The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
40
|
sequence length |
221
|
structure length |
211
|
Chain Sequence |
QVQLQESGPGLVKPSETLSLTCSVSGASISSYYWIWIRQPGKGLEWIGRFYTSGSPNYNPSLRSRVTMSVDTSKNQFSLKLTSVTAADTAVYYCAREEHITFGGVIVRYWGQGTLVTVSPASTKGPSVFPLAPTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGQTYICNVNHKPSNTKVDKKVEP
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Human antibody 3E1 targets the HA stem region of H1N1 and H5N6 influenza A viruses
pubmed doi rcsb |
molecule keywords |
Hemagglutinin
|
molecule tags |
Immune system
|
source organism |
Influenza a virus
|
total genus |
40
|
structure length |
211
|
sequence length |
221
|
ec nomenclature | |
pdb deposition date | 2016-07-01 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Sandwich | Immunoglobulin-like | Immunoglobulins | ||
Mainly Beta | Sandwich | Immunoglobulin-like | Immunoglobulins |