5GJWB

Structure of the mammalian voltage-gated calcium channel cav1.1 complex for classii map
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
100
structure length
100
Chain Sequence
QGPHMALRKEAERQALAQLEKAKTKPVAFAVRTNVGYNPSPGDEVPVEGVAITFEPKDFLHIKEKYNNDWWIGRLVKEGCEVGFIPSPVKLDSLRLLQEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the voltage-gated calcium channel Cav1.1 at 3.6 angstrom resolution
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Membrane protein
molecule keywords Voltage-dependent L-type calcium channel subunit alpha-1S
total genus 16
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2016-07-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 5gjwB00
4HCKA 2ED0A 2JTEA 3VS0A 3EHQA 1JU5C 2EYYA 1GCQC 1TUDA 1YN8A 2GTJA 4RTTA 2KROA 2M0YA 1GFCA 2BZXA 1T0HA 1QLYA 1OPLA 1HD3A 3U23A 2GTOA 1UHFA 2GBQA 3I9QA 2KR3A 2OAWA 3VS5A 1UJ0A 4DEYA 1UGVA 2DRMA 1AWWA 1X6BA 2JW4A 1MV0B 1K9AA 2RMOA 5ECAA 2DLPA 1BK2A 3TSZA 2EBPA 3M0RA 4X1VA 2DRKA 1JQQA 2EGAA 5IH2A 2LJ3A 3LH5A 1X69A 2EQIA 4R0KA 1SHGA 2G6FX 1AWJA 1J3TA 3FJ5A 4RTVA 4AFZC 2OJ2A 2D8HA 1WI7A 2OI3A 1UE9A 2HEQA 3EG1A 1YP5A 2ABLA 2DL3A 1B07A 2VWFA 4F14A 1B3QA 2YUQA 3EGUA 3EHRA 1GCQA 1E6HA 4K11A 2KGTA 4JZ3A 1QWFA 3EG2A 1PRMC 1ZUYA 2DL4A 1FMKA 1YNZA 2M51A 1E7OA 1KJWA 1ZSGA 2RQVA 1W70A 1MV3A 3QWXX 1NLOC 1WFWA 2PTKA 2J06A 2EKHA 2CT4A 5L23A 1OEBA 1NYGA 3UA6A 1WXBA 1JXMA 2CH4W 3M0QA 2KRMA 1W1FA 1GBQA 2XMFA 1PNJA 2AZSA 1JEGA 2ED1A 4GBQA 2KBTA 4RTUA 5EC7A 1M8MA 4JJCA 2DL7A 2VKNA 1JXOA 4JJDA 1CKAA 2W0ZA 4M4ZA 2D8JA 4Z89A 2LP5A 2KEAA 1UTIA 3NPFA 4J9FA 2LJ0A 4IIMA 4E6RA 2VVKA 5FWCA 3I5RA 1SEMA 1AD5A 2X3XD 3R6NA 1SPKA 2C0TA 4WCIA 1WXUA 4D8KA 1NEBA 1ZLMA 4OMLA 1K76A 1NEGA 2O9VA 2EPDA 3REAB 3M0TA 2A37A 4IIOA 2RQRA 1UHCA 4LN2A 1K4US 1W6XA 2AK5A 2EYWA 1WX6A 2JMCA 2KXCA 1K1ZA 1KSWA 4AFUC 1TG0A 4QT7A 1AVZC 2DX1A 1LCKA 4OMOA 2F2XA 3QWYA 1K0SA 4Z88A 2CUBA 1ZBJA 2J6OA 3NGPA 1M3AA 1WLPB 4CC7A 1T3LA 1V1CA 3VRYA 1PWTA 2BTTA 2HSPA 2ENMA 2JS2A 2FPDA 3I35A 1GL5A 4J9CA 3UF4A 4HVVA 4J9EA 2E5KA 2K2MA 1NYFA 2FRYA 2LQWA 2JM9A 1SHFA 4ORZA 2P4RA 4OMNA 1BBZA 1YWPA 2HCKA 2C0OA 1YCSB 1Y0MA 5GJWB 2CH4A 2K6DA 1GRIA 2HDAA 1ARKA 2H8HA 4EIKA 1HJDA 2SEMA 2DJQA 1U5SA 3ZL7C 2A08A 4Z8AA 1PHTA 3TSWA 1T3SA 1U06A 3GBQA 1AWOA 4OMPA 1UDLA 1XOVA 2GGRA 1ZX6A 3PVQA 1GBRA 2EVRA 1UJYA 2DM1A 2ESWA 1UUEA 1HSQA 5I11A 2EYZA 2O9SA 2CDTA 1X27A 2YT6A 1Y57A 3REBB 3H41A 1ABQA 2RQTA 1A0NB 2HBWA 1X2QA 1RLQC 2ECZA 1WA7A 1I0CA 1VYTA 2O2OA 3NHNA 1WDXA 2I0NA 2LJ1A 2FPFA 4JJBA 1M27C 4F17A 2RPNA 5IHIA 2NWMA 4LE9A 2FG0A 2KT1A 1IO6A 4RTWA 1VYUA 1KFZA 5GJVB 2KXDA 1NM7A 1RI9A 2YUOA 1X2KA 2JMAA 2J6KA 2A28A 4OMMA 3VS4A 2EYXA 3EG3A 4JPBW 2A36A 4FSSA 2V1RA 2J05A 3UATA 1NG2A 4Y92A 5IHNA 1RUWA 4HXJA 1U3OA 2JS0A 3SEMA 1PRLC 1OV3A 1PKTA 2FPEA 1SRLA 1VA7A 1Z9QA 4LUDA 2MIOA 2L3SA 2QDLA 2GNCA 4HVWA 2K79A 2L0AA 2B86A 3VS6A 4CC4B 5IHKA 2DBMA 2IIMA 1QKXA 1S1NA 3IQLA 4CC3A 4AFQC 1WIEA 3KFVA 1JO8A 4RTYA 2D0NA 3H0HA 2LMJA 1H3HA 4GLMA 3RBBB 2X3WD 2K3BA 2DILA 2L2PA 1RLPC 2DYBA 3NMZC 1Z9ZA 2K9GA 4LUEA 2AKLA 2CT3A 2L3QA 2LQNA 2FEIA 2DBKA 1BB9A 2DF6A 2ROTA 4RUGA 1K0XA 2MCNA 2CSQA 2PZ1A 1H92A 2O88A 1M3BA 2DL5A 3C0CA 5IXBA 2J6FA 5FW9A 2BZ8A 4RTXA 2EW3A 2AKKA 3VS2A 2YDLA 2YSQA 3H0IA 3JV3A 3EG0A 2O31A 4JZ4A 3SHWA 5I22A 2ROLA 1ZUUA 2W10A 1G83A 2GQIA 3M0PA 2V1QA 1WYXA 2RQUA 3H0FA 4CC2A 3ULRB 3THKA 1E6GA 3M0UA 2DNUA 2LCSA 2FO0A 2CREA 4HVUA 3PE0A 2JXBA 2LNHB 2LX7A 2JT4A 2EGEA 1CKBA 3PVLA 4AG1C 1CSKA 2D1XA 4D8DA 3I5SA 1BU1A 1SSHA 4J9DA 3M0SA 4ZNXA 2FRWA 2CSIA 4J9HA 1UECA 1N5ZA 2LZ6B 2F2WA 1M30A 1QCFA 2NUZA 1NLPC 1QKWA 1QWEA 2F2VA 4F16A 1I07A 3RNJA 1WXTA 4AG2C 1AEYA 1AZEA 1AWXA 1AZGB 4J9BA 2KE9A 1FYNA 3A98A 4RTZA 2JM8A 1YWOA 1H8KA 2EGCA 2MOXA 2L3PA 1G2BA 1EFNA 2CUDA 2DE0X 1SRMA 2BZYA 2C0IA 5HCKA 2K7AA 1PKSA 1X6GA 2DMOA 2KT8A 2RF0A 2DVJA 3UA7A 1MUZA 4KRTA 1GFDA 5IXFA 1TUCA 1ZUKA 5FWBA 4J9GA 1AOJA 2PNIA 1UFFA 2KNBB 1OPKA 2KRNA 1ABOA 4J9IA 1I1JA 3VRZA 4LNPA 2RN8A 3CQTA 2KYMA 3VS7A 1X43A 1VYVA 2RQWA 4OMQA 1M3CA 3VS3A 1UG1A 2AZVA 2DL8A 1T0JA 4DEXA 4A63B 1GCPA 4AFSC 2J7IA 3O5ZA 2RNAA 3TVTA 3VS1A 1OOTA 2KYBA 2KRSA 2DA9A 4ESRA 2SRCA 2YUNA 1KIKA 2YUPA
chains in the Genus database with same CATH superfamily
2M16A 4HCKA 2LC4A 2LQ8A 2JTEA 3VS0A 1XQHA 1IRXA 4E7JA 1ZA1B 4M7DD 1VIFA 3CCUQ 4X9DA 1YIJQ 2GTJA 1SSFA 2VUBA 1ZHIA 4J83A 1YITA 2R58A 1WNLA 1M2VA 2BZXA 4N4HA 1HD3A 3U23A 2GTOA 2Y4YA 1KQSP 4HKEA 3JCMb 2E12A 1VQ6Q 1AWWA 1X6BA 2JW4A 2CP2A 4M7AE 1ACMB 3M5AA 2CZ6B 3WVDB 3DB3A 1N27A 2HL3A 1JQQA 2E6NA 2V8IA 4JUVA 1QQJA 3JCMW 2G6FX 1AWJA 1J3TA 3UDCA 4EMGA 3SWNB 4J7IA 5I2MA 5GANj 1YHQQ 2XI9A 1WI7A 2HEQA 3SWNC 1K73U 1O75A 1OZ3A 1KD1U 3FIFA 1B07A 2VWFA 4L5GA 5AT1B 5CKEA 2DFUA 3OMCA 1FMKA 1G3YA 3OY9A 2HQHA 2P0PA 4C0GA 3CCMQ 4LDUA 3PTAA 4PJOB 1ZSGA 1K9MR 5GAN4 3TU4K 1W70A 4PJOG 1NLOC 2E3HA 2J06A 2CT4A 3VYGA 4EDUA 3X24B 1ZA2B 1JXMA 4BY6B 3OYHA 1GBQA 2AZSA 2QDYB 4AMCA 1MNEA 4QQGA 1KHCA 1M8MA 4JJCA 2DL7A 4JJDA 1CKAA 4M78G 4Z89A 2LP5A 3UT1A 4E2FB 3CXCP 2CGHA 2LT4A 5CQXA 2WSCE 3CC4T 2LJ0A 4IIMA 5GANe 2K5FA 1SG5A 4ELYC 1R77A 1SPKA 4PLIA 2CP0A 3LX7A 3PMTA 4D8KA 1TXQA 3G4ST 4M7AB 1IGQA 3REAB 2A37A 2RQRA 1UHCA 2HQEA 2QGGA 3OSVA 4LN2A 2KXCA 1K1ZA 1N8RC 1TG0A 4QT7A 5AYFA 4F7UB 3DKMA 2K3XA 5J39A 1ZBJA 2J6OA 3NGPA 1S72Q 1WLPB 4CC7A 1T3LA 1VQ8Q 2HSPA 2ENMA 3I35A 3H8ZA 2Y90A 1M90C 2JVVA 4J9EA 2RI2A 3WXMB 3P8DA 1VQLQ 1BBZA 4QQ6A 2C0OA 3CBPA 1VQOQ 3CBOA 2K6DA 1GRIA 5GAOl 1ARKA 4MZMA 2RB6A 3AHUA 4C5GA 2EQKA 4J6XA 4Z8AA 3VYHB 1QVGP 1MMNA 4F7UG 1U06A 4C0DB 3VUBA 2K3YA 3CCLT 4KUIA 2GGRA 1GBRA 2EVRA 2ESWA 3CCVT 4C92A 5M9OA 3VJPA 4GLKA 2EYZA 1GXIE 2K2VA 2X4XA 1M8VA 3TQ7P 5GAN3 2JUFA 4JRKA 2RQTA 4M78D 3QDFA 4M77B 3G71Q 2LT1A 4BDYA 3CD6A 3X25B 1ZBXA 1WHGA 1VYTA 5LJ3j 3CCJQ 1PCXA 2I0NA 5GAOn 2LJ1A 2JN0A 4JJBA 1M27C 1TH7A 3PGGA 4LE9A 2KT1A 1IO6A 4RTWA 1MNDA 1G5VA 1MHNA 4JJNK 1X01A 1D1AA 2QAZA 2YUOA 3VS4A 2A28A 4OMMA 4EMKB 4JPBW 3OSSC 3LGLA 4C0ZA 3CCSA 5GAMg 1QP3A 3CCEQ 4HXJA 4QQDA 2FPEA 5GMKm 1VA7A 4LUDA 5KYWB 2GNCA 3UWNA 1VQOT 2B86A 3CCRQ 3JB9F 4CC4B 1YJWT 3HFOA 5IHKA 1K9MU 1QKXA 3I55T 3IQLA 2M02A 2DO3A 3ZFJA 3KFVA 1JO8A 3KXTA 4XU3A 3V7RA 5CKDA 1X75C 2X3WD 5DLOA 3OYYA 4BI4A 2DYBA 5CCAA 4HT9A 2DIQA 2V26A 3I56A 2CZ7B 4F7UA 2CP7A 3V7SA 2ROTA 2HBPA 5GAOr 2MCNA 2VGNA 1M3BA 4C92G 2DXCA 5FRNA 1Q95G 2EW3A 1IZ6A 1KK7A 2YDLA 4BACA 1B34A 2QASA 3JV3A 3C95A 4TVRA 3JCMc 5I22A 1ZQ1A 2DXTA 3HFNA 3CBMA 5A2QE 1RAGB 4OP0A 3FDRA 3HKSA 1G83A 3GNGA 2OTJT 1O9SA 3A8GB 4XTXA 1Y7XA 3OYNA 3BFMA 1WYXA 1VQMQ 4CC2A 2XKOC 1U1TA 3THKA 2RJDA 3PE0A 2LNHB 3J7AF 1M5Q1 1KC8U 2AHJB 3V8JA 2LNVA 2R57A 2D1XA 4JRQA 4D8DA 3JB9D 4M77F 2AT1B 1C0MA 4J9DA 4JLGA 2DTIA 2KK4A 1W4SA 2LQKA 1N5ZA 2LZ6B 4PJOA 1VOMA 4ANJA 2NUZA 3FEOA 2F2VA 3LWHA 2FYKA 3E9FA 2DERA 4AG2C 4LXCA 1AWXA 2DK3A 1PD1A 3MP8A 2FZGB 5GAMh 3ME9A 3EH2A 2K57A 3OS1A 5FROA 2DXBA 3CMAA 3PNWC 1V76A 3HRUA 4C8QG 2CUDA 4OB1B 2MF2A 1OI1A 5KCHA 1D1CA 4DBRA 4M7DC 1YCYA 4L59A 2O4XA 1X6GA 3QJYA 1NPRA 4J6YA 3QJ6A 2BKDN 1WJSA 2DVJA 4C8QD 1NPPA 3UA7A 2F5KA 2WSEE 3QZ5B 5IXFA 4MMLA 4PJJA 4ELZC 4EMKC 3OYAA 2ZPGB 4JLIA 2RI3A 3VRZA 4OB2B 2RN8A 3M9QA 2DPPB 1RAHB 4ZTFA 1RABB 5GAN8 3MP6A 4KH0B 2DEUA 2NUTB 4OMQA 4XTVA 1FX7A 3EAEA 2AZVA 2DL8A 1M1KR 3QSUA 1T0JA 1GCPA 3WVEB 4AFSC 2RNAA 1OU9A 5FU6C 3JCMQ 1EX4A 2DA9A 2E1HA 3CC7Q 2RJFA 3VV0A 3OMGA 3JB9G 3EHQA 3QYGB 3OBYA 2QEXT 4RTTA 2KROA 3CCUA 3OS0A 2L8DA 4DOVA 3OYDA 3RERA 3A8OB 5HKCA 3QKJA 2CP3A 3QBYA 2GBQA 3I9QA 5KE3A 1UJ0A 2RHXA 1JJ2P 2RI5A 3OB9A 1MV0B 4PJOF 2DLPA 2P84A 1BK2A 1S72T 2EBPA 4N4IA 4M7DB 2RK2A 2LJ3A 1X69A 1WJRA 4R0KA 1W2BP 3HRTA 3CC2Q 1YHQA 3FJ5A 1VQNT 9ATCB 1VQLT 1U8RA 1RACB 2DL3A 1SKUB 2E65A 3FRNA 4J8OA 1IXDA 3EGUA 3MEVA 3HHTB 1GCQA 1E6HA 5A0LA 4JZ3A 3META 1PRMC 1YI2Q 1ZUYA 3A8MB 2QYZA 3HRSA 1M2OA 1NZ9A 1YNZA 1YJNT 3M4GA 2QEXQ 1E7OA 3CCVQ 3RKYA 4F7UE 3LW5E 1UGPB 3LLRA 2HAXA 5L23A 1BCMA 3UA6A 2DKGA 5CO7A 3M0QA 2KRMA 2QI2A 4M78C 4M75G 4RTUA 4QKUA 1EZZB 1KQ1A 3E1SA 2R5AA 3OW2P 1XNIA 2DZCA 2VKNA 1JXOA 2W0ZA 3GF5A 2D8JA 1BI1A 1YITT 2KEAA 1WHLA 1WJQA 1V29B 3CEYA 3EG9B 4E6RA 1KC8C 3I5RA 2F5TX 3JB9H 1SEMA 1AD5A 2X3XD 4P5NA 2CYZB 1M1FA 1WXUA 1IREB 4OMLA 3KUFA 2O9VA 2DZ9A 3CMEQ 3P8HA 1FMWA 1YJNA 1F1BB 4N4GA 1VIEA 5KYUB 4M77E 2CP6A 1AVZC 2DX1A 5GAMj 4M78A 1W2BA 4KGZB 4OMOA 4IUTA 2LTOA 3QWYA 4IUUA 1K0SA 3QG1A 2PUOB 1WHHA 1M3AA 3CCST 1AHJB 3EGDB 1OX9A 2WSFE 3VRYA 4QVCA 1PD0A 2RJCA 3LGFA 2IPOB 1GL5A 2ZPEB 2OTLA 4J9CA 4HVVA 2JM9A 3RDVA 4ORZA 1YJWA 2HCKA 1YCSB 1Y0MA 3QDRB 1VQ5Q 1M4ZA 3VU3C 5LJ5j 1Q86R 2HDAA 3RUXA 1YITQ 1U5SA 2KI7A 4LDWA 3QPHA 4LDXA 1T3SA 3OYFA 1PC0A 3OBWA 3JRZA 1XOVA 4O6JA 1ZX6A 1VQ6T 5CVIA 2ZPIB 2VGMA 5I11A 4AT1B 4MZTA 5GANh 1X27A 4DOWA 1Y57A 3SB2A 2YRDA 3CPWS 2ZCFB 1A0NB 3JCMX 1RLQC 2ECZA 4OGEA 3C12A 5DY9A 2O2OA 3DLMA 1TS9A 3O8VA 1BCOA 1UB4A 2EAYA 4RMOA 1HXDA 2FPFA 3CCJA 4E7ZA 4BE2A 3OYEA 5IHIA 3VKIA 3LH0A 4ME7A 1K8AU 5GJVB 4IKFA 1BIAA 4Y91A 2DEQA 1RAEB 2P0QA 1H3ZA 2J6KA 1N6AA 5GMKe 1LVKA 4KT0E 4M78F 3F70A 5GAN7 3DB4A 2P0KA 2HD0A 2XDPA 3MEWA 5CIUA 4M75F 4DBFA 3G4SA 1U3OA 2EQJA 2GQVA 1Y96A 3SEMA 1KG1A 1PKTA 1MMGA 1YFNA 2RM4A 4C8QE 3AT1B 2QDLA 2HZYA 4EMKA 5FRMA 2L0AA 2DBMA 2IIMA 2F69A 2MI6A 1YJ9T 2QTVA 4RTYA 2D0NA 4BI8B 1LNXA 3CMAT 3VUZA 1H3HA 4A4GA 4RCBA 1UGRB 3GP8A 2V8JA 2Z0WA 1RLPC 4LD9K 2DTOA 4FYXB 4FYYB 2K9GA 4LUEA 3S3MA 2CT3A 2L3QA 3MEUA 3RIRA 4M77A 4RUGA 2VYTA 4RKUE 1JBMA 1TSFA 2ZPBB 3HL8A 2BZ8A 2VC8A 4C92B 3URGA 2AKKA 5GMKl 4FU6A 3H0IA 2HQXA 4C8QB 2GFAA 3EG0A 4JZ4A 5GAOp 1I5LA 3SHWA 3CCRT 4M75B 4M7AA 2RQUA 2ZAEA 3SFMA 1OQKA 1E6GA 2LCSA 3MO8A 1XTDA 2JXBA 2LX7A 4C5EA 2KY9A 4VUBA 3MPUB 4M7AF 1CKBA 3M55A 3CCLQ 4M77C 3I5SA 2VB6A 1SSHA 1WHKA 2X4JA 3ASKA 3GOXA 2PUKB 4ZNXA 1OU8A 3NFCA 2JTFA 2FRWA 3L1AA 2CSIA 2F2WA 2RK1A 1NLPC 1QWEA 3G71T 3H9NA 3FC3A 4A53A 2ZZDA 2KE9A 3A98A 5A0GA 1YHQT 4R56A 2JM8A 4MMKA 5J26A 2QQRA 2PVOB 1VQLA 1YWOA 3CMAQ 3S3NA 1Q81R 5DM7R 1RADB 3S3OA 1QMCA 5IT9E 1G2BA 4M77D 1SRMA 4E7LA 1KC8R 5HCKA 1KD1R 3OW2S 2DMOA 3LWIA 2XU8A 1Q7YU 4ZN1A 2E3IA 4E7HA 4ZGDB 1D0XA 3FB9A 1MUZA 4Y28E 3CCQA 1VQKQ 4PK4A 3EG9A 5GAN6 5FLXE 4A4EA 3L2UA 1UFFA 3PIOA 4HCBA 1OPKA 1ABOA 1I1JA 2FB7A 3I55Q 1IB8A 1VQPA 3EGDA 1MMDA 3OS2A 1X43A 1M3CA 4PJOE 3D7SB 1ZSZA 1C6VX 4CI0C 1OOTA 4X34A 1WHJA 1BI2A 5IAYA 2M9UA 4ESRA 1K8AC 2E10A 2L89A 4C92F 1KIKA 2YUPA 5A0DA 2LCCA 2EYYA 1GCQC 1TUDA 3RKXA 3SWNA 2LRQA 2M0YA 1GFCA 3KBGA 5GMKj 2CZ1B 3QZ9B 1VQ4T 2XD0A 2AIRB 2QA4Q 2KR3A 3VS5A 1G3TA 3GPLA 3OYBA 2OTJQ 4PNOA 1K9AA 2DVEA 2RMOA 5ECAA 2QTXA 3CCQQ 5CKBA 1VQMT 4C92C 1RL2A 2QXFA 3TSZA 3JCMh 1EIFA 2H3JA 3X20B 5KE2A 4N0AC 4A54A 2EGAA 5IH2A 4NS5A 3G6ET 4C92E 4M75E 2E4HA 3PT9A 3CD6T 1VQPQ 1SHGA 3NTHA 1M2VB 5FU7C 4AFZC 4B9WA 1M90R 4M75C 1RAIB 2PQWA 1H641 2E6ZA 1VQKT 3CC2A 1VUBA 1G8XA 2OI3A 4BE0A 1OYXA 3EG1A 4LD6A 2ABLA 2HKNA 4F14A 1K73C 3GIBA 1B3QA 4WTOB 1TU0B 3Q1JA 7AT1B 1QWFA 4A4KA 5CKHA 2BUDA 2X35A 3JB9J 1VQ8A 2RQVA 3HTRA 4XU1A 4MDWA 1UGQB 3QWXX 2PTKA 2EKHA 3OW2A 2I2LA 4HA8A 5KCOA 3QYHB 1NYGA 4OF1A 4F7UF 1WXBA 2DD5A 2CH4W 2NUPB 4XAXB 1PNJA 5GANd 3CXCA 1JEGA 2ED1A 4GBQA 4E47A 1VQOA 2KBTA 5GMKi 3OYJA 5GANg 3MHXA 4M4ZA 2ZPHB 3L2WA 2RHZA 2MWPA 3J80E 4J7FA 4J9FA 4BB7A 1YIJT 1M1KC 5FWCA 4HCCA 4HCZA 1KD1C 4ZN3A 3CCQT 2DTHA 3I56T 1TOVA 4OB3B 5I21A 5KYXB 2EPDA 1YJNQ 2O4XB 1AT1B 1W6XA 2EYWA 3CCLA 1WX6A 2JMCA 3OYCA 3CPFA 4OVAA 4L6V5 2MYSA 2P4TA 3M53A 4C8QF 2HSEB 1Q86U 4JRIA 2F2XA 1YJ9A 1DJ7B 4Z88A 2CUBA 3N5BB 2X4YA 2NUTA 1VQNA 1V1CA 3CCMA 3L42A 3BY7A 4ATOA 2BTTA 2JS2A 2FPDA 2CP5A 2DIGA 3OYIA 5GMKh 3EGXB 5IN1A 2E5KA 1YBYA 4PFPA 1NYFA 2FRYA 2HMAA 2BIVA 1SHFA 1B7TA 3EFOB 2MAMA 8AT1B 4OMNA 2LX9A 4KBMB 2G3RA 2GFUA 3EFSA 5GANf 1HYOA 2A3LA 2HKQB 2H8HA 1NJIU 5KYNA 4EIKA 2SEMA 2IG0A 3BDLA 3EH1A 3QUIA 5DLQE 2QG9B 2YHTA 4C5HA 3GBQA 4KGXB 1AWOA 1K9MC 1UDLA 1C1AA 4E7IA 2KSSA 2KVQG 1UUEA 4EMHA 1LOJA 2EJFA 2CDTA 2JJ9A 3H41A 1ABQA 3MKDA 3G6EA 4PKCC 3OYKA 3TREA 2YXYA 3G7ZA 4M75D 3L2RA 2HNIA 4JS4A 2EQUA 4E7KA 1WDXA 3OS5A 3CC2T 1I8FA 3CC4Q 4F17A 2RPNA 5CK9A 4M78B 4LDYA 2NWMA 1VQ9T 1RI0A 2FG0A 3CXCS 5KYUA 4KUDK 2DAQA 1KFZA 5C0MA 2RHUA 4LDVA 1FMVA 1RI9A 1M90U 4OMFB 1X2KA 2JMAA 1YI2T 5KH6A 3FLGA 2A36A 4UC4A 3GLXA 1WZOA 4FYWB 2V1RA 3OYLA 5IHNA 2NLUA 1RUWA 4Q5WA 3EFRA 1VQ7Q 4XU2A 2OTLT 2JS0A 1PRLC 1OV3A 3G4SQ 3DLLA 4XK8E 1SRLA 2PVDB 5HK3A 2MIOA 4M7DF 2IVWA 4HVWA 2OTJA 3VS6A 2EQMA 1UEBA 1TWBA 3BE3A 4FYVB 4GY5A 1S1NA 3EFOA 4CC3A 4PJMA 3M54A 4C8QA 1I5OB 3OA6A 1NBEB 2CZ0B 1Q7YR 1ZSZC 3H0HA 2LMJA 3JSCA 5GAOm 2L5QA 1YIJA 4M7AG 1N9SA 2DETA 4XQ3A 2K3BA 2DILA 3NMZC 1LPLA 1Z9ZA 5HK0A 1D09B 2MMPA 2YLCA 3A1PA 3TEEA 4XU0A 2EFIA 4QW2A 4R55A 1K0XA 1BB9A 2V8KA 2COZA 4PFOA 1QW1A 2FHDA 2O88A 5IXBA 4M7AD 4MDXA 2EIFA 5FW9A 5D7UA 3X28B 1QVFP 3QO3A 2YSQA 5CAIA 5KYWA 4DA4A 4M7DE 1N8RU 2O31A 2M1HA 5LJ5g 3RR6A 1D0ZA 2W10A 1QVFS 2GQIA 4OB0B 3A8HB 3M0PA 5CQYA 2X4WA 3H0FA 3C4SA 4HT8A 5GAN2 2OTLQ 1TTHB 3M0UA 2DNUA 3M59A 4BI3A 2CREA 3NTIA 4HVUA 4EPCA 1W2BS 2XG8D 2EKOA 5I2SA 2EGEA 4PL6A 1CSKA 1BU1A 4MZPA 1WQWA 3MEAA 1X6OA 2E5QA 3CCJT 3M0SA 4N0AA 5LJ3d 3V8KA 1I4K1 3QIIA 5LJ3e 1UECA 3BDUA 5LJ3g 4NL3A 4NOYA 1M30A 3CPWA 3E19A 2A0FB 4OGCA 1QKWA 4F16A 1I07A 1QCNA 3RNJA 4ZGJB 1AEYA 4E7SA 3QXEB 1XJWB 1FYNA 1NE8A 1WPYA 1YJWQ 4FT2A 2HL5C 1EFNA 3R6OA 2JOYA 1VQ5A 2K4YA 2DE0X 5D6WA 2F1LA 2B8AA 1NJIC 3GNFB 1VQNQ 3PMIA 2NYSA 1PKSA 4J5YA 1UGSB 2D9TA 5HY6A 3OQ5A 3QHSA 2RF0A 3CCUT 1QCOA 2JTMA 1BIBA 4XTWA 4KRTA 2EYQA 1TUCA 1ZUKA 1HK9A 1AOJA 2KNBB 2KRNA 5LJ5f 3OYMA 2KQWA 4J9IA 2C06A 3H6ZA 4LNPA 4BDZA 1YJ9Q 3INZA 3CQTA 2KYMA 4D6WA 2E41A 1VQ8T 1D3BA 4BE1A 3O5ZA 2LCLA 1WQ7A 1Q82C 4DBHA 2KRSA 3TCJA 3JCMf 2Y4XA 4ZGEB 4C8QC 4B6MA 3SD4A 2ED0A 1JU5C 1N8RR 4II1A 1YN8A 1ZSZB 1NJIR 2RHIA 2R5MA 1T0HA 1QLYA 1OPLA 2QK0A 1SF9A 3CC4A 1IHWA 4JRPA 1UHFA 1QVFA 2OAWA 1WGSA 3BW1A 4DEYA 2QA4A 1UGVA 1D3BB 2DRMA 5FU6B 5GAN5 3X26B 1VQ6A 1PSEA 4IUPA 2EJGA 4DBQA 3M0RA 4X1VA 2DJZA 2DRKA 3CCSQ 2EWNA 3LH5A 4X9CA 3M58A 2EQIA 5LJ5d 5J3BA 2XK0A 4RTVA 3ZBDA 2OJ2A 2JZ2A 2D8HA 2PU9B 1UE9A 1B34B 2OX7A 4FT4A 1YP5A 2LVMA 4PJNA 3T9NA 3JCMP 2QQAA 3EHRA 2YUQA 3P8BB 3OYGA 1VQ4Q 2FZCB 2KGTA 4K11A 3PIPA 2YRCA 3EG2A 2DXUA 3JCMd 2DL4A 2MK5A 4PLLA 2RO0A 4PJOC 4RG8A 3ZEHA 2M51A 2X9HA 1KJWA 1JRIA 2MWOA 3L2QA 5KYXA 4QVZA 5EG2A 1MV3A 1VQ7A 1WFWA 4A4FA 2VXFA 1FWZA 1OEBA 2A7YA 1W1FA 2XMFA 4FM4B 4F04B 1VQPT 1VQ9A 3CC7T 5EC7A 4M7DA 4JS5A 2YWWA 1JJ2S 4XTUA 1KHIA 1UTIA 5GAMf 3NPFA 2OAUA 4KGVB 1QP2A 2VVKA 3MCAB 3R6NA 2C0TA 2BE9B 1BI3A 2K5LA 4CRIA 4WCIA 3RKWA 4FIBA 1NEBA 1ZLMA 1K76A 1K8AR 1NEGA 4WF2A 1BKBA 5L8RE 3M0TA 4IIOA 1Q82U 4C0FA 1K4US 2AK5A 4QVDA 1KSWA 4AFUC 2VASA 1VQ4A 3LYIA 1VQ7T 2MPXC 4PJLA 1LCKA 1YI2A 5CR2A 3I55A 3SDZA 1PWTA 5D6YA 2RHYA 3MP1A 4V2SA 3V8LA 1VQMA 2D6FA 4DQ2A 2RA2A 3UF4A 1R8OB 2K2MA 2D0QB 4XTYA 2LQWA 3E2UA 5LJ5h 1RAFB 3JAME 1Q82R 3PFSA 2ATCB 2P4RA 1KQ2A 1YWPA 1Q7YC 5GJWB 3RMQA 2CH4A 2XIDA 8ATCB 5C6SA 4FCYA 1Y96B 5GAMe 2PVGB 4IUQA 1HJDA 2O01E 2DJQA 4C92D 3ZL7C 2A08A 5GAMd 4B9XA 1PHTA 3TSWA 2QA4T 4OMPA 4BUGA 2E70A 3RESA 4C5IA 3PVQA 2GF7A 1UJYA 2DM1A 1M9SA 1HSQA 2YLBA 1Q81C 4YTLA 1I81A 2O9SA 3CCET 2YT6A 3REBB 4A4HA 4M7DG 3JB9I 2HBWA 2XICA 2ZGWA 1X2QA 1WA7A 3G6EQ 3A5ZB 1I0CA 3NHNA 3C94A 4PFZA 3ER0A 2DD4A 4IURA 1MMAA 1VYUA 5LJ3h 1PM3A 2QQBA 3HPWA 3JCMV 2KXDA 1NM7A 4BY6C 1M1KU 3M56A 3CMET 2EYXA 3EG3A 1Q86C 5KYYB 1D0YA 2FL7A 4FSSA 1OX8A 4FSXA 1D1BA 2VV5A 5CKFA 2E64A 2J05A 3UATA 1NG2A 4Y92A 4RCCA 2RH2A 2K5IA 3CCEA 2LDMA 1Q81U 1Z9QA 2L3SA 1FXXA 3CCRA 1BI0A 2K79A 1QVPA 3M57A 1OZ2A 2BE7D 3V7CA 1TUGB 2QQ9A 3CC7A 1JB0E 2VXEA 4M7AC 4AFQC 2CKKA 4FL6A 5KYYA 1WIEA 2L3RA 1OULA 3HSBA 1IHVA 4GLMA 4J6WA 5LL6S 1VQ5T 5GAOq 3RBBB 2L2PA 4PJOD 1QVGA 1G3SA 1KQSS 3EGXA 2AKLA 2LQNA 2FEIA 3S6WA 2DBKA 2DF6A 4RG2A 3JCMe 2YRVA 3I56Q 2CSQA 2PZ1A 1H92A 2DL5A 3C0CA 2J6FA 2ZPFB 2KDSA 4RTXA 1G3WA 1MGQA 1KQSA 2DYIA 3VS2A 1IGUA 1BYMA 1M1GA 2FZKB 4NL2A 3J81E 3E9GA 2KMTA 2ROLA 1ZUUA 3CCVA 5LJ5e 4FW1A 3L2VA 2V1QA 3MJXA 3ULRB 2XHCA 4FW2A 4C0DC 1K73R 1VQKA 2FO0A 3NTKA 4M75A 2JT4A 3A8LB 3PVLA 4AG1C 3RMSA 3JCMJ 3M4YA 1WHMA 3G1JA 4XTZA 2JNGA 1U1SA 1RAAB 4J9HA 5FU7B 4JDSA 2QEXA 1S72A 2EJ9A 1Y07A 2COWA 1QCFA 3HP9A 2NUPA 6AT1B 1QVGS 1WXTA 2GCXA 1AZEA 1LJOA 1AZGB 4J9BA 1JJ2A 4RTZA 2XDBA 1N9RA 2RJEA 1H8KA 1R0BG 1VQ9Q 2CS7A 2EGCA 2MOXA 2L3PA 4M78E 1P92A 2RD1A 3UPUA 4O5VA 5LJ3f 2BZYA 2C0IA 3CD6Q 2K7AA 2XDDA 2KT8A 1Y71A 3L2ZA 2H3EB 2QGFB 4M77G 4BD3A 3CMEA 3FJPA 2COYA 1GFDA 4KULA 5FWBA 4J9GA 2PNIA 3JCMg 4KH1B 2KAFA 4ZTJA 3G71A 2WACA 1PG5B 3VS7A 1R0CB 2X51A 1VYVA 2RQWA 3VS3A 1PSFA 1UG1A 5D6XA 4DEXA 4Z02A 4A63B 3CCMT 2J7IA 3TVTA 3VS1A 2KYBA 3CPWP 2QQSA 4IUVA 2M0OA 2SRCA 2YUNA 2FVUA
chains in the Genus database with same CATH topology
4HCKA 2ED0A 2JTEA 3VS0A 3EHQA 1JU5C 2EYYA 1GCQC 1TUDA 1YN8A 2GTJA 4RTTA 2KROA 2M0YA 1GFCA 2BZXA 1T0HA 1QLYA 1OPLA 1HD3A 3U23A 2GTOA 1UHFA 2GBQA 3I9QA 2KR3A 2OAWA 3VS5A 1UJ0A 4DEYA 1UGVA 2DRMA 1AWWA 1X6BA 2JW4A 1MV0B 1K9AA 2RMOA 5ECAA 2DLPA 1BK2A 3TSZA 2EBPA 3M0RA 4X1VA 2DRKA 1JQQA 2EGAA 5IH2A 2LJ3A 3LH5A 1X69A 2EQIA 4R0KA 1SHGA 2G6FX 1AWJA 1J3TA 3FJ5A 4RTVA 4AFZC 2OJ2A 2D8HA 1WI7A 2OI3A 1UE9A 2HEQA 3EG1A 1YP5A 2ABLA 2DL3A 1B07A 2VWFA 4F14A 1B3QA 2YUQA 3EGUA 3EHRA 1GCQA 1E6HA 4K11A 2KGTA 4JZ3A 1QWFA 3EG2A 1PRMC 1ZUYA 2DL4A 1FMKA 1YNZA 2M51A 1E7OA 1KJWA 1ZSGA 2RQVA 1W70A 1MV3A 3QWXX 1NLOC 1WFWA 2PTKA 2J06A 2EKHA 2CT4A 5L23A 1OEBA 1NYGA 3UA6A 1WXBA 1JXMA 2CH4W 3M0QA 2KRMA 1W1FA 1GBQA 2XMFA 1PNJA 2AZSA 1JEGA 2ED1A 4GBQA 2KBTA 4RTUA 5EC7A 1M8MA 4JJCA 2DL7A 2VKNA 1JXOA 4JJDA 1CKAA 2W0ZA 4M4ZA 2D8JA 4Z89A 2LP5A 2KEAA 1UTIA 3NPFA 4J9FA 2LJ0A 4IIMA 4E6RA 2VVKA 5FWCA 3I5RA 1SEMA 1AD5A 2X3XD 3R6NA 1SPKA 2C0TA 4WCIA 1WXUA 4D8KA 1NEBA 1ZLMA 4OMLA 1K76A 1NEGA 2O9VA 2EPDA 3REAB 3M0TA 2A37A 4IIOA 2RQRA 1UHCA 4LN2A 1K4US 1W6XA 2AK5A 2EYWA 1WX6A 2JMCA 2KXCA 1K1ZA 1KSWA 4AFUC 1TG0A 4QT7A 1AVZC 2DX1A 1LCKA 4OMOA 2F2XA 3QWYA 1K0SA 4Z88A 2CUBA 1ZBJA 2J6OA 3NGPA 1M3AA 1WLPB 4CC7A 1T3LA 1V1CA 3VRYA 1PWTA 2BTTA 2HSPA 2ENMA 2JS2A 2FPDA 3I35A 1GL5A 4J9CA 3UF4A 4HVVA 4J9EA 2E5KA 2K2MA 1NYFA 2FRYA 2LQWA 2JM9A 1SHFA 4ORZA 2P4RA 4OMNA 1BBZA 1YWPA 2HCKA 2C0OA 1YCSB 1Y0MA 5GJWB 2CH4A 2K6DA 1GRIA 2HDAA 1ARKA 2H8HA 4EIKA 1HJDA 2SEMA 2DJQA 1U5SA 3ZL7C 2A08A 4Z8AA 1PHTA 3TSWA 1T3SA 1U06A 3GBQA 1AWOA 4OMPA 1UDLA 1XOVA 2GGRA 1ZX6A 3PVQA 1GBRA 2EVRA 1UJYA 2DM1A 2ESWA 1UUEA 1HSQA 5I11A 2EYZA 2O9SA 2CDTA 1X27A 2YT6A 1Y57A 3REBB 3H41A 1ABQA 2RQTA 1A0NB 2HBWA 1X2QA 1RLQC 2ECZA 1WA7A 1I0CA 1VYTA 2O2OA 3NHNA 1WDXA 2I0NA 2LJ1A 2FPFA 4JJBA 1M27C 4F17A 2RPNA 5IHIA 2NWMA 4LE9A 2FG0A 2KT1A 1IO6A 4RTWA 1VYUA 1KFZA 5GJVB 2KXDA 1NM7A 1RI9A 2YUOA 1X2KA 2JMAA 2J6KA 2A28A 4OMMA 3VS4A 2EYXA 3EG3A 4JPBW 2A36A 4FSSA 2V1RA 2J05A 3UATA 1NG2A 4Y92A 5IHNA 1RUWA 4HXJA 1U3OA 2JS0A 3SEMA 1PRLC 1OV3A 1PKTA 2FPEA 1SRLA 1VA7A 1Z9QA 4LUDA 2MIOA 2L3SA 2QDLA 2GNCA 4HVWA 2K79A 2L0AA 2B86A 3VS6A 4CC4B 5IHKA 2DBMA 2IIMA 1QKXA 1S1NA 3IQLA 4CC3A 4AFQC 1WIEA 3KFVA 1JO8A 4RTYA 2D0NA 3H0HA 2LMJA 1H3HA 4GLMA 3RBBB 2X3WD 2K3BA 2DILA 2L2PA 1RLPC 2DYBA 3NMZC 1Z9ZA 2K9GA 4LUEA 2AKLA 2CT3A 2L3QA 2LQNA 2FEIA 2DBKA 1BB9A 2DF6A 2ROTA 4RUGA 1K0XA 2MCNA 2CSQA 2PZ1A 1H92A 2O88A 1M3BA 2DL5A 3C0CA 5IXBA 2J6FA 5FW9A 2BZ8A 4RTXA 2EW3A 2AKKA 3VS2A 2YDLA 2YSQA 3H0IA 3JV3A 3EG0A 2O31A 4JZ4A 3SHWA 5I22A 2ROLA 1ZUUA 2W10A 1G83A 2GQIA 3M0PA 2V1QA 1WYXA 2RQUA 3H0FA 4CC2A 3ULRB 3THKA 1E6GA 3M0UA 2DNUA 2LCSA 2FO0A 2CREA 4HVUA 3PE0A 2JXBA 2LNHB 2LX7A 2JT4A 2EGEA 1CKBA 3PVLA 4AG1C 1CSKA 2D1XA 4D8DA 3I5SA 1BU1A 1SSHA 4J9DA 3M0SA 4ZNXA 2FRWA 2CSIA 4J9HA 1UECA 1N5ZA 2LZ6B 2F2WA 1M30A 1QCFA 2NUZA 1NLPC 1QKWA 1QWEA 2F2VA 4F16A 1I07A 3RNJA 1WXTA 4AG2C 1AEYA 1AZEA 1AWXA 1AZGB 4J9BA 2KE9A 1FYNA 3A98A 4RTZA 2JM8A 1YWOA 1H8KA 2EGCA 2MOXA 2L3PA 1G2BA 1EFNA 2CUDA 2DE0X 1SRMA 2BZYA 2C0IA 5HCKA 2K7AA 1PKSA 1X6GA 2DMOA 2KT8A 2RF0A 2DVJA 3UA7A 1MUZA 4KRTA 1GFDA 5IXFA 1TUCA 1ZUKA 5FWBA 4J9GA 1AOJA 2PNIA 1UFFA 2KNBB 1OPKA 2KRNA 1ABOA 4J9IA 1I1JA 3VRZA 4LNPA 2RN8A 3CQTA 2KYMA 3VS7A 1X43A 1VYVA 2RQWA 4OMQA 1M3CA 3VS3A 1UG1A 2AZVA 2DL8A 1T0JA 4DEXA 4A63B 1GCPA 4AFSC 2J7IA 3O5ZA 2RNAA 3TVTA 3VS1A 1OOTA 2KYBA 2KRSA 2DA9A 4ESRA 2SRCA 2YUNA 1KIKA 2YUPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HCK A;  2ED0 A;  2JTE A;  3VS0 A;  3EHQ A;  1JU5 C;  2EYY A;  1GCQ C;  1TUD A;  1YN8 A;  2GTJ A;  4RTT A;  2KRO A;  2M0Y A;  1GFC A;  2BZX A;  1T0H A;  1QLY A;  1OPL A;  1HD3 A;  3U23 A;  2GTO A;  1UHF A;  2GBQ A;  3I9Q A;  2KR3 A;  2OAW A;  3VS5 A;  1UJ0 A;  4DEY A;  1UGV A;  2DRM A;  1AWW A;  1X6B A;  2JW4 A;  1MV0 B;  1K9A A;  2RMO A;  5ECA A;  2DLP A;  1BK2 A;  3TSZ A;  2EBP A;  3M0R A;  4X1V A;  2DRK A;  1JQQ A;  2EGA A;  5IH2 A;  2LJ3 A;  3LH5 A;  1X69 A;  2EQI A;  4R0K A;  1SHG A;  2G6F X;  1AWJ A;  1J3T A;  3FJ5 A;  4RTV A;  4AFZ C;  2OJ2 A;  2D8H A;  1WI7 A;  2OI3 A;  1UE9 A;  2HEQ A;  3EG1 A;  1YP5 A;  2ABL A;  2DL3 A;  1B07 A;  2VWF A;  4F14 A;  1B3Q A;  2YUQ A;  3EGU A;  3EHR A;  1GCQ A;  1E6H A;  4K11 A;  2KGT A;  4JZ3 A;  1QWF A;  3EG2 A;  1PRM C;  1ZUY A;  2DL4 A;  1FMK A;  1YNZ A;  2M51 A;  1E7O A;  1KJW A;  1ZSG A;  2RQV A;  1W70 A;  1MV3 A;  3QWX X;  1NLO C;  1WFW A;  2PTK A;  2J06 A;  2EKH A;  2CT4 A;  5L23 A;  1OEB A;  1NYG A;  3UA6 A;  1WXB A;  1JXM A;  2CH4 W;  3M0Q A;  2KRM A;  1W1F A;  1GBQ A;  2XMF A;  1PNJ A;  2AZS A;  1JEG A;  2ED1 A;  4GBQ A;  2KBT A;  4RTU A;  5EC7 A;  1M8M A;  4JJC A;  2DL7 A;  2VKN A;  1JXO A;  4JJD A;  1CKA A;  2W0Z A;  4M4Z A;  2D8J A;  4Z89 A;  2LP5 A;  2KEA A;  1UTI A;  3NPF A;  4J9F A;  2LJ0 A;  4IIM A;  4E6R A;  2VVK A;  5FWC A;  3I5R A;  1SEM A;  1AD5 A;  2X3X D;  3R6N A;  1SPK A;  2C0T A;  4WCI A;  1WXU A;  4D8K A;  1NEB A;  1ZLM A;  4OML A;  1K76 A;  1NEG A;  2O9V A;  2EPD A;  3REA B;  3M0T A;  2A37 A;  4IIO A;  2RQR A;  1UHC A;  4LN2 A;  1K4U S;  1W6X A;  2AK5 A;  2EYW A;  1WX6 A;  2JMC A;  2KXC A;  1K1Z A;  1KSW A;  4AFU C;  1TG0 A;  4QT7 A;  1AVZ C;  2DX1 A;  1LCK A;  4OMO A;  2F2X A;  3QWY A;  1K0S A;  4Z88 A;  2CUB A;  1ZBJ A;  2J6O A;  3NGP A;  1M3A A;  1WLP B;  4CC7 A;  1T3L A;  1V1C A;  3VRY A;  1PWT A;  2BTT A;  2HSP A;  2ENM A;  2JS2 A;  2FPD A;  3I35 A;  1GL5 A;  4J9C A;  3UF4 A;  4HVV A;  4J9E A;  2E5K A;  2K2M A;  1NYF A;  2FRY A;  2LQW A;  2JM9 A;  1SHF A;  4ORZ A;  2P4R A;  4OMN A;  1BBZ A;  1YWP A;  2HCK A;  2C0O A;  1YCS B;  1Y0M A;  5GJW B;  2CH4 A;  2K6D A;  1GRI A;  2HDA A;  1ARK A;  2H8H A;  4EIK A;  1HJD A;  2SEM A;  2DJQ A;  1U5S A;  3ZL7 C;  2A08 A;  4Z8A A;  1PHT A;  3TSW A;  1T3S A;  1U06 A;  3GBQ A;  1AWO A;  4OMP A;  1UDL A;  1XOV A;  2GGR A;  1ZX6 A;  3PVQ A;  1GBR A;  2EVR A;  1UJY A;  2DM1 A;  2ESW A;  1UUE A;  1HSQ A;  5I11 A;  2EYZ A;  2O9S A;  2CDT A;  1X27 A;  2YT6 A;  1Y57 A;  3REB B;  3H41 A;  1ABQ A;  2RQT A;  1A0N B;  2HBW A;  1X2Q A;  1RLQ C;  2ECZ A;  1WA7 A;  1I0C A;  1VYT A;  2O2O A;  3NHN A;  1WDX A;  2I0N A;  2LJ1 A;  2FPF A;  4JJB A;  1M27 C;  4F17 A;  2RPN A;  5IHI A;  2NWM A;  4LE9 A;  2FG0 A;  2KT1 A;  1IO6 A;  4RTW A;  1VYU A;  1KFZ A;  5GJV B;  2KXD A;  1NM7 A;  1RI9 A;  2YUO A;  1X2K A;  2JMA A;  2J6K A;  2A28 A;  4OMM A;  3VS4 A;  2EYX A;  3EG3 A;  4JPB W;  2A36 A;  4FSS A;  2V1R A;  2J05 A;  3UAT A;  1NG2 A;  4Y92 A;  5IHN A;  1RUW A;  4HXJ A;  1U3O A;  2JS0 A;  3SEM A;  1PRL C;  1OV3 A;  1PKT A;  2FPE A;  1SRL A;  1VA7 A;  1Z9Q A;  4LUD A;  2MIO A;  2L3S A;  2QDL A;  2GNC A;  4HVW A;  2K79 A;  2L0A A;  2B86 A;  3VS6 A;  4CC4 B;  5IHK A;  2DBM A;  2IIM A;  1QKX A;  1S1N A;  3IQL A;  4CC3 A;  4AFQ C;  1WIE A;  3KFV A;  1JO8 A;  4RTY A;  2D0N A;  3H0H A;  2LMJ A;  1H3H A;  4GLM A;  3RBB B;  2X3W D;  2K3B A;  2DIL A;  2L2P A;  1RLP C;  2DYB A;  3NMZ C;  1Z9Z A;  2K9G A;  4LUE A;  2AKL A;  2CT3 A;  2L3Q A;  2LQN A;  2FEI A;  2DBK A;  1BB9 A;  2DF6 A;  2ROT A;  4RUG A;  1K0X A;  2MCN A;  2CSQ A;  2PZ1 A;  1H92 A;  2O88 A;  1M3B A;  2DL5 A;  3C0C A;  5IXB A;  2J6F A;  5FW9 A;  2BZ8 A;  4RTX A;  2EW3 A;  2AKK A;  3VS2 A;  2YDL A;  2YSQ A;  3H0I A;  3JV3 A;  3EG0 A;  2O31 A;  4JZ4 A;  3SHW A;  5I22 A;  2ROL A;  1ZUU A;  2W10 A;  1G83 A;  2GQI A;  3M0P A;  2V1Q A;  1WYX A;  2RQU A;  3H0F A;  4CC2 A;  3ULR B;  3THK A;  1E6G A;  3M0U A;  2DNU A;  2LCS A;  2FO0 A;  2CRE A;  4HVU A;  3PE0 A;  2JXB A;  2LNH B;  2LX7 A;  2JT4 A;  2EGE A;  1CKB A;  3PVL A;  4AG1 C;  1CSK A;  2D1X A;  4D8D A;  3I5S A;  1BU1 A;  1SSH A;  4J9D A;  3M0S A;  4ZNX A;  2FRW A;  2CSI A;  4J9H A;  1UEC A;  1N5Z A;  2LZ6 B;  2F2W A;  1M30 A;  1QCF A;  2NUZ A;  1NLP C;  1QKW A;  1QWE A;  2F2V A;  4F16 A;  1I07 A;  3RNJ A;  1WXT A;  4AG2 C;  1AEY A;  1AZE A;  1AWX A;  1AZG B;  4J9B A;  2KE9 A;  1FYN A;  3A98 A;  4RTZ A;  2JM8 A;  1YWO A;  1H8K A;  2EGC A;  2MOX A;  2L3P A;  1G2B A;  1EFN A;  2CUD A;  2DE0 X;  1SRM A;  2BZY A;  2C0I A;  5HCK A;  2K7A A;  1PKS A;  1X6G A;  2DMO A;  2KT8 A;  2RF0 A;  2DVJ A;  3UA7 A;  1MUZ A;  4KRT A;  1GFD A;  5IXF A;  1TUC A;  1ZUK A;  5FWB A;  4J9G A;  1AOJ A;  2PNI A;  1UFF A;  2KNB B;  1OPK A;  2KRN A;  1ABO A;  4J9I A;  1I1J A;  3VRZ A;  4LNP A;  2RN8 A;  3CQT A;  2KYM A;  3VS7 A;  1X43 A;  1VYV A;  2RQW A;  4OMQ A;  1M3C A;  3VS3 A;  1UG1 A;  2AZV A;  2DL8 A;  1T0J A;  4DEX A;  4A63 B;  1GCP A;  4AFS C;  2J7I A;  3O5Z A;  2RNA A;  3TVT A;  3VS1 A;  1OOT A;  2KYB A;  2KRS A;  2DA9 A;  4ESR A;  2SRC A;  2YUN A;  1KIK A;  2YUP A; 
#chains in the Genus database with same CATH topology
 2M16 A;  4HCK A;  2LC4 A;  2LQ8 A;  2JTE A;  3VS0 A;  1XQH A;  1IRX A;  4E7J A;  1ZA1 B;  4M7D D;  1VIF A;  3CCU Q;  4X9D A;  1YIJ Q;  2GTJ A;  1SSF A;  2VUB A;  1ZHI A;  4J83 A;  1YIT A;  2R58 A;  1WNL A;  1M2V A;  2BZX A;  4N4H A;  1HD3 A;  3U23 A;  2GTO A;  2Y4Y A;  1KQS P;  4HKE A;  3JCM b;  2E12 A;  1VQ6 Q;  1AWW A;  1X6B A;  2JW4 A;  2CP2 A;  4M7A E;  1ACM B;  3M5A A;  2CZ6 B;  3WVD B;  3DB3 A;  1N27 A;  2HL3 A;  1JQQ A;  2E6N A;  2V8I A;  4JUV A;  1QQJ A;  3JCM W;  2G6F X;  1AWJ A;  1J3T A;  3UDC A;  4EMG A;  3SWN B;  4J7I A;  5I2M A;  5GAN j;  1YHQ Q;  2XI9 A;  1WI7 A;  2HEQ A;  3SWN C;  1K73 U;  1O75 A;  1OZ3 A;  1KD1 U;  3FIF A;  1B07 A;  2VWF A;  4L5G A;  5AT1 B;  5CKE A;  2DFU A;  3OMC A;  1FMK A;  1G3Y A;  3OY9 A;  2HQH A;  2P0P A;  4C0G A;  3CCM Q;  4LDU A;  3PTA A;  4PJO B;  1ZSG A;  1K9M R;  5GAN 4;  3TU4 K;  1W70 A;  4PJO G;  1NLO C;  2E3H A;  2J06 A;  2CT4 A;  3VYG A;  4EDU A;  3X24 B;  1ZA2 B;  1JXM A;  4BY6 B;  3OYH A;  1GBQ A;  2AZS A;  2QDY B;  4AMC A;  1MNE A;  4QQG A;  1KHC A;  1M8M A;  4JJC A;  2DL7 A;  4JJD A;  1CKA A;  4M78 G;  4Z89 A;  2LP5 A;  3UT1 A;  4E2F B;  3CXC P;  2CGH A;  2LT4 A;  5CQX A;  2WSC E;  3CC4 T;  2LJ0 A;  4IIM A;  5GAN e;  2K5F A;  1SG5 A;  4ELY C;  1R77 A;  1SPK A;  4PLI A;  2CP0 A;  3LX7 A;  3PMT A;  4D8K A;  1TXQ A;  3G4S T;  4M7A B;  1IGQ A;  3REA B;  2A37 A;  2RQR A;  1UHC A;  2HQE A;  2QGG A;  3OSV A;  4LN2 A;  2KXC A;  1K1Z A;  1N8R C;  1TG0 A;  4QT7 A;  5AYF A;  4F7U B;  3DKM A;  2K3X A;  5J39 A;  1ZBJ A;  2J6O A;  3NGP A;  1S72 Q;  1WLP B;  4CC7 A;  1T3L A;  1VQ8 Q;  2HSP A;  2ENM A;  3I35 A;  3H8Z A;  2Y90 A;  1M90 C;  2JVV A;  4J9E A;  2RI2 A;  3WXM B;  3P8D A;  1VQL Q;  1BBZ A;  4QQ6 A;  2C0O A;  3CBP A;  1VQO Q;  3CBO A;  2K6D A;  1GRI A;  5GAO l;  1ARK A;  4MZM A;  2RB6 A;  3AHU A;  4C5G A;  2EQK A;  4J6X A;  4Z8A A;  3VYH B;  1QVG P;  1MMN A;  4F7U G;  1U06 A;  4C0D B;  3VUB A;  2K3Y A;  3CCL T;  4KUI A;  2GGR A;  1GBR A;  2EVR A;  2ESW A;  3CCV T;  4C92 A;  5M9O A;  3VJP A;  4GLK A;  2EYZ A;  1GXI E;  2K2V A;  2X4X A;  1M8V A;  3TQ7 P;  5GAN 3;  2JUF A;  4JRK A;  2RQT A;  4M78 D;  3QDF A;  4M77 B;  3G71 Q;  2LT1 A;  4BDY A;  3CD6 A;  3X25 B;  1ZBX A;  1WHG A;  1VYT A;  5LJ3 j;  3CCJ Q;  1PCX A;  2I0N A;  5GAO n;  2LJ1 A;  2JN0 A;  4JJB A;  1M27 C;  1TH7 A;  3PGG A;  4LE9 A;  2KT1 A;  1IO6 A;  4RTW A;  1MND A;  1G5V A;  1MHN A;  4JJN K;  1X01 A;  1D1A A;  2QAZ A;  2YUO A;  3VS4 A;  2A28 A;  4OMM A;  4EMK B;  4JPB W;  3OSS C;  3LGL A;  4C0Z A;  3CCS A;  5GAM g;  1QP3 A;  3CCE Q;  4HXJ A;  4QQD A;  2FPE A;  5GMK m;  1VA7 A;  4LUD A;  5KYW B;  2GNC A;  3UWN A;  1VQO T;  2B86 A;  3CCR Q;  3JB9 F;  4CC4 B;  1YJW T;  3HFO A;  5IHK A;  1K9M U;  1QKX A;  3I55 T;  3IQL A;  2M02 A;  2DO3 A;  3ZFJ A;  3KFV A;  1JO8 A;  3KXT A;  4XU3 A;  3V7R A;  5CKD A;  1X75 C;  2X3W D;  5DLO A;  3OYY A;  4BI4 A;  2DYB A;  5CCA A;  4HT9 A;  2DIQ A;  2V26 A;  3I56 A;  2CZ7 B;  4F7U A;  2CP7 A;  3V7S A;  2ROT A;  2HBP A;  5GAO r;  2MCN A;  2VGN A;  1M3B A;  4C92 G;  2DXC A;  5FRN A;  1Q95 G;  2EW3 A;  1IZ6 A;  1KK7 A;  2YDL A;  4BAC A;  1B34 A;  2QAS A;  3JV3 A;  3C95 A;  4TVR A;  3JCM c;  5I22 A;  1ZQ1 A;  2DXT A;  3HFN A;  3CBM A;  5A2Q E;  1RAG B;  4OP0 A;  3FDR A;  3HKS A;  1G83 A;  3GNG A;  2OTJ T;  1O9S A;  3A8G B;  4XTX A;  1Y7X A;  3OYN A;  3BFM A;  1WYX A;  1VQM Q;  4CC2 A;  2XKO C;  1U1T A;  3THK A;  2RJD A;  3PE0 A;  2LNH B;  3J7A F;  1M5Q 1;  1KC8 U;  2AHJ B;  3V8J A;  2LNV A;  2R57 A;  2D1X A;  4JRQ A;  4D8D A;  3JB9 D;  4M77 F;  2AT1 B;  1C0M A;  4J9D A;  4JLG A;  2DTI A;  2KK4 A;  1W4S A;  2LQK A;  1N5Z A;  2LZ6 B;  4PJO A;  1VOM A;  4ANJ A;  2NUZ A;  3FEO A;  2F2V A;  3LWH A;  2FYK A;  3E9F A;  2DER A;  4AG2 C;  4LXC A;  1AWX A;  2DK3 A;  1PD1 A;  3MP8 A;  2FZG B;  5GAM h;  3ME9 A;  3EH2 A;  2K57 A;  3OS1 A;  5FRO A;  2DXB A;  3CMA A;  3PNW C;  1V76 A;  3HRU A;  4C8Q G;  2CUD A;  4OB1 B;  2MF2 A;  1OI1 A;  5KCH A;  1D1C A;  4DBR A;  4M7D C;  1YCY A;  4L59 A;  2O4X A;  1X6G A;  3QJY A;  1NPR A;  4J6Y A;  3QJ6 A;  2BKD N;  1WJS A;  2DVJ A;  4C8Q D;  1NPP A;  3UA7 A;  2F5K A;  2WSE E;  3QZ5 B;  5IXF A;  4MML A;  4PJJ A;  4ELZ C;  4EMK C;  3OYA A;  2ZPG B;  4JLI A;  2RI3 A;  3VRZ A;  4OB2 B;  2RN8 A;  3M9Q A;  2DPP B;  1RAH B;  4ZTF A;  1RAB B;  5GAN 8;  3MP6 A;  4KH0 B;  2DEU A;  2NUT B;  4OMQ A;  4XTV A;  1FX7 A;  3EAE A;  2AZV A;  2DL8 A;  1M1K R;  3QSU A;  1T0J A;  1GCP A;  3WVE B;  4AFS C;  2RNA A;  1OU9 A;  5FU6 C;  3JCM Q;  1EX4 A;  2DA9 A;  2E1H A;  3CC7 Q;  2RJF A;  3VV0 A;  3OMG A;  3JB9 G;  3EHQ A;  3QYG B;  3OBY A;  2QEX T;  4RTT A;  2KRO A;  3CCU A;  3OS0 A;  2L8D A;  4DOV A;  3OYD A;  3RER A;  3A8O B;  5HKC A;  3QKJ A;  2CP3 A;  3QBY A;  2GBQ A;  3I9Q A;  5KE3 A;  1UJ0 A;  2RHX A;  1JJ2 P;  2RI5 A;  3OB9 A;  1MV0 B;  4PJO F;  2DLP A;  2P84 A;  1BK2 A;  1S72 T;  2EBP A;  4N4I A;  4M7D B;  2RK2 A;  2LJ3 A;  1X69 A;  1WJR A;  4R0K A;  1W2B P;  3HRT A;  3CC2 Q;  1YHQ A;  3FJ5 A;  1VQN T;  9ATC B;  1VQL T;  1U8R A;  1RAC B;  2DL3 A;  1SKU B;  2E65 A;  3FRN A;  4J8O A;  1IXD A;  3EGU A;  3MEV A;  3HHT B;  1GCQ A;  1E6H A;  5A0L A;  4JZ3 A;  3MET A;  1PRM C;  1YI2 Q;  1ZUY A;  3A8M B;  2QYZ A;  3HRS A;  1M2O A;  1NZ9 A;  1YNZ A;  1YJN T;  3M4G A;  2QEX Q;  1E7O A;  3CCV Q;  3RKY A;  4F7U E;  3LW5 E;  1UGP B;  3LLR A;  2HAX A;  5L23 A;  1BCM A;  3UA6 A;  2DKG A;  5CO7 A;  3M0Q A;  2KRM A;  2QI2 A;  4M78 C;  4M75 G;  4RTU A;  4QKU A;  1EZZ B;  1KQ1 A;  3E1S A;  2R5A A;  3OW2 P;  1XNI A;  2DZC A;  2VKN A;  1JXO A;  2W0Z A;  3GF5 A;  2D8J A;  1BI1 A;  1YIT T;  2KEA A;  1WHL A;  1WJQ A;  1V29 B;  3CEY A;  3EG9 B;  4E6R A;  1KC8 C;  3I5R A;  2F5T X;  3JB9 H;  1SEM A;  1AD5 A;  2X3X D;  4P5N A;  2CYZ B;  1M1F A;  1WXU A;  1IRE B;  4OML A;  3KUF A;  2O9V A;  2DZ9 A;  3CME Q;  3P8H A;  1FMW A;  1YJN A;  1F1B B;  4N4G A;  1VIE A;  5KYU B;  4M77 E;  2CP6 A;  1AVZ C;  2DX1 A;  5GAM j;  4M78 A;  1W2B A;  4KGZ B;  4OMO A;  4IUT A;  2LTO A;  3QWY A;  4IUU A;  1K0S A;  3QG1 A;  2PUO B;  1WHH A;  1M3A A;  3CCS T;  1AHJ B;  3EGD B;  1OX9 A;  2WSF E;  3VRY A;  4QVC A;  1PD0 A;  2RJC A;  3LGF A;  2IPO B;  1GL5 A;  2ZPE B;  2OTL A;  4J9C A;  4HVV A;  2JM9 A;  3RDV A;  4ORZ A;  1YJW A;  2HCK A;  1YCS B;  1Y0M A;  3QDR B;  1VQ5 Q;  1M4Z A;  3VU3 C;  5LJ5 j;  1Q86 R;  2HDA A;  3RUX A;  1YIT Q;  1U5S A;  2KI7 A;  4LDW A;  3QPH A;  4LDX A;  1T3S A;  3OYF A;  1PC0 A;  3OBW A;  3JRZ A;  1XOV A;  4O6J A;  1ZX6 A;  1VQ6 T;  5CVI A;  2ZPI B;  2VGM A;  5I11 A;  4AT1 B;  4MZT A;  5GAN h;  1X27 A;  4DOW A;  1Y57 A;  3SB2 A;  2YRD A;  3CPW S;  2ZCF B;  1A0N B;  3JCM X;  1RLQ C;  2ECZ A;  4OGE A;  3C12 A;  5DY9 A;  2O2O A;  3DLM A;  1TS9 A;  3O8V A;  1BCO A;  1UB4 A;  2EAY A;  4RMO A;  1HXD A;  2FPF A;  3CCJ A;  4E7Z A;  4BE2 A;  3OYE A;  5IHI A;  3VKI A;  3LH0 A;  4ME7 A;  1K8A U;  5GJV B;  4IKF A;  1BIA A;  4Y91 A;  2DEQ A;  1RAE B;  2P0Q A;  1H3Z A;  2J6K A;  1N6A A;  5GMK e;  1LVK A;  4KT0 E;  4M78 F;  3F70 A;  5GAN 7;  3DB4 A;  2P0K A;  2HD0 A;  2XDP A;  3MEW A;  5CIU A;  4M75 F;  4DBF A;  3G4S A;  1U3O A;  2EQJ A;  2GQV A;  1Y96 A;  3SEM A;  1KG1 A;  1PKT A;  1MMG A;  1YFN A;  2RM4 A;  4C8Q E;  3AT1 B;  2QDL A;  2HZY A;  4EMK A;  5FRM A;  2L0A A;  2DBM A;  2IIM A;  2F69 A;  2MI6 A;  1YJ9 T;  2QTV A;  4RTY A;  2D0N A;  4BI8 B;  1LNX A;  3CMA T;  3VUZ A;  1H3H A;  4A4G A;  4RCB A;  1UGR B;  3GP8 A;  2V8J A;  2Z0W A;  1RLP C;  4LD9 K;  2DTO A;  4FYX B;  4FYY B;  2K9G A;  4LUE A;  3S3M A;  2CT3 A;  2L3Q A;  3MEU A;  3RIR A;  4M77 A;  4RUG A;  2VYT A;  4RKU E;  1JBM A;  1TSF A;  2ZPB B;  3HL8 A;  2BZ8 A;  2VC8 A;  4C92 B;  3URG A;  2AKK A;  5GMK l;  4FU6 A;  3H0I A;  2HQX A;  4C8Q B;  2GFA A;  3EG0 A;  4JZ4 A;  5GAO p;  1I5L A;  3SHW A;  3CCR T;  4M75 B;  4M7A A;  2RQU A;  2ZAE A;  3SFM A;  1OQK A;  1E6G A;  2LCS A;  3MO8 A;  1XTD A;  2JXB A;  2LX7 A;  4C5E A;  2KY9 A;  4VUB A;  3MPU B;  4M7A F;  1CKB A;  3M55 A;  3CCL Q;  4M77 C;  3I5S A;  2VB6 A;  1SSH A;  1WHK A;  2X4J A;  3ASK A;  3GOX A;  2PUK B;  4ZNX A;  1OU8 A;  3NFC A;  2JTF A;  2FRW A;  3L1A A;  2CSI A;  2F2W A;  2RK1 A;  1NLP C;  1QWE A;  3G71 T;  3H9N A;  3FC3 A;  4A53 A;  2ZZD A;  2KE9 A;  3A98 A;  5A0G A;  1YHQ T;  4R56 A;  2JM8 A;  4MMK A;  5J26 A;  2QQR A;  2PVO B;  1VQL A;  1YWO A;  3CMA Q;  3S3N A;  1Q81 R;  5DM7 R;  1RAD B;  3S3O A;  1QMC A;  5IT9 E;  1G2B A;  4M77 D;  1SRM A;  4E7L A;  1KC8 R;  5HCK A;  1KD1 R;  3OW2 S;  2DMO A;  3LWI A;  2XU8 A;  1Q7Y U;  4ZN1 A;  2E3I A;  4E7H A;  4ZGD B;  1D0X A;  3FB9 A;  1MUZ A;  4Y28 E;  3CCQ A;  1VQK Q;  4PK4 A;  3EG9 A;  5GAN 6;  5FLX E;  4A4E A;  3L2U A;  1UFF A;  3PIO A;  4HCB A;  1OPK A;  1ABO A;  1I1J A;  2FB7 A;  3I55 Q;  1IB8 A;  1VQP A;  3EGD A;  1MMD A;  3OS2 A;  1X43 A;  1M3C A;  4PJO E;  3D7S B;  1ZSZ A;  1C6V X;  4CI0 C;  1OOT A;  4X34 A;  1WHJ A;  1BI2 A;  5IAY A;  2M9U A;  4ESR A;  1K8A C;  2E10 A;  2L89 A;  4C92 F;  1KIK A;  2YUP A;  5A0D A;  2LCC A;  2EYY A;  1GCQ C;  1TUD A;  3RKX A;  3SWN A;  2LRQ A;  2M0Y A;  1GFC A;  3KBG A;  5GMK j;  2CZ1 B;  3QZ9 B;  1VQ4 T;  2XD0 A;  2AIR B;  2QA4 Q;  2KR3 A;  3VS5 A;  1G3T A;  3GPL A;  3OYB A;  2OTJ Q;  4PNO A;  1K9A A;  2DVE A;  2RMO A;  5ECA A;  2QTX A;  3CCQ Q;  5CKB A;  1VQM T;  4C92 C;  1RL2 A;  2QXF A;  3TSZ A;  3JCM h;  1EIF A;  2H3J A;  3X20 B;  5KE2 A;  4N0A C;  4A54 A;  2EGA A;  5IH2 A;  4NS5 A;  3G6E T;  4C92 E;  4M75 E;  2E4H A;  3PT9 A;  3CD6 T;  1VQP Q;  1SHG A;  3NTH A;  1M2V B;  5FU7 C;  4AFZ C;  4B9W A;  1M90 R;  4M75 C;  1RAI B;  2PQW A;  1H64 1;  2E6Z A;  1VQK T;  3CC2 A;  1VUB A;  1G8X A;  2OI3 A;  4BE0 A;  1OYX A;  3EG1 A;  4LD6 A;  2ABL A;  2HKN A;  4F14 A;  1K73 C;  3GIB A;  1B3Q A;  4WTO B;  1TU0 B;  3Q1J A;  7AT1 B;  1QWF A;  4A4K A;  5CKH A;  2BUD A;  2X35 A;  3JB9 J;  1VQ8 A;  2RQV A;  3HTR A;  4XU1 A;  4MDW A;  1UGQ B;  3QWX X;  2PTK A;  2EKH A;  3OW2 A;  2I2L A;  4HA8 A;  5KCO A;  3QYH B;  1NYG A;  4OF1 A;  4F7U F;  1WXB A;  2DD5 A;  2CH4 W;  2NUP B;  4XAX B;  1PNJ A;  5GAN d;  3CXC A;  1JEG A;  2ED1 A;  4GBQ A;  4E47 A;  1VQO A;  2KBT A;  5GMK i;  3OYJ A;  5GAN g;  3MHX A;  4M4Z A;  2ZPH B;  3L2W A;  2RHZ A;  2MWP A;  3J80 E;  4J7F A;  4J9F A;  4BB7 A;  1YIJ T;  1M1K C;  5FWC A;  4HCC A;  4HCZ A;  1KD1 C;  4ZN3 A;  3CCQ T;  2DTH A;  3I56 T;  1TOV A;  4OB3 B;  5I21 A;  5KYX B;  2EPD A;  1YJN Q;  2O4X B;  1AT1 B;  1W6X A;  2EYW A;  3CCL A;  1WX6 A;  2JMC A;  3OYC A;  3CPF A;  4OVA A;  4L6V 5;  2MYS A;  2P4T A;  3M53 A;  4C8Q F;  2HSE B;  1Q86 U;  4JRI A;  2F2X A;  1YJ9 A;  1DJ7 B;  4Z88 A;  2CUB A;  3N5B B;  2X4Y A;  2NUT A;  1VQN A;  1V1C A;  3CCM A;  3L42 A;  3BY7 A;  4ATO A;  2BTT A;  2JS2 A;  2FPD A;  2CP5 A;  2DIG A;  3OYI A;  5GMK h;  3EGX B;  5IN1 A;  2E5K A;  1YBY A;  4PFP A;  1NYF A;  2FRY A;  2HMA A;  2BIV A;  1SHF A;  1B7T A;  3EFO B;  2MAM A;  8AT1 B;  4OMN A;  2LX9 A;  4KBM B;  2G3R A;  2GFU A;  3EFS A;  5GAN f;  1HYO A;  2A3L A;  2HKQ B;  2H8H A;  1NJI U;  5KYN A;  4EIK A;  2SEM A;  2IG0 A;  3BDL A;  3EH1 A;  3QUI A;  5DLQ E;  2QG9 B;  2YHT A;  4C5H A;  3GBQ A;  4KGX B;  1AWO A;  1K9M C;  1UDL A;  1C1A A;  4E7I A;  2KSS A;  2KVQ G;  1UUE A;  4EMH A;  1LOJ A;  2EJF A;  2CDT A;  2JJ9 A;  3H41 A;  1ABQ A;  3MKD A;  3G6E A;  4PKC C;  3OYK A;  3TRE A;  2YXY A;  3G7Z A;  4M75 D;  3L2R A;  2HNI A;  4JS4 A;  2EQU A;  4E7K A;  1WDX A;  3OS5 A;  3CC2 T;  1I8F A;  3CC4 Q;  4F17 A;  2RPN A;  5CK9 A;  4M78 B;  4LDY A;  2NWM A;  1VQ9 T;  1RI0 A;  2FG0 A;  3CXC S;  5KYU A;  4KUD K;  2DAQ A;  1KFZ A;  5C0M A;  2RHU A;  4LDV A;  1FMV A;  1RI9 A;  1M90 U;  4OMF B;  1X2K A;  2JMA A;  1YI2 T;  5KH6 A;  3FLG A;  2A36 A;  4UC4 A;  3GLX A;  1WZO A;  4FYW B;  2V1R A;  3OYL A;  5IHN A;  2NLU A;  1RUW A;  4Q5W A;  3EFR A;  1VQ7 Q;  4XU2 A;  2OTL T;  2JS0 A;  1PRL C;  1OV3 A;  3G4S Q;  3DLL A;  4XK8 E;  1SRL A;  2PVD B;  5HK3 A;  2MIO A;  4M7D F;  2IVW A;  4HVW A;  2OTJ A;  3VS6 A;  2EQM A;  1UEB A;  1TWB A;  3BE3 A;  4FYV B;  4GY5 A;  1S1N A;  3EFO A;  4CC3 A;  4PJM A;  3M54 A;  4C8Q A;  1I5O B;  3OA6 A;  1NBE B;  2CZ0 B;  1Q7Y R;  1ZSZ C;  3H0H A;  2LMJ A;  3JSC A;  5GAO m;  2L5Q A;  1YIJ A;  4M7A G;  1N9S A;  2DET A;  4XQ3 A;  2K3B A;  2DIL A;  3NMZ C;  1LPL A;  1Z9Z A;  5HK0 A;  1D09 B;  2MMP A;  2YLC A;  3A1P A;  3TEE A;  4XU0 A;  2EFI A;  4QW2 A;  4R55 A;  1K0X A;  1BB9 A;  2V8K A;  2COZ A;  4PFO A;  1QW1 A;  2FHD A;  2O88 A;  5IXB A;  4M7A D;  4MDX A;  2EIF A;  5FW9 A;  5D7U A;  3X28 B;  1QVF P;  3QO3 A;  2YSQ A;  5CAI A;  5KYW A;  4DA4 A;  4M7D E;  1N8R U;  2O31 A;  2M1H A;  5LJ5 g;  3RR6 A;  1D0Z A;  2W10 A;  1QVF S;  2GQI A;  4OB0 B;  3A8H B;  3M0P A;  5CQY A;  2X4W A;  3H0F A;  3C4S A;  4HT8 A;  5GAN 2;  2OTL Q;  1TTH B;  3M0U A;  2DNU A;  3M59 A;  4BI3 A;  2CRE A;  3NTI A;  4HVU A;  4EPC A;  1W2B S;  2XG8 D;  2EKO A;  5I2S A;  2EGE A;  4PL6 A;  1CSK A;  1BU1 A;  4MZP A;  1WQW A;  3MEA A;  1X6O A;  2E5Q A;  3CCJ T;  3M0S A;  4N0A A;  5LJ3 d;  3V8K A;  1I4K 1;  3QII A;  5LJ3 e;  1UEC A;  3BDU A;  5LJ3 g;  4NL3 A;  4NOY A;  1M30 A;  3CPW A;  3E19 A;  2A0F B;  4OGC A;  1QKW A;  4F16 A;  1I07 A;  1QCN A;  3RNJ A;  4ZGJ B;  1AEY A;  4E7S A;  3QXE B;  1XJW B;  1FYN A;  1NE8 A;  1WPY A;  1YJW Q;  4FT2 A;  2HL5 C;  1EFN A;  3R6O A;  2JOY A;  1VQ5 A;  2K4Y A;  2DE0 X;  5D6W A;  2F1L A;  2B8A A;  1NJI C;  3GNF B;  1VQN Q;  3PMI A;  2NYS A;  1PKS A;  4J5Y A;  1UGS B;  2D9T A;  5HY6 A;  3OQ5 A;  3QHS A;  2RF0 A;  3CCU T;  1QCO A;  2JTM A;  1BIB A;  4XTW A;  4KRT A;  2EYQ A;  1TUC A;  1ZUK A;  1HK9 A;  1AOJ A;  2KNB B;  2KRN A;  5LJ5 f;  3OYM A;  2KQW A;  4J9I A;  2C06 A;  3H6Z A;  4LNP A;  4BDZ A;  1YJ9 Q;  3INZ A;  3CQT A;  2KYM A;  4D6W A;  2E41 A;  1VQ8 T;  1D3B A;  4BE1 A;  3O5Z A;  2LCL A;  1WQ7 A;  1Q82 C;  4DBH A;  2KRS A;  3TCJ A;  3JCM f;  2Y4X A;  4ZGE B;  4C8Q C;  4B6M A;  3SD4 A;  2ED0 A;  1JU5 C;  1N8R R;  4II1 A;  1YN8 A;  1ZSZ B;  1NJI R;  2RHI A;  2R5M A;  1T0H A;  1QLY A;  1OPL A;  2QK0 A;  1SF9 A;  3CC4 A;  1IHW A;  4JRP A;  1UHF A;  1QVF A;  2OAW A;  1WGS A;  3BW1 A;  4DEY A;  2QA4 A;  1UGV A;  1D3B B;  2DRM A;  5FU6 B;  5GAN 5;  3X26 B;  1VQ6 A;  1PSE A;  4IUP A;  2EJG A;  4DBQ A;  3M0R A;  4X1V A;  2DJZ A;  2DRK A;  3CCS Q;  2EWN A;  3LH5 A;  4X9C A;  3M58 A;  2EQI A;  5LJ5 d;  5J3B A;  2XK0 A;  4RTV A;  3ZBD A;  2OJ2 A;  2JZ2 A;  2D8H A;  2PU9 B;  1UE9 A;  1B34 B;  2OX7 A;  4FT4 A;  1YP5 A;  2LVM A;  4PJN A;  3T9N A;  3JCM P;  2QQA A;  3EHR A;  2YUQ A;  3P8B B;  3OYG A;  1VQ4 Q;  2FZC B;  2KGT A;  4K11 A;  3PIP A;  2YRC A;  3EG2 A;  2DXU A;  3JCM d;  2DL4 A;  2MK5 A;  4PLL A;  2RO0 A;  4PJO C;  4RG8 A;  3ZEH A;  2M51 A;  2X9H A;  1KJW A;  1JRI A;  2MWO A;  3L2Q A;  5KYX A;  4QVZ A;  5EG2 A;  1MV3 A;  1VQ7 A;  1WFW A;  4A4F A;  2VXF A;  1FWZ A;  1OEB A;  2A7Y A;  1W1F A;  2XMF A;  4FM4 B;  4F04 B;  1VQP T;  1VQ9 A;  3CC7 T;  5EC7 A;  4M7D A;  4JS5 A;  2YWW A;  1JJ2 S;  4XTU A;  1KHI A;  1UTI A;  5GAM f;  3NPF A;  2OAU A;  4KGV B;  1QP2 A;  2VVK A;  3MCA B;  3R6N A;  2C0T A;  2BE9 B;  1BI3 A;  2K5L A;  4CRI A;  4WCI A;  3RKW A;  4FIB A;  1NEB A;  1ZLM A;  1K76 A;  1K8A R;  1NEG A;  4WF2 A;  1BKB A;  5L8R E;  3M0T A;  4IIO A;  1Q82 U;  4C0F A;  1K4U S;  2AK5 A;  4QVD A;  1KSW A;  4AFU C;  2VAS A;  1VQ4 A;  3LYI A;  1VQ7 T;  2MPX C;  4PJL A;  1LCK A;  1YI2 A;  5CR2 A;  3I55 A;  3SDZ A;  1PWT A;  5D6Y A;  2RHY A;  3MP1 A;  4V2S A;  3V8L A;  1VQM A;  2D6F A;  4DQ2 A;  2RA2 A;  3UF4 A;  1R8O B;  2K2M A;  2D0Q B;  4XTY A;  2LQW A;  3E2U A;  5LJ5 h;  1RAF B;  3JAM E;  1Q82 R;  3PFS A;  2ATC B;  2P4R A;  1KQ2 A;  1YWP A;  1Q7Y C;  5GJW B;  3RMQ A;  2CH4 A;  2XID A;  8ATC B;  5C6S A;  4FCY A;  1Y96 B;  5GAM e;  2PVG B;  4IUQ A;  1HJD A;  2O01 E;  2DJQ A;  4C92 D;  3ZL7 C;  2A08 A;  5GAM d;  4B9X A;  1PHT A;  3TSW A;  2QA4 T;  4OMP A;  4BUG A;  2E70 A;  3RES A;  4C5I A;  3PVQ A;  2GF7 A;  1UJY A;  2DM1 A;  1M9S A;  1HSQ A;  2YLB A;  1Q81 C;  4YTL A;  1I81 A;  2O9S A;  3CCE T;  2YT6 A;  3REB B;  4A4H A;  4M7D G;  3JB9 I;  2HBW A;  2XIC A;  2ZGW A;  1X2Q A;  1WA7 A;  3G6E Q;  3A5Z B;  1I0C A;  3NHN A;  3C94 A;  4PFZ A;  3ER0 A;  2DD4 A;  4IUR A;  1MMA A;  1VYU A;  5LJ3 h;  1PM3 A;  2QQB A;  3HPW A;  3JCM V;  2KXD A;  1NM7 A;  4BY6 C;  1M1K U;  3M56 A;  3CME T;  2EYX A;  3EG3 A;  1Q86 C;  5KYY B;  1D0Y A;  2FL7 A;  4FSS A;  1OX8 A;  4FSX A;  1D1B A;  2VV5 A;  5CKF A;  2E64 A;  2J05 A;  3UAT A;  1NG2 A;  4Y92 A;  4RCC A;  2RH2 A;  2K5I A;  3CCE A;  2LDM A;  1Q81 U;  1Z9Q A;  2L3S A;  1FXX A;  3CCR A;  1BI0 A;  2K79 A;  1QVP A;  3M57 A;  1OZ2 A;  2BE7 D;  3V7C A;  1TUG B;  2QQ9 A;  3CC7 A;  1JB0 E;  2VXE A;  4M7A C;  4AFQ C;  2CKK A;  4FL6 A;  5KYY A;  1WIE A;  2L3R A;  1OUL A;  3HSB A;  1IHV A;  4GLM A;  4J6W A;  5LL6 S;  1VQ5 T;  5GAO q;  3RBB B;  2L2P A;  4PJO D;  1QVG A;  1G3S A;  1KQS S;  3EGX A;  2AKL A;  2LQN A;  2FEI A;  3S6W A;  2DBK A;  2DF6 A;  4RG2 A;  3JCM e;  2YRV A;  3I56 Q;  2CSQ A;  2PZ1 A;  1H92 A;  2DL5 A;  3C0C A;  2J6F A;  2ZPF B;  2KDS A;  4RTX A;  1G3W A;  1MGQ A;  1KQS A;  2DYI A;  3VS2 A;  1IGU A;  1BYM A;  1M1G A;  2FZK B;  4NL2 A;  3J81 E;  3E9G A;  2KMT A;  2ROL A;  1ZUU A;  3CCV A;  5LJ5 e;  4FW1 A;  3L2V A;  2V1Q A;  3MJX A;  3ULR B;  2XHC A;  4FW2 A;  4C0D C;  1K73 R;  1VQK A;  2FO0 A;  3NTK A;  4M75 A;  2JT4 A;  3A8L B;  3PVL A;  4AG1 C;  3RMS A;  3JCM J;  3M4Y A;  1WHM A;  3G1J A;  4XTZ A;  2JNG A;  1U1S A;  1RAA B;  4J9H A;  5FU7 B;  4JDS A;  2QEX A;  1S72 A;  2EJ9 A;  1Y07 A;  2COW A;  1QCF A;  3HP9 A;  2NUP A;  6AT1 B;  1QVG S;  1WXT A;  2GCX A;  1AZE A;  1LJO A;  1AZG B;  4J9B A;  1JJ2 A;  4RTZ A;  2XDB A;  1N9R A;  2RJE A;  1H8K A;  1R0B G;  1VQ9 Q;  2CS7 A;  2EGC A;  2MOX A;  2L3P A;  4M78 E;  1P92 A;  2RD1 A;  3UPU A;  4O5V A;  5LJ3 f;  2BZY A;  2C0I A;  3CD6 Q;  2K7A A;  2XDD A;  2KT8 A;  1Y71 A;  3L2Z A;  2H3E B;  2QGF B;  4M77 G;  4BD3 A;  3CME A;  3FJP A;  2COY A;  1GFD A;  4KUL A;  5FWB A;  4J9G A;  2PNI A;  3JCM g;  4KH1 B;  2KAF A;  4ZTJ A;  3G71 A;  2WAC A;  1PG5 B;  3VS7 A;  1R0C B;  2X51 A;  1VYV A;  2RQW A;  3VS3 A;  1PSF A;  1UG1 A;  5D6X A;  4DEX A;  4Z02 A;  4A63 B;  3CCM T;  2J7I A;  3TVT A;  3VS1 A;  2KYB A;  3CPW P;  2QQS A;  4IUV A;  2M0O A;  2SRC A;  2YUN A;  2FVU A; 
#chains in the Genus database with same CATH homology
 4HCK A;  2ED0 A;  2JTE A;  3VS0 A;  3EHQ A;  1JU5 C;  2EYY A;  1GCQ C;  1TUD A;  1YN8 A;  2GTJ A;  4RTT A;  2KRO A;  2M0Y A;  1GFC A;  2BZX A;  1T0H A;  1QLY A;  1OPL A;  1HD3 A;  3U23 A;  2GTO A;  1UHF A;  2GBQ A;  3I9Q A;  2KR3 A;  2OAW A;  3VS5 A;  1UJ0 A;  4DEY A;  1UGV A;  2DRM A;  1AWW A;  1X6B A;  2JW4 A;  1MV0 B;  1K9A A;  2RMO A;  5ECA A;  2DLP A;  1BK2 A;  3TSZ A;  2EBP A;  3M0R A;  4X1V A;  2DRK A;  1JQQ A;  2EGA A;  5IH2 A;  2LJ3 A;  3LH5 A;  1X69 A;  2EQI A;  4R0K A;  1SHG A;  2G6F X;  1AWJ A;  1J3T A;  3FJ5 A;  4RTV A;  4AFZ C;  2OJ2 A;  2D8H A;  1WI7 A;  2OI3 A;  1UE9 A;  2HEQ A;  3EG1 A;  1YP5 A;  2ABL A;  2DL3 A;  1B07 A;  2VWF A;  4F14 A;  1B3Q A;  2YUQ A;  3EGU A;  3EHR A;  1GCQ A;  1E6H A;  4K11 A;  2KGT A;  4JZ3 A;  1QWF A;  3EG2 A;  1PRM C;  1ZUY A;  2DL4 A;  1FMK A;  1YNZ A;  2M51 A;  1E7O A;  1KJW A;  1ZSG A;  2RQV A;  1W70 A;  1MV3 A;  3QWX X;  1NLO C;  1WFW A;  2PTK A;  2J06 A;  2EKH A;  2CT4 A;  5L23 A;  1OEB A;  1NYG A;  3UA6 A;  1WXB A;  1JXM A;  2CH4 W;  3M0Q A;  2KRM A;  1W1F A;  1GBQ A;  2XMF A;  1PNJ A;  2AZS A;  1JEG A;  2ED1 A;  4GBQ A;  2KBT A;  4RTU A;  5EC7 A;  1M8M A;  4JJC A;  2DL7 A;  2VKN A;  1JXO A;  4JJD A;  1CKA A;  2W0Z A;  4M4Z A;  2D8J A;  4Z89 A;  2LP5 A;  2KEA A;  1UTI A;  3NPF A;  4J9F A;  2LJ0 A;  4IIM A;  4E6R A;  2VVK A;  5FWC A;  3I5R A;  1SEM A;  1AD5 A;  2X3X D;  3R6N A;  1SPK A;  2C0T A;  4WCI A;  1WXU A;  4D8K A;  1NEB A;  1ZLM A;  4OML A;  1K76 A;  1NEG A;  2O9V A;  2EPD A;  3REA B;  3M0T A;  2A37 A;  4IIO A;  2RQR A;  1UHC A;  4LN2 A;  1K4U S;  1W6X A;  2AK5 A;  2EYW A;  1WX6 A;  2JMC A;  2KXC A;  1K1Z A;  1KSW A;  4AFU C;  1TG0 A;  4QT7 A;  1AVZ C;  2DX1 A;  1LCK A;  4OMO A;  2F2X A;  3QWY A;  1K0S A;  4Z88 A;  2CUB A;  1ZBJ A;  2J6O A;  3NGP A;  1M3A A;  1WLP B;  4CC7 A;  1T3L A;  1V1C A;  3VRY A;  1PWT A;  2BTT A;  2HSP A;  2ENM A;  2JS2 A;  2FPD A;  3I35 A;  1GL5 A;  4J9C A;  3UF4 A;  4HVV A;  4J9E A;  2E5K A;  2K2M A;  1NYF A;  2FRY A;  2LQW A;  2JM9 A;  1SHF A;  4ORZ A;  2P4R A;  4OMN A;  1BBZ A;  1YWP A;  2HCK A;  2C0O A;  1YCS B;  1Y0M A;  5GJW B;  2CH4 A;  2K6D A;  1GRI A;  2HDA A;  1ARK A;  2H8H A;  4EIK A;  1HJD A;  2SEM A;  2DJQ A;  1U5S A;  3ZL7 C;  2A08 A;  4Z8A A;  1PHT A;  3TSW A;  1T3S A;  1U06 A;  3GBQ A;  1AWO A;  4OMP A;  1UDL A;  1XOV A;  2GGR A;  1ZX6 A;  3PVQ A;  1GBR A;  2EVR A;  1UJY A;  2DM1 A;  2ESW A;  1UUE A;  1HSQ A;  5I11 A;  2EYZ A;  2O9S A;  2CDT A;  1X27 A;  2YT6 A;  1Y57 A;  3REB B;  3H41 A;  1ABQ A;  2RQT A;  1A0N B;  2HBW A;  1X2Q A;  1RLQ C;  2ECZ A;  1WA7 A;  1I0C A;  1VYT A;  2O2O A;  3NHN A;  1WDX A;  2I0N A;  2LJ1 A;  2FPF A;  4JJB A;  1M27 C;  4F17 A;  2RPN A;  5IHI A;  2NWM A;  4LE9 A;  2FG0 A;  2KT1 A;  1IO6 A;  4RTW A;  1VYU A;  1KFZ A;  5GJV B;  2KXD A;  1NM7 A;  1RI9 A;  2YUO A;  1X2K A;  2JMA A;  2J6K A;  2A28 A;  4OMM A;  3VS4 A;  2EYX A;  3EG3 A;  4JPB W;  2A36 A;  4FSS A;  2V1R A;  2J05 A;  3UAT A;  1NG2 A;  4Y92 A;  5IHN A;  1RUW A;  4HXJ A;  1U3O A;  2JS0 A;  3SEM A;  1PRL C;  1OV3 A;  1PKT A;  2FPE A;  1SRL A;  1VA7 A;  1Z9Q A;  4LUD A;  2MIO A;  2L3S A;  2QDL A;  2GNC A;  4HVW A;  2K79 A;  2L0A A;  2B86 A;  3VS6 A;  4CC4 B;  5IHK A;  2DBM A;  2IIM A;  1QKX A;  1S1N A;  3IQL A;  4CC3 A;  4AFQ C;  1WIE A;  3KFV A;  1JO8 A;  4RTY A;  2D0N A;  3H0H A;  2LMJ A;  1H3H A;  4GLM A;  3RBB B;  2X3W D;  2K3B A;  2DIL A;  2L2P A;  1RLP C;  2DYB A;  3NMZ C;  1Z9Z A;  2K9G A;  4LUE A;  2AKL A;  2CT3 A;  2L3Q A;  2LQN A;  2FEI A;  2DBK A;  1BB9 A;  2DF6 A;  2ROT A;  4RUG A;  1K0X A;  2MCN A;  2CSQ A;  2PZ1 A;  1H92 A;  2O88 A;  1M3B A;  2DL5 A;  3C0C A;  5IXB A;  2J6F A;  5FW9 A;  2BZ8 A;  4RTX A;  2EW3 A;  2AKK A;  3VS2 A;  2YDL A;  2YSQ A;  3H0I A;  3JV3 A;  3EG0 A;  2O31 A;  4JZ4 A;  3SHW A;  5I22 A;  2ROL A;  1ZUU A;  2W10 A;  1G83 A;  2GQI A;  3M0P A;  2V1Q A;  1WYX A;  2RQU A;  3H0F A;  4CC2 A;  3ULR B;  3THK A;  1E6G A;  3M0U A;  2DNU A;  2LCS A;  2FO0 A;  2CRE A;  4HVU A;  3PE0 A;  2JXB A;  2LNH B;  2LX7 A;  2JT4 A;  2EGE A;  1CKB A;  3PVL A;  4AG1 C;  1CSK A;  2D1X A;  4D8D A;  3I5S A;  1BU1 A;  1SSH A;  4J9D A;  3M0S A;  4ZNX A;  2FRW A;  2CSI A;  4J9H A;  1UEC A;  1N5Z A;  2LZ6 B;  2F2W A;  1M30 A;  1QCF A;  2NUZ A;  1NLP C;  1QKW A;  1QWE A;  2F2V A;  4F16 A;  1I07 A;  3RNJ A;  1WXT A;  4AG2 C;  1AEY A;  1AZE A;  1AWX A;  1AZG B;  4J9B A;  2KE9 A;  1FYN A;  3A98 A;  4RTZ A;  2JM8 A;  1YWO A;  1H8K A;  2EGC A;  2MOX A;  2L3P A;  1G2B A;  1EFN A;  2CUD A;  2DE0 X;  1SRM A;  2BZY A;  2C0I A;  5HCK A;  2K7A A;  1PKS A;  1X6G A;  2DMO A;  2KT8 A;  2RF0 A;  2DVJ A;  3UA7 A;  1MUZ A;  4KRT A;  1GFD A;  5IXF A;  1TUC A;  1ZUK A;  5FWB A;  4J9G A;  1AOJ A;  2PNI A;  1UFF A;  2KNB B;  1OPK A;  2KRN A;  1ABO A;  4J9I A;  1I1J A;  3VRZ A;  4LNP A;  2RN8 A;  3CQT A;  2KYM A;  3VS7 A;  1X43 A;  1VYV A;  2RQW A;  4OMQ A;  1M3C A;  3VS3 A;  1UG1 A;  2AZV A;  2DL8 A;  1T0J A;  4DEX A;  4A63 B;  1GCP A;  4AFS C;  2J7I A;  3O5Z A;  2RNA A;  3TVT A;  3VS1 A;  1OOT A;  2KYB A;  2KRS A;  2DA9 A;  4ESR A;  2SRC A;  2YUN A;  1KIK A;  2YUP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...