5GJWB

Structure of the mammalian voltage-gated calcium channel cav1.1 complex for classii map
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
100
structure length
100
Chain Sequence
QGPHMALRKEAERQALAQLEKAKTKPVAFAVRTNVGYNPSPGDEVPVEGVAITFEPKDFLHIKEKYNNDWWIGRLVKEGCEVGFIPSPVKLDSLRLLQEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the voltage-gated calcium channel Cav1.1 at 3.6 angstrom resolution
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Membrane protein
molecule keywords Voltage-dependent L-type calcium channel subunit alpha-1S
total genus 16
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2016-07-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 5gjwB00
3LH5A 5FWBA 3REAB 2FRYA 2YUOA 4FSSA 2DILA 1QWEA 1JXOA 2AKLA 2YUQA 3ULRB 1X43A 4AFUC 3EGUA 1K1ZA 2A36A 2LQWA 4J9HA 3VS4A 2KGTA 2JXBA 1U3OA 1M8MA 1EFNA 3VS6A 1CKBA 1PNJA 2A37A 2J6KA 1UFFA 4E6RA 1MV0B 1VYTA 4AG1C 1NEGA 1X2KA 2CDTA 4CC3A 4OMPA 1NM7A 4AG2C 2DM1A 1M3AA 1FYNA 1MUZA 2V1RA 3M0SA 2DYBA 1WI7A 1OPKA 1JU5C 2DL4A 1SEMA 2EGCA 4OMMA 1YCSB 2EGEA 1GBRA 2D0NA 1ZUUA 5IHKA 2CREA 1PHTA 3THKA 4RTWA 4OMNA 1K0XA 2KRMA 2JW4A 2JM8A 2ECZA 1ZUYA 2KYBA 4HVVA 2KNBB 1SRLA 1QLYA 4HVWA 2O31A 1WX6A 4IIOA 2FRWA 4DEXA 1WYXA 3TSZA 2HEQA 1TUDA 4HXJA 2RF0A 3KFVA 1KSWA 3EG3A 1PRLC 1I1JA 2C0TA 2F2WA 1WFWA 4Z88A 2X3WD 1AOJA 3IQLA 4F17A 1G2BA 2EW3A 2PNIA 4M4ZA 5FW9A 1NYFA 1RLQC 4J9DA 3I9QA 4CC2A 2EYXA 4J9FA 3GBQA 2CT3A 2KBTA 2EGAA 1WXBA 3I5RA 2BZYA 4Z89A 3M0RA 2M51A 2DRMA 4D8KA 1B07A 2AZVA 2DJQA 1GCQA 5EC7A 2KT1A 2F2VA 1PWTA 1AWJA 2A28A 2J06A 1SHGA 2P4RA 3QWXX 2CSIA 2RN8A 3VS0A 1KFZA 2YUNA 2EKHA 3NHNA 1NEBA 5IH2A 2D1XA 4OMLA 2H8HA 3EHRA 1W70A 2EBPA 5IXFA 4HCKA 3I5SA 1UUEA 1V1CA 2NWMA 2LZ6B 2KXCA 4Z8AA 2LX7A 3RBBB 2L2PA 5L23A 2K9GA 2CH4W 4AFSC 4RTUA 1X2QA 5HCKA 2FPEA 3SEMA 1KIKA 1HSQA 1VYVA 2ED1A 4RTXA 2SEMA 3M0UA 1AWXA 5IXBA 4JJDA 2NUZA 4JPBW 1ARKA 1Z9QA 1NLOC 4RUGA 2EQIA 2O88A 1W1FA 1YNZA 3TSWA 2MOXA 2CUDA 1RLPC 2L3PA 1ZSGA 1WDXA 1YWOA 3NGPA 2KYMA 3UF4A 2OI3A 1A0NB 3EG2A 4GLMA 2RPNA 2KE9A 2VWFA 2LJ1A 2EYWA 2EYZA 1YP5A 3EG0A 1AVZC 2BZXA 2A08A 4ESRA 3PVQA 3H0IA 3QWYA 2I0NA 1SHFA 1BK2A 1M3CA 1WA7A 1IO6A 1E6HA 2EVRA 5I11A 3UA6A 3H41A 1ABQA 2QDLA 3U23A 3REBB 2VVKA 1N5ZA 4D8DA 1AZGB 2FG0A 1AWOA 4R0KA 4WCIA 1NLPC 2JS0A 1GRIA 4KRTA 2YUPA 1G83A 2W0ZA 1JXMA 1X27A 1VA7A 4HVUA 2LP5A 1BBZA 2DE0X 1ZBJA 2DL3A 4LN2A 1NG2A 1H8KA 2DNUA 3VS2A 1GBQA 2PTKA 4JJBA 2ROLA 1GFCA 1UHFA 2BTTA 3VS5A 2OJ2A 1WXUA 2EPDA 2L3SA 3C0CA 2C0OA 1CSKA 2PZ1A 1ABOA 3M0PA 1OV3A 2FPDA 3I35A 2GBQA 2KXDA 4IIMA 1K4US 3JV3A 1PKSA 2DF6A 1E7OA 2YSQA 1ZUKA 4J9BA 4LUDA 2FPFA 3NPFA 2RQRA 4AFQC 2FO0A 5ECAA 3TVTA 3UATA 2C0IA 4AFZC 2K79A 2MIOA 1I07A 1RUWA 3EHQA 1X6GA 2LJ3A 3H0HA 1T3SA 2RMOA 2J6OA 4LE9A 1QKXA 1AD5A 1U5SA 2F2XA 1AEYA 5FWCA 1RI9A 2RQTA 2YT6A 4OMQA 1UG1A 1BU1A 3VS7A 4RTTA 1UDLA 4J9CA 1QCFA 1J3TA 4LUEA 1OOTA 2JTEA 1NYGA 1HJDA 1PKTA 1YWPA 2RQUA 4OMOA 2ESWA 1M27C 1T3LA 4J9IA 4CC7A 2LQNA 2CT4A 4DEYA 2RQVA 2BZ8A 3PVLA 1TG0A 3PE0A 3SHWA 2DRKA 1LCKA 4F14A 3EG1A 1Y0MA 1I0CA 3H0FA 2HCKA 1SPKA 3VS1A 2HSPA 1UECA 4QT7A 1ZLMA 2DX1A 2SRCA 1UJ0A 2KROA 3NMZC 4EIKA 3R6NA 2EYYA 1WIEA 2DA9A 2JMAA 2K6DA 2GTJA 3VRZA 2AZSA 4F16A 1ZX6A 4J9GA 2V1QA 1GCQC 2ROTA 4JJCA 2J05A 2JM9A 1FMKA 1W6XA 1B3QA 5IHIA 2X3XD 1GL5A 1BB9A 2CUBA 1PRMC 2LNHB 1T0HA 4CC4B 1AZEA 3A98A 2K2MA 2OAWA 2ENMA 2IIMA 4LNPA 1UTIA 2B86A 2DBMA 2VKNA 3VS3A 2MCNA 2DL5A 4J9EA 1AWWA 1M3BA 1U06A 3FJ5A 2ABLA 2M0YA 2GGRA 1JO8A 1JQQA 2G6FX 4K11A 4A63B 2YDLA 1M30A 1WXTA 1H92A 2JMCA 2K3BA 1TUCA 4JZ3A 2GTOA 2FEIA 4RTVA 1JEGA 1K9AA 2HBWA 1GCPA 2D8JA 1SRMA 5IHNA 2AK5A 2KRNA 4RTZA 3RNJA 1X6BA 1HD3A 1WLPB 2CSQA 2KT8A 1UGVA 2W10A 5GJWB 2KR3A 4X1VA 5GJVB 1H3HA 2D8HA 2K7AA 1K0SA 2LCSA 1Y57A 2J6FA 1UHCA 2KRSA 2O2OA 2XMFA 2DLPA 2GQIA 1XOVA 1S1NA 1T0JA 2GNCA 1X69A 3O5ZA 1QWFA 2AKKA 3M0QA 4ZNXA 1OEBA 2HDAA 4JZ4A 3M0TA 1QKWA 2KEAA 2O9VA 5I22A 2J7IA 3VRYA 2DVJA 4ORZA 3UA7A 3CQTA 2DL7A 2DMOA 2CH4A 1E6GA 2RNAA 2DBKA 1Z9ZA 1K76A 1MV3A 2RQWA 1UJYA 4RTYA 2LMJA 2L0AA 1CKAA 1GFDA 2L3QA 4GBQA 1VYUA 2ED0A 2DL8A 2LJ0A 1UE9A 2JS2A 1SSHA 3ZL7C 4Y92A 2JT4A 1KJWA 2E5KA 1OPLA 2O9SA 1YN8A
chains in the Genus database with same CATH superfamily
3DKMA 4HT8A 2KAFA 3M53A 2FZGB 3RESA 3ULRB 1K1ZA 2L3RA 2KGTA 1U3OA 4M78D 4JJNK 2E5QA 2EYQA 1EFNA 4AMCA 5FRMA 2EQKA 3C4SA 2DEUA 2JJ9A 4XU1A 2PVGB 1W2BP 3JCMV 2ZGWA 1IHWA 5GMKm 3OYKA 1NEGA 4CC3A 2X4WA 4OB0B 4OMPA 1WHHA 2RK1A 1KC8R 3M0SA 4PJOB 3CC4A 2DYBA 3OYYA 4OMMA 3SWNA 2COWA 1Q95G 2MYSA 3LYIA 2RHIA 1KHIA 2M9UA 2KYBA 4QVZA 3HFNA 3CCLQ 1BI3A 3MJXA 1WX6A 4C5EA 4IIOA 2A3LA 1KD1R 2FRWA 1VQOQ 2GCXA 4DEXA 3QYHB 1WYXA 3LGFA 2MWOA 3EG3A 4YTLA 2E3IA 2RI2A 2F2WA 2GFAA 4C0ZA 5GANj 3IQLA 4F17A 1Q7YR 2LCLA 2EW3A 5CIUA 4M4ZA 1RLQC 1NYFA 4CC2A 4J9FA 3CCEA 4C0FA 4C8QC 1QMCA 2EGAA 3INZA 3I5RA 3CD6T 4Z89A 1VQKQ 2M51A 1M2VB 2AZVA 4ATOA 1GCQA 3VV0A 3OYMA 2KT1A 3JCMP 2P4RA 5KCHA 3OS2A 3AT1B 4IUUA 2CSIA 3FDRA 1ZA2B 1KFZA 1NEBA 2CGHA 3EHRA 2QTXA 5IXFA 2OTLT 4HCKA 5KH6A 2RK2A 4M75B 1UUEA 1VQ7Q 1O9SA 2NWMA 3EH1A 5D6XA 3RBBB 2LX7A 1X75C 2K9GA 2MK5A 4PK4A 1VYVA 1TS9A 4FYVB 5CKDA 2EJ9A 5LJ3f 3FC3A 1RAAB 4JJDA 4P5NA 3PTAA 1ARKA 2RJDA 1WJQA 1W1FA 3ER0A 1UGRB 1VUBA 3V7SA 1RLPC 3OBYA 2L3PA 4J6XA 3NGPA 3JB9G 3UF4A 5CQXA 3C12A 2OI3A 2XD0A 1RAHB 3EG2A 4GLMA 3QPHA 2RD1A 2LJ1A 4BDZA 3V8LA 1MMGA 3EG0A 5GAMh 3MPUB 4M7AC 5GAOl 1FMVA 1KQSP 2I0NA 1M3CA 1WA7A 1IO6A 2QQBA 1LJOA 1E6HA 1KC8C 1VQ4Q 3UA6A 4A53A 2RJEA 2CP0A 1VQLQ 2P4TA 1XTDA 3OMGA 3REBB 2VVKA 4JDSA 2XDDA 3S3MA 1AWOA 1EX4A 1Y71A 1G8XA 1V29B 1M4ZA 2RJFA 1VQ7T 1WHGA 1G83A 1OQKA 4FYYB 2X35A 1W2BA 1W2BS 5D6YA 4LN2A 3EGXA 3ZEHA 1Y07A 5GAMd 2PQWA 4MZPA 4FU6A 1UHFA 5GMKh 1MNEA 3WVDB 2C0OA 2PUKB 4J8OA 5DY9A 5KE3A 1VQOA 1PD1A 2DIQA 3X25B 1IB8A 1PKSA 4M75F 1TOVA 1E7OA 2YSQA 1ZUKA 3G6EA 2K3XA 2DJZA 4AFQC 2VASA 3UWNA 5ECAA 4FIBA 2C0IA 3KUFA 2AIRB 4AFZC 4OB2B 2E6NA 5C6SA 3QSUA 4M7DG 2E1HA 5EG2A 2E64A 3VYGA 3HHTB 1AD5A 1TUGB 5D6WA 3LW5E 2F2XA 1FMWA 3L2UA 5IT9E 1YI2A 1UG1A 1NJIU 5GAOp 5HK0A 3QJ6A 5AT1B 3CD6Q 1J3TA 3Q1JA 2XICA 4C92B 1WHLA 1NYGA 1VQ9T 2C06A 4MMLA 1BI1A 3CMAA 1YITT 3JB9F 5C0MA 4N4IA 2ESWA 1M27C 1MMAA 4M77E 2DETA 2LQNA 3CMAQ 1M2VA 2VV5A 1VOMA 1QCOA 2DKGA 1RL2A 2ZPIB 4F14A 1WJSA 4J6YA 4JRIA 1YJWT 3AHUA 1I0CA 3H0FA 3OYDA 3OMCA 1I81A 1SPKA 1UECA 5FLXE 2DX1A 3L2QA 3RDVA 1UJ0A 4C8QG 3CXCP 2BE7D 1SF9A 3LWIA 2DFUA 3R6NA 1M1KR 1K8AU 3CCUT 2DA9A 2JMAA 1VQKA 2CP7A 2QEXT 1VQPT 4V2SA 1YJNT 3META 4M77F 3M55A 4B9WA 1GCQC 4FT2A 3RKWA 3OYLA 2ZPBB 4II1A 1N27A 1GL5A 2E6ZA 1Q82U 4JLIA 1T0HA 3JCMd 1AZEA 1IZ6A 4FYXB 2DK3A 4LNPA 2DBMA 3VS3A 1YIJA 2MCNA 2DL5A 1KQSS 4B9XA 1M3BA 3EG9B 4VUBA 1VQNQ 3BY7A 2GGRA 3MKDA 1MNDA 4PJOF 2D0QB 3PFSA 4E7KA 2K3BA 1Q7YC 1UGQB 3EFRA 2GTOA 4DA4A 1K9AA 2HBWA 1GCPA 4UC4A 4F04B 2I2LA 3HKSA 2AK5A 4OP0A 5KYXA 1KG1A 4RTZA 1Y7XA 1X6BA 5AYFA 3CMAT 1M90R 1OU8A 3A1PA 2KT8A 5LJ3d 2KR3A 5GJVB 1X6OA 3I56A 1VQ5Q 3DB4A 2WACA 4Q5WA 4LDXA 3CC2T 2KRSA 5LJ5d 4PFOA 1T0JA 1X69A 8AT1B 1QWFA 2AKKA 4ZGJB 1YHQA 3QXEB 3JCMX 1QVGA 4WTOB 3J80E 1N9RA 3M0TA 2G3RA 4M78C 1Q7YU 2J7IA 3MEVA 4ORZA 3UA7A 2DMOA 3SB2A 4DBQA 2RHZA 1E6GA 2RNAA 1Z9ZA 4KH0B 1YI2Q 1YITQ 4EPCA 1UJYA 4RTYA 3DLMA 2LMJA 2NUPB 1QW1A 4PJLA 2E4HA 1LPLA 2LJ0A 3DB3A 5CCAA 3ZL7C 1PSEA 1WJRA 4QQGA 4LDWA 5CKBA 1OPLA 2O9SA 3M0PA 3LH5A 3HTRA 2MWPA 1WHKA 2YUOA 5LJ5h 3M58A 3X28B 4EMKB 2DILA 1QWEA 3KBGA 1N8RC 4DBFA 2HMAA 3M4GA 2IPOB 2YUQA 4JLGA 4J9HA 2HSEB 3CCSA 4BE2A 2JXBA 2D9TA 4XTUA 1RAGB 3JCMh 5M9OA 4L6V5 3RMSA 4M77G 1M8MA 3EGDA 2V8IA 3MCAB 2O4XA 2J6KA 4A54A 3CC2Q 4E6RA 1MV0B 1KQ1A 1VYTA 1YJ9T 1X2KA 3CPWA 3FLGA 4M77D 4AG2C 5GAN5 1M3AA 5CR2A 4C5IA 3EG9A 2R57A 2V1RA 1OPKA 2DL4A 3OQ5A 1SEMA 2EGCA 1AHJB 3OYCA 1ZUUA 2CREA 4FT4A 3THKA 1VQKT 1VQLT 3VJPA 2KRMA 2ECZA 1RAIB 4HVVA 3CCUQ 2DTOA 3G4SQ 3OW2P 1TUDA 2RF0A 1KSWA 1PRLC 1I1JA 2RHXA 4Z88A 4QKUA 4E7HA 4FW1A 5FW9A 1JJ2S 2KBTA 1WXBA 4KBMB 3CC4Q 1G3SA 4CRIA 2RA2A 2DRMA 4D8KA 1VQPQ 1IHVA 4KGVB 3A8MB 2F2VA 1YJWA 4QQDA 3M59A 3QWXX 2DXBA 2RH2A 1Q86C 1FXXA 2EKHA 3NHNA 5IH2A 4IUVA 1UGPB 2OX7A 1VQMQ 5LJ3g 2NYSA 3UPUA 4XTWA 4M75G 1KHCA 4XTVA 2ZPEB 3I5SA 3CCVQ 1VQPA 3CC7A 1V1CA 1PM3A 2YWWA 1M1GA 4RTUA 1X2QA 1W4SA 5HCKA 1KIKA 1HSQA 1B7TA 1AWXA 3H6ZA 2ZPHB 5GAN8 4ZGEB 6AT1B 4JPBW 4C92F 2EQIA 2O88A 1YNZA 4N4GA 2YRCA 1YIJT 1HYOA 2CUDA 1RAEB 4ZGDB 4C92D 4EMGA 2XHCA 1S72A 1M90C 5KYXB 2EYWA 4LDUA 3TU4K 1KQ2A 2K57A 2A08A 1K8AC 1EIFA 3PVQA 2EVRA 5I11A 3CC4T 3OYEA 2K5LA 3CCLA 1VQNA 3P8BB 3U23A 3CC2A 2FHDA 4PJOG 5LJ5g 2WSCE 1N5ZA 2E65A 1JRIA 4D8DA 3L2ZA 5HKCA 2CZ7B 3L42A 4J83A 1NLPC 1GRIA 1RADB 4OF1A 3RUXA 3M56A 2HQHA 5FU7C 1OYXA 1X27A 4HVUA 2M02A 3CCJA 4C0GA 1H8KA 2DNUA 4J6WA 2RM4A 1D1BA 1GBQA 3SDZA 1K8AR 3CCMT 5J26A 2A0FB 2DZCA 2DD5A 2EPDA 2PZ1A 1PD0A 1OV3A 1IXDA 1D0XA 3OYBA 2GBQA 1G5VA 3CEYA 1K9MR 2XG8D 4J9BA 4R56A 1WNLA 4X9CA 2A7YA 3M4YA 3UATA 1KC8U 4KUIA 1DJ7B 4FCYA 2R5MA 2K79A 2MIOA 4EMKA 1HXDA 2HL3A 3EFOA 4M7DA 2LJ3A 2LRQA 3URGA 2RMOA 1YITA 1OU9A 2J6OA 2B8AA 1YHQQ 4M75E 4OMQA 2YXYA 1FX7A 1BU1A 4E7ZA 2COZA 4RTTA 2JTFA 4J9CA 2XDBA 4LUEA 4F7UF 4XQ3A 1HJDA 3M5AA 4E2FB 2AT1B 1MMNA 2VB6A 1YWPA 2RQUA 1NJIR 2RI3A 4M78F 5I21A 2CT4A 3OS1A 1MGQA 2X4XA 4DEYA 3G6EQ 5GMKi 3PVLA 3PE0A 3CCQT 2AHJB 3PT9A 1Y0MA 4JRPA 2EQMA 3L2RA 1KQSA 4PJOD 3CCJT 2HCKA 3CPFA 3UT1A 4M78A 4RG8A 4QT7A 4BY6B 1LVKA 2ZAEA 2FYKA 2KROA 1WZOA 4C8QA 1WIEA 3G1JA 4PJNA 3MP8A 5FROA 2Y4XA 1VQ6Q 2EJGA 4PFZA 4M78E 3CMEA 4F16A 4KULA 1Q81U 1YJ9Q 2NLUA 1FMKA 1W6XA 2X3XD 3GF5A 2E41A 1GXIE 4BUGA 1BB9A 2HKQB 3TCJA 2CUBA 2KK4A 4J5YA 3JAME 5DLOA 2K2MA 4RMOA 3G71A 3GLXA 4OB3B 3CCMQ 1U06A 2PVOB 1S72Q 4M77B 3BDUA 2CP3A 4N0AC 4K11A 2G6FX 3OB9A 4B6MA 3HPWA 3OBWA 1QP3A 3A5ZB 1YCYA 2COYA 2RJCA 4N0AA 2MMPA 4JZ3A 3FJPA 2O4XB 1Q81C 1JEGA 1PCXA 1I8FA 3NTIA 5A0LA 1SRMA 1WQ7A 2RHUA 1RACB 2V26A 2DZ9A 2YRDA 1UGVA 2W10A 3QDRB 3CPWS 5CK9A 1M1KU 3JCMe 2D8HA 2K7AA 1K0SA 2LCSA 4J7FA 1ZHIA 2QQRA 2O2OA 2XMFA 8ATCB 1Y96B 4M7AA 3CXCA 5I22A 2RO0A 1VQ8A 1QVGS 4BI3A 2R58A 3CQTA 2CH4A 1EZZB 3OA6A 2LC4A 5KCOA 2NUPA 2DBKA 1QQJA 1MV3A 1JB0E 4ZTFA 3CCLT 2XKOC 4RCCA 1TU0B 1CKAA 2MPXC 1KD1C 1M1KC 5HK3A 3CMEQ 4L5GA 5GMKj 4DBRA 4O5VA 2JT4A 2QYZA 1KJWA 5GAOr 2E5KA 4KGXB 5FWBA 2P0KA 4MMKA 4LDYA 1QVFA 1M9SA 4FSSA 5KYWA 1M90U 1YJ9A 1JXOA 2AKLA 1X43A 4AFUC 1JJ2P 2A36A 3VS4A 1TXQA 5GANd 2P0QA 4BE0A 3VS6A 1ACMB 2L8DA 1CKBA 3OYNA 3BW1A 2EWNA 3R6OA 4OVAA 2D6FA 4AG1C 2QA4A 4XTXA 2L5QA 2K4YA 2CDTA 2PUOB 2OTLQ 1NM7A 2CP5A 1FYNA 2CZ0B 1Q86U 1MUZA 2O01E 3G6ET 4A4HA 2LX9A 3NTHA 1VQ4A 1TSFA 1YCSB 2EGEA 1LOJA 2QQAA 5IHKA 3A8LB 5I2MA 3ASKA 4OMNA 2JZ2A 1TH7A 2VYTA 2F69A 2YLCA 9ATCB 4DOVA 4M75C 1XJWB 2IG0A 2ZPFB 1SRLA 1QLYA 3EGDB 2O31A 5KE2A 2OAUA 2MI6A 3CCVA 2KVQG 4M75D 3TSZA 2QDYB 4XK8E 2ZZDA 3LLRA 4ELYC 3JCMQ 1D0YA 2C0TA 1WFWA 4HCCA 2X3WD 4GY5A 1WPYA 1K73C 3EH2A 3HRTA 2F5TX 3I9QA 1UGSB 1M5Q1 2CT3A 2CS7A 1ZSZC 3MEWA 1ZQ1A 2QG9B 2BZYA 3FEOA 1B07A 1IREB 1WHMA 1AWJA 2A28A 2J06A 1SHGA 4KUDK 1BI0A 2LDMA 1BCMA 1BCOA 1NPPA 2VGMA 2D1XA 4OMLA 2HL5C 4HA8A 1WHJA 3D7SB 2Y90A 4C92C 2QGGA 2KXCA 4Z8AA 3CCUA 1SKUB 2L2PA 5L8RE 3VUBA 1PSFA 2DERA 1K73U 1YFNA 2DPPB 2ED1A 5LJ3h 3QHSA 4M7DE 3M54A 4A4FA 1D09B 2ZPGB 5DLQE 4PJOC 1YJNQ 4MZMA 4TVRA 3SWNB 1NLOC 3V8JA 4XTYA 4RUGA 4BD3A 4MDWA 5LJ5f 2MOXA 4NS5A 4DQ2A 5GAMf 2EQUA 2EFIA 2OTJT 1WDXA 1YWOA 2KYMA 4N4HA 4HCBA 2RPNA 3VUZA 2KE9A 3CCQQ 1D3BB 3SD4A 2VWFA 2QEXQ 3M57A 1R0CB 4M7DF 4FW2A 3JCMg 1N6AA 1IRXA 2RI5A 3I55Q 3J81E 4C92E 2LNVA 1TTHB 3T9NA 1BK2A 5I2SA 3A8OB 4C92G 2H3EB 5LJ5e 3CBMA 1B34A 4QQ6A 1VQ8Q 5CQYA 3H41A 4XU0A 3CCSQ 2QDLA 1VIEA 3S6WA 5KYYB 2MAMA 4QVDA 3QUIA 2EKOA 1AZGB 2FG0A 4JRKA 2DD4A 1KK7A 3JB9J 5GANe 4KRTA 5A0DA 3CXCS 2YUPA 1VQMA 3QJYA 2NUTA 4CI0C 1BI2A 1JXMA 1UEBA 2JN0A 5CKFA 1Q81R 3QZ9B 5GAN7 1BBZA 1NPRA 4ZTJA 2DL3A 1ZBJA 2M1HA 3GNFB 1NG2A 1QVFS 1VQ9A 3VS2A 3PIPA 3VKIA 2OJ2A 1WXUA 1PG5B 1VQ7A 3C0CA 3CD6A 1ABOA 3MO8A 1NJIC 2FPDA 4M7AB 2M0OA 1R8OB 2HKNA 2KXDA 4IIMA 5GANf 3JV3A 2CP2A 4LUDA 2M16A 4WF2A 2FPFA 5A0GA 2CKKA 3OY9A 3VYHB 2RQRA 2FO0A 1JBMA 4M7AD 2LQ8A 3BDLA 4JRQA 1G3TA 5KYUA 4A4KA 3I56Q 1ZSZA 2E70A 1X6GA 1H641 3H0HA 2EAYA 1OI1A 3FB9A 4OB1B 3SWNC 4LE9A 1QKXA 4AT1B 2XIDA 3PGGA 2XK0A 4M77C 5GAMj 4C0DB 1RI9A 3E2UA 3OYJA 3VS7A 1C0MA 3S3OA 2EJFA 4M77A 3CCQA 4C8QD 1OOTA 3OYIA 2JTEA 3MHXA 1BIAA 4KGZB 4C92A 3EGXB 1M2OA 2PU9B 1R77A 3HRSA 3L1AA 4OMOA 3UDCA 4R55A 4FM4B 4J9IA 2CYZB 4NOYA 3E1SA 3GOXA 3LWHA 1Y96A 2BZ8A 3SHWA 1UB4A 2DRKA 3CPWP 1LCKA 1VQLA 3OYGA 3EG1A 5GAN6 5J39A 3V7RA 4C5GA 1ZSZB 3VS1A 4C8QB 3FIFA 4Z02A 2SRCA 3ZBDA 1VQ8T 3GIBA 4F7UE 4NL2A 1HK9A 4EIKA 2LQKA 3JCMW 4LXCA 3OSSC 4XTZA 1OULA 2GTJA 4JS4A 2AZSA 4E7JA 1ZX6A 3MP1A 4J9GA 1PC0A 2J05A 2JM9A 2DXCA 1B3QA 1SSFA 3EFSA 1PRMC 2LNHB 3GNGA 4CC4B 2DXTA 5GMKl 4ANJA 4M7DD 3A8GB 3CC7Q 2OAWA 4OGEA 1UTIA 2B86A 4E7LA 1AWWA 1QVGP 1FWZA 1QP2A 1YJWQ 2FZCB 3I55T 2NUTB 4OMFB 2YDLA 4F7UA 1H92A 2X9HA 1K73R 1TUCA 4F7UG 2KSSA 4RTVA 3KXTA 2E3HA 4O6JA 5IHNA 3CCVT 1XQHA 3RNJA 2DEQA 1HD3A 1WLPB 5GJWB 1B34B 1H3HA 2QA4Q 4GLKA 4ZN1A 3E19A 4M7AE 1Y57A 1WQWA 1UHCA 4HKEA 2DLPA 3CMET 1XOVA 1S1NA 1VQ4T 2QI2A 4BACA 3O5ZA 3M0QA 3C94A 3JCMc 4E7SA 2JNGA 1QKWA 2YHTA 1BYMA 2O9VA 3VRYA 2DVJA 2DL7A 3F70A 1G3WA 4BI8B 1OX8A 1VIFA 1K76A 1D0ZA 2RQWA 3JB9H 3P8HA 1IGUA 1TWBA 3CBOA 4M7AF 2L0AA 1U1TA 1I5OB 1GFDA 3CC7T 4GBQA 5GAN3 1VYUA 3CCRA 1M1FA 2ED0A 4XU2A 2QTVA 2JS2A 5DM7R 4Y92A 3V7CA 2GF7A 5D7UA 3OS0A 3QDFA 1YN8A 3REAB 2FRYA 4PKCC 2JUFA 5CAIA 3TREA 4PLLA 5KYUB 3EGUA 3ZFJA 2LQWA 3QYGB 5GAMe 5GANg 4XU3A 3NFCA 3G4ST 1G3YA 1Q86R 5J3BA 2Y4YA 2EIFA 1PNJA 2A37A 4C8QE 3J7AF 1UFFA 4F7UB 1VQOT 3GP8A 2WSEE 3MEAA 3LGLA 3OW2A 3OS5A 4D6WA 3E9FA 4X9DA 4ZN3A 4FSXA 2DM1A 5GAOm 1MHNA 3BFMA 3G71T 1QCNA 2DYIA 1H3ZA 1WI7A 1JU5C 4QVCA 3C95A 5FU6B 2VGNA 3HP9A 4RKUE 1GBRA 2D0NA 1KD1U 2KDSA 3HSBA 1PHTA 2IVWA 3PMIA 4LDVA 4RTWA 1K0XA 2JW4A 2JM8A 3N5BB 2XI9A 4C8QF 1ZUYA 2HZYA 2KNBB 4HVWA 1BKBA 2HEQA 5LJ3j 4M78G 1MMDA 3LX7A 4HXJA 3KFVA 2BKDN 3RR6A 1C1AA 1X01A 2K5IA 2FVUA 3I56T 3JCMf 3QO3A 2VUBA 1AOJA 2FL7A 1G2BA 3CCMA 2QEXA 2PNIA 1S72T 5IAYA 5KYNA 4J9DA 2EYXA 2JVVA 4BY6C 3GBQA 3G71Q 3WVEB 3PIOA 3M0RA 2HAXA 4X34A 1YIJQ 2RB6A 2DJQA 2KMTA 5EC7A 1PWTA 1N8RU 2QAZA 3NTKA 3BE3A 2QQSA 3X26B 1VQ5T 2RN8A 3VS0A 3TQ7P 2YUNA 2OTJQ 2H8HA 1W70A 3CCET 2EBPA 3M9QA 2K2VA 3TEEA 2YLBA 5A2QE 1M8VA 3PMTA 2LZ6B 1U1SA 5CVIA 2QK0A 5L23A 2CH4W 2BUDA 4AFSC 3SEMA 2FPEA 2DVEA 4FYWB 4NL3A 3DLLA 3JCMJ 4RTXA 4JUVA 2SEMA 4IURA 5FU6C 3M0UA 5IXBA 1YI2T 5GAOq 2NUZA 1Z9QA 1O75A 1RI0A 2GFUA 2L89A 5LL6S 3TSWA 3EAEA 4IUTA 3CCST 2LT4A 1K9MC 2CZ6B 1ZSGA 4BB7A 4J7IA 1A0NB 5FRNA 2FB7A 2LVMA 1C6VX 3OYFA 2CP6A 4Y91A 4IKFA 5LJ5j 4L59A 2EYZA 1YP5A 2VXFA 1NZ9A 1AVZC 1RABB 2V8KA 4XAXB 2BZXA 4ESRA 3WXMB 3H0IA 3QWYA 1OZ2A 1SHFA 2QXFA 2KI7A 1YBYA 2DTHA 3HL8A 3JB9D 2XDPA 3X24B 5CKEA 5GMKe 2KY9A 4FL6A 4LD6A 1ABQA 5KYWB 4JS5A 4E7IA 4QW2A 1JJ2A 4PNOA 2K3YA 4R0KA 4WCIA 1AT1B 2EQJA 4M7DC 2JS0A 5FU7B 3MEUA 1VQ5A 1I4K1 2P84A 3QBYA 5GANh 5KYYA 2W0ZA 3EFOB 4M7DB 1VA7A 2OTLA 4RCBA 2QA4T 2LP5A 2K5FA 2DE0X 3RIRA 4M78B 2PTKA 4JJBA 1Q82R 2ROLA 1GFCA 2BTTA 3CCJQ 3I55A 3VS5A 2HD0A 1LNXA 3L2VA 2YRVA 2L3SA 1OZ3A 3L2WA 1CSKA 3I35A 7AT1B 2DAQA 1K4US 1VQ6A 1ZA1B 1U8RA 1D1CA 3GPLA 2DF6A 2WSFE 3CCRQ 5CO7A 1P92A 3NPFA 3QG1A 3JRZA 4PL6A 2BE9B 3TVTA 2HNIA 3CCEQ 2FZKB 3OW2S 3JSCA 4M7AG 1I07A 1RUWA 3PNWC 3EHQA 1N8RR 1YJNA 4MZTA 2X51A 1T3SA 1OX9A 2F5KA 1U5SA 1YHQT 2BIVA 4A4EA 1BIBA 4IUPA 1AEYA 3OSVA 1QVFP 5FWCA 5LJ3e 2RQTA 2YT6A 4Y28E 1UDLA 2Z0WA 1V76A 4RG2A 1QCFA 5CKHA 4PLIA 2R5AA 3LH0A 4BI4A 4PJOA 4DBHA 1PKTA 2KQWA 3QKJA 3V8KA 2QGFB 3MP6A 4MDXA 2QASA 2MF2A 1T3LA 4CC7A 4C5HA 2X4JA 3OYAA 5GAOn 2ZCFB 3S3NA 2RQVA 4BDYA 1D1AA 3OYHA 4EDUA 1TG0A 4BE1A 2LTOA 5HY6A 3H9NA 4KT0E 2HSPA 1ZLMA 1R0BG 2VXEA 3NMZC 1VQNT 2X4YA 2DXUA 3H8ZA 2EYYA 3RKXA 5GAMg 1VQ9Q 2K6DA 2DO3A 2HBPA 3VRZA 4PJOE 1VQ6T 2V1QA 2CZ1B 2ROTA 4JJCA 5IHIA 1XNIA 3A8HB 3RERA 3QIIA 3X20B 1IGQA 3A98A 2V8JA 2E12A 2ENMA 1SG5A 2IIMA 2VKNA 3E9GA 1I5LA 2HQEA 4PFPA 4J9EA 4C0DC 3FJ5A 2ABLA 2M0YA 4E47A 3O8VA 1Q82C 1NBEB 4ME7A 5GAN2 4A63B 1JO8A 1JQQA 3QZ5B 4LD9K 3G7ZA 2JTMA 1M30A 1WXTA 2JMCA 3HFOA 4PJMA 3G4SA 1D3BA 2FEIA 1NE8A 2D8JA 2HQXA 1ZBXA 2KRNA 1F1BB 1QVPA 1WGSA 3RMQA 2LCCA 1VQMT 2CSQA 4X1VA 4DOWA 3VU3C 2F1LA 3HRUA 1K9MU 2J6FA 4ELZC 2PVDB 2GQIA 2GNCA 2OTJA 3JCMb 3ME9A 4EMKC 4ZNXA 1OEBA 2ATCB 2HDAA 4JZ4A 2QQ9A 3CCRT 2KEAA 1RAFB 4M75A 2DIGA 4A4GA 2JOYA 2H3JA 2RHYA 4OGCA 2E10A 4PJJA 3P8DA 3SFMA 2DTIA 4HT9A 4EMHA 4IUQA 5IN1A 3RKYA 2XU8A 2L3QA 2VC8A 3JB9I 2DL8A 2GQVA 1UE9A 4HCZA 3CBPA 5GAN4 1SSHA 4KH1B 2LT1A 1N9SA 3FRNA 2P0PA
chains in the Genus database with same CATH topology
3LH5A 5FWBA 3REAB 2FRYA 2YUOA 4FSSA 2DILA 1QWEA 1JXOA 2AKLA 2YUQA 3ULRB 1X43A 4AFUC 3EGUA 1K1ZA 2A36A 2LQWA 4J9HA 3VS4A 2KGTA 2JXBA 1U3OA 1M8MA 1EFNA 3VS6A 1CKBA 1PNJA 2A37A 2J6KA 1UFFA 4E6RA 1MV0B 1VYTA 4AG1C 1NEGA 1X2KA 2CDTA 4CC3A 4OMPA 1NM7A 4AG2C 2DM1A 1M3AA 1FYNA 1MUZA 2V1RA 3M0SA 2DYBA 1WI7A 1OPKA 1JU5C 2DL4A 1SEMA 2EGCA 4OMMA 1YCSB 2EGEA 1GBRA 2D0NA 1ZUUA 5IHKA 2CREA 1PHTA 3THKA 4RTWA 4OMNA 1K0XA 2KRMA 2JW4A 2JM8A 2ECZA 1ZUYA 2KYBA 4HVVA 2KNBB 1SRLA 1QLYA 4HVWA 2O31A 1WX6A 4IIOA 2FRWA 4DEXA 1WYXA 3TSZA 2HEQA 1TUDA 4HXJA 2RF0A 3KFVA 1KSWA 3EG3A 1PRLC 1I1JA 2C0TA 2F2WA 1WFWA 4Z88A 2X3WD 1AOJA 3IQLA 4F17A 1G2BA 2EW3A 2PNIA 4M4ZA 5FW9A 1NYFA 1RLQC 4J9DA 3I9QA 4CC2A 2EYXA 4J9FA 3GBQA 2CT3A 2KBTA 2EGAA 1WXBA 3I5RA 2BZYA 4Z89A 3M0RA 2M51A 2DRMA 4D8KA 1B07A 2AZVA 2DJQA 1GCQA 5EC7A 2KT1A 2F2VA 1PWTA 1AWJA 2A28A 2J06A 1SHGA 2P4RA 3QWXX 2CSIA 2RN8A 3VS0A 1KFZA 2YUNA 2EKHA 3NHNA 1NEBA 5IH2A 2D1XA 4OMLA 2H8HA 3EHRA 1W70A 2EBPA 5IXFA 4HCKA 3I5SA 1UUEA 1V1CA 2NWMA 2LZ6B 2KXCA 4Z8AA 2LX7A 3RBBB 2L2PA 5L23A 2K9GA 2CH4W 4AFSC 4RTUA 1X2QA 5HCKA 2FPEA 3SEMA 1KIKA 1HSQA 1VYVA 2ED1A 4RTXA 2SEMA 3M0UA 1AWXA 5IXBA 4JJDA 2NUZA 4JPBW 1ARKA 1Z9QA 1NLOC 4RUGA 2EQIA 2O88A 1W1FA 1YNZA 3TSWA 2MOXA 2CUDA 1RLPC 2L3PA 1ZSGA 1WDXA 1YWOA 3NGPA 2KYMA 3UF4A 2OI3A 1A0NB 3EG2A 4GLMA 2RPNA 2KE9A 2VWFA 2LJ1A 2EYWA 2EYZA 1YP5A 3EG0A 1AVZC 2BZXA 2A08A 4ESRA 3PVQA 3H0IA 3QWYA 2I0NA 1SHFA 1BK2A 1M3CA 1WA7A 1IO6A 1E6HA 2EVRA 5I11A 3UA6A 3H41A 1ABQA 2QDLA 3U23A 3REBB 2VVKA 1N5ZA 4D8DA 1AZGB 2FG0A 1AWOA 4R0KA 4WCIA 1NLPC 2JS0A 1GRIA 4KRTA 2YUPA 1G83A 2W0ZA 1JXMA 1X27A 1VA7A 4HVUA 2LP5A 1BBZA 2DE0X 1ZBJA 2DL3A 4LN2A 1NG2A 1H8KA 2DNUA 3VS2A 1GBQA 2PTKA 4JJBA 2ROLA 1GFCA 1UHFA 2BTTA 3VS5A 2OJ2A 1WXUA 2EPDA 2L3SA 3C0CA 2C0OA 1CSKA 2PZ1A 1ABOA 3M0PA 1OV3A 2FPDA 3I35A 2GBQA 2KXDA 4IIMA 1K4US 3JV3A 1PKSA 2DF6A 1E7OA 2YSQA 1ZUKA 4J9BA 4LUDA 2FPFA 3NPFA 2RQRA 4AFQC 2FO0A 5ECAA 3TVTA 3UATA 2C0IA 4AFZC 2K79A 2MIOA 1I07A 1RUWA 3EHQA 1X6GA 2LJ3A 3H0HA 1T3SA 2RMOA 2J6OA 4LE9A 1QKXA 1AD5A 1U5SA 2F2XA 1AEYA 5FWCA 1RI9A 2RQTA 2YT6A 4OMQA 1UG1A 1BU1A 3VS7A 4RTTA 1UDLA 4J9CA 1QCFA 1J3TA 4LUEA 1OOTA 2JTEA 1NYGA 1HJDA 1PKTA 1YWPA 2RQUA 4OMOA 2ESWA 1M27C 1T3LA 4J9IA 4CC7A 2LQNA 2CT4A 4DEYA 2RQVA 2BZ8A 3PVLA 1TG0A 3PE0A 3SHWA 2DRKA 1LCKA 4F14A 3EG1A 1Y0MA 1I0CA 3H0FA 2HCKA 1SPKA 3VS1A 2HSPA 1UECA 4QT7A 1ZLMA 2DX1A 2SRCA 1UJ0A 2KROA 3NMZC 4EIKA 3R6NA 2EYYA 1WIEA 2DA9A 2JMAA 2K6DA 2GTJA 3VRZA 2AZSA 4F16A 1ZX6A 4J9GA 2V1QA 1GCQC 2ROTA 4JJCA 2J05A 2JM9A 1FMKA 1W6XA 1B3QA 5IHIA 2X3XD 1GL5A 1BB9A 2CUBA 1PRMC 2LNHB 1T0HA 4CC4B 1AZEA 3A98A 2K2MA 2OAWA 2ENMA 2IIMA 4LNPA 1UTIA 2B86A 2DBMA 2VKNA 3VS3A 2MCNA 2DL5A 4J9EA 1AWWA 1M3BA 1U06A 3FJ5A 2ABLA 2M0YA 2GGRA 1JO8A 1JQQA 2G6FX 4K11A 4A63B 2YDLA 1M30A 1WXTA 1H92A 2JMCA 2K3BA 1TUCA 4JZ3A 2GTOA 2FEIA 4RTVA 1JEGA 1K9AA 2HBWA 1GCPA 2D8JA 1SRMA 5IHNA 2AK5A 2KRNA 4RTZA 3RNJA 1X6BA 1HD3A 1WLPB 2CSQA 2KT8A 1UGVA 2W10A 5GJWB 2KR3A 4X1VA 5GJVB 1H3HA 2D8HA 2K7AA 1K0SA 2LCSA 1Y57A 2J6FA 1UHCA 2KRSA 2O2OA 2XMFA 2DLPA 2GQIA 1XOVA 1S1NA 1T0JA 2GNCA 1X69A 3O5ZA 1QWFA 2AKKA 3M0QA 4ZNXA 1OEBA 2HDAA 4JZ4A 3M0TA 1QKWA 2KEAA 2O9VA 5I22A 2J7IA 3VRYA 2DVJA 4ORZA 3UA7A 3CQTA 2DL7A 2DMOA 2CH4A 1E6GA 2RNAA 2DBKA 1Z9ZA 1K76A 1MV3A 2RQWA 1UJYA 4RTYA 2LMJA 2L0AA 1CKAA 1GFDA 2L3QA 4GBQA 1VYUA 2ED0A 2DL8A 2LJ0A 1UE9A 2JS2A 1SSHA 3ZL7C 4Y92A 2JT4A 1KJWA 2E5KA 1OPLA 2O9SA 1YN8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LH5 A;  5FWB A;  3REA B;  2FRY A;  2YUO A;  4FSS A;  2DIL A;  1QWE A;  1JXO A;  2AKL A;  2YUQ A;  3ULR B;  1X43 A;  4AFU C;  3EGU A;  1K1Z A;  2A36 A;  2LQW A;  4J9H A;  3VS4 A;  2KGT A;  2JXB A;  1U3O A;  1M8M A;  1EFN A;  3VS6 A;  1CKB A;  1PNJ A;  2A37 A;  2J6K A;  1UFF A;  4E6R A;  1MV0 B;  1VYT A;  4AG1 C;  1NEG A;  1X2K A;  2CDT A;  4CC3 A;  4OMP A;  1NM7 A;  4AG2 C;  2DM1 A;  1M3A A;  1FYN A;  1MUZ A;  2V1R A;  3M0S A;  2DYB A;  1WI7 A;  1OPK A;  1JU5 C;  2DL4 A;  1SEM A;  2EGC A;  4OMM A;  1YCS B;  2EGE A;  1GBR A;  2D0N A;  1ZUU A;  5IHK A;  2CRE A;  1PHT A;  3THK A;  4RTW A;  4OMN A;  1K0X A;  2KRM A;  2JW4 A;  2JM8 A;  2ECZ A;  1ZUY A;  2KYB A;  4HVV A;  2KNB B;  1SRL A;  1QLY A;  4HVW A;  2O31 A;  1WX6 A;  4IIO A;  2FRW A;  4DEX A;  1WYX A;  3TSZ A;  2HEQ A;  1TUD A;  4HXJ A;  2RF0 A;  3KFV A;  1KSW A;  3EG3 A;  1PRL C;  1I1J A;  2C0T A;  2F2W A;  1WFW A;  4Z88 A;  2X3W D;  1AOJ A;  3IQL A;  4F17 A;  1G2B A;  2EW3 A;  2PNI A;  4M4Z A;  5FW9 A;  1NYF A;  1RLQ C;  4J9D A;  3I9Q A;  4CC2 A;  2EYX A;  4J9F A;  3GBQ A;  2CT3 A;  2KBT A;  2EGA A;  1WXB A;  3I5R A;  2BZY A;  4Z89 A;  3M0R A;  2M51 A;  2DRM A;  4D8K A;  1B07 A;  2AZV A;  2DJQ A;  1GCQ A;  5EC7 A;  2KT1 A;  2F2V A;  1PWT A;  1AWJ A;  2A28 A;  2J06 A;  1SHG A;  2P4R A;  3QWX X;  2CSI A;  2RN8 A;  3VS0 A;  1KFZ A;  2YUN A;  2EKH A;  3NHN A;  1NEB A;  5IH2 A;  2D1X A;  4OML A;  2H8H A;  3EHR A;  1W70 A;  2EBP A;  5IXF A;  4HCK A;  3I5S A;  1UUE A;  1V1C A;  2NWM A;  2LZ6 B;  2KXC A;  4Z8A A;  2LX7 A;  3RBB B;  2L2P A;  5L23 A;  2K9G A;  2CH4 W;  4AFS C;  4RTU A;  1X2Q A;  5HCK A;  2FPE A;  3SEM A;  1KIK A;  1HSQ A;  1VYV A;  2ED1 A;  4RTX A;  2SEM A;  3M0U A;  1AWX A;  5IXB A;  4JJD A;  2NUZ A;  4JPB W;  1ARK A;  1Z9Q A;  1NLO C;  4RUG A;  2EQI A;  2O88 A;  1W1F A;  1YNZ A;  3TSW A;  2MOX A;  2CUD A;  1RLP C;  2L3P A;  1ZSG A;  1WDX A;  1YWO A;  3NGP A;  2KYM A;  3UF4 A;  2OI3 A;  1A0N B;  3EG2 A;  4GLM A;  2RPN A;  2KE9 A;  2VWF A;  2LJ1 A;  2EYW A;  2EYZ A;  1YP5 A;  3EG0 A;  1AVZ C;  2BZX A;  2A08 A;  4ESR A;  3PVQ A;  3H0I A;  3QWY A;  2I0N A;  1SHF A;  1BK2 A;  1M3C A;  1WA7 A;  1IO6 A;  1E6H A;  2EVR A;  5I11 A;  3UA6 A;  3H41 A;  1ABQ A;  2QDL A;  3U23 A;  3REB B;  2VVK A;  1N5Z A;  4D8D A;  1AZG B;  2FG0 A;  1AWO A;  4R0K A;  4WCI A;  1NLP C;  2JS0 A;  1GRI A;  4KRT A;  2YUP A;  1G83 A;  2W0Z A;  1JXM A;  1X27 A;  1VA7 A;  4HVU A;  2LP5 A;  1BBZ A;  2DE0 X;  1ZBJ A;  2DL3 A;  4LN2 A;  1NG2 A;  1H8K A;  2DNU A;  3VS2 A;  1GBQ A;  2PTK A;  4JJB A;  2ROL A;  1GFC A;  1UHF A;  2BTT A;  3VS5 A;  2OJ2 A;  1WXU A;  2EPD A;  2L3S A;  3C0C A;  2C0O A;  1CSK A;  2PZ1 A;  1ABO A;  3M0P A;  1OV3 A;  2FPD A;  3I35 A;  2GBQ A;  2KXD A;  4IIM A;  1K4U S;  3JV3 A;  1PKS A;  2DF6 A;  1E7O A;  2YSQ A;  1ZUK A;  4J9B A;  4LUD A;  2FPF A;  3NPF A;  2RQR A;  4AFQ C;  2FO0 A;  5ECA A;  3TVT A;  3UAT A;  2C0I A;  4AFZ C;  2K79 A;  2MIO A;  1I07 A;  1RUW A;  3EHQ A;  1X6G A;  2LJ3 A;  3H0H A;  1T3S A;  2RMO A;  2J6O A;  4LE9 A;  1QKX A;  1AD5 A;  1U5S A;  2F2X A;  1AEY A;  5FWC A;  1RI9 A;  2RQT A;  2YT6 A;  4OMQ A;  1UG1 A;  1BU1 A;  3VS7 A;  4RTT A;  1UDL A;  4J9C A;  1QCF A;  1J3T A;  4LUE A;  1OOT A;  2JTE A;  1NYG A;  1HJD A;  1PKT A;  1YWP A;  2RQU A;  4OMO A;  2ESW A;  1M27 C;  1T3L A;  4J9I A;  4CC7 A;  2LQN A;  2CT4 A;  4DEY A;  2RQV A;  2BZ8 A;  3PVL A;  1TG0 A;  3PE0 A;  3SHW A;  2DRK A;  1LCK A;  4F14 A;  3EG1 A;  1Y0M A;  1I0C A;  3H0F A;  2HCK A;  1SPK A;  3VS1 A;  2HSP A;  1UEC A;  4QT7 A;  1ZLM A;  2DX1 A;  2SRC A;  1UJ0 A;  2KRO A;  3NMZ C;  4EIK A;  3R6N A;  2EYY A;  1WIE A;  2DA9 A;  2JMA A;  2K6D A;  2GTJ A;  3VRZ A;  2AZS A;  4F16 A;  1ZX6 A;  4J9G A;  2V1Q A;  1GCQ C;  2ROT A;  4JJC A;  2J05 A;  2JM9 A;  1FMK A;  1W6X A;  1B3Q A;  5IHI A;  2X3X D;  1GL5 A;  1BB9 A;  2CUB A;  1PRM C;  2LNH B;  1T0H A;  4CC4 B;  1AZE A;  3A98 A;  2K2M A;  2OAW A;  2ENM A;  2IIM A;  4LNP A;  1UTI A;  2B86 A;  2DBM A;  2VKN A;  3VS3 A;  2MCN A;  2DL5 A;  4J9E A;  1AWW A;  1M3B A;  1U06 A;  3FJ5 A;  2ABL A;  2M0Y A;  2GGR A;  1JO8 A;  1JQQ A;  2G6F X;  4K11 A;  4A63 B;  2YDL A;  1M30 A;  1WXT A;  1H92 A;  2JMC A;  2K3B A;  1TUC A;  4JZ3 A;  2GTO A;  2FEI A;  4RTV A;  1JEG A;  1K9A A;  2HBW A;  1GCP A;  2D8J A;  1SRM A;  5IHN A;  2AK5 A;  2KRN A;  4RTZ A;  3RNJ A;  1X6B A;  1HD3 A;  1WLP B;  2CSQ A;  2KT8 A;  1UGV A;  2W10 A;  5GJW B;  2KR3 A;  4X1V A;  5GJV B;  1H3H A;  2D8H A;  2K7A A;  1K0S A;  2LCS A;  1Y57 A;  2J6F A;  1UHC A;  2KRS A;  2O2O A;  2XMF A;  2DLP A;  2GQI A;  1XOV A;  1S1N A;  1T0J A;  2GNC A;  1X69 A;  3O5Z A;  1QWF A;  2AKK A;  3M0Q A;  4ZNX A;  1OEB A;  2HDA A;  4JZ4 A;  3M0T A;  1QKW A;  2KEA A;  2O9V A;  5I22 A;  2J7I A;  3VRY A;  2DVJ A;  4ORZ A;  3UA7 A;  3CQT A;  2DL7 A;  2DMO A;  2CH4 A;  1E6G A;  2RNA A;  2DBK A;  1Z9Z A;  1K76 A;  1MV3 A;  2RQW A;  1UJY A;  4RTY A;  2LMJ A;  2L0A A;  1CKA A;  1GFD A;  2L3Q A;  4GBQ A;  1VYU A;  2ED0 A;  2DL8 A;  2LJ0 A;  1UE9 A;  2JS2 A;  1SSH A;  3ZL7 C;  4Y92 A;  2JT4 A;  1KJW A;  2E5K A;  1OPL A;  2O9S A;  1YN8 A; 
#chains in the Genus database with same CATH topology
 3DKM A;  4HT8 A;  2KAF A;  3M53 A;  2FZG B;  3RES A;  3ULR B;  1K1Z A;  2L3R A;  2KGT A;  1U3O A;  4M78 D;  4JJN K;  2E5Q A;  2EYQ A;  1EFN A;  4AMC A;  5FRM A;  2EQK A;  3C4S A;  2DEU A;  2JJ9 A;  4XU1 A;  2PVG B;  1W2B P;  3JCM V;  2ZGW A;  1IHW A;  5GMK m;  3OYK A;  1NEG A;  4CC3 A;  2X4W A;  4OB0 B;  4OMP A;  1WHH A;  2RK1 A;  1KC8 R;  3M0S A;  4PJO B;  3CC4 A;  2DYB A;  3OYY A;  4OMM A;  3SWN A;  2COW A;  1Q95 G;  2MYS A;  3LYI A;  2RHI A;  1KHI A;  2M9U A;  2KYB A;  4QVZ A;  3HFN A;  3CCL Q;  1BI3 A;  3MJX A;  1WX6 A;  4C5E A;  4IIO A;  2A3L A;  1KD1 R;  2FRW A;  1VQO Q;  2GCX A;  4DEX A;  3QYH B;  1WYX A;  3LGF A;  2MWO A;  3EG3 A;  4YTL A;  2E3I A;  2RI2 A;  2F2W A;  2GFA A;  4C0Z A;  5GAN j;  3IQL A;  4F17 A;  1Q7Y R;  2LCL A;  2EW3 A;  5CIU A;  4M4Z A;  1RLQ C;  1NYF A;  4CC2 A;  4J9F A;  3CCE A;  4C0F A;  4C8Q C;  1QMC A;  2EGA A;  3INZ A;  3I5R A;  3CD6 T;  4Z89 A;  1VQK Q;  2M51 A;  1M2V B;  2AZV A;  4ATO A;  1GCQ A;  3VV0 A;  3OYM A;  2KT1 A;  3JCM P;  2P4R A;  5KCH A;  3OS2 A;  3AT1 B;  4IUU A;  2CSI A;  3FDR A;  1ZA2 B;  1KFZ A;  1NEB A;  2CGH A;  3EHR A;  2QTX A;  5IXF A;  2OTL T;  4HCK A;  5KH6 A;  2RK2 A;  4M75 B;  1UUE A;  1VQ7 Q;  1O9S A;  2NWM A;  3EH1 A;  5D6X A;  3RBB B;  2LX7 A;  1X75 C;  2K9G A;  2MK5 A;  4PK4 A;  1VYV A;  1TS9 A;  4FYV B;  5CKD A;  2EJ9 A;  5LJ3 f;  3FC3 A;  1RAA B;  4JJD A;  4P5N A;  3PTA A;  1ARK A;  2RJD A;  1WJQ A;  1W1F A;  3ER0 A;  1UGR B;  1VUB A;  3V7S A;  1RLP C;  3OBY A;  2L3P A;  4J6X A;  3NGP A;  3JB9 G;  3UF4 A;  5CQX A;  3C12 A;  2OI3 A;  2XD0 A;  1RAH B;  3EG2 A;  4GLM A;  3QPH A;  2RD1 A;  2LJ1 A;  4BDZ A;  3V8L A;  1MMG A;  3EG0 A;  5GAM h;  3MPU B;  4M7A C;  5GAO l;  1FMV A;  1KQS P;  2I0N A;  1M3C A;  1WA7 A;  1IO6 A;  2QQB A;  1LJO A;  1E6H A;  1KC8 C;  1VQ4 Q;  3UA6 A;  4A53 A;  2RJE A;  2CP0 A;  1VQL Q;  2P4T A;  1XTD A;  3OMG A;  3REB B;  2VVK A;  4JDS A;  2XDD A;  3S3M A;  1AWO A;  1EX4 A;  1Y71 A;  1G8X A;  1V29 B;  1M4Z A;  2RJF A;  1VQ7 T;  1WHG A;  1G83 A;  1OQK A;  4FYY B;  2X35 A;  1W2B A;  1W2B S;  5D6Y A;  4LN2 A;  3EGX A;  3ZEH A;  1Y07 A;  5GAM d;  2PQW A;  4MZP A;  4FU6 A;  1UHF A;  5GMK h;  1MNE A;  3WVD B;  2C0O A;  2PUK B;  4J8O A;  5DY9 A;  5KE3 A;  1VQO A;  1PD1 A;  2DIQ A;  3X25 B;  1IB8 A;  1PKS A;  4M75 F;  1TOV A;  1E7O A;  2YSQ A;  1ZUK A;  3G6E A;  2K3X A;  2DJZ A;  4AFQ C;  2VAS A;  3UWN A;  5ECA A;  4FIB A;  2C0I A;  3KUF A;  2AIR B;  4AFZ C;  4OB2 B;  2E6N A;  5C6S A;  3QSU A;  4M7D G;  2E1H A;  5EG2 A;  2E64 A;  3VYG A;  3HHT B;  1AD5 A;  1TUG B;  5D6W A;  3LW5 E;  2F2X A;  1FMW A;  3L2U A;  5IT9 E;  1YI2 A;  1UG1 A;  1NJI U;  5GAO p;  5HK0 A;  3QJ6 A;  5AT1 B;  3CD6 Q;  1J3T A;  3Q1J A;  2XIC A;  4C92 B;  1WHL A;  1NYG A;  1VQ9 T;  2C06 A;  4MML A;  1BI1 A;  3CMA A;  1YIT T;  3JB9 F;  5C0M A;  4N4I A;  2ESW A;  1M27 C;  1MMA A;  4M77 E;  2DET A;  2LQN A;  3CMA Q;  1M2V A;  2VV5 A;  1VOM A;  1QCO A;  2DKG A;  1RL2 A;  2ZPI B;  4F14 A;  1WJS A;  4J6Y A;  4JRI A;  1YJW T;  3AHU A;  1I0C A;  3H0F A;  3OYD A;  3OMC A;  1I81 A;  1SPK A;  1UEC A;  5FLX E;  2DX1 A;  3L2Q A;  3RDV A;  1UJ0 A;  4C8Q G;  3CXC P;  2BE7 D;  1SF9 A;  3LWI A;  2DFU A;  3R6N A;  1M1K R;  1K8A U;  3CCU T;  2DA9 A;  2JMA A;  1VQK A;  2CP7 A;  2QEX T;  1VQP T;  4V2S A;  1YJN T;  3MET A;  4M77 F;  3M55 A;  4B9W A;  1GCQ C;  4FT2 A;  3RKW A;  3OYL A;  2ZPB B;  4II1 A;  1N27 A;  1GL5 A;  2E6Z A;  1Q82 U;  4JLI A;  1T0H A;  3JCM d;  1AZE A;  1IZ6 A;  4FYX B;  2DK3 A;  4LNP A;  2DBM A;  3VS3 A;  1YIJ A;  2MCN A;  2DL5 A;  1KQS S;  4B9X A;  1M3B A;  3EG9 B;  4VUB A;  1VQN Q;  3BY7 A;  2GGR A;  3MKD A;  1MND A;  4PJO F;  2D0Q B;  3PFS A;  4E7K A;  2K3B A;  1Q7Y C;  1UGQ B;  3EFR A;  2GTO A;  4DA4 A;  1K9A A;  2HBW A;  1GCP A;  4UC4 A;  4F04 B;  2I2L A;  3HKS A;  2AK5 A;  4OP0 A;  5KYX A;  1KG1 A;  4RTZ A;  1Y7X A;  1X6B A;  5AYF A;  3CMA T;  1M90 R;  1OU8 A;  3A1P A;  2KT8 A;  5LJ3 d;  2KR3 A;  5GJV B;  1X6O A;  3I56 A;  1VQ5 Q;  3DB4 A;  2WAC A;  4Q5W A;  4LDX A;  3CC2 T;  2KRS A;  5LJ5 d;  4PFO A;  1T0J A;  1X69 A;  8AT1 B;  1QWF A;  2AKK A;  4ZGJ B;  1YHQ A;  3QXE B;  3JCM X;  1QVG A;  4WTO B;  3J80 E;  1N9R A;  3M0T A;  2G3R A;  4M78 C;  1Q7Y U;  2J7I A;  3MEV A;  4ORZ A;  3UA7 A;  2DMO A;  3SB2 A;  4DBQ A;  2RHZ A;  1E6G A;  2RNA A;  1Z9Z A;  4KH0 B;  1YI2 Q;  1YIT Q;  4EPC A;  1UJY A;  4RTY A;  3DLM A;  2LMJ A;  2NUP B;  1QW1 A;  4PJL A;  2E4H A;  1LPL A;  2LJ0 A;  3DB3 A;  5CCA A;  3ZL7 C;  1PSE A;  1WJR A;  4QQG A;  4LDW A;  5CKB A;  1OPL A;  2O9S A;  3M0P A;  3LH5 A;  3HTR A;  2MWP A;  1WHK A;  2YUO A;  5LJ5 h;  3M58 A;  3X28 B;  4EMK B;  2DIL A;  1QWE A;  3KBG A;  1N8R C;  4DBF A;  2HMA A;  3M4G A;  2IPO B;  2YUQ A;  4JLG A;  4J9H A;  2HSE B;  3CCS A;  4BE2 A;  2JXB A;  2D9T A;  4XTU A;  1RAG B;  3JCM h;  5M9O A;  4L6V 5;  3RMS A;  4M77 G;  1M8M A;  3EGD A;  2V8I A;  3MCA B;  2O4X A;  2J6K A;  4A54 A;  3CC2 Q;  4E6R A;  1MV0 B;  1KQ1 A;  1VYT A;  1YJ9 T;  1X2K A;  3CPW A;  3FLG A;  4M77 D;  4AG2 C;  5GAN 5;  1M3A A;  5CR2 A;  4C5I A;  3EG9 A;  2R57 A;  2V1R A;  1OPK A;  2DL4 A;  3OQ5 A;  1SEM A;  2EGC A;  1AHJ B;  3OYC A;  1ZUU A;  2CRE A;  4FT4 A;  3THK A;  1VQK T;  1VQL T;  3VJP A;  2KRM A;  2ECZ A;  1RAI B;  4HVV A;  3CCU Q;  2DTO A;  3G4S Q;  3OW2 P;  1TUD A;  2RF0 A;  1KSW A;  1PRL C;  1I1J A;  2RHX A;  4Z88 A;  4QKU A;  4E7H A;  4FW1 A;  5FW9 A;  1JJ2 S;  2KBT A;  1WXB A;  4KBM B;  3CC4 Q;  1G3S A;  4CRI A;  2RA2 A;  2DRM A;  4D8K A;  1VQP Q;  1IHV A;  4KGV B;  3A8M B;  2F2V A;  1YJW A;  4QQD A;  3M59 A;  3QWX X;  2DXB A;  2RH2 A;  1Q86 C;  1FXX A;  2EKH A;  3NHN A;  5IH2 A;  4IUV A;  1UGP B;  2OX7 A;  1VQM Q;  5LJ3 g;  2NYS A;  3UPU A;  4XTW A;  4M75 G;  1KHC A;  4XTV A;  2ZPE B;  3I5S A;  3CCV Q;  1VQP A;  3CC7 A;  1V1C A;  1PM3 A;  2YWW A;  1M1G A;  4RTU A;  1X2Q A;  1W4S A;  5HCK A;  1KIK A;  1HSQ A;  1B7T A;  1AWX A;  3H6Z A;  2ZPH B;  5GAN 8;  4ZGE B;  6AT1 B;  4JPB W;  4C92 F;  2EQI A;  2O88 A;  1YNZ A;  4N4G A;  2YRC A;  1YIJ T;  1HYO A;  2CUD A;  1RAE B;  4ZGD B;  4C92 D;  4EMG A;  2XHC A;  1S72 A;  1M90 C;  5KYX B;  2EYW A;  4LDU A;  3TU4 K;  1KQ2 A;  2K57 A;  2A08 A;  1K8A C;  1EIF A;  3PVQ A;  2EVR A;  5I11 A;  3CC4 T;  3OYE A;  2K5L A;  3CCL A;  1VQN A;  3P8B B;  3U23 A;  3CC2 A;  2FHD A;  4PJO G;  5LJ5 g;  2WSC E;  1N5Z A;  2E65 A;  1JRI A;  4D8D A;  3L2Z A;  5HKC A;  2CZ7 B;  3L42 A;  4J83 A;  1NLP C;  1GRI A;  1RAD B;  4OF1 A;  3RUX A;  3M56 A;  2HQH A;  5FU7 C;  1OYX A;  1X27 A;  4HVU A;  2M02 A;  3CCJ A;  4C0G A;  1H8K A;  2DNU A;  4J6W A;  2RM4 A;  1D1B A;  1GBQ A;  3SDZ A;  1K8A R;  3CCM T;  5J26 A;  2A0F B;  2DZC A;  2DD5 A;  2EPD A;  2PZ1 A;  1PD0 A;  1OV3 A;  1IXD A;  1D0X A;  3OYB A;  2GBQ A;  1G5V A;  3CEY A;  1K9M R;  2XG8 D;  4J9B A;  4R56 A;  1WNL A;  4X9C A;  2A7Y A;  3M4Y A;  3UAT A;  1KC8 U;  4KUI A;  1DJ7 B;  4FCY A;  2R5M A;  2K79 A;  2MIO A;  4EMK A;  1HXD A;  2HL3 A;  3EFO A;  4M7D A;  2LJ3 A;  2LRQ A;  3URG A;  2RMO A;  1YIT A;  1OU9 A;  2J6O A;  2B8A A;  1YHQ Q;  4M75 E;  4OMQ A;  2YXY A;  1FX7 A;  1BU1 A;  4E7Z A;  2COZ A;  4RTT A;  2JTF A;  4J9C A;  2XDB A;  4LUE A;  4F7U F;  4XQ3 A;  1HJD A;  3M5A A;  4E2F B;  2AT1 B;  1MMN A;  2VB6 A;  1YWP A;  2RQU A;  1NJI R;  2RI3 A;  4M78 F;  5I21 A;  2CT4 A;  3OS1 A;  1MGQ A;  2X4X A;  4DEY A;  3G6E Q;  5GMK i;  3PVL A;  3PE0 A;  3CCQ T;  2AHJ B;  3PT9 A;  1Y0M A;  4JRP A;  2EQM A;  3L2R A;  1KQS A;  4PJO D;  3CCJ T;  2HCK A;  3CPF A;  3UT1 A;  4M78 A;  4RG8 A;  4QT7 A;  4BY6 B;  1LVK A;  2ZAE A;  2FYK A;  2KRO A;  1WZO A;  4C8Q A;  1WIE A;  3G1J A;  4PJN A;  3MP8 A;  5FRO A;  2Y4X A;  1VQ6 Q;  2EJG A;  4PFZ A;  4M78 E;  3CME A;  4F16 A;  4KUL A;  1Q81 U;  1YJ9 Q;  2NLU A;  1FMK A;  1W6X A;  2X3X D;  3GF5 A;  2E41 A;  1GXI E;  4BUG A;  1BB9 A;  2HKQ B;  3TCJ A;  2CUB A;  2KK4 A;  4J5Y A;  3JAM E;  5DLO A;  2K2M A;  4RMO A;  3G71 A;  3GLX A;  4OB3 B;  3CCM Q;  1U06 A;  2PVO B;  1S72 Q;  4M77 B;  3BDU A;  2CP3 A;  4N0A C;  4K11 A;  2G6F X;  3OB9 A;  4B6M A;  3HPW A;  3OBW A;  1QP3 A;  3A5Z B;  1YCY A;  2COY A;  2RJC A;  4N0A A;  2MMP A;  4JZ3 A;  3FJP A;  2O4X B;  1Q81 C;  1JEG A;  1PCX A;  1I8F A;  3NTI A;  5A0L A;  1SRM A;  1WQ7 A;  2RHU A;  1RAC B;  2V26 A;  2DZ9 A;  2YRD A;  1UGV A;  2W10 A;  3QDR B;  3CPW S;  5CK9 A;  1M1K U;  3JCM e;  2D8H A;  2K7A A;  1K0S A;  2LCS A;  4J7F A;  1ZHI A;  2QQR A;  2O2O A;  2XMF A;  8ATC B;  1Y96 B;  4M7A A;  3CXC A;  5I22 A;  2RO0 A;  1VQ8 A;  1QVG S;  4BI3 A;  2R58 A;  3CQT A;  2CH4 A;  1EZZ B;  3OA6 A;  2LC4 A;  5KCO A;  2NUP A;  2DBK A;  1QQJ A;  1MV3 A;  1JB0 E;  4ZTF A;  3CCL T;  2XKO C;  4RCC A;  1TU0 B;  1CKA A;  2MPX C;  1KD1 C;  1M1K C;  5HK3 A;  3CME Q;  4L5G A;  5GMK j;  4DBR A;  4O5V A;  2JT4 A;  2QYZ A;  1KJW A;  5GAO r;  2E5K A;  4KGX B;  5FWB A;  2P0K A;  4MMK A;  4LDY A;  1QVF A;  1M9S A;  4FSS A;  5KYW A;  1M90 U;  1YJ9 A;  1JXO A;  2AKL A;  1X43 A;  4AFU C;  1JJ2 P;  2A36 A;  3VS4 A;  1TXQ A;  5GAN d;  2P0Q A;  4BE0 A;  3VS6 A;  1ACM B;  2L8D A;  1CKB A;  3OYN A;  3BW1 A;  2EWN A;  3R6O A;  4OVA A;  2D6F A;  4AG1 C;  2QA4 A;  4XTX A;  2L5Q A;  2K4Y A;  2CDT A;  2PUO B;  2OTL Q;  1NM7 A;  2CP5 A;  1FYN A;  2CZ0 B;  1Q86 U;  1MUZ A;  2O01 E;  3G6E T;  4A4H A;  2LX9 A;  3NTH A;  1VQ4 A;  1TSF A;  1YCS B;  2EGE A;  1LOJ A;  2QQA A;  5IHK A;  3A8L B;  5I2M A;  3ASK A;  4OMN A;  2JZ2 A;  1TH7 A;  2VYT A;  2F69 A;  2YLC A;  9ATC B;  4DOV A;  4M75 C;  1XJW B;  2IG0 A;  2ZPF B;  1SRL A;  1QLY A;  3EGD B;  2O31 A;  5KE2 A;  2OAU A;  2MI6 A;  3CCV A;  2KVQ G;  4M75 D;  3TSZ A;  2QDY B;  4XK8 E;  2ZZD A;  3LLR A;  4ELY C;  3JCM Q;  1D0Y A;  2C0T A;  1WFW A;  4HCC A;  2X3W D;  4GY5 A;  1WPY A;  1K73 C;  3EH2 A;  3HRT A;  2F5T X;  3I9Q A;  1UGS B;  1M5Q 1;  2CT3 A;  2CS7 A;  1ZSZ C;  3MEW A;  1ZQ1 A;  2QG9 B;  2BZY A;  3FEO A;  1B07 A;  1IRE B;  1WHM A;  1AWJ A;  2A28 A;  2J06 A;  1SHG A;  4KUD K;  1BI0 A;  2LDM A;  1BCM A;  1BCO A;  1NPP A;  2VGM A;  2D1X A;  4OML A;  2HL5 C;  4HA8 A;  1WHJ A;  3D7S B;  2Y90 A;  4C92 C;  2QGG A;  2KXC A;  4Z8A A;  3CCU A;  1SKU B;  2L2P A;  5L8R E;  3VUB A;  1PSF A;  2DER A;  1K73 U;  1YFN A;  2DPP B;  2ED1 A;  5LJ3 h;  3QHS A;  4M7D E;  3M54 A;  4A4F A;  1D09 B;  2ZPG B;  5DLQ E;  4PJO C;  1YJN Q;  4MZM A;  4TVR A;  3SWN B;  1NLO C;  3V8J A;  4XTY A;  4RUG A;  4BD3 A;  4MDW A;  5LJ5 f;  2MOX A;  4NS5 A;  4DQ2 A;  5GAM f;  2EQU A;  2EFI A;  2OTJ T;  1WDX A;  1YWO A;  2KYM A;  4N4H A;  4HCB A;  2RPN A;  3VUZ A;  2KE9 A;  3CCQ Q;  1D3B B;  3SD4 A;  2VWF A;  2QEX Q;  3M57 A;  1R0C B;  4M7D F;  4FW2 A;  3JCM g;  1N6A A;  1IRX A;  2RI5 A;  3I55 Q;  3J81 E;  4C92 E;  2LNV A;  1TTH B;  3T9N A;  1BK2 A;  5I2S A;  3A8O B;  4C92 G;  2H3E B;  5LJ5 e;  3CBM A;  1B34 A;  4QQ6 A;  1VQ8 Q;  5CQY A;  3H41 A;  4XU0 A;  3CCS Q;  2QDL A;  1VIE A;  3S6W A;  5KYY B;  2MAM A;  4QVD A;  3QUI A;  2EKO A;  1AZG B;  2FG0 A;  4JRK A;  2DD4 A;  1KK7 A;  3JB9 J;  5GAN e;  4KRT A;  5A0D A;  3CXC S;  2YUP A;  1VQM A;  3QJY A;  2NUT A;  4CI0 C;  1BI2 A;  1JXM A;  1UEB A;  2JN0 A;  5CKF A;  1Q81 R;  3QZ9 B;  5GAN 7;  1BBZ A;  1NPR A;  4ZTJ A;  2DL3 A;  1ZBJ A;  2M1H A;  3GNF B;  1NG2 A;  1QVF S;  1VQ9 A;  3VS2 A;  3PIP A;  3VKI A;  2OJ2 A;  1WXU A;  1PG5 B;  1VQ7 A;  3C0C A;  3CD6 A;  1ABO A;  3MO8 A;  1NJI C;  2FPD A;  4M7A B;  2M0O A;  1R8O B;  2HKN A;  2KXD A;  4IIM A;  5GAN f;  3JV3 A;  2CP2 A;  4LUD A;  2M16 A;  4WF2 A;  2FPF A;  5A0G A;  2CKK A;  3OY9 A;  3VYH B;  2RQR A;  2FO0 A;  1JBM A;  4M7A D;  2LQ8 A;  3BDL A;  4JRQ A;  1G3T A;  5KYU A;  4A4K A;  3I56 Q;  1ZSZ A;  2E70 A;  1X6G A;  1H64 1;  3H0H A;  2EAY A;  1OI1 A;  3FB9 A;  4OB1 B;  3SWN C;  4LE9 A;  1QKX A;  4AT1 B;  2XID A;  3PGG A;  2XK0 A;  4M77 C;  5GAM j;  4C0D B;  1RI9 A;  3E2U A;  3OYJ A;  3VS7 A;  1C0M A;  3S3O A;  2EJF A;  4M77 A;  3CCQ A;  4C8Q D;  1OOT A;  3OYI A;  2JTE A;  3MHX A;  1BIA A;  4KGZ B;  4C92 A;  3EGX B;  1M2O A;  2PU9 B;  1R77 A;  3HRS A;  3L1A A;  4OMO A;  3UDC A;  4R55 A;  4FM4 B;  4J9I A;  2CYZ B;  4NOY A;  3E1S A;  3GOX A;  3LWH A;  1Y96 A;  2BZ8 A;  3SHW A;  1UB4 A;  2DRK A;  3CPW P;  1LCK A;  1VQL A;  3OYG A;  3EG1 A;  5GAN 6;  5J39 A;  3V7R A;  4C5G A;  1ZSZ B;  3VS1 A;  4C8Q B;  3FIF A;  4Z02 A;  2SRC A;  3ZBD A;  1VQ8 T;  3GIB A;  4F7U E;  4NL2 A;  1HK9 A;  4EIK A;  2LQK A;  3JCM W;  4LXC A;  3OSS C;  4XTZ A;  1OUL A;  2GTJ A;  4JS4 A;  2AZS A;  4E7J A;  1ZX6 A;  3MP1 A;  4J9G A;  1PC0 A;  2J05 A;  2JM9 A;  2DXC A;  1B3Q A;  1SSF A;  3EFS A;  1PRM C;  2LNH B;  3GNG A;  4CC4 B;  2DXT A;  5GMK l;  4ANJ A;  4M7D D;  3A8G B;  3CC7 Q;  2OAW A;  4OGE A;  1UTI A;  2B86 A;  4E7L A;  1AWW A;  1QVG P;  1FWZ A;  1QP2 A;  1YJW Q;  2FZC B;  3I55 T;  2NUT B;  4OMF B;  2YDL A;  4F7U A;  1H92 A;  2X9H A;  1K73 R;  1TUC A;  4F7U G;  2KSS A;  4RTV A;  3KXT A;  2E3H A;  4O6J A;  5IHN A;  3CCV T;  1XQH A;  3RNJ A;  2DEQ A;  1HD3 A;  1WLP B;  5GJW B;  1B34 B;  1H3H A;  2QA4 Q;  4GLK A;  4ZN1 A;  3E19 A;  4M7A E;  1Y57 A;  1WQW A;  1UHC A;  4HKE A;  2DLP A;  3CME T;  1XOV A;  1S1N A;  1VQ4 T;  2QI2 A;  4BAC A;  3O5Z A;  3M0Q A;  3C94 A;  3JCM c;  4E7S A;  2JNG A;  1QKW A;  2YHT A;  1BYM A;  2O9V A;  3VRY A;  2DVJ A;  2DL7 A;  3F70 A;  1G3W A;  4BI8 B;  1OX8 A;  1VIF A;  1K76 A;  1D0Z A;  2RQW A;  3JB9 H;  3P8H A;  1IGU A;  1TWB A;  3CBO A;  4M7A F;  2L0A A;  1U1T A;  1I5O B;  1GFD A;  3CC7 T;  4GBQ A;  5GAN 3;  1VYU A;  3CCR A;  1M1F A;  2ED0 A;  4XU2 A;  2QTV A;  2JS2 A;  5DM7 R;  4Y92 A;  3V7C A;  2GF7 A;  5D7U A;  3OS0 A;  3QDF A;  1YN8 A;  3REA B;  2FRY A;  4PKC C;  2JUF A;  5CAI A;  3TRE A;  4PLL A;  5KYU B;  3EGU A;  3ZFJ A;  2LQW A;  3QYG B;  5GAM e;  5GAN g;  4XU3 A;  3NFC A;  3G4S T;  1G3Y A;  1Q86 R;  5J3B A;  2Y4Y A;  2EIF A;  1PNJ A;  2A37 A;  4C8Q E;  3J7A F;  1UFF A;  4F7U B;  1VQO T;  3GP8 A;  2WSE E;  3MEA A;  3LGL A;  3OW2 A;  3OS5 A;  4D6W A;  3E9F A;  4X9D A;  4ZN3 A;  4FSX A;  2DM1 A;  5GAO m;  1MHN A;  3BFM A;  3G71 T;  1QCN A;  2DYI A;  1H3Z A;  1WI7 A;  1JU5 C;  4QVC A;  3C95 A;  5FU6 B;  2VGN A;  3HP9 A;  4RKU E;  1GBR A;  2D0N A;  1KD1 U;  2KDS A;  3HSB A;  1PHT A;  2IVW A;  3PMI A;  4LDV A;  4RTW A;  1K0X A;  2JW4 A;  2JM8 A;  3N5B B;  2XI9 A;  4C8Q F;  1ZUY A;  2HZY A;  2KNB B;  4HVW A;  1BKB A;  2HEQ A;  5LJ3 j;  4M78 G;  1MMD A;  3LX7 A;  4HXJ A;  3KFV A;  2BKD N;  3RR6 A;  1C1A A;  1X01 A;  2K5I A;  2FVU A;  3I56 T;  3JCM f;  3QO3 A;  2VUB A;  1AOJ A;  2FL7 A;  1G2B A;  3CCM A;  2QEX A;  2PNI A;  1S72 T;  5IAY A;  5KYN A;  4J9D A;  2EYX A;  2JVV A;  4BY6 C;  3GBQ A;  3G71 Q;  3WVE B;  3PIO A;  3M0R A;  2HAX A;  4X34 A;  1YIJ Q;  2RB6 A;  2DJQ A;  2KMT A;  5EC7 A;  1PWT A;  1N8R U;  2QAZ A;  3NTK A;  3BE3 A;  2QQS A;  3X26 B;  1VQ5 T;  2RN8 A;  3VS0 A;  3TQ7 P;  2YUN A;  2OTJ Q;  2H8H A;  1W70 A;  3CCE T;  2EBP A;  3M9Q A;  2K2V A;  3TEE A;  2YLB A;  5A2Q E;  1M8V A;  3PMT A;  2LZ6 B;  1U1S A;  5CVI A;  2QK0 A;  5L23 A;  2CH4 W;  2BUD A;  4AFS C;  3SEM A;  2FPE A;  2DVE A;  4FYW B;  4NL3 A;  3DLL A;  3JCM J;  4RTX A;  4JUV A;  2SEM A;  4IUR A;  5FU6 C;  3M0U A;  5IXB A;  1YI2 T;  5GAO q;  2NUZ A;  1Z9Q A;  1O75 A;  1RI0 A;  2GFU A;  2L89 A;  5LL6 S;  3TSW A;  3EAE A;  4IUT A;  3CCS T;  2LT4 A;  1K9M C;  2CZ6 B;  1ZSG A;  4BB7 A;  4J7I A;  1A0N B;  5FRN A;  2FB7 A;  2LVM A;  1C6V X;  3OYF A;  2CP6 A;  4Y91 A;  4IKF A;  5LJ5 j;  4L59 A;  2EYZ A;  1YP5 A;  2VXF A;  1NZ9 A;  1AVZ C;  1RAB B;  2V8K A;  4XAX B;  2BZX A;  4ESR A;  3WXM B;  3H0I A;  3QWY A;  1OZ2 A;  1SHF A;  2QXF A;  2KI7 A;  1YBY A;  2DTH A;  3HL8 A;  3JB9 D;  2XDP A;  3X24 B;  5CKE A;  5GMK e;  2KY9 A;  4FL6 A;  4LD6 A;  1ABQ A;  5KYW B;  4JS5 A;  4E7I A;  4QW2 A;  1JJ2 A;  4PNO A;  2K3Y A;  4R0K A;  4WCI A;  1AT1 B;  2EQJ A;  4M7D C;  2JS0 A;  5FU7 B;  3MEU A;  1VQ5 A;  1I4K 1;  2P84 A;  3QBY A;  5GAN h;  5KYY A;  2W0Z A;  3EFO B;  4M7D B;  1VA7 A;  2OTL A;  4RCB A;  2QA4 T;  2LP5 A;  2K5F A;  2DE0 X;  3RIR A;  4M78 B;  2PTK A;  4JJB A;  1Q82 R;  2ROL A;  1GFC A;  2BTT A;  3CCJ Q;  3I55 A;  3VS5 A;  2HD0 A;  1LNX A;  3L2V A;  2YRV A;  2L3S A;  1OZ3 A;  3L2W A;  1CSK A;  3I35 A;  7AT1 B;  2DAQ A;  1K4U S;  1VQ6 A;  1ZA1 B;  1U8R A;  1D1C A;  3GPL A;  2DF6 A;  2WSF E;  3CCR Q;  5CO7 A;  1P92 A;  3NPF A;  3QG1 A;  3JRZ A;  4PL6 A;  2BE9 B;  3TVT A;  2HNI A;  3CCE Q;  2FZK B;  3OW2 S;  3JSC A;  4M7A G;  1I07 A;  1RUW A;  3PNW C;  3EHQ A;  1N8R R;  1YJN A;  4MZT A;  2X51 A;  1T3S A;  1OX9 A;  2F5K A;  1U5S A;  1YHQ T;  2BIV A;  4A4E A;  1BIB A;  4IUP A;  1AEY A;  3OSV A;  1QVF P;  5FWC A;  5LJ3 e;  2RQT A;  2YT6 A;  4Y28 E;  1UDL A;  2Z0W A;  1V76 A;  4RG2 A;  1QCF A;  5CKH A;  4PLI A;  2R5A A;  3LH0 A;  4BI4 A;  4PJO A;  4DBH A;  1PKT A;  2KQW A;  3QKJ A;  3V8K A;  2QGF B;  3MP6 A;  4MDX A;  2QAS A;  2MF2 A;  1T3L A;  4CC7 A;  4C5H A;  2X4J A;  3OYA A;  5GAO n;  2ZCF B;  3S3N A;  2RQV A;  4BDY A;  1D1A A;  3OYH A;  4EDU A;  1TG0 A;  4BE1 A;  2LTO A;  5HY6 A;  3H9N A;  4KT0 E;  2HSP A;  1ZLM A;  1R0B G;  2VXE A;  3NMZ C;  1VQN T;  2X4Y A;  2DXU A;  3H8Z A;  2EYY A;  3RKX A;  5GAM g;  1VQ9 Q;  2K6D A;  2DO3 A;  2HBP A;  3VRZ A;  4PJO E;  1VQ6 T;  2V1Q A;  2CZ1 B;  2ROT A;  4JJC A;  5IHI A;  1XNI A;  3A8H B;  3RER A;  3QII A;  3X20 B;  1IGQ A;  3A98 A;  2V8J A;  2E12 A;  2ENM A;  1SG5 A;  2IIM A;  2VKN A;  3E9G A;  1I5L A;  2HQE A;  4PFP A;  4J9E A;  4C0D C;  3FJ5 A;  2ABL A;  2M0Y A;  4E47 A;  3O8V A;  1Q82 C;  1NBE B;  4ME7 A;  5GAN 2;  4A63 B;  1JO8 A;  1JQQ A;  3QZ5 B;  4LD9 K;  3G7Z A;  2JTM A;  1M30 A;  1WXT A;  2JMC A;  3HFO A;  4PJM A;  3G4S A;  1D3B A;  2FEI A;  1NE8 A;  2D8J A;  2HQX A;  1ZBX A;  2KRN A;  1F1B B;  1QVP A;  1WGS A;  3RMQ A;  2LCC A;  1VQM T;  2CSQ A;  4X1V A;  4DOW A;  3VU3 C;  2F1L A;  3HRU A;  1K9M U;  2J6F A;  4ELZ C;  2PVD B;  2GQI A;  2GNC A;  2OTJ A;  3JCM b;  3ME9 A;  4EMK C;  4ZNX A;  1OEB A;  2ATC B;  2HDA A;  4JZ4 A;  2QQ9 A;  3CCR T;  2KEA A;  1RAF B;  4M75 A;  2DIG A;  4A4G A;  2JOY A;  2H3J A;  2RHY A;  4OGC A;  2E10 A;  4PJJ A;  3P8D A;  3SFM A;  2DTI A;  4HT9 A;  4EMH A;  4IUQ A;  5IN1 A;  3RKY A;  2XU8 A;  2L3Q A;  2VC8 A;  3JB9 I;  2DL8 A;  2GQV A;  1UE9 A;  4HCZ A;  3CBP A;  5GAN 4;  1SSH A;  4KH1 B;  2LT1 A;  1N9S A;  3FRN A;  2P0P A; 
#chains in the Genus database with same CATH homology
 3LH5 A;  5FWB A;  3REA B;  2FRY A;  2YUO A;  4FSS A;  2DIL A;  1QWE A;  1JXO A;  2AKL A;  2YUQ A;  3ULR B;  1X43 A;  4AFU C;  3EGU A;  1K1Z A;  2A36 A;  2LQW A;  4J9H A;  3VS4 A;  2KGT A;  2JXB A;  1U3O A;  1M8M A;  1EFN A;  3VS6 A;  1CKB A;  1PNJ A;  2A37 A;  2J6K A;  1UFF A;  4E6R A;  1MV0 B;  1VYT A;  4AG1 C;  1NEG A;  1X2K A;  2CDT A;  4CC3 A;  4OMP A;  1NM7 A;  4AG2 C;  2DM1 A;  1M3A A;  1FYN A;  1MUZ A;  2V1R A;  3M0S A;  2DYB A;  1WI7 A;  1OPK A;  1JU5 C;  2DL4 A;  1SEM A;  2EGC A;  4OMM A;  1YCS B;  2EGE A;  1GBR A;  2D0N A;  1ZUU A;  5IHK A;  2CRE A;  1PHT A;  3THK A;  4RTW A;  4OMN A;  1K0X A;  2KRM A;  2JW4 A;  2JM8 A;  2ECZ A;  1ZUY A;  2KYB A;  4HVV A;  2KNB B;  1SRL A;  1QLY A;  4HVW A;  2O31 A;  1WX6 A;  4IIO A;  2FRW A;  4DEX A;  1WYX A;  3TSZ A;  2HEQ A;  1TUD A;  4HXJ A;  2RF0 A;  3KFV A;  1KSW A;  3EG3 A;  1PRL C;  1I1J A;  2C0T A;  2F2W A;  1WFW A;  4Z88 A;  2X3W D;  1AOJ A;  3IQL A;  4F17 A;  1G2B A;  2EW3 A;  2PNI A;  4M4Z A;  5FW9 A;  1NYF A;  1RLQ C;  4J9D A;  3I9Q A;  4CC2 A;  2EYX A;  4J9F A;  3GBQ A;  2CT3 A;  2KBT A;  2EGA A;  1WXB A;  3I5R A;  2BZY A;  4Z89 A;  3M0R A;  2M51 A;  2DRM A;  4D8K A;  1B07 A;  2AZV A;  2DJQ A;  1GCQ A;  5EC7 A;  2KT1 A;  2F2V A;  1PWT A;  1AWJ A;  2A28 A;  2J06 A;  1SHG A;  2P4R A;  3QWX X;  2CSI A;  2RN8 A;  3VS0 A;  1KFZ A;  2YUN A;  2EKH A;  3NHN A;  1NEB A;  5IH2 A;  2D1X A;  4OML A;  2H8H A;  3EHR A;  1W70 A;  2EBP A;  5IXF A;  4HCK A;  3I5S A;  1UUE A;  1V1C A;  2NWM A;  2LZ6 B;  2KXC A;  4Z8A A;  2LX7 A;  3RBB B;  2L2P A;  5L23 A;  2K9G A;  2CH4 W;  4AFS C;  4RTU A;  1X2Q A;  5HCK A;  2FPE A;  3SEM A;  1KIK A;  1HSQ A;  1VYV A;  2ED1 A;  4RTX A;  2SEM A;  3M0U A;  1AWX A;  5IXB A;  4JJD A;  2NUZ A;  4JPB W;  1ARK A;  1Z9Q A;  1NLO C;  4RUG A;  2EQI A;  2O88 A;  1W1F A;  1YNZ A;  3TSW A;  2MOX A;  2CUD A;  1RLP C;  2L3P A;  1ZSG A;  1WDX A;  1YWO A;  3NGP A;  2KYM A;  3UF4 A;  2OI3 A;  1A0N B;  3EG2 A;  4GLM A;  2RPN A;  2KE9 A;  2VWF A;  2LJ1 A;  2EYW A;  2EYZ A;  1YP5 A;  3EG0 A;  1AVZ C;  2BZX A;  2A08 A;  4ESR A;  3PVQ A;  3H0I A;  3QWY A;  2I0N A;  1SHF A;  1BK2 A;  1M3C A;  1WA7 A;  1IO6 A;  1E6H A;  2EVR A;  5I11 A;  3UA6 A;  3H41 A;  1ABQ A;  2QDL A;  3U23 A;  3REB B;  2VVK A;  1N5Z A;  4D8D A;  1AZG B;  2FG0 A;  1AWO A;  4R0K A;  4WCI A;  1NLP C;  2JS0 A;  1GRI A;  4KRT A;  2YUP A;  1G83 A;  2W0Z A;  1JXM A;  1X27 A;  1VA7 A;  4HVU A;  2LP5 A;  1BBZ A;  2DE0 X;  1ZBJ A;  2DL3 A;  4LN2 A;  1NG2 A;  1H8K A;  2DNU A;  3VS2 A;  1GBQ A;  2PTK A;  4JJB A;  2ROL A;  1GFC A;  1UHF A;  2BTT A;  3VS5 A;  2OJ2 A;  1WXU A;  2EPD A;  2L3S A;  3C0C A;  2C0O A;  1CSK A;  2PZ1 A;  1ABO A;  3M0P A;  1OV3 A;  2FPD A;  3I35 A;  2GBQ A;  2KXD A;  4IIM A;  1K4U S;  3JV3 A;  1PKS A;  2DF6 A;  1E7O A;  2YSQ A;  1ZUK A;  4J9B A;  4LUD A;  2FPF A;  3NPF A;  2RQR A;  4AFQ C;  2FO0 A;  5ECA A;  3TVT A;  3UAT A;  2C0I A;  4AFZ C;  2K79 A;  2MIO A;  1I07 A;  1RUW A;  3EHQ A;  1X6G A;  2LJ3 A;  3H0H A;  1T3S A;  2RMO A;  2J6O A;  4LE9 A;  1QKX A;  1AD5 A;  1U5S A;  2F2X A;  1AEY A;  5FWC A;  1RI9 A;  2RQT A;  2YT6 A;  4OMQ A;  1UG1 A;  1BU1 A;  3VS7 A;  4RTT A;  1UDL A;  4J9C A;  1QCF A;  1J3T A;  4LUE A;  1OOT A;  2JTE A;  1NYG A;  1HJD A;  1PKT A;  1YWP A;  2RQU A;  4OMO A;  2ESW A;  1M27 C;  1T3L A;  4J9I A;  4CC7 A;  2LQN A;  2CT4 A;  4DEY A;  2RQV A;  2BZ8 A;  3PVL A;  1TG0 A;  3PE0 A;  3SHW A;  2DRK A;  1LCK A;  4F14 A;  3EG1 A;  1Y0M A;  1I0C A;  3H0F A;  2HCK A;  1SPK A;  3VS1 A;  2HSP A;  1UEC A;  4QT7 A;  1ZLM A;  2DX1 A;  2SRC A;  1UJ0 A;  2KRO A;  3NMZ C;  4EIK A;  3R6N A;  2EYY A;  1WIE A;  2DA9 A;  2JMA A;  2K6D A;  2GTJ A;  3VRZ A;  2AZS A;  4F16 A;  1ZX6 A;  4J9G A;  2V1Q A;  1GCQ C;  2ROT A;  4JJC A;  2J05 A;  2JM9 A;  1FMK A;  1W6X A;  1B3Q A;  5IHI A;  2X3X D;  1GL5 A;  1BB9 A;  2CUB A;  1PRM C;  2LNH B;  1T0H A;  4CC4 B;  1AZE A;  3A98 A;  2K2M A;  2OAW A;  2ENM A;  2IIM A;  4LNP A;  1UTI A;  2B86 A;  2DBM A;  2VKN A;  3VS3 A;  2MCN A;  2DL5 A;  4J9E A;  1AWW A;  1M3B A;  1U06 A;  3FJ5 A;  2ABL A;  2M0Y A;  2GGR A;  1JO8 A;  1JQQ A;  2G6F X;  4K11 A;  4A63 B;  2YDL A;  1M30 A;  1WXT A;  1H92 A;  2JMC A;  2K3B A;  1TUC A;  4JZ3 A;  2GTO A;  2FEI A;  4RTV A;  1JEG A;  1K9A A;  2HBW A;  1GCP A;  2D8J A;  1SRM A;  5IHN A;  2AK5 A;  2KRN A;  4RTZ A;  3RNJ A;  1X6B A;  1HD3 A;  1WLP B;  2CSQ A;  2KT8 A;  1UGV A;  2W10 A;  5GJW B;  2KR3 A;  4X1V A;  5GJV B;  1H3H A;  2D8H A;  2K7A A;  1K0S A;  2LCS A;  1Y57 A;  2J6F A;  1UHC A;  2KRS A;  2O2O A;  2XMF A;  2DLP A;  2GQI A;  1XOV A;  1S1N A;  1T0J A;  2GNC A;  1X69 A;  3O5Z A;  1QWF A;  2AKK A;  3M0Q A;  4ZNX A;  1OEB A;  2HDA A;  4JZ4 A;  3M0T A;  1QKW A;  2KEA A;  2O9V A;  5I22 A;  2J7I A;  3VRY A;  2DVJ A;  4ORZ A;  3UA7 A;  3CQT A;  2DL7 A;  2DMO A;  2CH4 A;  1E6G A;  2RNA A;  2DBK A;  1Z9Z A;  1K76 A;  1MV3 A;  2RQW A;  1UJY A;  4RTY A;  2LMJ A;  2L0A A;  1CKA A;  1GFD A;  2L3Q A;  4GBQ A;  1VYU A;  2ED0 A;  2DL8 A;  2LJ0 A;  1UE9 A;  2JS2 A;  1SSH A;  3ZL7 C;  4Y92 A;  2JT4 A;  1KJW A;  2E5K A;  1OPL A;  2O9S A;  1YN8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...