5GJWB

Structure of the mammalian voltage-gated calcium channel cav1.1 complex for classii map
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
100
structure length
100
Chain Sequence
QGPHMALRKEAERQALAQLEKAKTKPVAFAVRTNVGYNPSPGDEVPVEGVAITFEPKDFLHIKEKYNNDWWIGRLVKEGCEVGFIPSPVKLDSLRLLQEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Voltage-dependent L-type calcium channel subunit alpha-1S
publication title Structure of the voltage-gated calcium channel Cav1.1 at 3.6 angstrom resolution
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Membrane protein
total genus 16
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2016-07-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 5gjwB00
2NWMA 2DL4A 2NUZA 1NEBA 2DBMA 1JO8A 2J6FA 4LUDA 2LCSA 1M30A 3RNJA 4OMQA 2FEIA 1I0CA 1MV0B 1TG0A 2ENMA 3PE0A 1GBRA 1A0NB 1Z9ZA 2YUNA 2CSQA 5IHKA 2DF6A 2CREA 3NHNA 4RUGA 3TVTA 2RPNA 3REBB 1KFZA 2BZYA 2H8HA 5IHIA 4Z88A 1GL5A 3M0RA 2AZSA 4LNPA 3VS6A 1UHFA 1WFWA 1AWWA 1RI9A 2YUPA 1GCQC 1H92A 3SHWA 1E7OA 2KYBA 1OV3A 1FYNA 2AZVA 4JZ4A 2MCNA 2BZXA 4HCKA 3VRZA 2C0TA 1SSHA 2RQRA 2FG0A 3EGUA 3I35A 4LN2A 1B3QA 1M3BA 3KFVA 4IIMA 1PRMC 4CC4B 4GLMA 3EG0A 3EG1A 3M0SA 1WXBA 2DJQA 2DX1A 4D8KA 1ZX6A 3VS1A 1GBQA 1AOJA 1UDLA 2KRSA 2LNHB 2JW4A 3CQTA 3EHQA 2E5KA 1G83A 2D1XA 1WA7A 1HD3A 2ECZA 4OMMA 3VS3A 1J3TA 1OPLA 2FRWA 2K6DA 5GJWB 1ARKA 4JJCA 1G2BA 2DL8A 2L2PA 3GBQA 1NLPC 1NG2A 2ED1A 1JXMA 1I1JA 4F17A 1GFCA 2JXBA 2JMAA 1W6XA 1Z9QA 1T3SA 2SRCA 3TSZA 1AWOA 4RTYA 4AG1C 4CC3A 2DRKA 3UF4A 4HVVA 2BZ8A 2PTKA 2RN8A 1K76A 1PWTA 1X69A 2KYMA 2DVJA 2J6OA 3I5RA 2L3SA 2GNCA 1NYGA 1NLOC 5L23A 2K3BA 1VA7A 5IXBA 1PNJA 3ULRB 2GTJA 2RF0A 2LQNA 1WXTA 2DYBA 1X43A 2HEQA 2PNIA 1AD5A 4J9FA 1H3HA 1U3OA 2EBPA 1WXUA 2YSQA 2M0YA 3SEMA 3M0QA 2JT4A 1T0JA 3UA6A 1SRMA 1JXOA 4RTTA 3LH5A 5ECAA 2W0ZA 4J9BA 1TUDA 1ZUKA 2CDTA 2X3WD 1RLQC 1SEMA 3VS7A 5FWBA 4FSSA 1CKBA 1M8MA 2BTTA 3RBBB 2C0OA 2L3PA 1HSQA 1M3CA 1YWPA 4J9HA 1AZGB 4JZ3A 2O2OA 2V1QA 1YN8A 1Y57A 2EQIA 2DILA 4CC2A 2CUDA 2LX7A 4M4ZA 1X2KA 2OI3A 2A36A 2KEAA 2LQWA 2YDLA 1BU1A 2ROTA 2YUOA 1E6HA 4OMPA 1IO6A 2JS2A 4WCIA 3THKA 2JS0A 2EW3A 4J9IA 3UA7A 4KRTA 1YCSB 2FPDA 1OEBA 1W70A 2GTOA 1JEGA 1GFDA 1M27C 3VS4A 2CSIA 3VS5A 4QT7A 1EFNA 1AWJA 1UE9A 2DRMA 3NGPA 1NEGA 2YT6A 1MUZA 2A08A 2LJ3A 2P4RA 1WI7A 2LP5A 4HVWA 2XMFA 3IQLA 1WYXA 4JJBA 4AFSC 1PKSA 1PHTA 1YP5A 5I11A 1UGVA 2ABLA 1GCPA 1TUCA 3QWYA 1CSKA 3I5SA 3H0IA 2DM1A 2RQTA 2V1RA 2VVKA 1RUWA 4AFUC 3U23A 1QWEA 2DL7A 1AVZC 2FO0A 2KT1A 4RTVA 2JM8A 2RNAA 2DLPA 1ABOA 1Y0MA 2OJ2A 2GBQA 2JM9A 2DA9A 5HCKA 1GCQA 1AEYA 1NM7A 1V1CA 2EGAA 2KROA 2KBTA 2EVRA 4LE9A 2HDAA 2L3QA 2F2VA 5FWCA 1K0SA 1WDXA 1UECA 1WX6A 2JTEA 1VYUA 1S1NA 1B07A 1W1FA 4CC7A 1FMKA 3JV3A 4RTUA 4JJDA 3REAB 2AK5A 1VYVA 2EYZA 5EC7A 2EYYA 2EYWA 1X6GA 3TSWA 1BB9A 2D8JA 3VRYA 1ZBJA 1OOTA 2KRNA 4HVUA 1QWFA 1ZSGA 2ESWA 4RTXA 3M0PA 3R6NA 3VS2A 4E6RA 2YUQA 1MV3A 1UJ0A 2CT4A 1QKWA 4HXJA 3EG2A 1WIEA 2FPEA 2L0AA 2D0NA 1JQQA 2KT8A 4LUEA 2MIOA 2VKNA 4AG2C 1T0HA 2A28A 2KNBB 4OMNA 1BBZA 3FJ5A 2DBKA 2FRYA 2FPFA 1UHCA 4GBQA 4ORZA 1N5ZA 4JPBW 2W10A 2X3XD 2PZ1A 3NMZC 2AKLA 2CH4A 2KGTA 4K11A 4OMOA 1K0XA 1K9AA 2DNUA 1GRIA 2EYXA 2SEMA 5IHNA 3PVQA 4Z89A 4ZNXA 1X6BA 1SHFA 2QDLA 1SHGA 2J6KA 2RQUA 1ZLMA 4AFQC 1QLYA 3A98A 4F16A 2HBWA 3C0CA 1X27A 2DMOA 2F2XA 1LCKA 4IIOA 1CKAA 2JMCA 3H0HA 2C0IA 2EGCA 2GGRA 3M0UA 2G6FX 2AKKA 2EPDA 5FW9A 1K1ZA 2I0NA 2O31A 3PVLA 2EGEA 2HSPA 2A37A 4Y92A 2IIMA 4RTZA 2KR3A 4J9CA 4OMLA 1BK2A 2KXDA 1E6GA 1NYFA 2LJ1A 1I07A 2OAWA 4Z8AA 3UATA 1RLPC 5GJVB 1PRLC 1K4US 5I22A 2LZ6B 3M0TA 2DE0X 4J9GA 1ABQA 3ZL7C 4DEXA 1ZUYA 2K2MA 3EG3A 3I9QA 2RMOA 1OPKA 1HJDA 1UG1A 3O5ZA 2GQIA 1SPKA 4RTWA 2DL3A 2K9GA 1JU5C 1H8KA 2O9SA 1YWOA 4ESRA 2D8HA 3H0FA 3H41A 4AFZC 4DEYA 1U5SA 4EIKA 4J9EA 2M51A 3NPFA 4A63B 1U06A 2VWFA 5IXFA 1M3AA 4R0KA 2CH4W 2LJ0A 2O9VA 1WLPB 2MOXA 1XOVA 4F14A 1QKXA 2J7IA 4D8DA 1PKTA 2DL5A 1VYTA 4J9DA 4X1VA 1ZUUA 2B86A 1X2QA 1SRLA 3QWXX 2RQVA 1UTIA 2ROLA 2J05A 1AZEA 2LMJA 2RQWA 5IH2A 1KSWA 2CT3A 1AWXA 2J06A 2ED0A 2K7AA 2KRMA 1UUEA 2O88A 2KXCA 1UFFA 1QCFA 2HCKA 1KIKA 2CUBA 2KE9A 3VS0A 1KJWA 2F2WA 2EKHA 1UJYA 1YNZA 1T3LA 2K79A 3EHRA
chains in the Genus database with same CATH superfamily
3TEEA 2DEQA 2NWMA 3CCUQ 4LXCA 2NUZA 2NUTB 1NEBA 2J6FA 2E41A 4C5HA 3OYYA 1NJIC 4KT0E 2MI6A 1YI2A 1I0CA 1MV0B 2WSEE 3PE0A 3OY9A 4E7LA 1VUBA 3CCLT 4M77C 1G3WA 5KYNA 1M1KU 3CPWS 2RPNA 1KFZA 2H8HA 4Z88A 4RKUE 3EGDB 3JCMd 1GCQC 2YRDA 1K9MC 2KI7A 5CAIA 5KE2A 1VQ5A 1E7OA 2MCNA 5CKEA 4DBHA 1SSHA 4JRKA 3EGUA 3Q1JA 2COWA 4OF1A 5GANe 3I35A 2OTLQ 2E3HA 1RAIB 1B3QA 4IIMA 1PRMC 1KC8C 4F7UG 2HMAA 3L42A 2MWOA 3JB9F 3CXCA 1TXQA 3VS1A 1BI2A 2P0QA 3G4SQ 5GAN3 4M75D 1K73C 4KGZB 3EHQA 1KK7A 1KQSP 5CR2A 3CCJQ 3OBYA 5GAMj 2LVMA 4E7SA 3LGFA 1U1SA 2H3JA 4A53A 2RHIA 2EJGA 1C1AA 4ZGJB 2ED1A 4N0AA 2JMAA 5CK9A 2HBPA 3OMGA 4RTYA 1IGQA 3M55A 1M1KR 4AMCA 3RR6A 2DRKA 1M1GA 3UF4A 2EQJA 1K76A 2DO3A 3I5RA 1BKBA 2CKKA 2LDMA 1H641 1RI0A 2R5MA 4PKCC 3PFSA 3M58A 5IXBA 2RF0A 2LQNA 4PJOF 3CC4T 3JB9G 4Y28E 3CCSQ 1PSFA 2XDDA 2EBPA 4M75C 5GAN7 1YIJA 1FMWA 2YSQA 2JT4A 1T0JA 3UA6A 4C5EA 1YHQQ 3CCVA 2M02A 1B34B 1BCMA 1Y7XA 2CDTA 2DFUA 1VQPT 1SEMA 4A4EA 5A0LA 2LTOA 4M7AA 5A2QE 2QQBA 3KUFA 3BDLA 1HSQA 5GAMg 1BCOA 1YBYA 1YWPA 3C95A 3I55T 4JZ3A 4WTOB 4M7AF 2DILA 3CMAQ 4CRIA 2RK2A 2IVWA 2LX7A 4M4ZA 4XK8E 1ZBXA 2EQMA 2QAZA 4KH1B 2COZA 2KSSA 2JS2A 4WCIA 2JS0A 1W2BA 1KD1C 1Q82U 1Q81U 4KGXB 5C0MA 3DLMA 3DB3A 2GTOA 3JCMQ 2RI3A 4PJOG 3UDCA 5FLXE 2QTXA 1JEGA 2V8JA 5DY9A 4QT7A 1UE9A 3M54A 1VQNT 1QVPA 3C12A 3CBOA 2DRMA 4ZTJA 3RDVA 1MUZA 2QGGA 1N8RC 1TS9A 3HHTB 2LP5A 4FYYB 4JJBA 1PM3A 4VUBA 3CCRQ 1LOJA 1PKSA 2RM4A 1YP5A 2ABLA 1GCPA 4BE0A 4OP0A 4A4FA 3QZ9B 3DLLA 1G8XA 1QWEA 2DL7A 2A0FB 1WQ7A 4BI4A 2RNAA 1QP2A 2OJ2A 4M77F 1KQ1A 2JM9A 2K2VA 5CCAA 2E12A 1GCQA 4ELYC 1VQ5T 1NM7A 2KBTA 2DD4A 3CCUA 4LE9A 2L3QA 1K0SA 4FM4B 1M90U 1WDXA 1VYUA 5GMKh 1VQMA 2JN0A 4RTUA 4DBRA 3VKIA 2P0KA 1VYVA 2EYZA 5EC7A 1X6GA 3EFOA 2QGFB 5A0GA 4XU2A 4M78F 1QWFA 2ESWA 2HNIA 2QTVA 2ATCB 2YUQA 1MV3A 1UJ0A 4HXJA 1X01A 4M77G 3PIOA 2YLBA 5GAMf 4LUEA 2OTLA 1I4K1 4MDXA 2DPPB 3CC7Q 1T0HA 2ZZDA 2A28A 3HKSA 4L6V5 3M9QA 2FB7A 3PGGA 1IHWA 1I8FA 1VOMA 3FJ5A 5KYUB 5LJ5g 4BUGA 2PVOB 1UHCA 1QVGS 3CCJA 1OX8A 5FRMA 2NYSA 2BUDA 3QYGB 3OYBA 5I2MA 3RESA 3NMZC 2JOYA 4OMOA 1K0XA 1M90R 1AHJB 3OYDA 2KAFA 1UGPB 4M75F 2EQKA 2LX9A 4EDUA 2EYQA 4M78G 3KXTA 1SHFA 2FVUA 3JCMP 1XNIA 4PLLA 3JB9H 2VXFA 1SHGA 2RQUA 2WSFE 1WZOA 3HFNA 1QLYA 3A98A 3C0CA 1VQLT 2HKQB 1X27A 2DMOA 7AT1B 1C0MA 1VQPQ 1TUGB 3VJPA 2OTJQ 4OB0B 5CO7A 1LVKA 2X4YA 2Y4YA 5KCHA 3VYGA 1NPPA 3OS2A 3I55Q 5HK3A 2EGEA 2VV5A 2HKNA 2A37A 5GAMe 2IIMA 4RTZA 5AT1B 5LJ3h 2KR3A 2VB6A 1BK2A 5FU7C 1NYFA 2CZ0B 4MMKA 4Z8AA 2GQVA 3UATA 5GJVB 3M56A 3MKDA 3CMET 3GF5A 2DD5A 2QK0A 1RADB 1ZUYA 3EG3A 3I9QA 2RMOA 1OPKA 3VUZA 3JCMb 1SPKA 2K9GA 4M7AB 1H8KA 1OYXA 1JBMA 1WHLA 1S72Q 4P5NA 3RKXA 3H41A 4AFZC 1Q7YC 4EIKA 4XTWA 5GAN5 5LJ3d 1SSFA 2M51A 3A8LB 3AHUA 3NPFA 3EFSA 1XOVA 2X51A 4BY6C 4YTLA 3H8ZA 2J7IA 1G3YA 2DL5A 1VYTA 1X2QA 1SRLA 1UTIA 1QCOA 1G3TA 1HXDA 1KSWA 5KCOA 1VQMT 2J06A 1I5OB 1WHHA 4LDXA 2VGNA 3CC2Q 3BDUA 1UFFA 2DEUA 4A4KA 4PL6A 2PQWA 4BI8B 2HQXA 1VQOQ 4JS4A 4M77B 2K79A 3EHRA 3EH1A 3JCMV 2DL4A 2CGHA 4ZTFA 1JO8A 4LUDA 1RABB 1IZ6A 3QSUA 4OMQA 1N9RA 8AT1B 2YUNA 4E7JA 3NHNA 1TOVA 4RUGA 2DETA 4J6YA 3GIBA 1GL5A 2RB6A 3M0RA 2CP0A 4QKUA 1OI1A 2FZKB 1UHFA 1WFWA 1VQ7A 1RI9A 3BW1A 2KYBA 3RUXA 4DA4A 2AZVA 2G3RA 1ZSZA 4M78B 4HCKA 3VRZA 3QJYA 2RI2A 4LDUA 3G71A 2EJ9A 3KFVA 1YITT 2M1HA 4IUTA 4PJMA 4CC4B 2VGMA 3EGXA 3G1JA 2KDSA 1ZX6A 1K8AR 8ATCB 2MPXC 3J7AF 2JW4A 1G83A 3OYMA 4XTYA 2D1XA 4C8QA 2ECZA 2E6ZA 3OW2P 3BY7A 1ARKA 2CZ1B 4JRIA 1UEBA 1G2BA 3F70A 3LH0A 5LL6S 4C0GA 2JXBA 2Y4XA 2M9UA 2QXFA 4HKEA 1W6XA 2SRCA 5GANh 1UGRB 4C0DB 2QA4A 4CC3A 4M75B 4R55A 4ME7A 1QVFP 5CQYA 3X28B 2E6NA 2OX7A 3OYGA 2DVJA 2J6OA 4JRQA 2GNCA 1NYGA 1Y96B 5L23A 1VA7A 1PNJA 2K5IA 4PLIA 4RCCA 3DKMA 1WXTA 2DYBA 2L5QA 1OULA 2OTJA 1AD5A 4MMLA 4J9FA 1YJWA 2QI2A 1VQ6A 2EAYA 2ZPFB 3CMEQ 4ELZC 1M8VA 4RTTA 2MK5A 2W0ZA 2JTFA 2CYZB 1TU0B 4OMFB 1Q82C 4M7DE 1VQ9A 1CKBA 1M8MA 4C0ZA 5FU6C 9ATCB 3QDFA 1M4ZA 1SF9A 2XDPA 1XQHA 3CXCS 2WSCE 3LX7A 3MJXA 1AZGB 2ZPBB 3V8KA 2MMPA 3TREA 3V7RA 2CZ6B 2OI3A 3E1SA 4O6JA 2NUPA 1KHIA 2YUOA 1R77A 2HQEA 4OMPA 4KH0B 2EW3A 3CD6Q 3CCMT 4J9IA 3UA7A 3CPWP 4KRTA 4QQ6A 2FPDA 3AT1B 5D6XA 3MCAB 2RK1A 4IUPA 3G6EQ 3I56Q 2VUBA 1AWJA 1V76A 1G5VA 3JCMf 2DTOA 1NEGA 4JJNK 3EG9B 2A08A 4KGVB 2QASA 3QDRB 4HA8A 2M16A 2XMFA 2MAMA 3IQLA 4HT9A 1JJ2S 3TQ7P 1D0ZA 1PHTA 5I11A 1UGVA 1TUCA 3CCEA 1VQKQ 1VQ8T 4NL2A 2DM1A 2RQTA 2V1RA 3BE3A 1RUWA 4AFUC 3OS5A 2RHZA 1YJ9Q 5KYYB 2KT1A 2O4XA 4M7DD 1ABOA 1Y0MA 1JB0E 2GBQA 4Z02A 3CCQT 1VQ7T 5HCKA 3PT9A 1VQOA 2RH2A 2KROA 4QQDA 1RAAB 3OYCA 2PVDB 3FC3A 5FWCA 1PC0A 4PK4A 4O5VA 3RMQA 4C5IA 2JTEA 1S1NA 3NTHA 3CPWA 3JV3A 4JJDA 2AIRB 2AK5A 4NL3A 3TSWA 4LD6A 3SWNC 3ZEHA 1W2BS 5J3BA 5KYWB 1BIAA 3OSVA 2KRNA 4DBQA 3JCMe 4M7DC 4PJNA 4RTXA 2FYKA 3M0PA 3O8VA 5IAYA 2CT4A 1QKWA 3QUIA 3NTKA 1WIEA 2FPEA 2L0AA 1JQQA 3H9NA 2D6FA 4AG2C 2QA4T 1Y07A 3HRSA 5J26A 2EWNA 3A8GB 1YFNA 2QDYB 2YWWA 1KQSA 1BBZA 2DERA 2XDBA 1VQ4Q 4GBQA 4ORZA 2X3XD 1Q86R 2VC8A 2K5FA 3RMSA 4DBFA 1K9AA 2EYXA 5GAOl 2SEMA 2RJDA 2MYSA 2VASA 4ZNXA 1KHCA 3VV0A 2E70A 1D0XA 2QDLA 2J6KA 4XTVA 1Q95G 2HBWA 1D3BA 3HTRA 4FU6A 4GLKA 4JRPA 2F2XA 2ZAEA 1YI2T 1MMNA 1CKAA 2JMCA 3OQ5A 2EGCA 2GGRA 2G6FX 5L8RE 1YJNQ 4L5GA 2AKKA 5LJ3j 2EPDA 2QEXA 1NJIU 3OYIA 2LNVA 4M7AG 1U1TA 2O31A 2PU9B 2ZGWA 2HSPA 2LT1A 4TVRA 4Y92A 4C8QE 4ZGEB 6AT1B 3CCLQ 2WACA 4R56A 4FYWB 4E2FB 4L59A 1K4US 1NZ9A 5I22A 2IG0A 5EG2A 2DE0X 4J9GA 1OU8A 5FROA 1XJWB 1HJDA 1UG1A 4E7ZA 2GQIA 4RTWA 2DL3A 2GFAA 3CCET 4JS5A 5GAOq 1M2VA 3MEVA 4BY6B 3H0FA 4DEYA 5GAOm 1KC8U 2KY9A 4J9EA 3M4YA 3I56A 2VWFA 3QKJA 4R0KA 2NUPB 1PG5B 2O9VA 2MOXA 4C92D 5LJ3g 3A5ZB 1QKXA 5GAOn 2V8IA 4D8DA 1PKTA 4X1VA 2B86A 1HYOA 1TH7A 2DTIA 3FLGA 4FL6A 2ROLA 2RQWA 1VQKA 1NJIR 4FT2A 2ZPGB 3GPLA 3HSBA 4KUDK 3ER0A 4C8QD 1YJ9A 1UUEA 2O88A 4OGEA 3G4SA 4F7UE 2K3XA 1QMCA 3SWNA 4QVDA 1QCFA 2CUBA 3M59A 2KE9A 5KE3A 3VS0A 1QVGP 3DB4A 5A0DA 4M7DA 2E4HA 4OB2B 1YIJT 1PSEA 2FRWA 3L2WA 1ZSZC 2V8KA 1K9MR 4N4IA 3QXEB 2DBMA 2LCSA 1BIBA 3CCVT 4M7DF 3J81E 2R5AA 4ANJA 3CC4Q 1EX4A 4C92C 1TG0A 2ENMA 5I21A 1IXDA 1H3ZA 1A0NB 3HP9A 2CSQA 5IHKA 2DF6A 3PTAA 1FWZA 1KC8R 1AT1B 3E9FA 5IHIA 4J6WA 2K4YA 4C8QC 3VS6A 3P8DA 2NLUA 4IURA 4XTUA 1AWWA 1K73R 2YUPA 3CCSA 3MHXA 4NS5A 2DXUA 3SHWA 1OV3A 2E5QA 1RAFB 4JZ4A 2BZXA 3JCMW 2FG0A 1YHQA 4XU3A 1OZ2A 4OGCA 3L2RA 3EG1A 3M0SA 1WXBA 2DJQA 5CKDA 4IKFA 1WHMA 5GAN4 2NUTA 4M75G 3MEAA 3A8HB 2KRSA 2DAQA 3EFRA 2E5KA 2CS7A 2Y90A 3CMAA 3V7SA 1HD3A 1VQ4A 1VQNQ 3VS3A 1J3TA 1OPLA 3EAEA 1VIFA 4JJCA 3GBQA 2QEXT 2L2PA 1NLPC 2XG8D 4CI0C 3SB2A 4LDVA 3TSZA 1AWOA 3OMCA 2X35A 5LJ3f 1WGSA 1ACMB 4ATOA 3EGDA 2F5KA 4HVVA 1WQWA 2BZ8A 2RN8A 5LJ5h 4V2SA 1X69A 3CCUT 4PNOA 2L3SA 1LJOA 3A1PA 1MHNA 2X4XA 1NLOC 3CCRA 2FHDA 5I2SA 3BFMA 4QVCA 1X43A 2HEQA 2PNIA 3HRUA 3JB9D 1VQ5Q 1U3OA 3LW5E 1WXUA 3NTIA 1YJNA 2M0YA 4XQ3A 3M0QA 1ZQ1A 1JXOA 3LH5A 1K8AU 1BYMA 1P92A 1M1KC 1TUDA 1KD1R 4PJLA 2DYIA 2X3WD 4DOVA 1RAHB 3OYFA 4KUIA 1O9SA 5CKHA 2LC4A 4FSSA 4C5GA 3CCLA 2JVVA 5LJ5d 1D1CA 4BDZA 4ZN1A 1M3CA 4BD3A 1I5LA 1U8RA 2P0PA 3MP8A 3QJ6A 1Y57A 2EQIA 1N8RR 4X9CA 4MDWA 3OYEA 2OTLT 2CP2A 4XTZA 2A36A 5CKBA 1O75A 2LQWA 2YDLA 2ROTA 2KQWA 1E6HA 4C0FA 3THKA 4QVZA 4BB7A 3G4ST 3RKYA 1YCSB 2ZPHB 1WNLA 5LJ3e 3LYIA 4PJOD 1M27C 3VS4A 3CCJT 3VS5A 4Q5WA 1EFNA 3RERA 4DQ2A 4E7KA 1M2VB 2LJ3A 2LT4A 4XAXB 3C94A 2P4RA 1WI7A 3HPWA 2DKGA 4HVWA 5GAN2 2GCXA 2PUOB 3JCMg 4N4HA 4AFSC 2YXYA 3HFOA 3EFOB 4C92A 1NBEB 1EZZB 3QWYA 5GAN8 3CC7A 4RG8A 3H0IA 2VVKA 1YIJQ 5FRNA 3MO8A 3MPUB 1AVZC 4RTVA 2DLPA 4JUVA 3OYHA 1UB4A 2DTHA 2XICA 2R58A 3T9NA 3X20B 3CCST 3RIRA 3KBGA 4FW2A 4PJOC 1VQLQ 4C8QF 2RD1A 2LRQA 2EVRA 2EJFA 5AYFA 2HDAA 3SWNB 2F2VA 2IPOB 3GP8A 2QQAA 1WX6A 3OS0A 4ZGDB 4M7DB 4PJJA 4UC4A 5CQXA 3V8LA 1FMKA 2L8DA 1QQJA 3REAB 2MF2A 1BB9A 1ZBJA 1VQPA 1IREB 3M57A 4E7IA 4EMKC 1M1FA 2GFUA 1LNXA 3E19A 3R6NA 3VS2A 3META 1WJSA 3I55A 1MMDA 5GANd 2D0NA 2DZ9A 4A4HA 5D6WA 5GANf 3QIIA 1Q81C 3EH2A 3CPFA 2MIOA 2VKNA 2QYZA 2R57A 1N6AA 4C8QG 2C06A 2CP6A 3CXCP 4HCZA 5CKFA 1TWBA 4F7UA 2ZPEB 4IUVA 1R8OB 3CCRT 3OW2A 1RACB 3HRTA 4FYXB 3OYAA 1UGQB 1VQNA 3GNGA 5DM7R 4F7UF 1S72A 2CH4A 3X26B 1M5Q1 3CEYA 5IHNA 2E65A 5D7UA 2ZCFB 3LWHA 4Z89A 1QVFA 3JCMc 1X6BA 3LGLA 4M78D 1VQMQ 2VXEA 2EIFA 4BE1A 1OX9A 4AFQC 1WHGA 4F16A 2A7YA 3H6ZA 1IHVA 2HZYA 1JJ2P 3GLXA 4QW2A 1LCKA 2OAUA 3OBWA 2YRCA 2C0IA 2LQ8A 5KYXA 3MP6A 3S6WA 2KK4A 4HCCA 3WXMB 1M90C 2EFIA 2DIGA 3RKWA 4D6WA 5J39A 3CC2A 2I0NA 1HK9A 4KULA 2H3EB 3TCJA 5KYUA 1Q7YR 2KXDA 1KG1A 1I07A 1RLPC 1PRLC 1MNDA 5GMKj 2LZ6B 1Q86U 4M78C 1IRXA 1ABQA 3P8HA 2JUFA 2K2MA 1D1AA 1OQKA 2HQHA 3G71T 3JCMJ 1PD0A 4MZPA 1KQSS 3O5ZA 1WJRA 3S3MA 5HK0A 5GAN6 3N5BB 4GY5A 3CC7T 2CP3A 1N9SA 3GOXA 4E7HA 4FW1A 1YCYA 4J7IA 2COYA 3FDRA 2M0OA 4X9DA 1W2BP 1YITQ 4BDYA 4A63B 1U06A 3ZFJA 5KH6A 3UT1A 1M3AA 2K5LA 3CBMA 4E47A 3MEWA 4PJOA 1WLPB 3SD4A 4F14A 1WHKA 3J80E 1JJ2A 3OS1A 4J9DA 1IB8A 1ZHIA 1RAEB 3QHSA 2RQVA 2J05A 1AZEA 4C0DC 4XU1A 1UGSB 1ZSZB 2ZPIB 3QG1A 2RI5A 2X4WA 5HY6A 4WF2A 3JCMX 2HCKA 1V29B 2XI9A 4C92B 1KJWA 1W4SA 2L3RA 2OTJT 2EKHA 3EGXB 2HD0A 2XIDA 4EMKA 1YJWT 1TTHB 1UJYA 1YNZA 1AWXA 1T3LA 2HL5C 4KBMB 1XTDA 1VQ6T 4J8OA 2RHUA 1VQLA 1M30A 3RNJA 3V8JA 2FEIA 4C8QB 1D0YA 1GBRA 2AHJB 1M9SA 4DOWA 1VQ9T 4JDSA 1Z9ZA 2CREA 5C6SA 2QG9B 3SFMA 2DXBA 2JTMA 3TVTA 3JRZA 3REBB 2BZYA 4B6MA 2D0QB 4C92E 4LD9K 2AZSA 4LNPA 2FZCB 3M4GA 1LPLA 2E3IA 2FL7A 5FU7B 3LLRA 5M9OA 1H92A 2I2LA 1FYNA 1S72T 2LCCA 4BI3A 3CMEA 3L2QA 2C0TA 2RQRA 4A4GA 2E10A 3PMIA 4LN2A 1M3BA 3FIFA 4GLMA 4OVAA 3EG0A 4JLIA 3FJPA 4M77A 2JJ9A 2DX1A 4D8KA 1GBQA 4NOYA 3CCMQ 1X6OA 5GAOp 1AOJA 1UDLA 2LNHB 2F1LA 3CQTA 1K9MU 4LDYA 1NPRA 1WA7A 4OMMA 1TSFA 3CBPA 3ZBDA 2K6DA 5GJWB 2DL8A 1NG2A 3CD6A 1JXMA 3CC2T 1I1JA 4OB3B 3WVEB 4F17A 2PVGB 1GFCA 2AT1B 4F7UB 4RMOA 5LJ5j 1Z9QA 1T3SA 5GAMh 2F69A 3QYHB 3G6EA 4J6XA 4AG1C 1K8AC 1VQ8Q 1OZ3A 2KMTA 1VQOT 3ME9A 4OB1B 1K73U 2PTKA 1Q81R 1Q82R 3QBYA 5DLQE 5D6YA 1PWTA 1QW1A 2KYMA 4M78A 2HAXA 2K3BA 3M53A 3ULRB 1FMVA 3CCQQ 2GTJA 1VQ7Q 1WJQA 1D1BA 1Y71A 1H3HA 4II1A 4J83A 3SEMA 4HCBA 3FEOA 1SRMA 5ECAA 3S3OA 4J9BA 2EKOA 3G71Q 1I81A 5GAMd 1ZUKA 1RLQC 3VS7A 5KYXB 5FWBA 2BTTA 3RBBB 2C0OA 2MWPA 2L3PA 1MMAA 1ZA2B 4PFZA 3V7CA 4J9HA 2O4XB 2O2OA 3HL8A 2V1QA 1YN8A 1C6VX 2O01E 2QQRA 4CC2A 2CUDA 4N4GA 1X2KA 2KEAA 3NFCA 2LQKA 3X24B 2L89A 4M75A 1SKUB 1BU1A 2V26A 1IO6A 3SDZA 3INZA 2YHTA 2D9TA 3OYLA 5GAOr 1MMGA 1OEBA 2DXCA 1W70A 1Y96A 4J5YA 3OYKA 1GFDA 2VYTA 1YITA 2CSIA 2QA4Q 2DJZA 2XHCA 4MZTA 2X4JA 3NGPA 2YT6A 2PUKB 3JB9J 2RJFA 3TU4K 4FYVB 1WYXA 2DVEA 1G3SA 3UWNA 3QPHA 5GMKe 1KD1U 1CSKA 3I5SA 4XTXA 1YJWQ 1WHJA 2K57A 2DK3A 2F5TX 2JZ2A 3R6OA 1VQ6Q 3U23A 4PJOB 3C4SA 2FO0A 4QQGA 4M7DG 2JM8A 3QO3A 1QVGA 2CP5A 4J7FA 1SG5A 2CP7A 2DA9A 3JAME 1N8RU 2A3LA 4FT4A 2X9HA 2YLCA 1VQ9Q 2XD0A 1AEYA 2K3YA 5GANj 1V1CA 2EGAA 2BE9B 2RHYA 4RG2A 3QZ5B 2BE7D 4RCBA 3L2VA 1YI2Q 3VU3C 1UECA 2RO0A 4EMKB 1B07A 1W1FA 4CC7A 4PFPA 4PJOE 1X75C 1ZA1B 4FSXA 3EG9A 4FCYA 3L2ZA 3P8BB 1GXIE 2EYYA 4IUQA 2EYWA 2D8JA 3VRYA 1MNEA 5CIUA 3WVDB 3G7ZA 4EMGA 1N27A 4F04B 1OOTA 4HVUA 3E9GA 4AT1B 1ZSGA 1BI0A 1R0BG 5FU6B 1KQ2A 1WPYA 4JLGA 4E6RA 1DJ7B 5IT9E 4B9XA 1D3BB 5KYYA 3CD6T 3EG2A 4X34A 2CZ7B 3L1AA 2KT8A 1B7TA 4IUUA 3FRNA 3G6ET 3UPUA 3CCEQ 4M7AE 2E64A 3PNWC 3I56T 3M5AA 3VYHB 2RA2A 4B9WA 5LJ5f 1RL2A 5GANg 2KNBB 3CCMA 2QQSA 4OMNA 1PCXA 3VUBA 5DLOA 2P84A 2E1HA 2DBKA 2FRYA 2FPFA 2BKDN 2HSEB 2DIQA 1N5ZA 2FZGB 1VQKT 4JPBW 2W10A 1RAGB 4Y91A 2PZ1A 1YJ9T 2AKLA 2KGTA 4K11A 2DNUA 1GRIA 2LCLA 1MGQA 3ASKA 2KVQG 4XU0A 5GMKl 2XK0A 3PVQA 2XU8A 5KYWA 1NE8A 1VQ8A 2JNGA 3PIPA 4A54A 4BE2A 1BI3A 1F1BB 1ZLMA 3JSCA 4PFOA 2P4TA 4BACA 1B34A 3OYJA 4IIOA 3D7SB 3PMTA 3CCQA 1Q86C 3H0HA 2GF7A 4FIBA 2DXTA 2Z0WA 4M77E 3M0UA 5FW9A 1EIFA 2XKOC 1K1ZA 4C92F 1QCNA 3OA6A 3PVLA 3L2UA 3CCVQ 4M7AD 4N0AC 3URGA 3JB9I 4J9CA 2DZCA 4OMLA 1OU9A 2RHXA 1E6GA 2LJ1A 5LJ5e 2OAWA 3A8MB 1PD1A 1D09B 3M0TA 3ZL7C 4DEXA 1YHQT 1M2OA 3X25B 3OYNA 3CC4A 3LWIA 3MP1A 3OW2S 1JU5C 1R0CB 1IGUA 2O9SA 1YWOA 4ESRA 5HKCA 2D8HA 4M78E 4HT8A 4EPCA 4LDWA 3OB9A 1U5SA 5GMKm 1VIEA 3MEUA 3OSSC 3CMAT 2EQUA 1VQ4T 4M7AC 5IXFA 2CH4W 1QP3A 2LJ0A 1FXXA 1FX7A 1QVFS 4C92G 5IN1A 3E2UA 2B8AA 2RJCA 1JRIA 4M77D 4ZN3A 1ZUUA 3GNFB 1BI1A 3QWXX 2YRVA 2RJEA 2LMJA 3S3NA 3FB9A 5IH2A 2CT3A 1Q7YU 2ED0A 2K7AA 2KRMA 2QQ9A 4EMHA 2QEXQ 2KXCA 4MZMA 3A8OB 5CVIA 1KIKA 2F2WA 2BIVA 2HL3A 4M75E 5GMKi 3JCMh 1YJNT
chains in the Genus database with same CATH topology
2NWMA 2DL4A 2NUZA 1NEBA 2DBMA 1JO8A 2J6FA 4LUDA 2LCSA 1M30A 3RNJA 4OMQA 2FEIA 1I0CA 1MV0B 1TG0A 2ENMA 3PE0A 1GBRA 1A0NB 1Z9ZA 2YUNA 2CSQA 5IHKA 2DF6A 2CREA 3NHNA 4RUGA 3TVTA 2RPNA 3REBB 1KFZA 2BZYA 2H8HA 5IHIA 4Z88A 1GL5A 3M0RA 2AZSA 4LNPA 3VS6A 1UHFA 1WFWA 1AWWA 1RI9A 2YUPA 1GCQC 1H92A 3SHWA 1E7OA 2KYBA 1OV3A 1FYNA 2AZVA 4JZ4A 2MCNA 2BZXA 4HCKA 3VRZA 2C0TA 1SSHA 2RQRA 2FG0A 3EGUA 3I35A 4LN2A 1B3QA 1M3BA 3KFVA 4IIMA 1PRMC 4CC4B 4GLMA 3EG0A 3EG1A 3M0SA 1WXBA 2DJQA 2DX1A 4D8KA 1ZX6A 3VS1A 1GBQA 1AOJA 1UDLA 2KRSA 2LNHB 2JW4A 3CQTA 3EHQA 2E5KA 1G83A 2D1XA 1WA7A 1HD3A 2ECZA 4OMMA 3VS3A 1J3TA 1OPLA 2FRWA 2K6DA 5GJWB 1ARKA 4JJCA 1G2BA 2DL8A 2L2PA 3GBQA 1NLPC 1NG2A 2ED1A 1JXMA 1I1JA 4F17A 1GFCA 2JXBA 2JMAA 1W6XA 1Z9QA 1T3SA 2SRCA 3TSZA 1AWOA 4RTYA 4AG1C 4CC3A 2DRKA 3UF4A 4HVVA 2BZ8A 2PTKA 2RN8A 1K76A 1PWTA 1X69A 2KYMA 2DVJA 2J6OA 3I5RA 2L3SA 2GNCA 1NYGA 1NLOC 5L23A 2K3BA 1VA7A 5IXBA 1PNJA 3ULRB 2GTJA 2RF0A 2LQNA 1WXTA 2DYBA 1X43A 2HEQA 2PNIA 1AD5A 4J9FA 1H3HA 1U3OA 2EBPA 1WXUA 2YSQA 2M0YA 3SEMA 3M0QA 2JT4A 1T0JA 3UA6A 1SRMA 1JXOA 4RTTA 3LH5A 5ECAA 2W0ZA 4J9BA 1TUDA 1ZUKA 2CDTA 2X3WD 1RLQC 1SEMA 3VS7A 5FWBA 4FSSA 1CKBA 1M8MA 2BTTA 3RBBB 2C0OA 2L3PA 1HSQA 1M3CA 1YWPA 4J9HA 1AZGB 4JZ3A 2O2OA 2V1QA 1YN8A 1Y57A 2EQIA 2DILA 4CC2A 2CUDA 2LX7A 4M4ZA 1X2KA 2OI3A 2A36A 2KEAA 2LQWA 2YDLA 1BU1A 2ROTA 2YUOA 1E6HA 4OMPA 1IO6A 2JS2A 4WCIA 3THKA 2JS0A 2EW3A 4J9IA 3UA7A 4KRTA 1YCSB 2FPDA 1OEBA 1W70A 2GTOA 1JEGA 1GFDA 1M27C 3VS4A 2CSIA 3VS5A 4QT7A 1EFNA 1AWJA 1UE9A 2DRMA 3NGPA 1NEGA 2YT6A 1MUZA 2A08A 2LJ3A 2P4RA 1WI7A 2LP5A 4HVWA 2XMFA 3IQLA 1WYXA 4JJBA 4AFSC 1PKSA 1PHTA 1YP5A 5I11A 1UGVA 2ABLA 1GCPA 1TUCA 3QWYA 1CSKA 3I5SA 3H0IA 2DM1A 2RQTA 2V1RA 2VVKA 1RUWA 4AFUC 3U23A 1QWEA 2DL7A 1AVZC 2FO0A 2KT1A 4RTVA 2JM8A 2RNAA 2DLPA 1ABOA 1Y0MA 2OJ2A 2GBQA 2JM9A 2DA9A 5HCKA 1GCQA 1AEYA 1NM7A 1V1CA 2EGAA 2KROA 2KBTA 2EVRA 4LE9A 2HDAA 2L3QA 2F2VA 5FWCA 1K0SA 1WDXA 1UECA 1WX6A 2JTEA 1VYUA 1S1NA 1B07A 1W1FA 4CC7A 1FMKA 3JV3A 4RTUA 4JJDA 3REAB 2AK5A 1VYVA 2EYZA 5EC7A 2EYYA 2EYWA 1X6GA 3TSWA 1BB9A 2D8JA 3VRYA 1ZBJA 1OOTA 2KRNA 4HVUA 1QWFA 1ZSGA 2ESWA 4RTXA 3M0PA 3R6NA 3VS2A 4E6RA 2YUQA 1MV3A 1UJ0A 2CT4A 1QKWA 4HXJA 3EG2A 1WIEA 2FPEA 2L0AA 2D0NA 1JQQA 2KT8A 4LUEA 2MIOA 2VKNA 4AG2C 1T0HA 2A28A 2KNBB 4OMNA 1BBZA 3FJ5A 2DBKA 2FRYA 2FPFA 1UHCA 4GBQA 4ORZA 1N5ZA 4JPBW 2W10A 2X3XD 2PZ1A 3NMZC 2AKLA 2CH4A 2KGTA 4K11A 4OMOA 1K0XA 1K9AA 2DNUA 1GRIA 2EYXA 2SEMA 5IHNA 3PVQA 4Z89A 4ZNXA 1X6BA 1SHFA 2QDLA 1SHGA 2J6KA 2RQUA 1ZLMA 4AFQC 1QLYA 3A98A 4F16A 2HBWA 3C0CA 1X27A 2DMOA 2F2XA 1LCKA 4IIOA 1CKAA 2JMCA 3H0HA 2C0IA 2EGCA 2GGRA 3M0UA 2G6FX 2AKKA 2EPDA 5FW9A 1K1ZA 2I0NA 2O31A 3PVLA 2EGEA 2HSPA 2A37A 4Y92A 2IIMA 4RTZA 2KR3A 4J9CA 4OMLA 1BK2A 2KXDA 1E6GA 1NYFA 2LJ1A 1I07A 2OAWA 4Z8AA 3UATA 1RLPC 5GJVB 1PRLC 1K4US 5I22A 2LZ6B 3M0TA 2DE0X 4J9GA 1ABQA 3ZL7C 4DEXA 1ZUYA 2K2MA 3EG3A 3I9QA 2RMOA 1OPKA 1HJDA 1UG1A 3O5ZA 2GQIA 1SPKA 4RTWA 2DL3A 2K9GA 1JU5C 1H8KA 2O9SA 1YWOA 4ESRA 2D8HA 3H0FA 3H41A 4AFZC 4DEYA 1U5SA 4EIKA 4J9EA 2M51A 3NPFA 4A63B 1U06A 2VWFA 5IXFA 1M3AA 4R0KA 2CH4W 2LJ0A 2O9VA 1WLPB 2MOXA 1XOVA 4F14A 1QKXA 2J7IA 4D8DA 1PKTA 2DL5A 1VYTA 4J9DA 4X1VA 1ZUUA 2B86A 1X2QA 1SRLA 3QWXX 2RQVA 1UTIA 2ROLA 2J05A 1AZEA 2LMJA 2RQWA 5IH2A 1KSWA 2CT3A 1AWXA 2J06A 2ED0A 2K7AA 2KRMA 1UUEA 2O88A 2KXCA 1UFFA 1QCFA 2HCKA 1KIKA 2CUBA 2KE9A 3VS0A 1KJWA 2F2WA 2EKHA 1UJYA 1YNZA 1T3LA 2K79A 3EHRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NWM A;  2DL4 A;  2NUZ A;  1NEB A;  2DBM A;  1JO8 A;  2J6F A;  4LUD A;  2LCS A;  1M30 A;  3RNJ A;  4OMQ A;  2FEI A;  1I0C A;  1MV0 B;  1TG0 A;  2ENM A;  3PE0 A;  1GBR A;  1A0N B;  1Z9Z A;  2YUN A;  2CSQ A;  5IHK A;  2DF6 A;  2CRE A;  3NHN A;  4RUG A;  3TVT A;  2RPN A;  3REB B;  1KFZ A;  2BZY A;  2H8H A;  5IHI A;  4Z88 A;  1GL5 A;  3M0R A;  2AZS A;  4LNP A;  3VS6 A;  1UHF A;  1WFW A;  1AWW A;  1RI9 A;  2YUP A;  1GCQ C;  1H92 A;  3SHW A;  1E7O A;  2KYB A;  1OV3 A;  1FYN A;  2AZV A;  4JZ4 A;  2MCN A;  2BZX A;  4HCK A;  3VRZ A;  2C0T A;  1SSH A;  2RQR A;  2FG0 A;  3EGU A;  3I35 A;  4LN2 A;  1B3Q A;  1M3B A;  3KFV A;  4IIM A;  1PRM C;  4CC4 B;  4GLM A;  3EG0 A;  3EG1 A;  3M0S A;  1WXB A;  2DJQ A;  2DX1 A;  4D8K A;  1ZX6 A;  3VS1 A;  1GBQ A;  1AOJ A;  1UDL A;  2KRS A;  2LNH B;  2JW4 A;  3CQT A;  3EHQ A;  2E5K A;  1G83 A;  2D1X A;  1WA7 A;  1HD3 A;  2ECZ A;  4OMM A;  3VS3 A;  1J3T A;  1OPL A;  2FRW A;  2K6D A;  5GJW B;  1ARK A;  4JJC A;  1G2B A;  2DL8 A;  2L2P A;  3GBQ A;  1NLP C;  1NG2 A;  2ED1 A;  1JXM A;  1I1J A;  4F17 A;  1GFC A;  2JXB A;  2JMA A;  1W6X A;  1Z9Q A;  1T3S A;  2SRC A;  3TSZ A;  1AWO A;  4RTY A;  4AG1 C;  4CC3 A;  2DRK A;  3UF4 A;  4HVV A;  2BZ8 A;  2PTK A;  2RN8 A;  1K76 A;  1PWT A;  1X69 A;  2KYM A;  2DVJ A;  2J6O A;  3I5R A;  2L3S A;  2GNC A;  1NYG A;  1NLO C;  5L23 A;  2K3B A;  1VA7 A;  5IXB A;  1PNJ A;  3ULR B;  2GTJ A;  2RF0 A;  2LQN A;  1WXT A;  2DYB A;  1X43 A;  2HEQ A;  2PNI A;  1AD5 A;  4J9F A;  1H3H A;  1U3O A;  2EBP A;  1WXU A;  2YSQ A;  2M0Y A;  3SEM A;  3M0Q A;  2JT4 A;  1T0J A;  3UA6 A;  1SRM A;  1JXO A;  4RTT A;  3LH5 A;  5ECA A;  2W0Z A;  4J9B A;  1TUD A;  1ZUK A;  2CDT A;  2X3W D;  1RLQ C;  1SEM A;  3VS7 A;  5FWB A;  4FSS A;  1CKB A;  1M8M A;  2BTT A;  3RBB B;  2C0O A;  2L3P A;  1HSQ A;  1M3C A;  1YWP A;  4J9H A;  1AZG B;  4JZ3 A;  2O2O A;  2V1Q A;  1YN8 A;  1Y57 A;  2EQI A;  2DIL A;  4CC2 A;  2CUD A;  2LX7 A;  4M4Z A;  1X2K A;  2OI3 A;  2A36 A;  2KEA A;  2LQW A;  2YDL A;  1BU1 A;  2ROT A;  2YUO A;  1E6H A;  4OMP A;  1IO6 A;  2JS2 A;  4WCI A;  3THK A;  2JS0 A;  2EW3 A;  4J9I A;  3UA7 A;  4KRT A;  1YCS B;  2FPD A;  1OEB A;  1W70 A;  2GTO A;  1JEG A;  1GFD A;  1M27 C;  3VS4 A;  2CSI A;  3VS5 A;  4QT7 A;  1EFN A;  1AWJ A;  1UE9 A;  2DRM A;  3NGP A;  1NEG A;  2YT6 A;  1MUZ A;  2A08 A;  2LJ3 A;  2P4R A;  1WI7 A;  2LP5 A;  4HVW A;  2XMF A;  3IQL A;  1WYX A;  4JJB A;  4AFS C;  1PKS A;  1PHT A;  1YP5 A;  5I11 A;  1UGV A;  2ABL A;  1GCP A;  1TUC A;  3QWY A;  1CSK A;  3I5S A;  3H0I A;  2DM1 A;  2RQT A;  2V1R A;  2VVK A;  1RUW A;  4AFU C;  3U23 A;  1QWE A;  2DL7 A;  1AVZ C;  2FO0 A;  2KT1 A;  4RTV A;  2JM8 A;  2RNA A;  2DLP A;  1ABO A;  1Y0M A;  2OJ2 A;  2GBQ A;  2JM9 A;  2DA9 A;  5HCK A;  1GCQ A;  1AEY A;  1NM7 A;  1V1C A;  2EGA A;  2KRO A;  2KBT A;  2EVR A;  4LE9 A;  2HDA A;  2L3Q A;  2F2V A;  5FWC A;  1K0S A;  1WDX A;  1UEC A;  1WX6 A;  2JTE A;  1VYU A;  1S1N A;  1B07 A;  1W1F A;  4CC7 A;  1FMK A;  3JV3 A;  4RTU A;  4JJD A;  3REA B;  2AK5 A;  1VYV A;  2EYZ A;  5EC7 A;  2EYY A;  2EYW A;  1X6G A;  3TSW A;  1BB9 A;  2D8J A;  3VRY A;  1ZBJ A;  1OOT A;  2KRN A;  4HVU A;  1QWF A;  1ZSG A;  2ESW A;  4RTX A;  3M0P A;  3R6N A;  3VS2 A;  4E6R A;  2YUQ A;  1MV3 A;  1UJ0 A;  2CT4 A;  1QKW A;  4HXJ A;  3EG2 A;  1WIE A;  2FPE A;  2L0A A;  2D0N A;  1JQQ A;  2KT8 A;  4LUE A;  2MIO A;  2VKN A;  4AG2 C;  1T0H A;  2A28 A;  2KNB B;  4OMN A;  1BBZ A;  3FJ5 A;  2DBK A;  2FRY A;  2FPF A;  1UHC A;  4GBQ A;  4ORZ A;  1N5Z A;  4JPB W;  2W10 A;  2X3X D;  2PZ1 A;  3NMZ C;  2AKL A;  2CH4 A;  2KGT A;  4K11 A;  4OMO A;  1K0X A;  1K9A A;  2DNU A;  1GRI A;  2EYX A;  2SEM A;  5IHN A;  3PVQ A;  4Z89 A;  4ZNX A;  1X6B A;  1SHF A;  2QDL A;  1SHG A;  2J6K A;  2RQU A;  1ZLM A;  4AFQ C;  1QLY A;  3A98 A;  4F16 A;  2HBW A;  3C0C A;  1X27 A;  2DMO A;  2F2X A;  1LCK A;  4IIO A;  1CKA A;  2JMC A;  3H0H A;  2C0I A;  2EGC A;  2GGR A;  3M0U A;  2G6F X;  2AKK A;  2EPD A;  5FW9 A;  1K1Z A;  2I0N A;  2O31 A;  3PVL A;  2EGE A;  2HSP A;  2A37 A;  4Y92 A;  2IIM A;  4RTZ A;  2KR3 A;  4J9C A;  4OML A;  1BK2 A;  2KXD A;  1E6G A;  1NYF A;  2LJ1 A;  1I07 A;  2OAW A;  4Z8A A;  3UAT A;  1RLP C;  5GJV B;  1PRL C;  1K4U S;  5I22 A;  2LZ6 B;  3M0T A;  2DE0 X;  4J9G A;  1ABQ A;  3ZL7 C;  4DEX A;  1ZUY A;  2K2M A;  3EG3 A;  3I9Q A;  2RMO A;  1OPK A;  1HJD A;  1UG1 A;  3O5Z A;  2GQI A;  1SPK A;  4RTW A;  2DL3 A;  2K9G A;  1JU5 C;  1H8K A;  2O9S A;  1YWO A;  4ESR A;  2D8H A;  3H0F A;  3H41 A;  4AFZ C;  4DEY A;  1U5S A;  4EIK A;  4J9E A;  2M51 A;  3NPF A;  4A63 B;  1U06 A;  2VWF A;  5IXF A;  1M3A A;  4R0K A;  2CH4 W;  2LJ0 A;  2O9V A;  1WLP B;  2MOX A;  1XOV A;  4F14 A;  1QKX A;  2J7I A;  4D8D A;  1PKT A;  2DL5 A;  1VYT A;  4J9D A;  4X1V A;  1ZUU A;  2B86 A;  1X2Q A;  1SRL A;  3QWX X;  2RQV A;  1UTI A;  2ROL A;  2J05 A;  1AZE A;  2LMJ A;  2RQW A;  5IH2 A;  1KSW A;  2CT3 A;  1AWX A;  2J06 A;  2ED0 A;  2K7A A;  2KRM A;  1UUE A;  2O88 A;  2KXC A;  1UFF A;  1QCF A;  2HCK A;  1KIK A;  2CUB A;  2KE9 A;  3VS0 A;  1KJW A;  2F2W A;  2EKH A;  1UJY A;  1YNZ A;  1T3L A;  2K79 A;  3EHR A; 
#chains in the Genus database with same CATH topology
 3TEE A;  2DEQ A;  2NWM A;  3CCU Q;  4LXC A;  2NUZ A;  2NUT B;  1NEB A;  2J6F A;  2E41 A;  4C5H A;  3OYY A;  1NJI C;  4KT0 E;  2MI6 A;  1YI2 A;  1I0C A;  1MV0 B;  2WSE E;  3PE0 A;  3OY9 A;  4E7L A;  1VUB A;  3CCL T;  4M77 C;  1G3W A;  5KYN A;  1M1K U;  3CPW S;  2RPN A;  1KFZ A;  2H8H A;  4Z88 A;  4RKU E;  3EGD B;  3JCM d;  1GCQ C;  2YRD A;  1K9M C;  2KI7 A;  5CAI A;  5KE2 A;  1VQ5 A;  1E7O A;  2MCN A;  5CKE A;  4DBH A;  1SSH A;  4JRK A;  3EGU A;  3Q1J A;  2COW A;  4OF1 A;  5GAN e;  3I35 A;  2OTL Q;  2E3H A;  1RAI B;  1B3Q A;  4IIM A;  1PRM C;  1KC8 C;  4F7U G;  2HMA A;  3L42 A;  2MWO A;  3JB9 F;  3CXC A;  1TXQ A;  3VS1 A;  1BI2 A;  2P0Q A;  3G4S Q;  5GAN 3;  4M75 D;  1K73 C;  4KGZ B;  3EHQ A;  1KK7 A;  1KQS P;  5CR2 A;  3CCJ Q;  3OBY A;  5GAM j;  2LVM A;  4E7S A;  3LGF A;  1U1S A;  2H3J A;  4A53 A;  2RHI A;  2EJG A;  1C1A A;  4ZGJ B;  2ED1 A;  4N0A A;  2JMA A;  5CK9 A;  2HBP A;  3OMG A;  4RTY A;  1IGQ A;  3M55 A;  1M1K R;  4AMC A;  3RR6 A;  2DRK A;  1M1G A;  3UF4 A;  2EQJ A;  1K76 A;  2DO3 A;  3I5R A;  1BKB A;  2CKK A;  2LDM A;  1H64 1;  1RI0 A;  2R5M A;  4PKC C;  3PFS A;  3M58 A;  5IXB A;  2RF0 A;  2LQN A;  4PJO F;  3CC4 T;  3JB9 G;  4Y28 E;  3CCS Q;  1PSF A;  2XDD A;  2EBP A;  4M75 C;  5GAN 7;  1YIJ A;  1FMW A;  2YSQ A;  2JT4 A;  1T0J A;  3UA6 A;  4C5E A;  1YHQ Q;  3CCV A;  2M02 A;  1B34 B;  1BCM A;  1Y7X A;  2CDT A;  2DFU A;  1VQP T;  1SEM A;  4A4E A;  5A0L A;  2LTO A;  4M7A A;  5A2Q E;  2QQB A;  3KUF A;  3BDL A;  1HSQ A;  5GAM g;  1BCO A;  1YBY A;  1YWP A;  3C95 A;  3I55 T;  4JZ3 A;  4WTO B;  4M7A F;  2DIL A;  3CMA Q;  4CRI A;  2RK2 A;  2IVW A;  2LX7 A;  4M4Z A;  4XK8 E;  1ZBX A;  2EQM A;  2QAZ A;  4KH1 B;  2COZ A;  2KSS A;  2JS2 A;  4WCI A;  2JS0 A;  1W2B A;  1KD1 C;  1Q82 U;  1Q81 U;  4KGX B;  5C0M A;  3DLM A;  3DB3 A;  2GTO A;  3JCM Q;  2RI3 A;  4PJO G;  3UDC A;  5FLX E;  2QTX A;  1JEG A;  2V8J A;  5DY9 A;  4QT7 A;  1UE9 A;  3M54 A;  1VQN T;  1QVP A;  3C12 A;  3CBO A;  2DRM A;  4ZTJ A;  3RDV A;  1MUZ A;  2QGG A;  1N8R C;  1TS9 A;  3HHT B;  2LP5 A;  4FYY B;  4JJB A;  1PM3 A;  4VUB A;  3CCR Q;  1LOJ A;  1PKS A;  2RM4 A;  1YP5 A;  2ABL A;  1GCP A;  4BE0 A;  4OP0 A;  4A4F A;  3QZ9 B;  3DLL A;  1G8X A;  1QWE A;  2DL7 A;  2A0F B;  1WQ7 A;  4BI4 A;  2RNA A;  1QP2 A;  2OJ2 A;  4M77 F;  1KQ1 A;  2JM9 A;  2K2V A;  5CCA A;  2E12 A;  1GCQ A;  4ELY C;  1VQ5 T;  1NM7 A;  2KBT A;  2DD4 A;  3CCU A;  4LE9 A;  2L3Q A;  1K0S A;  4FM4 B;  1M90 U;  1WDX A;  1VYU A;  5GMK h;  1VQM A;  2JN0 A;  4RTU A;  4DBR A;  3VKI A;  2P0K A;  1VYV A;  2EYZ A;  5EC7 A;  1X6G A;  3EFO A;  2QGF B;  5A0G A;  4XU2 A;  4M78 F;  1QWF A;  2ESW A;  2HNI A;  2QTV A;  2ATC B;  2YUQ A;  1MV3 A;  1UJ0 A;  4HXJ A;  1X01 A;  4M77 G;  3PIO A;  2YLB A;  5GAM f;  4LUE A;  2OTL A;  1I4K 1;  4MDX A;  2DPP B;  3CC7 Q;  1T0H A;  2ZZD A;  2A28 A;  3HKS A;  4L6V 5;  3M9Q A;  2FB7 A;  3PGG A;  1IHW A;  1I8F A;  1VOM A;  3FJ5 A;  5KYU B;  5LJ5 g;  4BUG A;  2PVO B;  1UHC A;  1QVG S;  3CCJ A;  1OX8 A;  5FRM A;  2NYS A;  2BUD A;  3QYG B;  3OYB A;  5I2M A;  3RES A;  3NMZ C;  2JOY A;  4OMO A;  1K0X A;  1M90 R;  1AHJ B;  3OYD A;  2KAF A;  1UGP B;  4M75 F;  2EQK A;  2LX9 A;  4EDU A;  2EYQ A;  4M78 G;  3KXT A;  1SHF A;  2FVU A;  3JCM P;  1XNI A;  4PLL A;  3JB9 H;  2VXF A;  1SHG A;  2RQU A;  2WSF E;  1WZO A;  3HFN A;  1QLY A;  3A98 A;  3C0C A;  1VQL T;  2HKQ B;  1X27 A;  2DMO A;  7AT1 B;  1C0M A;  1VQP Q;  1TUG B;  3VJP A;  2OTJ Q;  4OB0 B;  5CO7 A;  1LVK A;  2X4Y A;  2Y4Y A;  5KCH A;  3VYG A;  1NPP A;  3OS2 A;  3I55 Q;  5HK3 A;  2EGE A;  2VV5 A;  2HKN A;  2A37 A;  5GAM e;  2IIM A;  4RTZ A;  5AT1 B;  5LJ3 h;  2KR3 A;  2VB6 A;  1BK2 A;  5FU7 C;  1NYF A;  2CZ0 B;  4MMK A;  4Z8A A;  2GQV A;  3UAT A;  5GJV B;  3M56 A;  3MKD A;  3CME T;  3GF5 A;  2DD5 A;  2QK0 A;  1RAD B;  1ZUY A;  3EG3 A;  3I9Q A;  2RMO A;  1OPK A;  3VUZ A;  3JCM b;  1SPK A;  2K9G A;  4M7A B;  1H8K A;  1OYX A;  1JBM A;  1WHL A;  1S72 Q;  4P5N A;  3RKX A;  3H41 A;  4AFZ C;  1Q7Y C;  4EIK A;  4XTW A;  5GAN 5;  5LJ3 d;  1SSF A;  2M51 A;  3A8L B;  3AHU A;  3NPF A;  3EFS A;  1XOV A;  2X51 A;  4BY6 C;  4YTL A;  3H8Z A;  2J7I A;  1G3Y A;  2DL5 A;  1VYT A;  1X2Q A;  1SRL A;  1UTI A;  1QCO A;  1G3T A;  1HXD A;  1KSW A;  5KCO A;  1VQM T;  2J06 A;  1I5O B;  1WHH A;  4LDX A;  2VGN A;  3CC2 Q;  3BDU A;  1UFF A;  2DEU A;  4A4K A;  4PL6 A;  2PQW A;  4BI8 B;  2HQX A;  1VQO Q;  4JS4 A;  4M77 B;  2K79 A;  3EHR A;  3EH1 A;  3JCM V;  2DL4 A;  2CGH A;  4ZTF A;  1JO8 A;  4LUD A;  1RAB B;  1IZ6 A;  3QSU A;  4OMQ A;  1N9R A;  8AT1 B;  2YUN A;  4E7J A;  3NHN A;  1TOV A;  4RUG A;  2DET A;  4J6Y A;  3GIB A;  1GL5 A;  2RB6 A;  3M0R A;  2CP0 A;  4QKU A;  1OI1 A;  2FZK B;  1UHF A;  1WFW A;  1VQ7 A;  1RI9 A;  3BW1 A;  2KYB A;  3RUX A;  4DA4 A;  2AZV A;  2G3R A;  1ZSZ A;  4M78 B;  4HCK A;  3VRZ A;  3QJY A;  2RI2 A;  4LDU A;  3G71 A;  2EJ9 A;  3KFV A;  1YIT T;  2M1H A;  4IUT A;  4PJM A;  4CC4 B;  2VGM A;  3EGX A;  3G1J A;  2KDS A;  1ZX6 A;  1K8A R;  8ATC B;  2MPX C;  3J7A F;  2JW4 A;  1G83 A;  3OYM A;  4XTY A;  2D1X A;  4C8Q A;  2ECZ A;  2E6Z A;  3OW2 P;  3BY7 A;  1ARK A;  2CZ1 B;  4JRI A;  1UEB A;  1G2B A;  3F70 A;  3LH0 A;  5LL6 S;  4C0G A;  2JXB A;  2Y4X A;  2M9U A;  2QXF A;  4HKE A;  1W6X A;  2SRC A;  5GAN h;  1UGR B;  4C0D B;  2QA4 A;  4CC3 A;  4M75 B;  4R55 A;  4ME7 A;  1QVF P;  5CQY A;  3X28 B;  2E6N A;  2OX7 A;  3OYG A;  2DVJ A;  2J6O A;  4JRQ A;  2GNC A;  1NYG A;  1Y96 B;  5L23 A;  1VA7 A;  1PNJ A;  2K5I A;  4PLI A;  4RCC A;  3DKM A;  1WXT A;  2DYB A;  2L5Q A;  1OUL A;  2OTJ A;  1AD5 A;  4MML A;  4J9F A;  1YJW A;  2QI2 A;  1VQ6 A;  2EAY A;  2ZPF B;  3CME Q;  4ELZ C;  1M8V A;  4RTT A;  2MK5 A;  2W0Z A;  2JTF A;  2CYZ B;  1TU0 B;  4OMF B;  1Q82 C;  4M7D E;  1VQ9 A;  1CKB A;  1M8M A;  4C0Z A;  5FU6 C;  9ATC B;  3QDF A;  1M4Z A;  1SF9 A;  2XDP A;  1XQH A;  3CXC S;  2WSC E;  3LX7 A;  3MJX A;  1AZG B;  2ZPB B;  3V8K A;  2MMP A;  3TRE A;  3V7R A;  2CZ6 B;  2OI3 A;  3E1S A;  4O6J A;  2NUP A;  1KHI A;  2YUO A;  1R77 A;  2HQE A;  4OMP A;  4KH0 B;  2EW3 A;  3CD6 Q;  3CCM T;  4J9I A;  3UA7 A;  3CPW P;  4KRT A;  4QQ6 A;  2FPD A;  3AT1 B;  5D6X A;  3MCA B;  2RK1 A;  4IUP A;  3G6E Q;  3I56 Q;  2VUB A;  1AWJ A;  1V76 A;  1G5V A;  3JCM f;  2DTO A;  1NEG A;  4JJN K;  3EG9 B;  2A08 A;  4KGV B;  2QAS A;  3QDR B;  4HA8 A;  2M16 A;  2XMF A;  2MAM A;  3IQL A;  4HT9 A;  1JJ2 S;  3TQ7 P;  1D0Z A;  1PHT A;  5I11 A;  1UGV A;  1TUC A;  3CCE A;  1VQK Q;  1VQ8 T;  4NL2 A;  2DM1 A;  2RQT A;  2V1R A;  3BE3 A;  1RUW A;  4AFU C;  3OS5 A;  2RHZ A;  1YJ9 Q;  5KYY B;  2KT1 A;  2O4X A;  4M7D D;  1ABO A;  1Y0M A;  1JB0 E;  2GBQ A;  4Z02 A;  3CCQ T;  1VQ7 T;  5HCK A;  3PT9 A;  1VQO A;  2RH2 A;  2KRO A;  4QQD A;  1RAA B;  3OYC A;  2PVD B;  3FC3 A;  5FWC A;  1PC0 A;  4PK4 A;  4O5V A;  3RMQ A;  4C5I A;  2JTE A;  1S1N A;  3NTH A;  3CPW A;  3JV3 A;  4JJD A;  2AIR B;  2AK5 A;  4NL3 A;  3TSW A;  4LD6 A;  3SWN C;  3ZEH A;  1W2B S;  5J3B A;  5KYW B;  1BIA A;  3OSV A;  2KRN A;  4DBQ A;  3JCM e;  4M7D C;  4PJN A;  4RTX A;  2FYK A;  3M0P A;  3O8V A;  5IAY A;  2CT4 A;  1QKW A;  3QUI A;  3NTK A;  1WIE A;  2FPE A;  2L0A A;  1JQQ A;  3H9N A;  2D6F A;  4AG2 C;  2QA4 T;  1Y07 A;  3HRS A;  5J26 A;  2EWN A;  3A8G B;  1YFN A;  2QDY B;  2YWW A;  1KQS A;  1BBZ A;  2DER A;  2XDB A;  1VQ4 Q;  4GBQ A;  4ORZ A;  2X3X D;  1Q86 R;  2VC8 A;  2K5F A;  3RMS A;  4DBF A;  1K9A A;  2EYX A;  5GAO l;  2SEM A;  2RJD A;  2MYS A;  2VAS A;  4ZNX A;  1KHC A;  3VV0 A;  2E70 A;  1D0X A;  2QDL A;  2J6K A;  4XTV A;  1Q95 G;  2HBW A;  1D3B A;  3HTR A;  4FU6 A;  4GLK A;  4JRP A;  2F2X A;  2ZAE A;  1YI2 T;  1MMN A;  1CKA A;  2JMC A;  3OQ5 A;  2EGC A;  2GGR A;  2G6F X;  5L8R E;  1YJN Q;  4L5G A;  2AKK A;  5LJ3 j;  2EPD A;  2QEX A;  1NJI U;  3OYI A;  2LNV A;  4M7A G;  1U1T A;  2O31 A;  2PU9 B;  2ZGW A;  2HSP A;  2LT1 A;  4TVR A;  4Y92 A;  4C8Q E;  4ZGE B;  6AT1 B;  3CCL Q;  2WAC A;  4R56 A;  4FYW B;  4E2F B;  4L59 A;  1K4U S;  1NZ9 A;  5I22 A;  2IG0 A;  5EG2 A;  2DE0 X;  4J9G A;  1OU8 A;  5FRO A;  1XJW B;  1HJD A;  1UG1 A;  4E7Z A;  2GQI A;  4RTW A;  2DL3 A;  2GFA A;  3CCE T;  4JS5 A;  5GAO q;  1M2V A;  3MEV A;  4BY6 B;  3H0F A;  4DEY A;  5GAO m;  1KC8 U;  2KY9 A;  4J9E A;  3M4Y A;  3I56 A;  2VWF A;  3QKJ A;  4R0K A;  2NUP B;  1PG5 B;  2O9V A;  2MOX A;  4C92 D;  5LJ3 g;  3A5Z B;  1QKX A;  5GAO n;  2V8I A;  4D8D A;  1PKT A;  4X1V A;  2B86 A;  1HYO A;  1TH7 A;  2DTI A;  3FLG A;  4FL6 A;  2ROL A;  2RQW A;  1VQK A;  1NJI R;  4FT2 A;  2ZPG B;  3GPL A;  3HSB A;  4KUD K;  3ER0 A;  4C8Q D;  1YJ9 A;  1UUE A;  2O88 A;  4OGE A;  3G4S A;  4F7U E;  2K3X A;  1QMC A;  3SWN A;  4QVD A;  1QCF A;  2CUB A;  3M59 A;  2KE9 A;  5KE3 A;  3VS0 A;  1QVG P;  3DB4 A;  5A0D A;  4M7D A;  2E4H A;  4OB2 B;  1YIJ T;  1PSE A;  2FRW A;  3L2W A;  1ZSZ C;  2V8K A;  1K9M R;  4N4I A;  3QXE B;  2DBM A;  2LCS A;  1BIB A;  3CCV T;  4M7D F;  3J81 E;  2R5A A;  4ANJ A;  3CC4 Q;  1EX4 A;  4C92 C;  1TG0 A;  2ENM A;  5I21 A;  1IXD A;  1H3Z A;  1A0N B;  3HP9 A;  2CSQ A;  5IHK A;  2DF6 A;  3PTA A;  1FWZ A;  1KC8 R;  1AT1 B;  3E9F A;  5IHI A;  4J6W A;  2K4Y A;  4C8Q C;  3VS6 A;  3P8D A;  2NLU A;  4IUR A;  4XTU A;  1AWW A;  1K73 R;  2YUP A;  3CCS A;  3MHX A;  4NS5 A;  2DXU A;  3SHW A;  1OV3 A;  2E5Q A;  1RAF B;  4JZ4 A;  2BZX A;  3JCM W;  2FG0 A;  1YHQ A;  4XU3 A;  1OZ2 A;  4OGC A;  3L2R A;  3EG1 A;  3M0S A;  1WXB A;  2DJQ A;  5CKD A;  4IKF A;  1WHM A;  5GAN 4;  2NUT A;  4M75 G;  3MEA A;  3A8H B;  2KRS A;  2DAQ A;  3EFR A;  2E5K A;  2CS7 A;  2Y90 A;  3CMA A;  3V7S A;  1HD3 A;  1VQ4 A;  1VQN Q;  3VS3 A;  1J3T A;  1OPL A;  3EAE A;  1VIF A;  4JJC A;  3GBQ A;  2QEX T;  2L2P A;  1NLP C;  2XG8 D;  4CI0 C;  3SB2 A;  4LDV A;  3TSZ A;  1AWO A;  3OMC A;  2X35 A;  5LJ3 f;  1WGS A;  1ACM B;  4ATO A;  3EGD A;  2F5K A;  4HVV A;  1WQW A;  2BZ8 A;  2RN8 A;  5LJ5 h;  4V2S A;  1X69 A;  3CCU T;  4PNO A;  2L3S A;  1LJO A;  3A1P A;  1MHN A;  2X4X A;  1NLO C;  3CCR A;  2FHD A;  5I2S A;  3BFM A;  4QVC A;  1X43 A;  2HEQ A;  2PNI A;  3HRU A;  3JB9 D;  1VQ5 Q;  1U3O A;  3LW5 E;  1WXU A;  3NTI A;  1YJN A;  2M0Y A;  4XQ3 A;  3M0Q A;  1ZQ1 A;  1JXO A;  3LH5 A;  1K8A U;  1BYM A;  1P92 A;  1M1K C;  1TUD A;  1KD1 R;  4PJL A;  2DYI A;  2X3W D;  4DOV A;  1RAH B;  3OYF A;  4KUI A;  1O9S A;  5CKH A;  2LC4 A;  4FSS A;  4C5G A;  3CCL A;  2JVV A;  5LJ5 d;  1D1C A;  4BDZ A;  4ZN1 A;  1M3C A;  4BD3 A;  1I5L A;  1U8R A;  2P0P A;  3MP8 A;  3QJ6 A;  1Y57 A;  2EQI A;  1N8R R;  4X9C A;  4MDW A;  3OYE A;  2OTL T;  2CP2 A;  4XTZ A;  2A36 A;  5CKB A;  1O75 A;  2LQW A;  2YDL A;  2ROT A;  2KQW A;  1E6H A;  4C0F A;  3THK A;  4QVZ A;  4BB7 A;  3G4S T;  3RKY A;  1YCS B;  2ZPH B;  1WNL A;  5LJ3 e;  3LYI A;  4PJO D;  1M27 C;  3VS4 A;  3CCJ T;  3VS5 A;  4Q5W A;  1EFN A;  3RER A;  4DQ2 A;  4E7K A;  1M2V B;  2LJ3 A;  2LT4 A;  4XAX B;  3C94 A;  2P4R A;  1WI7 A;  3HPW A;  2DKG A;  4HVW A;  5GAN 2;  2GCX A;  2PUO B;  3JCM g;  4N4H A;  4AFS C;  2YXY A;  3HFO A;  3EFO B;  4C92 A;  1NBE B;  1EZZ B;  3QWY A;  5GAN 8;  3CC7 A;  4RG8 A;  3H0I A;  2VVK A;  1YIJ Q;  5FRN A;  3MO8 A;  3MPU B;  1AVZ C;  4RTV A;  2DLP A;  4JUV A;  3OYH A;  1UB4 A;  2DTH A;  2XIC A;  2R58 A;  3T9N A;  3X20 B;  3CCS T;  3RIR A;  3KBG A;  4FW2 A;  4PJO C;  1VQL Q;  4C8Q F;  2RD1 A;  2LRQ A;  2EVR A;  2EJF A;  5AYF A;  2HDA A;  3SWN B;  2F2V A;  2IPO B;  3GP8 A;  2QQA A;  1WX6 A;  3OS0 A;  4ZGD B;  4M7D B;  4PJJ A;  4UC4 A;  5CQX A;  3V8L A;  1FMK A;  2L8D A;  1QQJ A;  3REA B;  2MF2 A;  1BB9 A;  1ZBJ A;  1VQP A;  1IRE B;  3M57 A;  4E7I A;  4EMK C;  1M1F A;  2GFU A;  1LNX A;  3E19 A;  3R6N A;  3VS2 A;  3MET A;  1WJS A;  3I55 A;  1MMD A;  5GAN d;  2D0N A;  2DZ9 A;  4A4H A;  5D6W A;  5GAN f;  3QII A;  1Q81 C;  3EH2 A;  3CPF A;  2MIO A;  2VKN A;  2QYZ A;  2R57 A;  1N6A A;  4C8Q G;  2C06 A;  2CP6 A;  3CXC P;  4HCZ A;  5CKF A;  1TWB A;  4F7U A;  2ZPE B;  4IUV A;  1R8O B;  3CCR T;  3OW2 A;  1RAC B;  3HRT A;  4FYX B;  3OYA A;  1UGQ B;  1VQN A;  3GNG A;  5DM7 R;  4F7U F;  1S72 A;  2CH4 A;  3X26 B;  1M5Q 1;  3CEY A;  5IHN A;  2E65 A;  5D7U A;  2ZCF B;  3LWH A;  4Z89 A;  1QVF A;  3JCM c;  1X6B A;  3LGL A;  4M78 D;  1VQM Q;  2VXE A;  2EIF A;  4BE1 A;  1OX9 A;  4AFQ C;  1WHG A;  4F16 A;  2A7Y A;  3H6Z A;  1IHV A;  2HZY A;  1JJ2 P;  3GLX A;  4QW2 A;  1LCK A;  2OAU A;  3OBW A;  2YRC A;  2C0I A;  2LQ8 A;  5KYX A;  3MP6 A;  3S6W A;  2KK4 A;  4HCC A;  3WXM B;  1M90 C;  2EFI A;  2DIG A;  3RKW A;  4D6W A;  5J39 A;  3CC2 A;  2I0N A;  1HK9 A;  4KUL A;  2H3E B;  3TCJ A;  5KYU A;  1Q7Y R;  2KXD A;  1KG1 A;  1I07 A;  1RLP C;  1PRL C;  1MND A;  5GMK j;  2LZ6 B;  1Q86 U;  4M78 C;  1IRX A;  1ABQ A;  3P8H A;  2JUF A;  2K2M A;  1D1A A;  1OQK A;  2HQH A;  3G71 T;  3JCM J;  1PD0 A;  4MZP A;  1KQS S;  3O5Z A;  1WJR A;  3S3M A;  5HK0 A;  5GAN 6;  3N5B B;  4GY5 A;  3CC7 T;  2CP3 A;  1N9S A;  3GOX A;  4E7H A;  4FW1 A;  1YCY A;  4J7I A;  2COY A;  3FDR A;  2M0O A;  4X9D A;  1W2B P;  1YIT Q;  4BDY A;  4A63 B;  1U06 A;  3ZFJ A;  5KH6 A;  3UT1 A;  1M3A A;  2K5L A;  3CBM A;  4E47 A;  3MEW A;  4PJO A;  1WLP B;  3SD4 A;  4F14 A;  1WHK A;  3J80 E;  1JJ2 A;  3OS1 A;  4J9D A;  1IB8 A;  1ZHI A;  1RAE B;  3QHS A;  2RQV A;  2J05 A;  1AZE A;  4C0D C;  4XU1 A;  1UGS B;  1ZSZ B;  2ZPI B;  3QG1 A;  2RI5 A;  2X4W A;  5HY6 A;  4WF2 A;  3JCM X;  2HCK A;  1V29 B;  2XI9 A;  4C92 B;  1KJW A;  1W4S A;  2L3R A;  2OTJ T;  2EKH A;  3EGX B;  2HD0 A;  2XID A;  4EMK A;  1YJW T;  1TTH B;  1UJY A;  1YNZ A;  1AWX A;  1T3L A;  2HL5 C;  4KBM B;  1XTD A;  1VQ6 T;  4J8O A;  2RHU A;  1VQL A;  1M30 A;  3RNJ A;  3V8J A;  2FEI A;  4C8Q B;  1D0Y A;  1GBR A;  2AHJ B;  1M9S A;  4DOW A;  1VQ9 T;  4JDS A;  1Z9Z A;  2CRE A;  5C6S A;  2QG9 B;  3SFM A;  2DXB A;  2JTM A;  3TVT A;  3JRZ A;  3REB B;  2BZY A;  4B6M A;  2D0Q B;  4C92 E;  4LD9 K;  2AZS A;  4LNP A;  2FZC B;  3M4G A;  1LPL A;  2E3I A;  2FL7 A;  5FU7 B;  3LLR A;  5M9O A;  1H92 A;  2I2L A;  1FYN A;  1S72 T;  2LCC A;  4BI3 A;  3CME A;  3L2Q A;  2C0T A;  2RQR A;  4A4G A;  2E10 A;  3PMI A;  4LN2 A;  1M3B A;  3FIF A;  4GLM A;  4OVA A;  3EG0 A;  4JLI A;  3FJP A;  4M77 A;  2JJ9 A;  2DX1 A;  4D8K A;  1GBQ A;  4NOY A;  3CCM Q;  1X6O A;  5GAO p;  1AOJ A;  1UDL A;  2LNH B;  2F1L A;  3CQT A;  1K9M U;  4LDY A;  1NPR A;  1WA7 A;  4OMM A;  1TSF A;  3CBP A;  3ZBD A;  2K6D A;  5GJW B;  2DL8 A;  1NG2 A;  3CD6 A;  1JXM A;  3CC2 T;  1I1J A;  4OB3 B;  3WVE B;  4F17 A;  2PVG B;  1GFC A;  2AT1 B;  4F7U B;  4RMO A;  5LJ5 j;  1Z9Q A;  1T3S A;  5GAM h;  2F69 A;  3QYH B;  3G6E A;  4J6X A;  4AG1 C;  1K8A C;  1VQ8 Q;  1OZ3 A;  2KMT A;  1VQO T;  3ME9 A;  4OB1 B;  1K73 U;  2PTK A;  1Q81 R;  1Q82 R;  3QBY A;  5DLQ E;  5D6Y A;  1PWT A;  1QW1 A;  2KYM A;  4M78 A;  2HAX A;  2K3B A;  3M53 A;  3ULR B;  1FMV A;  3CCQ Q;  2GTJ A;  1VQ7 Q;  1WJQ A;  1D1B A;  1Y71 A;  1H3H A;  4II1 A;  4J83 A;  3SEM A;  4HCB A;  3FEO A;  1SRM A;  5ECA A;  3S3O A;  4J9B A;  2EKO A;  3G71 Q;  1I81 A;  5GAM d;  1ZUK A;  1RLQ C;  3VS7 A;  5KYX B;  5FWB A;  2BTT A;  3RBB B;  2C0O A;  2MWP A;  2L3P A;  1MMA A;  1ZA2 B;  4PFZ A;  3V7C A;  4J9H A;  2O4X B;  2O2O A;  3HL8 A;  2V1Q A;  1YN8 A;  1C6V X;  2O01 E;  2QQR A;  4CC2 A;  2CUD A;  4N4G A;  1X2K A;  2KEA A;  3NFC A;  2LQK A;  3X24 B;  2L89 A;  4M75 A;  1SKU B;  1BU1 A;  2V26 A;  1IO6 A;  3SDZ A;  3INZ A;  2YHT A;  2D9T A;  3OYL A;  5GAO r;  1MMG A;  1OEB A;  2DXC A;  1W70 A;  1Y96 A;  4J5Y A;  3OYK A;  1GFD A;  2VYT A;  1YIT A;  2CSI A;  2QA4 Q;  2DJZ A;  2XHC A;  4MZT A;  2X4J A;  3NGP A;  2YT6 A;  2PUK B;  3JB9 J;  2RJF A;  3TU4 K;  4FYV B;  1WYX A;  2DVE A;  1G3S A;  3UWN A;  3QPH A;  5GMK e;  1KD1 U;  1CSK A;  3I5S A;  4XTX A;  1YJW Q;  1WHJ A;  2K57 A;  2DK3 A;  2F5T X;  2JZ2 A;  3R6O A;  1VQ6 Q;  3U23 A;  4PJO B;  3C4S A;  2FO0 A;  4QQG A;  4M7D G;  2JM8 A;  3QO3 A;  1QVG A;  2CP5 A;  4J7F A;  1SG5 A;  2CP7 A;  2DA9 A;  3JAM E;  1N8R U;  2A3L A;  4FT4 A;  2X9H A;  2YLC A;  1VQ9 Q;  2XD0 A;  1AEY A;  2K3Y A;  5GAN j;  1V1C A;  2EGA A;  2BE9 B;  2RHY A;  4RG2 A;  3QZ5 B;  2BE7 D;  4RCB A;  3L2V A;  1YI2 Q;  3VU3 C;  1UEC A;  2RO0 A;  4EMK B;  1B07 A;  1W1F A;  4CC7 A;  4PFP A;  4PJO E;  1X75 C;  1ZA1 B;  4FSX A;  3EG9 A;  4FCY A;  3L2Z A;  3P8B B;  1GXI E;  2EYY A;  4IUQ A;  2EYW A;  2D8J A;  3VRY A;  1MNE A;  5CIU A;  3WVD B;  3G7Z A;  4EMG A;  1N27 A;  4F04 B;  1OOT A;  4HVU A;  3E9G A;  4AT1 B;  1ZSG A;  1BI0 A;  1R0B G;  5FU6 B;  1KQ2 A;  1WPY A;  4JLG A;  4E6R A;  1DJ7 B;  5IT9 E;  4B9X A;  1D3B B;  5KYY A;  3CD6 T;  3EG2 A;  4X34 A;  2CZ7 B;  3L1A A;  2KT8 A;  1B7T A;  4IUU A;  3FRN A;  3G6E T;  3UPU A;  3CCE Q;  4M7A E;  2E64 A;  3PNW C;  3I56 T;  3M5A A;  3VYH B;  2RA2 A;  4B9W A;  5LJ5 f;  1RL2 A;  5GAN g;  2KNB B;  3CCM A;  2QQS A;  4OMN A;  1PCX A;  3VUB A;  5DLO A;  2P84 A;  2E1H A;  2DBK A;  2FRY A;  2FPF A;  2BKD N;  2HSE B;  2DIQ A;  1N5Z A;  2FZG B;  1VQK T;  4JPB W;  2W10 A;  1RAG B;  4Y91 A;  2PZ1 A;  1YJ9 T;  2AKL A;  2KGT A;  4K11 A;  2DNU A;  1GRI A;  2LCL A;  1MGQ A;  3ASK A;  2KVQ G;  4XU0 A;  5GMK l;  2XK0 A;  3PVQ A;  2XU8 A;  5KYW A;  1NE8 A;  1VQ8 A;  2JNG A;  3PIP A;  4A54 A;  4BE2 A;  1BI3 A;  1F1B B;  1ZLM A;  3JSC A;  4PFO A;  2P4T A;  4BAC A;  1B34 A;  3OYJ A;  4IIO A;  3D7S B;  3PMT A;  3CCQ A;  1Q86 C;  3H0H A;  2GF7 A;  4FIB A;  2DXT A;  2Z0W A;  4M77 E;  3M0U A;  5FW9 A;  1EIF A;  2XKO C;  1K1Z A;  4C92 F;  1QCN A;  3OA6 A;  3PVL A;  3L2U A;  3CCV Q;  4M7A D;  4N0A C;  3URG A;  3JB9 I;  4J9C A;  2DZC A;  4OML A;  1OU9 A;  2RHX A;  1E6G A;  2LJ1 A;  5LJ5 e;  2OAW A;  3A8M B;  1PD1 A;  1D09 B;  3M0T A;  3ZL7 C;  4DEX A;  1YHQ T;  1M2O A;  3X25 B;  3OYN A;  3CC4 A;  3LWI A;  3MP1 A;  3OW2 S;  1JU5 C;  1R0C B;  1IGU A;  2O9S A;  1YWO A;  4ESR A;  5HKC A;  2D8H A;  4M78 E;  4HT8 A;  4EPC A;  4LDW A;  3OB9 A;  1U5S A;  5GMK m;  1VIE A;  3MEU A;  3OSS C;  3CMA T;  2EQU A;  1VQ4 T;  4M7A C;  5IXF A;  2CH4 W;  1QP3 A;  2LJ0 A;  1FXX A;  1FX7 A;  1QVF S;  4C92 G;  5IN1 A;  3E2U A;  2B8A A;  2RJC A;  1JRI A;  4M77 D;  4ZN3 A;  1ZUU A;  3GNF B;  1BI1 A;  3QWX X;  2YRV A;  2RJE A;  2LMJ A;  3S3N A;  3FB9 A;  5IH2 A;  2CT3 A;  1Q7Y U;  2ED0 A;  2K7A A;  2KRM A;  2QQ9 A;  4EMH A;  2QEX Q;  2KXC A;  4MZM A;  3A8O B;  5CVI A;  1KIK A;  2F2W A;  2BIV A;  2HL3 A;  4M75 E;  5GMK i;  3JCM h;  1YJN T; 
#chains in the Genus database with same CATH homology
 2NWM A;  2DL4 A;  2NUZ A;  1NEB A;  2DBM A;  1JO8 A;  2J6F A;  4LUD A;  2LCS A;  1M30 A;  3RNJ A;  4OMQ A;  2FEI A;  1I0C A;  1MV0 B;  1TG0 A;  2ENM A;  3PE0 A;  1GBR A;  1A0N B;  1Z9Z A;  2YUN A;  2CSQ A;  5IHK A;  2DF6 A;  2CRE A;  3NHN A;  4RUG A;  3TVT A;  2RPN A;  3REB B;  1KFZ A;  2BZY A;  2H8H A;  5IHI A;  4Z88 A;  1GL5 A;  3M0R A;  2AZS A;  4LNP A;  3VS6 A;  1UHF A;  1WFW A;  1AWW A;  1RI9 A;  2YUP A;  1GCQ C;  1H92 A;  3SHW A;  1E7O A;  2KYB A;  1OV3 A;  1FYN A;  2AZV A;  4JZ4 A;  2MCN A;  2BZX A;  4HCK A;  3VRZ A;  2C0T A;  1SSH A;  2RQR A;  2FG0 A;  3EGU A;  3I35 A;  4LN2 A;  1B3Q A;  1M3B A;  3KFV A;  4IIM A;  1PRM C;  4CC4 B;  4GLM A;  3EG0 A;  3EG1 A;  3M0S A;  1WXB A;  2DJQ A;  2DX1 A;  4D8K A;  1ZX6 A;  3VS1 A;  1GBQ A;  1AOJ A;  1UDL A;  2KRS A;  2LNH B;  2JW4 A;  3CQT A;  3EHQ A;  2E5K A;  1G83 A;  2D1X A;  1WA7 A;  1HD3 A;  2ECZ A;  4OMM A;  3VS3 A;  1J3T A;  1OPL A;  2FRW A;  2K6D A;  5GJW B;  1ARK A;  4JJC A;  1G2B A;  2DL8 A;  2L2P A;  3GBQ A;  1NLP C;  1NG2 A;  2ED1 A;  1JXM A;  1I1J A;  4F17 A;  1GFC A;  2JXB A;  2JMA A;  1W6X A;  1Z9Q A;  1T3S A;  2SRC A;  3TSZ A;  1AWO A;  4RTY A;  4AG1 C;  4CC3 A;  2DRK A;  3UF4 A;  4HVV A;  2BZ8 A;  2PTK A;  2RN8 A;  1K76 A;  1PWT A;  1X69 A;  2KYM A;  2DVJ A;  2J6O A;  3I5R A;  2L3S A;  2GNC A;  1NYG A;  1NLO C;  5L23 A;  2K3B A;  1VA7 A;  5IXB A;  1PNJ A;  3ULR B;  2GTJ A;  2RF0 A;  2LQN A;  1WXT A;  2DYB A;  1X43 A;  2HEQ A;  2PNI A;  1AD5 A;  4J9F A;  1H3H A;  1U3O A;  2EBP A;  1WXU A;  2YSQ A;  2M0Y A;  3SEM A;  3M0Q A;  2JT4 A;  1T0J A;  3UA6 A;  1SRM A;  1JXO A;  4RTT A;  3LH5 A;  5ECA A;  2W0Z A;  4J9B A;  1TUD A;  1ZUK A;  2CDT A;  2X3W D;  1RLQ C;  1SEM A;  3VS7 A;  5FWB A;  4FSS A;  1CKB A;  1M8M A;  2BTT A;  3RBB B;  2C0O A;  2L3P A;  1HSQ A;  1M3C A;  1YWP A;  4J9H A;  1AZG B;  4JZ3 A;  2O2O A;  2V1Q A;  1YN8 A;  1Y57 A;  2EQI A;  2DIL A;  4CC2 A;  2CUD A;  2LX7 A;  4M4Z A;  1X2K A;  2OI3 A;  2A36 A;  2KEA A;  2LQW A;  2YDL A;  1BU1 A;  2ROT A;  2YUO A;  1E6H A;  4OMP A;  1IO6 A;  2JS2 A;  4WCI A;  3THK A;  2JS0 A;  2EW3 A;  4J9I A;  3UA7 A;  4KRT A;  1YCS B;  2FPD A;  1OEB A;  1W70 A;  2GTO A;  1JEG A;  1GFD A;  1M27 C;  3VS4 A;  2CSI A;  3VS5 A;  4QT7 A;  1EFN A;  1AWJ A;  1UE9 A;  2DRM A;  3NGP A;  1NEG A;  2YT6 A;  1MUZ A;  2A08 A;  2LJ3 A;  2P4R A;  1WI7 A;  2LP5 A;  4HVW A;  2XMF A;  3IQL A;  1WYX A;  4JJB A;  4AFS C;  1PKS A;  1PHT A;  1YP5 A;  5I11 A;  1UGV A;  2ABL A;  1GCP A;  1TUC A;  3QWY A;  1CSK A;  3I5S A;  3H0I A;  2DM1 A;  2RQT A;  2V1R A;  2VVK A;  1RUW A;  4AFU C;  3U23 A;  1QWE A;  2DL7 A;  1AVZ C;  2FO0 A;  2KT1 A;  4RTV A;  2JM8 A;  2RNA A;  2DLP A;  1ABO A;  1Y0M A;  2OJ2 A;  2GBQ A;  2JM9 A;  2DA9 A;  5HCK A;  1GCQ A;  1AEY A;  1NM7 A;  1V1C A;  2EGA A;  2KRO A;  2KBT A;  2EVR A;  4LE9 A;  2HDA A;  2L3Q A;  2F2V A;  5FWC A;  1K0S A;  1WDX A;  1UEC A;  1WX6 A;  2JTE A;  1VYU A;  1S1N A;  1B07 A;  1W1F A;  4CC7 A;  1FMK A;  3JV3 A;  4RTU A;  4JJD A;  3REA B;  2AK5 A;  1VYV A;  2EYZ A;  5EC7 A;  2EYY A;  2EYW A;  1X6G A;  3TSW A;  1BB9 A;  2D8J A;  3VRY A;  1ZBJ A;  1OOT A;  2KRN A;  4HVU A;  1QWF A;  1ZSG A;  2ESW A;  4RTX A;  3M0P A;  3R6N A;  3VS2 A;  4E6R A;  2YUQ A;  1MV3 A;  1UJ0 A;  2CT4 A;  1QKW A;  4HXJ A;  3EG2 A;  1WIE A;  2FPE A;  2L0A A;  2D0N A;  1JQQ A;  2KT8 A;  4LUE A;  2MIO A;  2VKN A;  4AG2 C;  1T0H A;  2A28 A;  2KNB B;  4OMN A;  1BBZ A;  3FJ5 A;  2DBK A;  2FRY A;  2FPF A;  1UHC A;  4GBQ A;  4ORZ A;  1N5Z A;  4JPB W;  2W10 A;  2X3X D;  2PZ1 A;  3NMZ C;  2AKL A;  2CH4 A;  2KGT A;  4K11 A;  4OMO A;  1K0X A;  1K9A A;  2DNU A;  1GRI A;  2EYX A;  2SEM A;  5IHN A;  3PVQ A;  4Z89 A;  4ZNX A;  1X6B A;  1SHF A;  2QDL A;  1SHG A;  2J6K A;  2RQU A;  1ZLM A;  4AFQ C;  1QLY A;  3A98 A;  4F16 A;  2HBW A;  3C0C A;  1X27 A;  2DMO A;  2F2X A;  1LCK A;  4IIO A;  1CKA A;  2JMC A;  3H0H A;  2C0I A;  2EGC A;  2GGR A;  3M0U A;  2G6F X;  2AKK A;  2EPD A;  5FW9 A;  1K1Z A;  2I0N A;  2O31 A;  3PVL A;  2EGE A;  2HSP A;  2A37 A;  4Y92 A;  2IIM A;  4RTZ A;  2KR3 A;  4J9C A;  4OML A;  1BK2 A;  2KXD A;  1E6G A;  1NYF A;  2LJ1 A;  1I07 A;  2OAW A;  4Z8A A;  3UAT A;  1RLP C;  5GJV B;  1PRL C;  1K4U S;  5I22 A;  2LZ6 B;  3M0T A;  2DE0 X;  4J9G A;  1ABQ A;  3ZL7 C;  4DEX A;  1ZUY A;  2K2M A;  3EG3 A;  3I9Q A;  2RMO A;  1OPK A;  1HJD A;  1UG1 A;  3O5Z A;  2GQI A;  1SPK A;  4RTW A;  2DL3 A;  2K9G A;  1JU5 C;  1H8K A;  2O9S A;  1YWO A;  4ESR A;  2D8H A;  3H0F A;  3H41 A;  4AFZ C;  4DEY A;  1U5S A;  4EIK A;  4J9E A;  2M51 A;  3NPF A;  4A63 B;  1U06 A;  2VWF A;  5IXF A;  1M3A A;  4R0K A;  2CH4 W;  2LJ0 A;  2O9V A;  1WLP B;  2MOX A;  1XOV A;  4F14 A;  1QKX A;  2J7I A;  4D8D A;  1PKT A;  2DL5 A;  1VYT A;  4J9D A;  4X1V A;  1ZUU A;  2B86 A;  1X2Q A;  1SRL A;  3QWX X;  2RQV A;  1UTI A;  2ROL A;  2J05 A;  1AZE A;  2LMJ A;  2RQW A;  5IH2 A;  1KSW A;  2CT3 A;  1AWX A;  2J06 A;  2ED0 A;  2K7A A;  2KRM A;  1UUE A;  2O88 A;  2KXC A;  1UFF A;  1QCF A;  2HCK A;  1KIK A;  2CUB A;  2KE9 A;  3VS0 A;  1KJW A;  2F2W A;  2EKH A;  1UJY A;  1YNZ A;  1T3L A;  2K79 A;  3EHR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...