA 3QQ9D 4DW2L 4M6AA 5T3XH 1QEWB 3PDGA 4QRSA 4DGVH 1RZJL 1QD0A 4ZMAT 4DUVA 5HYJB 2IH3B 3PV6B 4Y5YC 3Q5YA 3Q5OA 1S9XB 3MV8E 5C7XL 1P2CB 4ZD3L 1B0GB 5BVJB 1JGLL 4XCCH 3BQUC 1AE6H 3G5XB 5K9KB 5M7QA 4U0QB 1MHCA 2GJJA 5JPNA 1VFAB 1QQDB 4ZSOE 4XH2A 1HHGA 3QDGA 4W68A 3VGAB 5FYJE 4OZHA 3FO0H 3OXSA 2B0SH 3I50H 2V9RA 5F1NB 4I3GA 5T1MB 3U30C 3MOBH 4QF1A 5SWQB 4HQQH 5HGBA 4YR6A 4WWKB 5CGMA 4P2OC 4P4RB 5AUMB 2DKMA 4HIIB 2GIYA 1ZLUK 3QAZB 4X98A 3PABB 5DFTA 4J4PA 2DF3A 1HYSC 4PS4H 1BX2A 1UFUA 3QP3A 5I76A 5BS0A 2ARJB 4WI2A 2X4RA 2AJZB 2FECL 3BZDA 4MD4A 5D2NE 2V6HA 4HHAA 4BKLB 4U1NB 1WWBX 3ARDD 1NKRA 4Q9QL 3VFVA 4RRPG 4H25A 5TH2B 4PRHD 4F7EA 3ZTJG 5KSVA 1NGXA 2Y5EA 3P30L 4JFEA 4XNUL 4PRIB 2FDBP 3MRIB 3NPZB 1U8IB 2BVYA 2H2PD 5GS3A 4YHYB 3ZDXE 3IDMB 5L8KB 3P4NA 4ZNEA 1OTSD 4MDJB 5DQDH 2C4FU 4I1NB 4M4RA 4NO3B 4WFED 5EFIB 5MHSD 4Q7DA 4EUPA 2F54A 4OZHF 1LO3L 3VRIA 4MA3A 5BRZD 4AT6B 1QYGL 3QCUH 4L3CA 1IGTA 1UEMA 1MI5E 2WBKA 4M7LT 4EXKA 2CDGA 5FYJL 5GXBB 4JFOB 2JIXB 2ITCB 3I02A 1UKSA 3GSOA 2FSEA 1T04B 3NPSB 1T1YA 1F90L 1H5BC 1ZT7B 3GMMB 5DQJB 4P3DA 1YUHA 4XAKD 1GIGH 3BZEB 3D85B 3AU1A 2IGFL 5FEBA 4EXPX 2W65A 4JM2C 4TOYH 3VE0B 4I3RL 1ZWIA 2CK2A 1INEL 4AIZB 3GI9H 2L7UA 4XNMA 1NAMH 1S7XA 4DFIA 3DSFL 2AGJL 1T1ZA 1L9NA 3RWIA 1RUQL 1CDBA 4Z7NF 3U0PA 3HE6C 4GUPA 2Q1EA 3MBXL 2EH7L 1FC2D 1IGFL 4I0PB 4B50A 2AJXL 4JHZA 2D7TH 2RAMA 1JHTB 2VLRD 3IAQA 4JZJA 1MCWW 1U93A 2YKLL 2X40A 2WBJA 4G8GA 5D1XB 4LCWA 2IMMA 1U41A 1EJOH 5DWUL 4JPKH 3LPWA 8CGTA 2ZPKL 4OZGB 1ORSA 4LU5H 1XGUB 2DB8A 2E27L 3O2DL 3BZFA 2NTFA 4ONFL 1VPOH 4UT9H 4GXVL 4NQCD 4QRRB 3KS0H 1RPQA 1FN4A 3WLWD 3W11D 2DLHA 4NT6B 4U2ZA 3WD5H 4UUJA 4PRPE 2WK2A 5C0NC 3L3IA 4P46C 3VXSB 4HZAA 5CEYB 2B4CC 4H20L 2E7LA 1G6RA 3CH8A 5DMJB 4Z7VB 4RFEA 3DARA 5GJTL 1RZIB 1S3KH 5KSAB 1GAFH 3QHFH 1D5BB 5CZVH 5LWYH 2JTDA 5LAXB 2MCPH 5D7JB 4ZFZB 2NY3C 1A7NH 1BVKA 2R15A 4KV5E 5FKAB 3Q6GL 5I1HL 4PJCE 2X6MA 3E2HB 1UM6L 3LS4L 1ZV5A 1E28B 3P0YH 4KJPD 5T3ZE 1X5GA 4EIGB 4ODSL 1UZ8B 3QZWA 1JPFB 2NY1C 3IVKA 4WUKH 5FGBC 3S4SB 2J5LC 2P8PB 2I27N 3ZT6A 5FHAH 2ZCKH 2ADJA 3MJ7A 3OSKA 4Z7UE 5IG7A 2HYMA 3H0TA 4L5FH 4R2GC 4YDVB 1AGBB 1CICD 1ZT4A 5CCKL 1IVLA 1X5AA 5IOPA 5IP4A 4HS6B 2GJZA 3KHOA 1OOAA 4JRYB 2AXGA 5EOTB 1ADQH 1HE7A 1DEDA 1GC1H 3DI2B 3BXNA 1AXTL 3QULA 5FECA 3T65B 1KB5B 3D0VA 2VDOL 4FABH 4Y5VC 4PUBH 5ACMA 1YN7A 2GSIB 1RUKH 1NLDL 1HILB 1T20A 2D03L 3U82B 5F1IB 4HAFA 5D1QA 1KYOJ 5HVFB 3DX6B 4KZDH 5AZEL 4P3CL 5IB4A 1U8LB 3IF1A 5AG9A 3GM0A 3MTRA 2IPTL 2IJ0C 3NN8B 4Y4KC 4JM2F 2FO4B 2VLLB 1VFBB 4LEXH 4F9PC 1WZ1L 3QXAA 1YPZE 1NDMA 3JV6A 5LCVH 1X5HA 3BKJL 4GMSH 1Q9WA 4I77L 5TE7H 4WHDA 3S96B 3MRHA 2FJFA 3WL9A 1SYSB 4TSBL 3P11L 3VD7A 3EDJA 5T3ZL 4X6CF 5JOEA 4J3WA 2EIBA 3O8XC 4NKMB 4UQ3B 4LRNL 2UY7A 4J3XA 1MRCH 3T4YA 5IHBA 5DLMH 2ZSWB 1KJVA 3WFBH 5F96H 2CO6B 5IKCA 2I25N 3L95B 3W9DB 1UXSA 5B38B 2W0FA 1AD0B 1Q0YL 4OKVB 4PJXE 2R8SL 1E4WH 1BVZA 2I24N 3HMXH 5FM5M 2I9LB 2AK4E 1YMMB 4WDIB 1AO7D 5CJXA 4POYA 5DRNB 1G7MB 2VSCA 2BX5A 3MV01 4YHOH 2BY3A 1JF1A 5FGRA 2DBLL 4ODXA 5I18L 1T7YA 3VXRE 3SHSA 4BFIB 1RURL 1PYWB 2HFEB 1AXSA 3DO3A 3P73B 3TBWB 4FFVC 1LP9B 3QEGH 4FQ2L 3U0TA 4JN1H 3SO5A 3IDGA 5JO5A 3WNLA 1N8ZA 4JFDE 4FHBD 4CMMA 4Z78B 2R1XA 4P48A 4A6YH 2OR9H 1YNTB 2XWTA 5DR5L 1XIWA 3KPLB 4FXGB 5D9SA 5JQ6L 5HBBA 4OCLC 5D2LB 1IBGL 5IVZB 3QUZB 2VLRB 1RK1B 3NFNB 5FDWB 1A1NA 15C8H 3LMJH 1MFBL 2XPGB 1J0YA 3UYRL 3ROOB 3GMOA 3QNYB 4JFYA 1G9MH 1W72L 2LU4A 1OT1A 1YQVH 4JY4B 3MLVH 2BERA 4N5UA 4Y4FC 3QWRA 5IB3B 1Y6KR 5C0DA 1DUYB 3EOAA 4JDZA 3U46B 4BM7A 4F15B 1CE6B 4ZO9A 3EOBB 5B39G 5C86A 4GFTB 1FRGH 4D9RE 1TTFA 2J8UF 5IBUB 1RJLB 1UC6A 5KSBF 3NCYP 2DN7A 1RZJC 2IPUG 3BD5A 3BE1H 2DLGA 2GK0B 3MBEA 5EIVA 3QA3B 1H3GA 3AREC 1T2XA 2F9BT 2Y1VA 1FL6A 3KG5A 1XF3B 3A6BH 1FG2A 3BP4A 2CLVB 5IBUG 3GMQB 2Z8VC 4IMKC 2J12B 1EVUA 2N7AA 2A9ML 5ESAA 5H8DA 1FNEB 1FVCA 3B3IB 4MZ2A 1HIML 1WBXA 5E2UH 2IQ9L 4U1IA 4YHIB 5F9OH 5EU6A 2APBA 2P1YA 3DGGA 5CWSA 3TM6A 1QLRA 3T0EC 1RZ8B 5AYUH 3QEUB 4NHCH 4LEOA 4X4ZA 1CICB 3CCHA 3WCYA 2ZCLL 1G9NC 1QR4A 5DMIH 4NC1E 5CJQH 4Y4HB 5T3XE 2VIRA 3CFDA 4KRLB 4N0FA 2EE2A 1CDYA 4J2XA 2HJLB 2J1KA 1JGEA 3T8XA 2XN9A 4O51A 3O6MH 3P4MB 5KVGL 1FVDA 2VR9A 5I1CL 4WHYG 3HRZB 1QACA 1TQBB 5HJ3B 1S7WA 1KJ3L 4UTBL 1FYTE 3QJHB 2NY0C 5KANG 4L4TD 3VFOB 3EYUH 2AEPH 5FGSA 4E5XA 3HNTH 4OTXH 5D5MA 3MNVB 3QFJE 3FRUA 4L9LC 4MQ7A 1W0VA 3C6SB 3QUXB 3KYNB 1OGAB 3UAJC 4OAWA 1PKQA 1G7QB 5BJTA 5C1MB 4KU1A 4L8SB 5FYKU 4P5KA 3MRRA 1EH9A 4GW1B 3VW3H 3MV9A 4H5SA 1L0QA 5IV2B 1MHEA 4IMKA 1QSZA 43C9A 1TFHA 2XZCH 4LGPB 4YZFF 4ZUVA 2C1OA 5HVGB 5HVHB 5CBAA 2YZ1A 4L4VA 1NBZB 5FOBA 4Q0XH 1Y6MR 3CXDH 3U6RA 3F5WA 2EXWD 5L2JA 1JNJA 1DQJA 1QRNE 5E1HB 4ZUTA 1BQLH 3RPIA 4JZOB 2NY2D 1NC4A 1DVFC 3JV5A 1LVEA 3O6FA 5IT2H 1EEYA 3O3BB 4LPTA 3CPLA 4ZOAA 4DEPC 3TT1H 2ATKB 3KYKL 1GH7A 4G6KL 4WENB 5F6HI 1AD9A 4OFVA 5C0IB 1OP3H 5T3XL 2NX5A 4DGVL 4PJIB 2DMCA 5E0QA 5DD3H 4XVSH 1GOFA 2BMKA 3NOIA 4PTUA 1KCRH 4P49A 2NXZD 5H94B 1GGTA 1AFVL 4XCCL 2YPLD 5GIRA 4U1LB 5L2KE 2DQEH 1KNOA 3HA0A 3IFLH 4DVRL 5D71H 3QUKB 2QQKL 2A77H 4C56A 5I8OH 4OLZL 4JFFD 3GSNB 3H9SE 5J6GB 3ARSA 4LLYA 4BQCA 4XB8A 5JDSB 3BEVA 3FJTA 1FFNB 1QSED 2HWZH 1DN0A 4S2SB 4MZ3A 1S5HB 2DLFH 1P6AB 5J1SC 4FFWD 1SJEB 1YMHA 4HQQL 3TA3C 5A2IH 2FX7H 1A6TB 2X9XA 5ID0A 1W0WB 1CT8A 4DQOL 1U8NB 4PS4L 3BT2H 4WGWB 4Y7MA 3EO9H 5IBTL 3Q3GB 5BRZE 4QXUH 4G7YH 3FQUB 3WHXB 3N50A 3MRNB 4YXLH 5DI8A 3FB7B 2BNRD 1AY1L 2IC2A 2MJWA 2HH0L 1P1ZB 1Z3GH 5JHLH 3ARXA 5DK0B 4B7IA 4GO6B 3QWOA 1VA9A 1QRKA 2KBGA 4UNTA 5IMOA 5F3BB 1NUNB 1JWUA 1ND0A 1LDPH 5F6IC 3AGVA 4IRSC 2OS7A 3TBTA 2DM4A 5F89A 5JW4R 4M8VA 2YPVL 2AQ1A 3ORJA 4NUJB 3UO1H 5DQDL 3NFSH 3PIQA 1DQQB 5IHUH 2DBJA 1XZ0A 3T1FA 4DN4H 4NZJA 3QDAA 1A4KA 1U2CA 2F53B 1OTTD 3AROA 4NWTH 2A73A 1HWHB 3V4PH 3B5GA 1MFDH 4LLDB 4X6DE 1A22B 4AQ1B 4JQXC 1I1CA 3QCUL 3OR6A 3JVGA 1EFQA 5DO2D 3QSKB 3R06A 5ADOH 3EOYG 4NGHL 3A6CH 3HPLA 2KZ1B 3MLWH 2AXFA 3MUZ1 4MCZA 4ONHB 1PW3A 1UEYA 3WS3A 2AERT 3GMRA 4S1QH 3MR9B 4GS7C 2B1HH 3BUYA 4WHTA 5GRVL 2X4PA 2IH1A 4K3HA 2ZG2A 1GIGL 1PX4A 1RU9H 1PDKA 5HYIA 1L7TH 4RCAA 2FX8L 5HHNA 4N8VA 2NY4D 2R56L 4XBGA 4LCUA 4TOYL 1JIBA 1YDPA 1D5IH 3OQ3B 3GRWA 2QKIB 2GW5A 1A14H 4MX7A 2OTWB 4OLUH 2CR6A 1M6OB 3GI9L 3LKPA 3OKEB 3O2VH 4XP1L 4F2MA 4QHKJ 4ZXBC 3ULUD 1I4FA 1GGIL 1IGIH 5DSCB 2NR6D 1TVBB 4MNQD 3SDAA 2HTKD 2CMRH 4YHKH 4Q9RL 3MV7A 2XZZA 3OB8A 4NZDA 4UIMA 3RVXC 4ORGA 2D7TL 1GGCH 1IKFH 1H8OA 1MWAA 2VB5A 1ZLWH 3VGEA 3DRQB 4EN3B 4XP9H 4LSUL 1BFVL 3VFWA 1BD2A 1H3PL 5E9DD 2XNAA 5MERB 3KPQA 3KVQA 2GEEA 4IJ3B 1EJOL 5CJBA 4JPKL 4OD1L 1JPGB 2CRMA 4S1RH 4GKNB 1IEBA 4JO1L 2EZ0C 5HHME 4KK6C 1KELL 3FONB 4JQXA 4UT9L 3BJLA 5DEFB 4OT1L 2GAZB 4PJFE 4EI5B 4LCCC 3KHQA 5BVPH 1MCBA 5FXCH 4DTGL 3E3QE 4Z7WB 2M26A 5A43C 1ZK9A 2GCYB 2BVUA 4XWOD 2P47B 1EV2E 3DVGA 3RWEB 3BGMB 3MFFB 3RWCA 1GAFL 3QHFL 4YHZL 4GG6E 3MRPB 1LEIA 1HKFA 1A7NL 2BCKB 3RNKA 1HHIA 3GBLA 1TVDA 5TQ0L 5GGUA 3ALPA 3TIEA 3CGTA 3GSQB 3SPVA 3UTQB 1C16B 5GISH 3VFUA 1MCSA 5BQ7A 5JMRA 1SMAA 2BRQA 4ELMB 4HKBA 2XACC 4XBEH 4H88H 5D72H 2YPLB 3DUHA 4NKQB 1F4WH 8FABA 1HHJB 1FO0A 2ZCKL 4RQQA 3MLUH 3QI9B 5D7IF 4ELKA 4I9WD 1IGMH 5DJ0B 1WAAE 4FQLH 4NKDB 3L3JB 4EVNA 4Y1AD 6CGTA 4HXAH 2AJUH 2X4OA 3DX8B 5EBMB 4MJ6A 2XG4A 3SDXB 1I1AB 4KJYA 5ETUA 3TZVB 3O4LD 4N9OB 1YN6B 1GGUA 1WC7B 1FZMA 2NYYC 4BA8A 4MNHB 4WI5A 2R4SH 3BHBA 1S7SA 1ADQL 1I8LA 1NH6A 4HAGA 1GC1L 4JM4H 3VGAC 1CK0L 2PXYC 3U9PL 2ESVD 3MRMB 3VFMA 4NBZB 1XF2A 2Y7QB 3G04A 3UTTE 4NQVB 3X13B 1GSMA 5CIPA 2XWBA 1MSPA 4XGZB 4FABL 4PUBL 3STLB 4NQTA 5CSZB 4MJIA 4WWKC 5F70A 4EI6B 2FH6A 2BNRB 4ZSOB 1VADA 2PYED 4FQHA 2CPCA 2P8MB 3EYVB 2GT9A 3HAEH 1YJDH 3OKKB 3H9HA 4KC3B 4TNVK 4YFDB 1X4YA 2YC1A 1MREH 4KZDL 3WFDH 4HUWB 3P0VH 4E0RB 4UV4H 1RZFH 4NBXB 1AP2B 3S97C 4PR5B 1AO7E 1QVOA 3D0LB 3E6HA 3U36B 3O41A 4X5WB 4KROD 3HPJA 5JHDA 3HS0A 3VFSA 1MIEL 5LCVL 2R2EB 1F8TH 3KAAA 4IOFD 2HG5A 2Z8RA 1BIIA 1UYWL 1U8JB 4Y2OA 4PJ9B 4ZDHA 3RQ3A 4EQ3A 4YHYC 5EO9A 1R0AL 1QEWA 1BZQK 4UTAH 2R0LH 1MRCL 1TQCB 3HHRB 2IH3A 5HYJA 1S9XA 5IEKB 1P2CA 4X9BA 4PJCF 2KKQA 5DLML 1B0GA 1KN4L 2QSCH 5BVJA 5F96L 3QCTL 3G5XA 3DIFB 5K9KA 5J9PB 5A2JH 5I1LB 1VFAA 3MJ9A 1QQDA 3U4EB 3UTSE 3WDHA 1BBJB 5F8RC 1IMHC 2BJMH 3CVHB 5DJCB 4ORZC 2PW2B 2IWGA 2ZUXA 3T3ME 5KS9B 5F1NA 4GKSB 4X4MA 5ILTL 5T1MA 5SWQA 4YHOL 1NUGA 1XH3B 3NPSC 4P9HH 5AUMA 4P4RA 1ZVYA 1LILA 4K07A 4CL7A 4HIIA 3HC4L 4RRPA 3PABA 1JUFB 1UQSB 1UA6L 4DCQB 2ARJA 4GAFB 3VXUE 2AJZA 3VMNA 2OR9L 4N68A 3W9EB 1A6UH 4YXKL 1SJVA 4MJ2A 4NM8L 4BKLA 4XP4H 4U1NA 4EDWH 1MIML 3AY4C 3OPZH 5TH2A 5K59F 3X3GH 4L9DA 4Q74A 3UYPA 4PRIA 3MRIA 2VDLH 3VG9C 1SM3L 5E9DB 5KVFH 3LMJL 1BZ9B 1U8IA 4WJ5B 1BQHG 4PJDE 4X9IA 3KPRE 3IDMA 5DD6B 3GSNL 4CVXB 1JF5A 3N1GC 3MOAL 2AXHA 3ULSB 2H32B 3MLVL 3GHEH 3MLRL 3EYQD 3M45A 3U7AA 2BVPB 4NO3A 4LKXB 4OB5L 1MQKH 3HUJA 4CNIB 4JZNB 5INCB 5DMKA 5EFIA 2UVFA 3LB6D 3B9EA 3GK8H 4K23H 1FRGL 3HTLX 3V7AG 2WAHA 1N64H 3SGEH 2XRAL 1UCBH 4AT6A 4B7LA 5IM7A 1MRFL 4HF5H 3QDJE 3BE1L 3OGCB 1JI1A 4LSPL 4HJ0D 4RDQG 4JFOA 2JIXA 1WJ3A 4ODBD 2ITCA 4Z0BL 3DYOA 1T04A 4MQTB 4WFHE 2V5MA 4L4TE 3W82A 1ZT7A 3GMMA 5DQJA 5E2UL 2JB6B 4NP4L 5DEZA 3RZCA 1DLFH 3FRPG 4FQIH 5IROC 3BZEA 4MLSA 3D85A 3QIBB 1BBDL 3FB6B 2CJUL 1QUNA 1EGJH 3O9WD 3ZKND 5JIKA 3QQ9C 5C2BL 1DDHB 2NNAB 5DJDB 5AYUL 4AIZA 4NNPH 4OCYH 4OZIF 1R3JB 3DO7B 1K2DB 5L88L 4Y1AB 4ENED 3ARGC 1HEZA 1KJ2L 1RUMH 5CJQL 5DMIL 1HQRB 5CP3H 1IT9H 2GSGB 2VZVA 1DSFH 3ZE0F 4R96B 4I0PA 1X44A 4P99A 4EJ1C 3NH7H 3O6ML 2DDQL 4CU8A 1UM5L 3S88H 1JHTA 2ESVB 3RVUD 2VTFA 4W6YB 3M1BB 3O45B 1MCIA 5D1XA 5C0GB 4LVNC 1CCZA 2HT3D 3CSPA 4OZGA 3HNTL 1XGUA 4JKMA 2PYEB 4Z7UB 4Y2DC 3DI3B 4QRRA 4X7DC 4LSDA 3U7WL 4NT6A 2D3VA 4RISH 1BEYH 4I3SL 4N0UB 5SWSD 3VXSA 3ILPA 1JJUA 5CEYA 3VW3L 4Y89A 4ETYA 3L3GB 4KROB 3ARDC 4EBQH 4OZ4A 5C9JA 4P2QE 4QTHA 4W6XB 4WU5B 3IXAB 2G9HB 1RZIA 4APQD 5KSAA 3CSYB 4P59L 2JK5B 1D5BA 5LAXA 5D7JA 4ZFZA 4HX1B 1IKNA 4Q0XL 1JYWA 3CXDL 5FKAA 1IE5A 4MSWB 2FB4H 1I9JH 4XP6H 3QEHB 2K7QA 3NACL 4OGYL 1OTSC 1BQLL 2R0WL 1E28A 4XT1C 1UZ8A 3EO1B 1JPFA 4P23B 1HXMB 2OL3H 1NPUA 1BOYA 3TT1L 3S4SA 3NCFB 2P8PA 1J0KA 3MNWB 4X99B 4HK0B 4YDVA 5HVWA 1AGBA 1PLGH 4XVSL 3GI8H 3RA7L 3U83A 1NGYB 1KCRL 4HJJL 4H1LH 4Z8FH 1ITCA 4ZTPH 1EZVX 4ZFOB 2VZUA 1JPTH 4OZGF 2DQEL 2MMXA 2QSQA 5E4IA 3IFLL 4HS6A 5JR1L 4JRYA 5EOTA 2A77L 5ENWB 5GRZA 1NEZB 2HT4D 3T65A 1KB5A 4KHXH 1FGNH 1CIDA 4HWEL 4LFHD 2DLFL 2J3SA 4YH6A 2GSIA 2B2XH 1HILA 3EJJX 2O5XL 2XOTA 4RMRA 4HWZA 4K9EL 4PJXB 1HHHB 5F1IA 4Z7VF 2FX7L 2X9WA 3K80A 1NEZG 3E6FB 3DX6A 4PJGE 2E7BA 4UAOC 1U8LA 3NAAH 4JRXE 3BT2L 3AM8A 4FS0A 3H8NA 3LS5H 3EO9L 1UACH 4GBXD 4WI6A 4G7YL 1EMTH 3NN8A 2BNQB 2FO4A 2Z93B 4YXLL 2VLLA 1VFBA 1SEQL 4QXTB 5GGTL 2VLKE 2R2HB 4WTZA 3ZKXC 3D3VB 1QFUH 3I3BA 4GRWH 2ZP0T 2AQ3A 3GBNH 3QCVH 1B0WA 4P57A 3MLYH 3S96A 3UPRB 4PYGA 1SYSA 5ADPH 3B6SB 1CL7L 5EUKB 3L5HA 5C3TA 3C5JB 5MI0C 3O11B 3WJLC 4UQ3A 1A9BA 3PHSA 3UO1L 4IDJL 4GKOA 5IHUL 4HK3N 4HMEA 4JPIB 3WLWC 2XWJB 2ZSWA 3W11C 4K7FB 3L95A 4DN4L 3KPTA 3W9DA 5D1ZD 5B38A 1C5CH 4PB0L 1AD0A 4NWTL 4OKVA 5BZWB 2DQTL 3K2UH 5ISZE 3QO1B 1UG9A 2BHYA 1MFDL 2CRZA 2I9LA 1YEGL 1YMMA 5C09D 4ZNCD 3VFTB 2ZKHH 4KRPD 4AQOA 5I9QB 2DIJA 1L6XA 4RFNB 3FAXA 4P4KB 1G7MA 2YA0A 3O9WB 4NUGL 5C0CE 3UMTA 2VQ1B 4BFIA 2B1HL 1PYWA 2HFEA 3T77B 3WYRA 2VABB 1LK3L 4KJPC 3P73A 1GC1C 4HLZH 1LP9A 3K8LA 5E2VL 3KR3L 4NQEB 1P5UA 1L7TL 1KXTB 3SKJH 5IFJB 4Z78A 1YNTA 4L8BB 3MLZH 3B83A 1Z9MA 5FCUH 4C58B 1C12A 3KPLA 4FXGA 2IEPA 5JXAL 5DD0L 5AYQA 5D2LA 4OLUL 2FR4B 3L3HB 1CICC 3QUZA 5B22A 1RK1A 3NFNA 2BC4B 4QHUB 2LTQB 3B9VA 5E8EB 4LLMA 3UCRA 5FDWA 4OV5B 1M05B 5MENE 1SBSH 4O9HH 2CMRL 4YHKL 2XPGA 5I30L 1NDGB 5GGRY 1MFCH 3ROOA 4P2RA 3QNYA 4URTB 1GGCL 4Q6IC 1IKFL 2BSTB 4JY4A 3FN3A 4XP9L 3RU8L 1P7KB 2XTLA 2NY6D 1DUYA 3U46A 4DZBB 3RGVC 1CE6A 4UOW1 5SWSB 3EOBA 4WNQB 1FFRA 1RJLA 3RTQD 2H6PB 1D3CA 3DX9B 4QRTA 5E03A 5EWIL 1IQWL 2EDRA 3WFCH 4APQB 4LKCB 3RUGE 4F57H 2GK0A 4I9WE 3QA3A 5ANMB 2OYPA 3AMLA 1JHLH 3VI3E 3QO0B 5BVPL 2VQTA 1XF3A 4G8FB 1GL4B 5D7LE 3O4LE 3GMQA 2QL1A 3HZVA 5F7KC 3LQZB 5J57B 4ZYKB 1FNEA 4U6TA 3B3IA 3QFJB 1JNHB 4HS3B 3DVIA 4I8DA 4NRXB 4YHIA 4ZQKB 4HWNA 1CYGA 4OLXL 4JGMA 2BSRA 1H15B 1RZ8A 1JTTA 2W59A 1S5IL 3FQXB 3K1DA 3QEUA 4U0RC 5AWNH 1CICA 2AABH 3P2TA 1BLNB 4UV7L 4OJFH 3QRGH 1EBPA 2D7PA 4Y4HA 5CUSH 1MHPH 2WBWB 2XQYK 4XBEL 3WUWA 4JO2H 4MA1B 2ARWA 1CI5A 4LIQL 2HJLA 3O3DB 4P0DA 3WXVH 1K4CB 3MLUL 1DQLH 5GRUH 4XP5L 3PWPE 1QRNB 3P4MA 1R5IB 3KXFE 4FQLL 4D9QE 2J2ZA 2NW2A 3HFML 3HRZA 4LHUB 1KCLA 1N0XH 5HJ3A 2AJUL 2WQRA 2VLJD 1CF8H 3QJHA 5DUML 5DUPH 3VFOA 3MCKB 4CDGC 5SWZA 1ZGLB 5TF1H 4AL8H 3X3FL 2GJ6E 1FNLA 3MNVA 4JM4L 4PJBA 4U4BA 1T22B 4R90H 5IWLA 3C6SA 3QUXA 4RFOH 3FO1B 3MLTB 1OGAA 1JZ4A 1G7QA 4GBXB 1RZKC 4L8SA 3RGHA 4LFHG 1OHQA 2HFGH 4QOKD 4GW1A 3RDTD 5IV2A 3CC5B 2VXUH 2Y06H 1XGYH 1LO0H 3P0VL 2CD0A 4YFLI 4U49A 4OKDA 1RZFL 1A2YB 2G60H 1NBZA 3WNMA 1UWXH 3QUYD 4BZYA 4L1HA 3RWDB 4JZOA 2ZOLB 2J4WH 2VN4A 1DFBL 3O3BA 2VDNL 2ATKA 3V6BR 4X7SH 5D1ZB 1MJUH 4KJWD 4JFQB 5KG9B 5C0IA 2P5WD 1NAMB 5CS7A 2R0LL 4PJIA 4UTAL 4GG6F 4P9ML 3T09A 2E8ZA 4FNLL 4M02A 4JQVA 4R26L 3P9LB 5H94A 4MNGE 3IDYC 1WZLA 1H3VA 1GZPB 4HD9A 4U1LA 1IFHL 1S9YB 1YEJH 4XCNB 3O6KH 1P9MA 1ZXQA 1CBVL 2BJML 1H0DA 2LU7A 5C07E 5JDSA 5ID1A 5SV4A 5HGHB 4PJHE 1FFNA 2ITDA 4ODUB 4S2SA 4IRZH 1IAOB 3OAZH 1WAAF 3GDBA 3OKDA 5KOVC 3PP4H 1SJEA 3T08A 4NRYA 4NM4H 2WIMA 5DMGD 1U2HA 1N5YL 5E8OB 1A6TA 2VR5A 1D6VH 1W0WA 4X6DB 4OF7A 1CDHA 2CUHA 1DQTA 3VI4F 1U8NA 1X7QB 3ZDYE 3NGBB 2IBZY 5FV2A 4TULH 3FQUA 3WHXA 5DFWH 3C5ZB 4JN2B 3MRNA 2EH8L 4HLJA 1HKLH 1EO7A 3D69B 3QDMD 2OZ4L 3OWEA 3FB7A 5L9DL 3VD3A 4XP4L 4EDWL 1P1ZA 3DURB 1BM3L 5DK0A 1CN4A 4FZ8L 4D0CB 3X3GL 1F2XK 3LN5B 3G6DL 1F11B 3O6LH 1YEHH 2V5SA 2EEAA 3D18B 2VDLL 1HI6B 4NJ9H 1ZAGA 4BQBA 1CG9B 2FRGP 1NJ9B 1PD6A 1OP5H 4LGRB 5BV7B 3BAEL 4I48B 3RTQB 4TVPH 3PHOB 5L7XH 4KKAD 3H3BC 3KPSE 5H35B 5LJYH 3VXMD 2DQJH 2J6EA 4K23L 2F53A 3WIHL 2YD7A 2H9GB 3BYTA 1V3JA 4PJ7E 3I6LD 1OL0A 3SKNB 3MLXL 4LLDA 3ESUF 1S78C 3MACH 5TE6H 1I9IH 4LSVH 2OCFD 1IM9B 4R4BB 4KKCD 3STBA 3PQYE 4Y5XC 2EIDA 3HCVB 2DS4A 2EXWC 4ONHA 1HCFX 2PO6B 2Z92B 4UU9B 2YPKB 3MR9A 2NY2C 5JIPA 4E9LA 5HHMB 1PG7H 1PEWA 3F7QA 4NZUH 4FQIL 1P53A 3A67H 5I74C 1N26A 1EGJL 4HC1A 3WO3B 3E8UH 2QKIA 3FCTA 4POUB 2OTWA 5ITBL 2IAND 2X4QB 1U0QA 4NNPL 3OKEA 4K9EC 4XX1G 5GGVH 2NXZC 1FFQA 3EO0B 1LGVA 3K0WA 1ZA6B 2VLJB 1TVBA 4JE4B 2FHCA 5HGDB 4M6ML 4UB0H 1E6JL 1ZT1A 3NH7L 1TJIH 1C1EH 2BK8A 3S88L 4HFUH 5JOPE 1FORL 3DRQA 3C60D 4EN3A 1QHOA 4TNWK 1QSFE 5E5RB 2ZG3A 5MERA 2DLIA 1JPGA 4C4KT 4L3EE 1DBJH 4GKNA 1L0YA 2CK0H 3RDTB 4XPFL 3FONA 1KEML 3KDMB 2Y4SA 5HHPB 1MCDA 2GAZA 5IK3B 4EI5A 4BFGA 3FN9A 1J86A 5HI5D 4G8IB 4P2YA 1BEYL 4LVHB 4HCRH 4Z7WA 1WTLA 2GCYA 4HBQA 3OAUH 5DRWB 4YK4C 4IOIB 5H37H 3HLAA 2BP3A 2QADD 5IESH 3RWEA 2WUCH 3MFFA 2X89D 5HHVH 2I5YH 3UTTB 5I17B 2BCKA 4M62L 1I9JL 4GRWE 3WSQL 2P4AB 1IILE 3RI5K 2P5WB 4M7LL 4ZAKB 4XVUD 3GSQA 3UTQA 5GZOD 5MEOB 1C16A 4DGIL 2WSKA 2ICEB 3QEQD 4NZTH 2F58H 1K5NB 4A6YB 3SDDD 4ELMA 3G6JE 4IMLB 5IJVB 4HJGB 2YPLA 5EA0H 3WNNA 1FPTH 3ARFB 1OTTC 1U58B 5DK3A 1HHJA 2NXYD 2P5ED 1VDGA 2YA2A 3QI9A 5DJ0A 3L3DB 3MV11 4NKDA 3L3JA 4LHJB 4AZ8A 5HDQL 3WS6C 3CAFA 3DX8A 5DO2C 5EBMA 2I60H 4ZTPL 2W0KA 3SDXA 1I1AA 1WWWX 3TZVA 1YN6A 3V0WH 1DBAH 1WC7A 2EDNA 4MNHA 3TWCH 4PV8B 3GZKA 4WHCA 2UUDH 2IAMB 3MRMA 3TVMD 3RL1B 2Y7QA 3MLPA 4NQVA 4XNZB 3X13A 3KWWB 2NY4C 3RHWK 3CVIH 4G6JH 2YZ8A 3L7EB 5F9WC 3U7YL 2B2XL 1UWEH 3QDMB 5CSZA 1GXEA 4EI6A 5MEPA 2BNRA 4ZSOA 5IFAH 5J6HB 2P8MA 5TE4H 3WFEL 4M61B 3OKKA 2BZDA 1JYVA 4HUWA 3H7LA 1FFOB 3SGEI 5KW9L 4E0RA 3VFPB 1UACL 2NR6C 1AP2A 5C09E 1EMTL 2HTKC 3RNQB 4PR5A 5F88B 5D6DA 3DRTB 2EDJA 3QDGD 3D0LA 3QIUA 3U36A 4C4KO 5BO1H 3IU3B 1OSPH 4X5WA 7CGTA 4Z76B 1QFUL 4U7MA 2R2EA 3BD4A 3QCVL 2D0HA 1FL3B 1U8JA 4PJ9A 1C5DB 4XVJL 5CHNA 2YK1L 3VXUB 3QT2A 3VCLB 5D2NA 1J05B 3IJSB 4AEIL 1U95B 4LNRB 5IEKA 3SDXF 1SJXA 5BS0D 4NJAL 2ORBL 4J6RL 3DIFA 5J9PA 1KIPB 5I1LA 1FSKB 2ED7A 2H1PL 3DMMC 1C5CL 3U4EA 3MRBB 3K2UL 4U1GB 2VITB 1BBJA 3KPRB 4XPTH 4GSDH 3UTZB 3VRJB 3CVHA 3TV3H 5DJCA 5IB1B 1P84J 3M8OL 4PIRF 5GZND 2BFVH 4F3FA 1J0ZA 5KZCD 1UWGH 1A6ZB 4GKSA 5DURD 1GHFL 3F65A 5LBSL 2FJGB 1XH3A 4AEHL 4M1CD 2VDMH 4QKXB 5F71A 2C5DC 5FO9B 4O2FB 1JUFA 1IGJB 1NGPL 3BDBA 3W2DH 4I18C 3L6FB 1UQSA 2JB5H 1MI5A 4OQTA 3QPXH 3W9EA 2F54D 2HKFL 3MLZL