5GJWB

Structure of the mammalian voltage-gated calcium channel cav1.1 complex for classii map
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
100
structure length
100
Chain Sequence
b'QGPHMALRKEAERQALAQLEKAKTKPVAFAVRTNVGYNPSPGDEVPVEGVAITFEPKDFLHIKEKYNNDWWIGRLVKEGCEVGFIPSPVKLDSLRLLQEQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Voltage-dependent L-type calcium channel subunit alpha-1S
publication title Structure of the voltage-gated calcium channel Cav1.1 at 3.6 angstrom resolution
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Membrane protein
total genus 16
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2016-07-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 5gjwB00
1TG0A 2EBPA 2KYBA 1YNZA 4JJDA 3VS1A 1SRLA 2O9VA 2OJ2A 1S1NA 2GNCA 1ZSGA 4OMNA 5GJVB 2M0YA 4HVWA 3EG3A 3VS2A 2KXDA 2ED0A 4OMLA 1KIKA 1K4US 1UHCA 2LQWA 4AFZC 3M0PA 1UDLA 1NYFA 2V1RA 2YT6A 3THKA 1X27A 2KXCA 3REBB 2JM8A 2BZXA 5ECAA 2HBWA 3VS7A 4Y92A 2KYMA 2RQWA 2JS2A 1T3SA 2GTOA 4JZ4A 2YUNA 1PWTA 2B86A 2FG0A 3EHQA 2KRSA 3CQTA 4RTXA 2NUZA 1Y0MA 2C0IA 4WCIA 1SSHA 1FYNA 2FRWA 2CH4A 3JV3A 2DRKA 3H0FA 1AZEA 2DL7A 1KFZA 2DBKA 1AZGB 2A36A 1OPLA 2JM9A 3H0IA 1ABOA 2YDLA 4AFSC 1WXTA 2DX1A 1V1CA 1MUZA 2K7AA 4Z88A 2F2WA 5FW9A 3REAB 3NMZC 1WLPB 5GJWB 2J7IA 2J6FA 2LX7A 4AFQC 2VKNA 1E6GA 2GQIA 1XOVA 1YN8A 5I11A 4LN2A 1GBRA 1WX6A 3NPFA 4ZNXA 2YUOA 3I35A 1VYUA 2SEMA 1T3LA 4QT7A 2BZYA 1M30A 1WFWA 3VS5A 2RMOA 1SPKA 5EC7A 1NYGA 2L3SA 1EFNA 1ZUYA 4Z89A 1I0CA 3RBBB 1YCSB 3RNJA 1WXBA 2VVKA 2D8JA 1PRLC 1CKBA 4OMQA 2FEIA 4M4ZA 2AZVA 2GGRA 5HCKA 3SEMA 3TSWA 3EG0A 2A28A 2QDLA 2AKKA 2DMOA 4J9CA 4E6RA 4JJBA 4CC3A 2P4RA 2EW3A 3SHWA 3UF4A 4CC7A 3M0UA 3VRZA 2O31A 5IXBA 1LCKA 1MV0B 1VA7A 2EPDA 1X6BA 2CUBA 1YWPA 1UJ0A 1WI7A 2MIOA 1A0NB 2EGCA 1WYXA 4RUGA 3I9QA 4ESRA 2FO0A 2DRMA 2JMCA 4ORZA 2DL3A 2EGAA 1M8MA 3O5ZA 2CREA 2W0ZA 2DL5A 1CSKA 3I5RA 2ROTA 2YSQA 3PVLA 2EYXA 2CUDA 2RF0A 4RTTA 2EYWA 2ROLA 2BTTA 4JZ3A 3EG1A 2LP5A 2CSQA 2EYZA 1QWEA 1W6XA 2RN8A 3M0RA 2ESWA 2JT4A 4RTVA 2EQIA 2DLPA 2AKLA 3NGPA 1NEBA 3VS0A 1ZX6A 4JJCA 1ARKA 2KR3A 4A63B 2CT3A 2CSIA 2JS0A 3UA6A 1BK2A 1HD3A 2KBTA 1RUWA 1X2QA 1AD5A 4RTYA 1Z9ZA 1OV3A 2ECZA 2C0OA 1K76A 2LJ3A 4GLMA 3UATA 2SRCA 3C0CA 4J9DA 2J06A 2DJQA 1AEYA 4DEYA 1GL5A 2DL4A 2V1QA 4X1VA 2JXBA 1JXOA 2CDTA 1B3QA 3A98A 2HCKA 5IXFA 4LUDA 1JEGA 2LQNA 1MV3A 1HJDA 1NEGA 2RNAA 1AWWA 1H8KA 2DA9A 2L2PA 2LJ1A 1ZUUA 2OI3A 4GBQA 2JMAA 4Z8AA 2E5KA 2H8HA 4KRTA 1W70A 1WXUA 1UG1A 2K2MA 1BU1A 1SHGA 5FWBA 1J3TA 1Y57A 2J6OA 2HEQA 2KE9A 2RQTA 4EIKA 1GFCA 1HSQA 1UJYA 1KSWA 1WIEA 1YWOA 4LE9A 1WDXA 1NG2A 2YUPA 2BZ8A 3TSZA 1GCQC 4J9EA 1AWJA 1E7OA 2OAWA 4J9HA 5IHIA 5IHNA 1M3BA 2M51A 1U06A 2ED1A 1M3CA 1JU5C 4AFUC 2PZ1A 1M27C 4HVVA 2LCSA 3R6NA 2LJ0A 1FMKA 3EG2A 1PKSA 2DVJA 1UHFA 2KNBB 2L3QA 2KRMA 4HVUA 4CC4B 4J9GA 1AWXA 3ZL7C 1PNJA 2FPEA 1QKWA 2K79A 3VS3A 1BB9A 1IO6A 1NLOC 4K11A 2L0AA 2DYBA 1K1ZA 2YUQA 2DF6A 4IIOA 1ZLMA 4FSSA 1GCQA 4J9FA 2J6KA 2PNIA 5IH2A 1RLPC 2RPNA 1X2KA 1QKXA 2A37A 5FWCA 2L3PA 3VS4A 1TUDA 3VRYA 2FPDA 1JQQA 2DM1A 2DILA 4AG2C 2X3WD 3FJ5A 1PKTA 2GBQA 2RQUA 2J05A 1G83A 1CKAA 2F2VA 1PHTA 2EVRA 1QWFA 2DNUA 1OEBA 2FPFA 2GTJA 2K9GA 3EHRA 1U3OA 1G2BA 3KFVA 2PTKA 3QWYA 2KT8A 4OMPA 2O2OA 1BBZA 1AWOA 4F17A 1ZBJA 2G6FX 3IQLA 5IHKA 2LNHB 1K9AA 4J9IA 2K3BA 1JXMA 1AOJA 2JTEA 2KT1A 1GRIA 1UTIA 1T0JA 2EKHA 2KROA 2RQVA 1X6GA 3M0TA 4J9BA 1TUCA 2D1XA 4HXJA 4HCKA 1SEMA 2DE0X 3VS6A 2NWMA 2I0NA 1OPKA 2LMJA 1K0XA 1NLPC 1VYTA 2O88A 1H3HA 1YP5A 2D0NA 4RTUA 3UA7A 2VWFA 2KRNA 2FRYA 1UFFA 1E6HA 1U5SA 3H0HA 4RTWA 1NM7A 1UUEA 4RTZA 2IIMA 2ABLA 2RQRA 2O9SA 4JPBW 1WA7A 1T0HA 1X69A 3M0QA 3PE0A 2CT4A 2KEAA 1GFDA 1RI9A 4OMMA 5L23A 1ZUKA 1K0SA 3ULRB 5I22A 3M0SA 1PRMC 1AVZC 1N5ZA 2XMFA 2KGTA 1RLQC 3EGUA 4LNPA 2EGEA 3U23A 1M3AA 1W1FA 2HSPA 2K6DA 1I07A 3GBQA 1Z9QA 4AG1C 1SRMA 2LZ6B 3NHNA 1GCPA 1X43A 2HDAA 3QWXX 1UGVA 2ENMA 1SHFA 2D8HA 1UE9A 4DEXA 2A08A 4F16A 1VYVA 2AZSA 1OOTA 3I5SA 3TVTA 1GBQA 2X3XD 4D8DA 2DBMA 2DL8A 4LUEA 4OMOA 1QCFA 1JO8A 2MCNA 1UECA 3LH5A 2W10A 2AK5A 3H41A 4IIMA 2CH4W 1I1JA 1ABQA 1QLYA 2C0TA 4D8KA 3PVQA 2MOXA 2EYYA 2JW4A 2F2XA 4F14A 1H92A 4R0KA 1KJWA 1B07A 4CC2A
chains in the Genus database with same CATH superfamily
3CXCA 2OTLT 1VQ8Q 1SRLA 2O9VA 1OQKA 4EMKC 1KQ1A 4IUTA 1OZ3A 3FIFA 2KXDA 2QQAA 1IHVA 3CC7T 2M9UA 3BDLA 4XU1A 3M0PA 3PIPA 4PJMA 4J7IA 3NFCA 3GPLA 4LDUA 2DXTA 1ZA2B 3MP6A 2BZXA 3RESA 5IT9E 3VUBA 4B9WA 5GANd 2MAMA 2KYMA 3GOXA 3INZA 3PNWC 1YITT 4QVDA 1M90R 4WTOB 2DFUA 3H9NA 4EMKA 3RR6A 2NUZA 3F70A 2C0IA 3CC7Q 3C95A 2K2VA 1YJWQ 1FYNA 3JV3A 1MMAA 2DRKA 3H0FA 1TS9A 1B34B 1KFZA 4AMCA 4PK4A 4LD6A 1WHKA 2JN0A 3OS0A 3NTIA 3H0IA 5GAN7 2EIFA 2YDLA 2DX1A 1V1CA 3JCMg 2NUPB 1YITQ 2JJ9A 1KC8R 1WLPB 1E6GA 3I56A 2ZCFB 3ASKA 4MDXA 4LN2A 2BUDA 1TWBA 2JVVA 3G6EQ 3SWNB 1JJ2P 1VQ5T 4E7KA 3JCMd 2DEUA 3VS5A 2O4XA 1SPKA 2DKGA 3N5BB 3EG9B 4M7AB 3GF5A 3CXCP 1YI2A 1BYMA 4C92C 1K8AC 3CCSQ 1PRLC 1Y96A 4OMQA 4QW2A 2XICA 4M78C 4OVAA 3JCMe 4M4ZA 3RMSA 1N6AA 1KK7A 4M7AE 4PFOA 1VQ5Q 4XTXA 3UF4A 1K73U 2RO0A 1PC0A 4IUUA 1VQ9A 3HSBA 2CUBA 2GFUA 1YWPA 5GAN4 1M1GA 1VQ4T 2XKOC 3RKWA 1Q86U 4C5HA 2QXFA 3TEEA 2RI2A 4C92A 2VV5A 4JRPA 3CD6T 4ORZA 3TU4K 3GNGA 2HL5C 4M78A 4PJOD 1VQKT 3RUXA 4EMKB 2ZPGB 1QVPA 1QCNA 2QGFB 2YSQA 3PVLA 3CPWS 3CPFA 2ZAEA 2DIGA 2RF0A 2EYWA 2DK3A 5CQXA 4KBMB 4JLIA 1IREB 2EWNA 2LP5A 3FRNA 1VQ4Q 2EYZA 3OYFA 2EQIA 5CAIA 3PFSA 4E7ZA 2AKLA 2Y4XA 3WXMB 1NEBA 2DXCA 2HQHA 3VS0A 2F1LA 2K57A 5C0MA 1VQKQ 4UC4A 4E47A 3PMIA 1YIJT 3QPHA 5GANh 4RTYA 3URGA 1Z9ZA 5HY6A 1NPRA 2COZA 2X9HA 1OU8A 3BY7A 4VUBA 1Q7YC 2GQVA 1NJIC 2P0PA 2GF7A 2RI5A 3P8HA 3C0CA 1TH7A 1C1AA 1OULA 3FEOA 1IB8A 2DJQA 1AEYA 1QMCA 2O4XB 3OYBA 4X1VA 3CCQA 2E3IA 1W4SA 1RAHB 1JEGA 2LQNA 2NYSA 4LDVA 1ZUUA 3OMCA 2E65A 2E5KA 1UG1A 1BU1A 1SHGA 5FWBA 3JCMQ 5D6WA 1J3TA 3KXTA 2E6NA 2KE9A 3QBYA 1HSQA 3CCUT 1Q82U 1WIEA 1VQNQ 1F1BB 4M78G 3TSZA 4J9EA 4LD9K 2OAWA 4C92B 1K8AR 3CCVA 2CZ1B 3H6ZA 4AFUC 5GAMg 5D6XA 4DBRA 1TTHB 3O8VA 4M78B 1DJ7B 1Q86R 2HQXA 2DPPB 2QASA 2KNBB 2L3QA 4BI8B 4HVUA 4J9GA 1AWXA 1RADB 4C92E 5GAOl 4M7AF 1WJQA 1EX4A 4DBHA 2CP7A 4E7LA 4IKFA 4M78E 5GAOq 2DYBA 3G71A 3JB9H 4KGVB 5DY9A 6AT1B 2L3RA 4IIOA 5GAMd 3QG1A 3UT1A 1Y07A 3I55A 2JUFA 5LJ3f 2HKQB 4TVRA 1RLPC 2RHUA 4HT8A 3V7CA 2L3PA 1BI2A 3RERA 2LC4A 2FPDA 4M7DG 4C5EA 3MEWA 3S6WA 2XI9A 2X4YA 1KHCA 1YHQT 1VQMA 4N4GA 3E9GA 1OEBA 3BW1A 4E7JA 2GTJA 3EHRA 1U3OA 3KUFA 2EJFA 4E2FB 3LWHA 2O2OA 2VASA 1ZBJA 3IQLA 3EH1A 5GAN5 1JXMA 1AOJA 1YHQQ 2KT1A 1M2OA 1X6GA 1XNIA 2DE0X 2QQBA 2I0NA 3S3NA 1K0XA 2X51A 5AYFA 4FL6A 4BE1A 1YP5A 3LYIA 1Q81U 2EQJA 3QJYA 1Q95G 3S3OA 4M7DD 3CMAT 3RKXA 2HKNA 2QQRA 1NM7A 2QEXQ 3CCLT 2DEQA 2M16A 2O9SA 4JPBW 3EAEA 2KEAA 2DD5A 1I8FA 4OMMA 5I21A 2XD0A 3CCEA 1BI3A 3M0SA 2XMFA 2KVQG 3EGUA 4FYVB 4JJNK 2RJFA 1M1KC 3CMAQ 2CP0A 4PLLA 2FHDA 2PUKB 3CCLQ 2MMPA 3FJPA 3I5SA 1M2VA 1GBQA 2XK0A 3R6OA 4OMOA 4C5GA 3QSUA 1JO8A 1WPYA 2MCNA 4C92F 1EIFA 2W10A 3H41A 4IIMA 3PIOA 3L2UA 4FW1A 1KQSS 4EMGA 3UPUA 4FIBA 4M78F 5C6SA 3ME9A 2MPXC 2F5TX 4D8KA 2LT4A 5KH6A 3V7SA 1VQ7T 2RK2A 2PVGB 4XK8E 2OTLA 2JW4A 2F2XA 2XDPA 2DYIA 9ATCB 4OGEA 1KG1A 3LWIA 3J80E 4CC2A 1TG0A 1OYXA 1SSFA 1YNZA 3VS1A 4OMFB 4JLGA 2OJ2A 1D09B 3CBPA 5CKFA 5FROA 3MHXA 4HVWA 2HD0A 4JUVA 2HL3A 3EG3A 1YJNT 1QQJA 2ED0A 2DXBA 1VQ7Q 3GLXA 1XJWB 1KIKA 3OYCA 4AFZC 5KE2A 1UDLA 2EFIA 4C5IA 2A3LA 2OTJT 1X27A 3REBB 2DERA 3L2ZA 5GAN3 3VS7A 3ZBDA 3QDRB 3JCMf 3ER0A 1BIAA 3MEVA 1YITA 4Y92A 1TOVA 2RB6A 4HCBA 5CCAA 1M90C 1PD0A 4JZ4A 2FG0A 2HQEA 2RI3A 3QO3A 4RMOA 5FU7C 1SSHA 3QZ9B 1AZEA 2DL7A 2OTJQ 1VUBA 2YXYA 2ZPBB 4MZTA 1AZGB 3HFNA 2QA4T 1WXTA 3C12A 1KC8C 2MI6A 2F2WA 4BDZA 3NMZC 5GJWB 3QZ5B 2J6FA 4AFQC 4KUIA 1YN8A 5I11A 1WQ7A 1PSFA 1WX6A 1VQ5A 3WVEB 1VOMA 2IPOB 3VU3C 4OB1B 1SG5A 4JRKA 4C8QC 3CCJT 3EH2A 4ZNXA 2YUOA 3CBOA 4PJOC 2P0QA 3OS2A 3EFOB 1M1KR 4C0DB 4QT7A 4RKUE 2QA4Q 1ZBXA 4LDXA 2KQWA 5EC7A 1NYGA 4BD3A 2RM4A 2L3SA 3VV0A 4Z89A 1MNDA 2PVDB 4RCCA 1YCSB 2XIDA 3RNJA 5DM7R 4OF1A 2QI2A 2D8JA 3V8LA 5CIUA 2K4YA 2GGRA 3HRSA 5CVIA 3QUIA 5KYWB 2AKKA 3CCJQ 5KYXA 5KYYA 2KY9A 2EJ9A 1M4ZA 4C8QA 2HSEB 4BACA 4A4GA 2IVWA 3AT1B 3VYGA 1VQ4A 1XTDA 1QVGA 4PJOA 1LCKA 1VA7A 1IRXA 1RAEB 1SKUB 3Q1JA 3G4SA 1UGSB 2LQ8A 2D6FA 5GMKl 2ZPFB 3CD6A 4RUGA 1VQKA 4NS5A 2CZ0B 2DRMA 3OW2A 5GANg 2JMCA 3DB4A 4MDWA 1RL2A 3HL8A 4XU2A 1CSKA 2ROTA 1K9MU 3AHUA 2H3EB 1YJWT 1VQOT 3CMET 1PD1A 2A0FB 2CSQA 2FB7A 1WGSA 3OMGA 3V8KA 3M0RA 5GAN6 1YJ9T 2LCCA 4ZGEB 4M77G 1YIJA 1IGUA 2G3RA 2RHYA 4JJCA 4N4HA 1LOJA 4A63B 4JS5A 1HD3A 1X2QA 1AD5A 1G3SA 4L5GA 2QTXA 4BB7A 5GANe 1VQOQ 5GAOp 4AT1B 2ECZA 2C0OA 3CMEQ 5FU7B 2CS7A 3G6ET 4GLMA 2DXUA 1VIEA 2LT1A 4J9DA 3LW5E 3LGLA 3TREA 5KE3A 1FX7A 1YJ9Q 1PSEA 4DEYA 3JCMX 2XG8D 1WJRA 2V1QA 1JXOA 1B3QA 3A98A 3FC3A 3CCST 1MV3A 3A1PA 1HJDA 1NEGA 2RNAA 4C8QG 1H8KA 2LJ1A 2VXEA 5GAN2 3SDZA 4PJLA 3JB9G 1M9SA 2OI3A 1U1SA 4GBQA 4Z8AA 5LJ3h 5GANj 4PJOG 2DTHA 4FCYA 2H8HA 4JRIA 1W70A 3EGXB 1WXUA 3MO8A 3FDRA 5KYXB 1BCMA 4BI3A 4XTZA 2KI7A 4C8QB 1ZA1B 3CCUA 3TQ7P 2J6OA 2HEQA 3V7RA 1QVGP 4EIKA 5DLOA 4PJOB 2LQKA 1KSWA 1IHWA 1YWOA 4LE9A 1WDXA 1NG2A 4M77D 3C94A 2BZ8A 4MZMA 2YLCA 4J9HA 5KCHA 4PJOE 1U06A 2HMAA 1JU5C 3OW2P 5J3BA 1Q86C 4PJJA 2LCSA 2HBPA 2LJ0A 1FMKA 2CYZB 4ME7A 4ZTJA 3EG2A 3GIBA 1UEBA 3CC2A 1UHFA 4J8OA 3CXCS 2IG0A 2RD1A 1PNJA 2EYQA 2KSSA 1QKWA 5GAOr 1FMWA 4YTLA 1BB9A 1NLOC 2YUQA 1ZLMA 2X4JA 4FSSA 4J9FA 4C8QD 2J6KA 5IH2A 3JB9D 8ATCB 2CP6A 5J39A 5FWCA 3MPUB 2YRDA 3M4YA 2DO3A 1YHQA 3OYMA 4FYXB 3FJ5A 1PKTA 3CCRA 3OA6A 2GBQA 3HP9A 1G83A 1CKAA 2BKDN 2F2VA 2EVRA 4M7DC 1H3ZA 4PFPA 1D3BA 4BI4A 2K9GA 1S72T 1G2BA 3QIIA 4E7HA 2PTKA 4OMPA 5I2SA 3OSVA 1AWOA 4OB3B 2VGNA 1G8XA 1K9AA 2JNGA 3VUZA 2E6ZA 2K3BA 3HRUA 1T0JA 2EKHA 2KROA 2RQVA 2D1XA 2XDDA 4HXJA 4M7DA 3CC4T 1S72Q 1ZHIA 2AIRB 2XU8A 2LMJA 2QAZA 3A8HB 3MEAA 1WHGA 1VQNT 1VYTA 2O88A 1H3HA 2K3XA 2D0NA 3M59A 5CKBA 1QVFA 4RTUA 3JCMb 1Y96B 3CCLA 5IN1A 1UFFA 3HFOA 1E6HA 2FZGB 4RTWA 1M1FA 5A2QE 1UUEA 1W2BS 4RTZA 2ABLA 1TSFA 1T0HA 3CC4Q 2D9TA 2E1HA 2R5AA 3OYJA 2PU9B 1RI0A 1RI9A 3ZEHA 5L23A 1Q7YU 1NJIU 2DVEA 5I22A 1MGQA 1IGQA 1AVZC 2M1HA 2KGTA 3OBWA 2E64A 3I56T 1K73R 2K6DA 1OI1A 2CZ6B 1I07A 4GLKA 5DLQE 2LZ6B 2HDAA 2ENMA 4DEXA 2WACA 3PTAA 2HZYA 2QK0A 1G3YA 4F7UA 4KH0B 3RMQA 3UDCA 5A0DA 4PFZA 4LUEA 4RG8A 5GAN8 2PUOB 1QCFA 3OQ5A 1ZQ1A 2QQ9A 1UECA 1YI2T 3QHSA 1D3BB 2K5IA 1VQ7A 4LXCA 5A0LA 4Y28E 1ABQA 3I56Q 3SFMA 3OYGA 1OU9A 4PL6A 3LLRA 5M9OA 2K5FA 4F14A 1I5OB 1H92A 4R0KA 3OBYA 4Q5WA 2EBPA 3VKIA 5GAMe 2V8KA 4FU6A 1ACMB 2QQSA 2EQUA 3PGGA 4JJDA 1VQ9T 2DAQA 2JZ2A 4HA8A 4FW2A 1PM3A 4ZTFA 1YI2Q 1YJNA 4LDWA 1S1NA 4M7DB 3OY9A 5GJVB 1TU0B 4QVZA 2DZCA 1ZSZC 5L8RE 4M75G 1K4US 1UHCA 2LQWA 1QVFP 1QP3A 5GMKe 4FSXA 4F04B 4M7DE 2JTMA 1BI0A 3THKA 5LJ5h 4KUDK 1WHJA 5GAMj 2Z0WA 2JM8A 1VQLA 1RAIB 1WJSA 1VQ9Q 5GAOn 2QEXT 2L8DA 2RQWA 4ELZC 3X26B 2GTOA 2RA2A 3JRZA 4PKCC 4DOVA 3JCMc 1YBYA 3X28B 4ZGJB 4WCIA 3M58A 1N8RU 1ZSZA 2COWA 1IZ6A 3A8OB 3JB9I 2DTIA 4X9DA 2FRWA 2P4TA 5GMKj 2CH4A 3G1JA 4Y91A 4D6WA 4F7UG 1NE8A 2PVOB 2QA4A 1KD1U 4DQ2A 1Q82R 2JM9A 1XQHA 2E10A 4AFSC 4XQ3A 4XTWA 4F7UB 3FB9A 4NOYA 2K7AA 4Z88A 3REAB 2VKNA 2D0QB 2GQIA 3CCJA 1XOVA 1GBRA 4M75D 1VYUA 2LTOA 2SEMA 4PLIA 5GAOm 1VQ8A 1FXXA 4KULA 3M9QA 1BKBA 1WFWA 3OYYA 1EFNA 1ZUYA 3RBBB 4BE2A 1WXBA 2VVKA 2FZKB 5HKCA 1C6VX 5EG2A 5GANf 1CKBA 2VXFA 3X25B 4E7SA 2L5QA 3CCQQ 2FZCB 4O5VA 5HCKA 3SEMA 3EG0A 1I5LA 2A28A 3JSCA 2QDLA 2A7YA 2DMOA 4JJBA 3M54A 2P4RA 2EW3A 5HK3A 3E19A 3VRZA 4R56A 5IXBA 2EPDA 1X6BA 3E2UA 1FWZA 3OYKA 2YWWA 5D6YA 1UJ0A 2MIOA 2EGCA 5FLXE 1WYXA 3M57A 3M53A 4LDYA 2FO0A 3X24B 3G7ZA 3CC7A 2DL3A 2EGAA 1M8MA 1YJWA 3J7AF 3O5ZA 1VQOA 2CREA 2W0ZA 3CMEA 1MHNA 3I5RA 5J26A 1ZSZB 2CUDA 3QJ6A 2BTTA 1YJ9A 1KQ2A 3EG1A 3OYDA 2LDMA 2V26A 4RTVA 7AT1B 4M7DF 4KT0E 2EJGA 2DLPA 3NGPA 2GCXA 1Q81R 1ZX6A 2CKKA 2JOYA 1KD1R 2XHCA 2QDYB 2KR3A 4L59A 4MZPA 2CT3A 2CSIA 2B8AA 5KCOA 2JS0A 5LJ3g 3UA6A 3I55Q 5KYUA 4M77C 1BK2A 3OS1A 3G6EA 2KBTA 1RUWA 4X34A 2AT1B 1OV3A 2KMTA 1K76A 3UATA 4A4FA 2X35A 4JDSA 2DTOA 1C0MA 3CCSA 1GL5A 2R5MA 1LPLA 2DL4A 4V2SA 4FYWB 5LJ3d 1M2VB 3TCJA 4A53A 5FRNA 2E41A 3CBMA 1G5VA 1AWWA 2DA9A 4M77A 1B7TA 1HXDA 2FVUA 2JMAA 4EDUA 1M90U 2K2MA 5HK0A 2K3YA 2NUTA 1G3TA 4OGCA 1VIFA 3QKJA 2RHIA 4DA4A 1GFCA 2AHJB 5CK9A 4J6YA 3META 1OX9A 3E9FA 2RK1A 4QVCA 1X6OA 5IHIA 2V8JA 3L1AA 2M51A 1KC8U 1M3CA 1VQ6T 2PZ1A 4HVVA 3R6NA 3RDVA 3MKDA 3CCMT 1PCXA 2DVJA 2KRMA 2L89A 1TXQA 4CC4B 3DLMA 1PG5B 3ZL7C 4RCBA 3OB9A 2X4XA 4J5YA 4N4IA 4IUVA 1K9MC 1IO6A 1HYOA 1K1ZA 2BE7D 2DF6A 3OYLA 3CCEQ 1I81A 3LGFA 1VQ6Q 2ZPEB 2COYA 4A4EA 1X2KA 4QQGA 3CCMQ 1LJOA 2YLBA 3VS4A 1TUDA 1U8RA 2DM1A 2DILA 3EG9A 1AT1B 2OX7A 1S72A 2LNVA 2FPFA 1JRIA 1RACB 4QQ6A 1FMVA 3QWYA 1D0YA 2BIVA 1BBZA 4F17A 2M02A 2G6FX 2LNHB 2OTLQ 4M77B 3QXEB 3CPWA 3CC4A 2NUTB 3M0TA 4ANJA 2MF2A 1X75C 1VQNA 1LNXA 1SEMA 2NWMA 4XU3A 1UGPB 1OPKA 2FYKA 2KDSA 4M77E 1NLPC 2M0OA 1V29B 3M4GA 1NPPA 5GAMf 1V76A 2KRNA 2FRYA 3CEYA 5LL6S 4R55A 1UB4A 2EAYA 5KYYB 4A4KA 2VGMA 3M0QA 3UWNA 3PE0A 1GFDA 1VQPT 2VB6A 1K0SA 3ULRB 1PRMC 2QTVA 4C8QE 1K73C 4LNPA 2E5QA 2ZPHB 4ATOA 1N9SA 2EGEA 3LX7A 2EQMA 1JJ2S 4M7AG 1W1FA 2HSPA 5A0GA 3EFSA 3GBQA 1SF9A 1Z9QA 4AG1C 1SRMA 3NHNA 1GCPA 1QVGS 1SHFA 2D8HA 1JB0E 1UE9A 1P92A 2RHZA 1W2BA 5CO7A 2AZSA 3TVTA 2X3XD 4D8DA 2DBMA 4FT4A 5GMKm 4XTYA 4XU0A 4EPCA 3BDUA 1VQPQ 3OW2S 3LH5A 2AK5A 3OYEA 3NTKA 1K9MR 1JBMA 1QLYA 1WZOA 1AHJB 4N0AC 3WVDB 3OS5A 1MMGA 2ZGWA 3SB2A 3ZFJA 5LJ5g 4NL2A 3OSSC 5IAYA 2DJZA 1K8AU 2NLUA 1B07A 3JCMP 3OYAA 3MCAB 3A8LB 3CPWP 2YRCA 2KYBA 2MWOA 2X4WA 2O01E 3GP8A 3G4ST 3V8JA 2GNCA 1ZSGA 3A5ZB 3HTRA 4EMHA 2CZ7B 1U1TA 4OMNA 2M0YA 4DBQA 5LJ5d 1GXIE 3VS2A 2R58A 4OMLA 4M7AD 2WSEE 3QDFA 4N0AA 4JRQA 4IURA 4OB0B 4XAXB 1NYFA 1RAFB 2CP3A 2QEXA 2V1RA 2YT6A 4M75C 3A8MB 2Y4YA 2KXCA 2ZZDA 1NBEB 5LJ5e 4FM4B 2KK4A 2HBWA 5ECAA 1QP2A 3G4SQ 4ELYC 3CD6Q 2JS2A 4QKUA 1T3SA 2YUNA 1PWTA 2B86A 1WQWA 3EHQA 3QYHB 2KRSA 3CQTA 1BIBA 4RTXA 2ZPIB 1Y0MA 1RAAB 4B9XA 3OYNA 3CMAA 4M77F 3VJPA 5FRMA 3M55A 1Q82C 4NL3A 4E7IA 2DBKA 4M75A 5LJ5j 2A36A 2CP5A 1OPLA 1WNLA 4Z02A 1W2BP 4A4HA 1ABOA 2WSFE 1MUZA 5FW9A 3JAME 1WHLA 4IUQA 2J7IA 2LX7A 1YIJQ 4MMLA 4FYYB 3NPFA 3I35A 4XTVA 3D7SB 4C8QF 1T3LA 3E1SA 4C92G 2BZYA 1M30A 4KH1B 3JB9F 2RMOA 4PJOF 1Y71A 1BI1A 2R57A 1I0CA 3L2WA 4CRIA 1OZ2A 2EKOA 3JCMh 1D1AA 2FEIA 5CKHA 3JCMW 4WF2A 4PNOA 2AZVA 3TSWA 3T9NA 4J9CA 4E6RA 2XDBA 1KHIA 3EGDA 4CC3A 2RJDA 3SHWA 3JCMV 4CC7A 3M0UA 2O31A 1MV0B 3HKSA 3CC2T 1EZZB 3CCUQ 3L42A 2FL7A 4XTUA 1WI7A 4HKEA 1A0NB 1M8VA 2E4HA 3I9QA 4KGZB 4ESRA 2VUBA 2WSCE 1H641 3L2QA 2LRQA 3P8BB 1R0CB 1KQSA 2DL5A 2LVMA 4QQDA 4HCCA 2OTJA 3HRTA 1I4K1 2EQKA 2EYXA 4HT9A 4RTTA 2ROLA 3BFMA 2KAFA 3CC2Q 1D1CA 4C92D 4HCZA 4JZ3A 3HHTB 4BE0A 1N8RC 1QWEA 1W6XA 2RN8A 4IUPA 4M75B 3CCRT 2ESWA 2JT4A 2RJCA 4M78D 1D0ZA 1Q81C 3FLGA 2K5LA 1KD1C 4CI0C 4O6JA 5CR2A 3MJXA 2OAUA 1QVFS 1ARKA 3SD4A 4M75E 2P84A 8AT1B 4J7FA 1O75A 1D1BA 2LJ3A 4PJNA 1R8OB 2SRCA 3X20B 2MYSA 1Q7YR 3CCRQ 2V8IA 1NJIR 2MK5A 2J06A 3JB9J 3RKYA 4GY5A 1NZ9A 2I2LA 2JXBA 2CDTA 3MP1A 2PQWA 2HCKA 2Y90A 1D0XA 5FU6C 5IXFA 4LUDA 3C4SA 3H8ZA 2L2PA 3CCQT 3QYGB 1TUGB 5AT1B 4RG2A 4F7UE 1BCOA 2H3JA 4KRTA 2F5KA 1LVKA 1YCYA 2RHXA 3EGDB 1Y57A 2RQTA 1RABB 1UJYA 4II1A 2E70A 3J81E 3L2VA 2YRVA 2YUPA 1VQ6A 1GCQC 1R77A 2RJEA 1AWJA 1E7OA 2QYZA 3CCMA 1UGQB 5IHNA 1M3BA 2YHTA 2ED1A 4C0DC 1M27C 2E3HA 2DZ9A 3PMTA 1KQSP 1PKSA 1G3WA 3CCVT 3A8GB 3DB3A 3JCMJ 2FPEA 2K79A 5CQYA 3RIRA 3VS3A 3LH0A 3DKMA 1M1KU 4K11A 2L0AA 4FT2A 3PT9A 3OYHA 2HAXA 4KGXB 4J6XA 4BUGA 1GCQA 4ZGDB 1QCOA 2PNIA 2VYTA 2E12A 3G71T 3EFOA 4BY6C 2RPNA 1QKXA 2A37A 3I55T 3CCVQ 3VRYA 3M5AA 5GAMh 1JQQA 2F69A 4ZN1A 4AG2C 2X3WD 2GFAA 2RQUA 1MNEA 2J05A 1PHTA 1QWFA 2DNUA 4P5NA 1N8RR 5KYWA 3KFVA 1VQMT 1YFNA 4L6V5 2KT8A 3G71Q 1O9SA 3L2RA 1RAGB 5GMKh 2HNIA 5IHKA 2LCLA 4J6WA 4J9IA 3DLLA 4M75F 2JTEA 3EFRA 5I2MA 2P0KA 4C0ZA 1GRIA 1UTIA 4J9BA 1VQLT 1TUCA 4DBFA 2DD4A 4HCKA 3VS6A 1VQMQ 4C0GA 1YJNQ 5GMKi 2BE9B 2VC8A 5D7UA 1MMNA 4A54A 3UA7A 1N9RA 3M56A 5FU6B 2VWFA 4ZN3A 1U5SA 3H0HA 4OB2B 4C0FA 1MMDA 1WHHA 1QW1A 3BE3A 1WHMA 5KYNA 5LJ3e 2IIMA 2RQRA 1UGRB 1VQLQ 1WA7A 1VQPA 1X69A 4F7UF 4BDYA 2CT4A 1X01A 4DOWA 1ZUKA 2MWPA 1N5ZA 3SWNC 3MP8A 1RLQC 3HPWA 5LJ5f 1B34A 3KBGA 3CCET 2C06A 3U23A 1M3AA 2CGHA 3QWXX 1HK9A 1X43A 2LX9A 1UGVA 3NTHA 5LJ3j 4M7AC 2A08A 1IXDA 4F16A 1VYVA 3VYHB 1OOTA 4B6MA 2JTFA 2NUPA 1VQ8T 2DL8A 4J83A 1Y7XA 2QGGA 5CKDA 4OP0A 2DETA 3P8DA 1OX8A 2RH2A 3MEUA 3S3MA 2CH4W 1I1JA 4JS4A 4X9CA 5CKEA 3EGXA 4MMKA 2C0TA 3SWNA 1N27A 2CP2A 1JJ2A 3PVQA 2QG9B 1M5Q1 2MOXA 2ATCB 2DIQA 2EYYA 1R0BG 3OYIA 5KYUB 4BY6B 1KJWA 3GNFB 4M7AA
chains in the Genus database with same CATH topology
1TG0A 2EBPA 2KYBA 1YNZA 4JJDA 3VS1A 1SRLA 2O9VA 2OJ2A 1S1NA 2GNCA 1ZSGA 4OMNA 5GJVB 2M0YA 4HVWA 3EG3A 3VS2A 2KXDA 2ED0A 4OMLA 1KIKA 1K4US 1UHCA 2LQWA 4AFZC 3M0PA 1UDLA 1NYFA 2V1RA 2YT6A 3THKA 1X27A 2KXCA 3REBB 2JM8A 2BZXA 5ECAA 2HBWA 3VS7A 4Y92A 2KYMA 2RQWA 2JS2A 1T3SA 2GTOA 4JZ4A 2YUNA 1PWTA 2B86A 2FG0A 3EHQA 2KRSA 3CQTA 4RTXA 2NUZA 1Y0MA 2C0IA 4WCIA 1SSHA 1FYNA 2FRWA 2CH4A 3JV3A 2DRKA 3H0FA 1AZEA 2DL7A 1KFZA 2DBKA 1AZGB 2A36A 1OPLA 2JM9A 3H0IA 1ABOA 2YDLA 4AFSC 1WXTA 2DX1A 1V1CA 1MUZA 2K7AA 4Z88A 2F2WA 5FW9A 3REAB 3NMZC 1WLPB 5GJWB 2J7IA 2J6FA 2LX7A 4AFQC 2VKNA 1E6GA 2GQIA 1XOVA 1YN8A 5I11A 4LN2A 1GBRA 1WX6A 3NPFA 4ZNXA 2YUOA 3I35A 1VYUA 2SEMA 1T3LA 4QT7A 2BZYA 1M30A 1WFWA 3VS5A 2RMOA 1SPKA 5EC7A 1NYGA 2L3SA 1EFNA 1ZUYA 4Z89A 1I0CA 3RBBB 1YCSB 3RNJA 1WXBA 2VVKA 2D8JA 1PRLC 1CKBA 4OMQA 2FEIA 4M4ZA 2AZVA 2GGRA 5HCKA 3SEMA 3TSWA 3EG0A 2A28A 2QDLA 2AKKA 2DMOA 4J9CA 4E6RA 4JJBA 4CC3A 2P4RA 2EW3A 3SHWA 3UF4A 4CC7A 3M0UA 3VRZA 2O31A 5IXBA 1LCKA 1MV0B 1VA7A 2EPDA 1X6BA 2CUBA 1YWPA 1UJ0A 1WI7A 2MIOA 1A0NB 2EGCA 1WYXA 4RUGA 3I9QA 4ESRA 2FO0A 2DRMA 2JMCA 4ORZA 2DL3A 2EGAA 1M8MA 3O5ZA 2CREA 2W0ZA 2DL5A 1CSKA 3I5RA 2ROTA 2YSQA 3PVLA 2EYXA 2CUDA 2RF0A 4RTTA 2EYWA 2ROLA 2BTTA 4JZ3A 3EG1A 2LP5A 2CSQA 2EYZA 1QWEA 1W6XA 2RN8A 3M0RA 2ESWA 2JT4A 4RTVA 2EQIA 2DLPA 2AKLA 3NGPA 1NEBA 3VS0A 1ZX6A 4JJCA 1ARKA 2KR3A 4A63B 2CT3A 2CSIA 2JS0A 3UA6A 1BK2A 1HD3A 2KBTA 1RUWA 1X2QA 1AD5A 4RTYA 1Z9ZA 1OV3A 2ECZA 2C0OA 1K76A 2LJ3A 4GLMA 3UATA 2SRCA 3C0CA 4J9DA 2J06A 2DJQA 1AEYA 4DEYA 1GL5A 2DL4A 2V1QA 4X1VA 2JXBA 1JXOA 2CDTA 1B3QA 3A98A 2HCKA 5IXFA 4LUDA 1JEGA 2LQNA 1MV3A 1HJDA 1NEGA 2RNAA 1AWWA 1H8KA 2DA9A 2L2PA 2LJ1A 1ZUUA 2OI3A 4GBQA 2JMAA 4Z8AA 2E5KA 2H8HA 4KRTA 1W70A 1WXUA 1UG1A 2K2MA 1BU1A 1SHGA 5FWBA 1J3TA 1Y57A 2J6OA 2HEQA 2KE9A 2RQTA 4EIKA 1GFCA 1HSQA 1UJYA 1KSWA 1WIEA 1YWOA 4LE9A 1WDXA 1NG2A 2YUPA 2BZ8A 3TSZA 1GCQC 4J9EA 1AWJA 1E7OA 2OAWA 4J9HA 5IHIA 5IHNA 1M3BA 2M51A 1U06A 2ED1A 1M3CA 1JU5C 4AFUC 2PZ1A 1M27C 4HVVA 2LCSA 3R6NA 2LJ0A 1FMKA 3EG2A 1PKSA 2DVJA 1UHFA 2KNBB 2L3QA 2KRMA 4HVUA 4CC4B 4J9GA 1AWXA 3ZL7C 1PNJA 2FPEA 1QKWA 2K79A 3VS3A 1BB9A 1IO6A 1NLOC 4K11A 2L0AA 2DYBA 1K1ZA 2YUQA 2DF6A 4IIOA 1ZLMA 4FSSA 1GCQA 4J9FA 2J6KA 2PNIA 5IH2A 1RLPC 2RPNA 1X2KA 1QKXA 2A37A 5FWCA 2L3PA 3VS4A 1TUDA 3VRYA 2FPDA 1JQQA 2DM1A 2DILA 4AG2C 2X3WD 3FJ5A 1PKTA 2GBQA 2RQUA 2J05A 1G83A 1CKAA 2F2VA 1PHTA 2EVRA 1QWFA 2DNUA 1OEBA 2FPFA 2GTJA 2K9GA 3EHRA 1U3OA 1G2BA 3KFVA 2PTKA 3QWYA 2KT8A 4OMPA 2O2OA 1BBZA 1AWOA 4F17A 1ZBJA 2G6FX 3IQLA 5IHKA 2LNHB 1K9AA 4J9IA 2K3BA 1JXMA 1AOJA 2JTEA 2KT1A 1GRIA 1UTIA 1T0JA 2EKHA 2KROA 2RQVA 1X6GA 3M0TA 4J9BA 1TUCA 2D1XA 4HXJA 4HCKA 1SEMA 2DE0X 3VS6A 2NWMA 2I0NA 1OPKA 2LMJA 1K0XA 1NLPC 1VYTA 2O88A 1H3HA 1YP5A 2D0NA 4RTUA 3UA7A 2VWFA 2KRNA 2FRYA 1UFFA 1E6HA 1U5SA 3H0HA 4RTWA 1NM7A 1UUEA 4RTZA 2IIMA 2ABLA 2RQRA 2O9SA 4JPBW 1WA7A 1T0HA 1X69A 3M0QA 3PE0A 2CT4A 2KEAA 1GFDA 1RI9A 4OMMA 5L23A 1ZUKA 1K0SA 3ULRB 5I22A 3M0SA 1PRMC 1AVZC 1N5ZA 2XMFA 2KGTA 1RLQC 3EGUA 4LNPA 2EGEA 3U23A 1M3AA 1W1FA 2HSPA 2K6DA 1I07A 3GBQA 1Z9QA 4AG1C 1SRMA 2LZ6B 3NHNA 1GCPA 1X43A 2HDAA 3QWXX 1UGVA 2ENMA 1SHFA 2D8HA 1UE9A 4DEXA 2A08A 4F16A 1VYVA 2AZSA 1OOTA 3I5SA 3TVTA 1GBQA 2X3XD 4D8DA 2DBMA 2DL8A 4LUEA 4OMOA 1QCFA 1JO8A 2MCNA 1UECA 3LH5A 2W10A 2AK5A 3H41A 4IIMA 2CH4W 1I1JA 1ABQA 1QLYA 2C0TA 4D8KA 3PVQA 2MOXA 2EYYA 2JW4A 2F2XA 4F14A 1H92A 4R0KA 1KJWA 1B07A 4CC2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TG0 A;  2EBP A;  2KYB A;  1YNZ A;  4JJD A;  3VS1 A;  1SRL A;  2O9V A;  2OJ2 A;  1S1N A;  2GNC A;  1ZSG A;  4OMN A;  5GJV B;  2M0Y A;  4HVW A;  3EG3 A;  3VS2 A;  2KXD A;  2ED0 A;  4OML A;  1KIK A;  1K4U S;  1UHC A;  2LQW A;  4AFZ C;  3M0P A;  1UDL A;  1NYF A;  2V1R A;  2YT6 A;  3THK A;  1X27 A;  2KXC A;  3REB B;  2JM8 A;  2BZX A;  5ECA A;  2HBW A;  3VS7 A;  4Y92 A;  2KYM A;  2RQW A;  2JS2 A;  1T3S A;  2GTO A;  4JZ4 A;  2YUN A;  1PWT A;  2B86 A;  2FG0 A;  3EHQ A;  2KRS A;  3CQT A;  4RTX A;  2NUZ A;  1Y0M A;  2C0I A;  4WCI A;  1SSH A;  1FYN A;  2FRW A;  2CH4 A;  3JV3 A;  2DRK A;  3H0F A;  1AZE A;  2DL7 A;  1KFZ A;  2DBK A;  1AZG B;  2A36 A;  1OPL A;  2JM9 A;  3H0I A;  1ABO A;  2YDL A;  4AFS C;  1WXT A;  2DX1 A;  1V1C A;  1MUZ A;  2K7A A;  4Z88 A;  2F2W A;  5FW9 A;  3REA B;  3NMZ C;  1WLP B;  5GJW B;  2J7I A;  2J6F A;  2LX7 A;  4AFQ C;  2VKN A;  1E6G A;  2GQI A;  1XOV A;  1YN8 A;  5I11 A;  4LN2 A;  1GBR A;  1WX6 A;  3NPF A;  4ZNX A;  2YUO A;  3I35 A;  1VYU A;  2SEM A;  1T3L A;  4QT7 A;  2BZY A;  1M30 A;  1WFW A;  3VS5 A;  2RMO A;  1SPK A;  5EC7 A;  1NYG A;  2L3S A;  1EFN A;  1ZUY A;  4Z89 A;  1I0C A;  3RBB B;  1YCS B;  3RNJ A;  1WXB A;  2VVK A;  2D8J A;  1PRL C;  1CKB A;  4OMQ A;  2FEI A;  4M4Z A;  2AZV A;  2GGR A;  5HCK A;  3SEM A;  3TSW A;  3EG0 A;  2A28 A;  2QDL A;  2AKK A;  2DMO A;  4J9C A;  4E6R A;  4JJB A;  4CC3 A;  2P4R A;  2EW3 A;  3SHW A;  3UF4 A;  4CC7 A;  3M0U A;  3VRZ A;  2O31 A;  5IXB A;  1LCK A;  1MV0 B;  1VA7 A;  2EPD A;  1X6B A;  2CUB A;  1YWP A;  1UJ0 A;  1WI7 A;  2MIO A;  1A0N B;  2EGC A;  1WYX A;  4RUG A;  3I9Q A;  4ESR A;  2FO0 A;  2DRM A;  2JMC A;  4ORZ A;  2DL3 A;  2EGA A;  1M8M A;  3O5Z A;  2CRE A;  2W0Z A;  2DL5 A;  1CSK A;  3I5R A;  2ROT A;  2YSQ A;  3PVL A;  2EYX A;  2CUD A;  2RF0 A;  4RTT A;  2EYW A;  2ROL A;  2BTT A;  4JZ3 A;  3EG1 A;  2LP5 A;  2CSQ A;  2EYZ A;  1QWE A;  1W6X A;  2RN8 A;  3M0R A;  2ESW A;  2JT4 A;  4RTV A;  2EQI A;  2DLP A;  2AKL A;  3NGP A;  1NEB A;  3VS0 A;  1ZX6 A;  4JJC A;  1ARK A;  2KR3 A;  4A63 B;  2CT3 A;  2CSI A;  2JS0 A;  3UA6 A;  1BK2 A;  1HD3 A;  2KBT A;  1RUW A;  1X2Q A;  1AD5 A;  4RTY A;  1Z9Z A;  1OV3 A;  2ECZ A;  2C0O A;  1K76 A;  2LJ3 A;  4GLM A;  3UAT A;  2SRC A;  3C0C A;  4J9D A;  2J06 A;  2DJQ A;  1AEY A;  4DEY A;  1GL5 A;  2DL4 A;  2V1Q A;  4X1V A;  2JXB A;  1JXO A;  2CDT A;  1B3Q A;  3A98 A;  2HCK A;  5IXF A;  4LUD A;  1JEG A;  2LQN A;  1MV3 A;  1HJD A;  1NEG A;  2RNA A;  1AWW A;  1H8K A;  2DA9 A;  2L2P A;  2LJ1 A;  1ZUU A;  2OI3 A;  4GBQ A;  2JMA A;  4Z8A A;  2E5K A;  2H8H A;  4KRT A;  1W70 A;  1WXU A;  1UG1 A;  2K2M A;  1BU1 A;  1SHG A;  5FWB A;  1J3T A;  1Y57 A;  2J6O A;  2HEQ A;  2KE9 A;  2RQT A;  4EIK A;  1GFC A;  1HSQ A;  1UJY A;  1KSW A;  1WIE A;  1YWO A;  4LE9 A;  1WDX A;  1NG2 A;  2YUP A;  2BZ8 A;  3TSZ A;  1GCQ C;  4J9E A;  1AWJ A;  1E7O A;  2OAW A;  4J9H A;  5IHI A;  5IHN A;  1M3B A;  2M51 A;  1U06 A;  2ED1 A;  1M3C A;  1JU5 C;  4AFU C;  2PZ1 A;  1M27 C;  4HVV A;  2LCS A;  3R6N A;  2LJ0 A;  1FMK A;  3EG2 A;  1PKS A;  2DVJ A;  1UHF A;  2KNB B;  2L3Q A;  2KRM A;  4HVU A;  4CC4 B;  4J9G A;  1AWX A;  3ZL7 C;  1PNJ A;  2FPE A;  1QKW A;  2K79 A;  3VS3 A;  1BB9 A;  1IO6 A;  1NLO C;  4K11 A;  2L0A A;  2DYB A;  1K1Z A;  2YUQ A;  2DF6 A;  4IIO A;  1ZLM A;  4FSS A;  1GCQ A;  4J9F A;  2J6K A;  2PNI A;  5IH2 A;  1RLP C;  2RPN A;  1X2K A;  1QKX A;  2A37 A;  5FWC A;  2L3P A;  3VS4 A;  1TUD A;  3VRY A;  2FPD A;  1JQQ A;  2DM1 A;  2DIL A;  4AG2 C;  2X3W D;  3FJ5 A;  1PKT A;  2GBQ A;  2RQU A;  2J05 A;  1G83 A;  1CKA A;  2F2V A;  1PHT A;  2EVR A;  1QWF A;  2DNU A;  1OEB A;  2FPF A;  2GTJ A;  2K9G A;  3EHR A;  1U3O A;  1G2B A;  3KFV A;  2PTK A;  3QWY A;  2KT8 A;  4OMP A;  2O2O A;  1BBZ A;  1AWO A;  4F17 A;  1ZBJ A;  2G6F X;  3IQL A;  5IHK A;  2LNH B;  1K9A A;  4J9I A;  2K3B A;  1JXM A;  1AOJ A;  2JTE A;  2KT1 A;  1GRI A;  1UTI A;  1T0J A;  2EKH A;  2KRO A;  2RQV A;  1X6G A;  3M0T A;  4J9B A;  1TUC A;  2D1X A;  4HXJ A;  4HCK A;  1SEM A;  2DE0 X;  3VS6 A;  2NWM A;  2I0N A;  1OPK A;  2LMJ A;  1K0X A;  1NLP C;  1VYT A;  2O88 A;  1H3H A;  1YP5 A;  2D0N A;  4RTU A;  3UA7 A;  2VWF A;  2KRN A;  2FRY A;  1UFF A;  1E6H A;  1U5S A;  3H0H A;  4RTW A;  1NM7 A;  1UUE A;  4RTZ A;  2IIM A;  2ABL A;  2RQR A;  2O9S A;  4JPB W;  1WA7 A;  1T0H A;  1X69 A;  3M0Q A;  3PE0 A;  2CT4 A;  2KEA A;  1GFD A;  1RI9 A;  4OMM A;  5L23 A;  1ZUK A;  1K0S A;  3ULR B;  5I22 A;  3M0S A;  1PRM C;  1AVZ C;  1N5Z A;  2XMF A;  2KGT A;  1RLQ C;  3EGU A;  4LNP A;  2EGE A;  3U23 A;  1M3A A;  1W1F A;  2HSP A;  2K6D A;  1I07 A;  3GBQ A;  1Z9Q A;  4AG1 C;  1SRM A;  2LZ6 B;  3NHN A;  1GCP A;  1X43 A;  2HDA A;  3QWX X;  1UGV A;  2ENM A;  1SHF A;  2D8H A;  1UE9 A;  4DEX A;  2A08 A;  4F16 A;  1VYV A;  2AZS A;  1OOT A;  3I5S A;  3TVT A;  1GBQ A;  2X3X D;  4D8D A;  2DBM A;  2DL8 A;  4LUE A;  4OMO A;  1QCF A;  1JO8 A;  2MCN A;  1UEC A;  3LH5 A;  2W10 A;  2AK5 A;  3H41 A;  4IIM A;  2CH4 W;  1I1J A;  1ABQ A;  1QLY A;  2C0T A;  4D8K A;  3PVQ A;  2MOX A;  2EYY A;  2JW4 A;  2F2X A;  4F14 A;  1H92 A;  4R0K A;  1KJW A;  1B07 A;  4CC2 A; 
#chains in the Genus database with same CATH topology
 3CXC A;  2OTL T;  1VQ8 Q;  1SRL A;  2O9V A;  1OQK A;  4EMK C;  1KQ1 A;  4IUT A;  1OZ3 A;  3FIF A;  2KXD A;  2QQA A;  1IHV A;  3CC7 T;  2M9U A;  3BDL A;  4XU1 A;  3M0P A;  3PIP A;  4PJM A;  4J7I A;  3NFC A;  3GPL A;  4LDU A;  2DXT A;  1ZA2 B;  3MP6 A;  2BZX A;  3RES A;  5IT9 E;  3VUB A;  4B9W A;  5GAN d;  2MAM A;  2KYM A;  3GOX A;  3INZ A;  3PNW C;  1YIT T;  4QVD A;  1M90 R;  4WTO B;  2DFU A;  3H9N A;  4EMK A;  3RR6 A;  2NUZ A;  3F70 A;  2C0I A;  3CC7 Q;  3C95 A;  2K2V A;  1YJW Q;  1FYN A;  3JV3 A;  1MMA A;  2DRK A;  3H0F A;  1TS9 A;  1B34 B;  1KFZ A;  4AMC A;  4PK4 A;  4LD6 A;  1WHK A;  2JN0 A;  3OS0 A;  3NTI A;  3H0I A;  5GAN 7;  2EIF A;  2YDL A;  2DX1 A;  1V1C A;  3JCM g;  2NUP B;  1YIT Q;  2JJ9 A;  1KC8 R;  1WLP B;  1E6G A;  3I56 A;  2ZCF B;  3ASK A;  4MDX A;  4LN2 A;  2BUD A;  1TWB A;  2JVV A;  3G6E Q;  3SWN B;  1JJ2 P;  1VQ5 T;  4E7K A;  3JCM d;  2DEU A;  3VS5 A;  2O4X A;  1SPK A;  2DKG A;  3N5B B;  3EG9 B;  4M7A B;  3GF5 A;  3CXC P;  1YI2 A;  1BYM A;  4C92 C;  1K8A C;  3CCS Q;  1PRL C;  1Y96 A;  4OMQ A;  4QW2 A;  2XIC A;  4M78 C;  4OVA A;  3JCM e;  4M4Z A;  3RMS A;  1N6A A;  1KK7 A;  4M7A E;  4PFO A;  1VQ5 Q;  4XTX A;  3UF4 A;  1K73 U;  2RO0 A;  1PC0 A;  4IUU A;  1VQ9 A;  3HSB A;  2CUB A;  2GFU A;  1YWP A;  5GAN 4;  1M1G A;  1VQ4 T;  2XKO C;  3RKW A;  1Q86 U;  4C5H A;  2QXF A;  3TEE A;  2RI2 A;  4C92 A;  2VV5 A;  4JRP A;  3CD6 T;  4ORZ A;  3TU4 K;  3GNG A;  2HL5 C;  4M78 A;  4PJO D;  1VQK T;  3RUX A;  4EMK B;  2ZPG B;  1QVP A;  1QCN A;  2QGF B;  2YSQ A;  3PVL A;  3CPW S;  3CPF A;  2ZAE A;  2DIG A;  2RF0 A;  2EYW A;  2DK3 A;  5CQX A;  4KBM B;  4JLI A;  1IRE B;  2EWN A;  2LP5 A;  3FRN A;  1VQ4 Q;  2EYZ A;  3OYF A;  2EQI A;  5CAI A;  3PFS A;  4E7Z A;  2AKL A;  2Y4X A;  3WXM B;  1NEB A;  2DXC A;  2HQH A;  3VS0 A;  2F1L A;  2K57 A;  5C0M A;  1VQK Q;  4UC4 A;  4E47 A;  3PMI A;  1YIJ T;  3QPH A;  5GAN h;  4RTY A;  3URG A;  1Z9Z A;  5HY6 A;  1NPR A;  2COZ A;  2X9H A;  1OU8 A;  3BY7 A;  4VUB A;  1Q7Y C;  2GQV A;  1NJI C;  2P0P A;  2GF7 A;  2RI5 A;  3P8H A;  3C0C A;  1TH7 A;  1C1A A;  1OUL A;  3FEO A;  1IB8 A;  2DJQ A;  1AEY A;  1QMC A;  2O4X B;  3OYB A;  4X1V A;  3CCQ A;  2E3I A;  1W4S A;  1RAH B;  1JEG A;  2LQN A;  2NYS A;  4LDV A;  1ZUU A;  3OMC A;  2E65 A;  2E5K A;  1UG1 A;  1BU1 A;  1SHG A;  5FWB A;  3JCM Q;  5D6W A;  1J3T A;  3KXT A;  2E6N A;  2KE9 A;  3QBY A;  1HSQ A;  3CCU T;  1Q82 U;  1WIE A;  1VQN Q;  1F1B B;  4M78 G;  3TSZ A;  4J9E A;  4LD9 K;  2OAW A;  4C92 B;  1K8A R;  3CCV A;  2CZ1 B;  3H6Z A;  4AFU C;  5GAM g;  5D6X A;  4DBR A;  1TTH B;  3O8V A;  4M78 B;  1DJ7 B;  1Q86 R;  2HQX A;  2DPP B;  2QAS A;  2KNB B;  2L3Q A;  4BI8 B;  4HVU A;  4J9G A;  1AWX A;  1RAD B;  4C92 E;  5GAO l;  4M7A F;  1WJQ A;  1EX4 A;  4DBH A;  2CP7 A;  4E7L A;  4IKF A;  4M78 E;  5GAO q;  2DYB A;  3G71 A;  3JB9 H;  4KGV B;  5DY9 A;  6AT1 B;  2L3R A;  4IIO A;  5GAM d;  3QG1 A;  3UT1 A;  1Y07 A;  3I55 A;  2JUF A;  5LJ3 f;  2HKQ B;  4TVR A;  1RLP C;  2RHU A;  4HT8 A;  3V7C A;  2L3P A;  1BI2 A;  3RER A;  2LC4 A;  2FPD A;  4M7D G;  4C5E A;  3MEW A;  3S6W A;  2XI9 A;  2X4Y A;  1KHC A;  1YHQ T;  1VQM A;  4N4G A;  3E9G A;  1OEB A;  3BW1 A;  4E7J A;  2GTJ A;  3EHR A;  1U3O A;  3KUF A;  2EJF A;  4E2F B;  3LWH A;  2O2O A;  2VAS A;  1ZBJ A;  3IQL A;  3EH1 A;  5GAN 5;  1JXM A;  1AOJ A;  1YHQ Q;  2KT1 A;  1M2O A;  1X6G A;  1XNI A;  2DE0 X;  2QQB A;  2I0N A;  3S3N A;  1K0X A;  2X51 A;  5AYF A;  4FL6 A;  4BE1 A;  1YP5 A;  3LYI A;  1Q81 U;  2EQJ A;  3QJY A;  1Q95 G;  3S3O A;  4M7D D;  3CMA T;  3RKX A;  2HKN A;  2QQR A;  1NM7 A;  2QEX Q;  3CCL T;  2DEQ A;  2M16 A;  2O9S A;  4JPB W;  3EAE A;  2KEA A;  2DD5 A;  1I8F A;  4OMM A;  5I21 A;  2XD0 A;  3CCE A;  1BI3 A;  3M0S A;  2XMF A;  2KVQ G;  3EGU A;  4FYV B;  4JJN K;  2RJF A;  1M1K C;  3CMA Q;  2CP0 A;  4PLL A;  2FHD A;  2PUK B;  3CCL Q;  2MMP A;  3FJP A;  3I5S A;  1M2V A;  1GBQ A;  2XK0 A;  3R6O A;  4OMO A;  4C5G A;  3QSU A;  1JO8 A;  1WPY A;  2MCN A;  4C92 F;  1EIF A;  2W10 A;  3H41 A;  4IIM A;  3PIO A;  3L2U A;  4FW1 A;  1KQS S;  4EMG A;  3UPU A;  4FIB A;  4M78 F;  5C6S A;  3ME9 A;  2MPX C;  2F5T X;  4D8K A;  2LT4 A;  5KH6 A;  3V7S A;  1VQ7 T;  2RK2 A;  2PVG B;  4XK8 E;  2OTL A;  2JW4 A;  2F2X A;  2XDP A;  2DYI A;  9ATC B;  4OGE A;  1KG1 A;  3LWI A;  3J80 E;  4CC2 A;  1TG0 A;  1OYX A;  1SSF A;  1YNZ A;  3VS1 A;  4OMF B;  4JLG A;  2OJ2 A;  1D09 B;  3CBP A;  5CKF A;  5FRO A;  3MHX A;  4HVW A;  2HD0 A;  4JUV A;  2HL3 A;  3EG3 A;  1YJN T;  1QQJ A;  2ED0 A;  2DXB A;  1VQ7 Q;  3GLX A;  1XJW B;  1KIK A;  3OYC A;  4AFZ C;  5KE2 A;  1UDL A;  2EFI A;  4C5I A;  2A3L A;  2OTJ T;  1X27 A;  3REB B;  2DER A;  3L2Z A;  5GAN 3;  3VS7 A;  3ZBD A;  3QDR B;  3JCM f;  3ER0 A;  1BIA A;  3MEV A;  1YIT A;  4Y92 A;  1TOV A;  2RB6 A;  4HCB A;  5CCA A;  1M90 C;  1PD0 A;  4JZ4 A;  2FG0 A;  2HQE A;  2RI3 A;  3QO3 A;  4RMO A;  5FU7 C;  1SSH A;  3QZ9 B;  1AZE A;  2DL7 A;  2OTJ Q;  1VUB A;  2YXY A;  2ZPB B;  4MZT A;  1AZG B;  3HFN A;  2QA4 T;  1WXT A;  3C12 A;  1KC8 C;  2MI6 A;  2F2W A;  4BDZ A;  3NMZ C;  5GJW B;  3QZ5 B;  2J6F A;  4AFQ C;  4KUI A;  1YN8 A;  5I11 A;  1WQ7 A;  1PSF A;  1WX6 A;  1VQ5 A;  3WVE B;  1VOM A;  2IPO B;  3VU3 C;  4OB1 B;  1SG5 A;  4JRK A;  4C8Q C;  3CCJ T;  3EH2 A;  4ZNX A;  2YUO A;  3CBO A;  4PJO C;  2P0Q A;  3OS2 A;  3EFO B;  1M1K R;  4C0D B;  4QT7 A;  4RKU E;  2QA4 Q;  1ZBX A;  4LDX A;  2KQW A;  5EC7 A;  1NYG A;  4BD3 A;  2RM4 A;  2L3S A;  3VV0 A;  4Z89 A;  1MND A;  2PVD B;  4RCC A;  1YCS B;  2XID A;  3RNJ A;  5DM7 R;  4OF1 A;  2QI2 A;  2D8J A;  3V8L A;  5CIU A;  2K4Y A;  2GGR A;  3HRS A;  5CVI A;  3QUI A;  5KYW B;  2AKK A;  3CCJ Q;  5KYX A;  5KYY A;  2KY9 A;  2EJ9 A;  1M4Z A;  4C8Q A;  2HSE B;  4BAC A;  4A4G A;  2IVW A;  3AT1 B;  3VYG A;  1VQ4 A;  1XTD A;  1QVG A;  4PJO A;  1LCK A;  1VA7 A;  1IRX A;  1RAE B;  1SKU B;  3Q1J A;  3G4S A;  1UGS B;  2LQ8 A;  2D6F A;  5GMK l;  2ZPF B;  3CD6 A;  4RUG A;  1VQK A;  4NS5 A;  2CZ0 B;  2DRM A;  3OW2 A;  5GAN g;  2JMC A;  3DB4 A;  4MDW A;  1RL2 A;  3HL8 A;  4XU2 A;  1CSK A;  2ROT A;  1K9M U;  3AHU A;  2H3E B;  1YJW T;  1VQO T;  3CME T;  1PD1 A;  2A0F B;  2CSQ A;  2FB7 A;  1WGS A;  3OMG A;  3V8K A;  3M0R A;  5GAN 6;  1YJ9 T;  2LCC A;  4ZGE B;  4M77 G;  1YIJ A;  1IGU A;  2G3R A;  2RHY A;  4JJC A;  4N4H A;  1LOJ A;  4A63 B;  4JS5 A;  1HD3 A;  1X2Q A;  1AD5 A;  1G3S A;  4L5G A;  2QTX A;  4BB7 A;  5GAN e;  1VQO Q;  5GAO p;  4AT1 B;  2ECZ A;  2C0O A;  3CME Q;  5FU7 B;  2CS7 A;  3G6E T;  4GLM A;  2DXU A;  1VIE A;  2LT1 A;  4J9D A;  3LW5 E;  3LGL A;  3TRE A;  5KE3 A;  1FX7 A;  1YJ9 Q;  1PSE A;  4DEY A;  3JCM X;  2XG8 D;  1WJR A;  2V1Q A;  1JXO A;  1B3Q A;  3A98 A;  3FC3 A;  3CCS T;  1MV3 A;  3A1P A;  1HJD A;  1NEG A;  2RNA A;  4C8Q G;  1H8K A;  2LJ1 A;  2VXE A;  5GAN 2;  3SDZ A;  4PJL A;  3JB9 G;  1M9S A;  2OI3 A;  1U1S A;  4GBQ A;  4Z8A A;  5LJ3 h;  5GAN j;  4PJO G;  2DTH A;  4FCY A;  2H8H A;  4JRI A;  1W70 A;  3EGX B;  1WXU A;  3MO8 A;  3FDR A;  5KYX B;  1BCM A;  4BI3 A;  4XTZ A;  2KI7 A;  4C8Q B;  1ZA1 B;  3CCU A;  3TQ7 P;  2J6O A;  2HEQ A;  3V7R A;  1QVG P;  4EIK A;  5DLO A;  4PJO B;  2LQK A;  1KSW A;  1IHW A;  1YWO A;  4LE9 A;  1WDX A;  1NG2 A;  4M77 D;  3C94 A;  2BZ8 A;  4MZM A;  2YLC A;  4J9H A;  5KCH A;  4PJO E;  1U06 A;  2HMA A;  1JU5 C;  3OW2 P;  5J3B A;  1Q86 C;  4PJJ A;  2LCS A;  2HBP A;  2LJ0 A;  1FMK A;  2CYZ B;  4ME7 A;  4ZTJ A;  3EG2 A;  3GIB A;  1UEB A;  3CC2 A;  1UHF A;  4J8O A;  3CXC S;  2IG0 A;  2RD1 A;  1PNJ A;  2EYQ A;  2KSS A;  1QKW A;  5GAO r;  1FMW A;  4YTL A;  1BB9 A;  1NLO C;  2YUQ A;  1ZLM A;  2X4J A;  4FSS A;  4J9F A;  4C8Q D;  2J6K A;  5IH2 A;  3JB9 D;  8ATC B;  2CP6 A;  5J39 A;  5FWC A;  3MPU B;  2YRD A;  3M4Y A;  2DO3 A;  1YHQ A;  3OYM A;  4FYX B;  3FJ5 A;  1PKT A;  3CCR A;  3OA6 A;  2GBQ A;  3HP9 A;  1G83 A;  1CKA A;  2BKD N;  2F2V A;  2EVR A;  4M7D C;  1H3Z A;  4PFP A;  1D3B A;  4BI4 A;  2K9G A;  1S72 T;  1G2B A;  3QII A;  4E7H A;  2PTK A;  4OMP A;  5I2S A;  3OSV A;  1AWO A;  4OB3 B;  2VGN A;  1G8X A;  1K9A A;  2JNG A;  3VUZ A;  2E6Z A;  2K3B A;  3HRU A;  1T0J A;  2EKH A;  2KRO A;  2RQV A;  2D1X A;  2XDD A;  4HXJ A;  4M7D A;  3CC4 T;  1S72 Q;  1ZHI A;  2AIR B;  2XU8 A;  2LMJ A;  2QAZ A;  3A8H B;  3MEA A;  1WHG A;  1VQN T;  1VYT A;  2O88 A;  1H3H A;  2K3X A;  2D0N A;  3M59 A;  5CKB A;  1QVF A;  4RTU A;  3JCM b;  1Y96 B;  3CCL A;  5IN1 A;  1UFF A;  3HFO A;  1E6H A;  2FZG B;  4RTW A;  1M1F A;  5A2Q E;  1UUE A;  1W2B S;  4RTZ A;  2ABL A;  1TSF A;  1T0H A;  3CC4 Q;  2D9T A;  2E1H A;  2R5A A;  3OYJ A;  2PU9 B;  1RI0 A;  1RI9 A;  3ZEH A;  5L23 A;  1Q7Y U;  1NJI U;  2DVE A;  5I22 A;  1MGQ A;  1IGQ A;  1AVZ C;  2M1H A;  2KGT A;  3OBW A;  2E64 A;  3I56 T;  1K73 R;  2K6D A;  1OI1 A;  2CZ6 B;  1I07 A;  4GLK A;  5DLQ E;  2LZ6 B;  2HDA A;  2ENM A;  4DEX A;  2WAC A;  3PTA A;  2HZY A;  2QK0 A;  1G3Y A;  4F7U A;  4KH0 B;  3RMQ A;  3UDC A;  5A0D A;  4PFZ A;  4LUE A;  4RG8 A;  5GAN 8;  2PUO B;  1QCF A;  3OQ5 A;  1ZQ1 A;  2QQ9 A;  1UEC A;  1YI2 T;  3QHS A;  1D3B B;  2K5I A;  1VQ7 A;  4LXC A;  5A0L A;  4Y28 E;  1ABQ A;  3I56 Q;  3SFM A;  3OYG A;  1OU9 A;  4PL6 A;  3LLR A;  5M9O A;  2K5F A;  4F14 A;  1I5O B;  1H92 A;  4R0K A;  3OBY A;  4Q5W A;  2EBP A;  3VKI A;  5GAM e;  2V8K A;  4FU6 A;  1ACM B;  2QQS A;  2EQU A;  3PGG A;  4JJD A;  1VQ9 T;  2DAQ A;  2JZ2 A;  4HA8 A;  4FW2 A;  1PM3 A;  4ZTF A;  1YI2 Q;  1YJN A;  4LDW A;  1S1N A;  4M7D B;  3OY9 A;  5GJV B;  1TU0 B;  4QVZ A;  2DZC A;  1ZSZ C;  5L8R E;  4M75 G;  1K4U S;  1UHC A;  2LQW A;  1QVF P;  1QP3 A;  5GMK e;  4FSX A;  4F04 B;  4M7D E;  2JTM A;  1BI0 A;  3THK A;  5LJ5 h;  4KUD K;  1WHJ A;  5GAM j;  2Z0W A;  2JM8 A;  1VQL A;  1RAI B;  1WJS A;  1VQ9 Q;  5GAO n;  2QEX T;  2L8D A;  2RQW A;  4ELZ C;  3X26 B;  2GTO A;  2RA2 A;  3JRZ A;  4PKC C;  4DOV A;  3JCM c;  1YBY A;  3X28 B;  4ZGJ B;  4WCI A;  3M58 A;  1N8R U;  1ZSZ A;  2COW A;  1IZ6 A;  3A8O B;  3JB9 I;  2DTI A;  4X9D A;  2FRW A;  2P4T A;  5GMK j;  2CH4 A;  3G1J A;  4Y91 A;  4D6W A;  4F7U G;  1NE8 A;  2PVO B;  2QA4 A;  1KD1 U;  4DQ2 A;  1Q82 R;  2JM9 A;  1XQH A;  2E10 A;  4AFS C;  4XQ3 A;  4XTW A;  4F7U B;  3FB9 A;  4NOY A;  2K7A A;  4Z88 A;  3REA B;  2VKN A;  2D0Q B;  2GQI A;  3CCJ A;  1XOV A;  1GBR A;  4M75 D;  1VYU A;  2LTO A;  2SEM A;  4PLI A;  5GAO m;  1VQ8 A;  1FXX A;  4KUL A;  3M9Q A;  1BKB A;  1WFW A;  3OYY A;  1EFN A;  1ZUY A;  3RBB B;  4BE2 A;  1WXB A;  2VVK A;  2FZK B;  5HKC A;  1C6V X;  5EG2 A;  5GAN f;  1CKB A;  2VXF A;  3X25 B;  4E7S A;  2L5Q A;  3CCQ Q;  2FZC B;  4O5V A;  5HCK A;  3SEM A;  3EG0 A;  1I5L A;  2A28 A;  3JSC A;  2QDL A;  2A7Y A;  2DMO A;  4JJB A;  3M54 A;  2P4R A;  2EW3 A;  5HK3 A;  3E19 A;  3VRZ A;  4R56 A;  5IXB A;  2EPD A;  1X6B A;  3E2U A;  1FWZ A;  3OYK A;  2YWW A;  5D6Y A;  1UJ0 A;  2MIO A;  2EGC A;  5FLX E;  1WYX A;  3M57 A;  3M53 A;  4LDY A;  2FO0 A;  3X24 B;  3G7Z A;  3CC7 A;  2DL3 A;  2EGA A;  1M8M A;  1YJW A;  3J7A F;  3O5Z A;  1VQO A;  2CRE A;  2W0Z A;  3CME A;  1MHN A;  3I5R A;  5J26 A;  1ZSZ B;  2CUD A;  3QJ6 A;  2BTT A;  1YJ9 A;  1KQ2 A;  3EG1 A;  3OYD A;  2LDM A;  2V26 A;  4RTV A;  7AT1 B;  4M7D F;  4KT0 E;  2EJG A;  2DLP A;  3NGP A;  2GCX A;  1Q81 R;  1ZX6 A;  2CKK A;  2JOY A;  1KD1 R;  2XHC A;  2QDY B;  2KR3 A;  4L59 A;  4MZP A;  2CT3 A;  2CSI A;  2B8A A;  5KCO A;  2JS0 A;  5LJ3 g;  3UA6 A;  3I55 Q;  5KYU A;  4M77 C;  1BK2 A;  3OS1 A;  3G6E A;  2KBT A;  1RUW A;  4X34 A;  2AT1 B;  1OV3 A;  2KMT A;  1K76 A;  3UAT A;  4A4F A;  2X35 A;  4JDS A;  2DTO A;  1C0M A;  3CCS A;  1GL5 A;  2R5M A;  1LPL A;  2DL4 A;  4V2S A;  4FYW B;  5LJ3 d;  1M2V B;  3TCJ A;  4A53 A;  5FRN A;  2E41 A;  3CBM A;  1G5V A;  1AWW A;  2DA9 A;  4M77 A;  1B7T A;  1HXD A;  2FVU A;  2JMA A;  4EDU A;  1M90 U;  2K2M A;  5HK0 A;  2K3Y A;  2NUT A;  1G3T A;  4OGC A;  1VIF A;  3QKJ A;  2RHI A;  4DA4 A;  1GFC A;  2AHJ B;  5CK9 A;  4J6Y A;  3MET A;  1OX9 A;  3E9F A;  2RK1 A;  4QVC A;  1X6O A;  5IHI A;  2V8J A;  3L1A A;  2M51 A;  1KC8 U;  1M3C A;  1VQ6 T;  2PZ1 A;  4HVV A;  3R6N A;  3RDV A;  3MKD A;  3CCM T;  1PCX A;  2DVJ A;  2KRM A;  2L89 A;  1TXQ A;  4CC4 B;  3DLM A;  1PG5 B;  3ZL7 C;  4RCB A;  3OB9 A;  2X4X A;  4J5Y A;  4N4I A;  4IUV A;  1K9M C;  1IO6 A;  1HYO A;  1K1Z A;  2BE7 D;  2DF6 A;  3OYL A;  3CCE Q;  1I81 A;  3LGF A;  1VQ6 Q;  2ZPE B;  2COY A;  4A4E A;  1X2K A;  4QQG A;  3CCM Q;  1LJO A;  2YLB A;  3VS4 A;  1TUD A;  1U8R A;  2DM1 A;  2DIL A;  3EG9 A;  1AT1 B;  2OX7 A;  1S72 A;  2LNV A;  2FPF A;  1JRI A;  1RAC B;  4QQ6 A;  1FMV A;  3QWY A;  1D0Y A;  2BIV A;  1BBZ A;  4F17 A;  2M02 A;  2G6F X;  2LNH B;  2OTL Q;  4M77 B;  3QXE B;  3CPW A;  3CC4 A;  2NUT B;  3M0T A;  4ANJ A;  2MF2 A;  1X75 C;  1VQN A;  1LNX A;  1SEM A;  2NWM A;  4XU3 A;  1UGP B;  1OPK A;  2FYK A;  2KDS A;  4M77 E;  1NLP C;  2M0O A;  1V29 B;  3M4G A;  1NPP A;  5GAM f;  1V76 A;  2KRN A;  2FRY A;  3CEY A;  5LL6 S;  4R55 A;  1UB4 A;  2EAY A;  5KYY B;  4A4K A;  2VGM A;  3M0Q A;  3UWN A;  3PE0 A;  1GFD A;  1VQP T;  2VB6 A;  1K0S A;  3ULR B;  1PRM C;  2QTV A;  4C8Q E;  1K73 C;  4LNP A;  2E5Q A;  2ZPH B;  4ATO A;  1N9S A;  2EGE A;  3LX7 A;  2EQM A;  1JJ2 S;  4M7A G;  1W1F A;  2HSP A;  5A0G A;  3EFS A;  3GBQ A;  1SF9 A;  1Z9Q A;  4AG1 C;  1SRM A;  3NHN A;  1GCP A;  1QVG S;  1SHF A;  2D8H A;  1JB0 E;  1UE9 A;  1P92 A;  2RHZ A;  1W2B A;  5CO7 A;  2AZS A;  3TVT A;  2X3X D;  4D8D A;  2DBM A;  4FT4 A;  5GMK m;  4XTY A;  4XU0 A;  4EPC A;  3BDU A;  1VQP Q;  3OW2 S;  3LH5 A;  2AK5 A;  3OYE A;  3NTK A;  1K9M R;  1JBM A;  1QLY A;  1WZO A;  1AHJ B;  4N0A C;  3WVD B;  3OS5 A;  1MMG A;  2ZGW A;  3SB2 A;  3ZFJ A;  5LJ5 g;  4NL2 A;  3OSS C;  5IAY A;  2DJZ A;  1K8A U;  2NLU A;  1B07 A;  3JCM P;  3OYA A;  3MCA B;  3A8L B;  3CPW P;  2YRC A;  2KYB A;  2MWO A;  2X4W A;  2O01 E;  3GP8 A;  3G4S T;  3V8J A;  2GNC A;  1ZSG A;  3A5Z B;  3HTR A;  4EMH A;  2CZ7 B;  1U1T A;  4OMN A;  2M0Y A;  4DBQ A;  5LJ5 d;  1GXI E;  3VS2 A;  2R58 A;  4OML A;  4M7A D;  2WSE E;  3QDF A;  4N0A A;  4JRQ A;  4IUR A;  4OB0 B;  4XAX B;  1NYF A;  1RAF B;  2CP3 A;  2QEX A;  2V1R A;  2YT6 A;  4M75 C;  3A8M B;  2Y4Y A;  2KXC A;  2ZZD A;  1NBE B;  5LJ5 e;  4FM4 B;  2KK4 A;  2HBW A;  5ECA A;  1QP2 A;  3G4S Q;  4ELY C;  3CD6 Q;  2JS2 A;  4QKU A;  1T3S A;  2YUN A;  1PWT A;  2B86 A;  1WQW A;  3EHQ A;  3QYH B;  2KRS A;  3CQT A;  1BIB A;  4RTX A;  2ZPI B;  1Y0M A;  1RAA B;  4B9X A;  3OYN A;  3CMA A;  4M77 F;  3VJP A;  5FRM A;  3M55 A;  1Q82 C;  4NL3 A;  4E7I A;  2DBK A;  4M75 A;  5LJ5 j;  2A36 A;  2CP5 A;  1OPL A;  1WNL A;  4Z02 A;  1W2B P;  4A4H A;  1ABO A;  2WSF E;  1MUZ A;  5FW9 A;  3JAM E;  1WHL A;  4IUQ A;  2J7I A;  2LX7 A;  1YIJ Q;  4MML A;  4FYY B;  3NPF A;  3I35 A;  4XTV A;  3D7S B;  4C8Q F;  1T3L A;  3E1S A;  4C92 G;  2BZY A;  1M30 A;  4KH1 B;  3JB9 F;  2RMO A;  4PJO F;  1Y71 A;  1BI1 A;  2R57 A;  1I0C A;  3L2W A;  4CRI A;  1OZ2 A;  2EKO A;  3JCM h;  1D1A A;  2FEI A;  5CKH A;  3JCM W;  4WF2 A;  4PNO A;  2AZV A;  3TSW A;  3T9N A;  4J9C A;  4E6R A;  2XDB A;  1KHI A;  3EGD A;  4CC3 A;  2RJD A;  3SHW A;  3JCM V;  4CC7 A;  3M0U A;  2O31 A;  1MV0 B;  3HKS A;  3CC2 T;  1EZZ B;  3CCU Q;  3L42 A;  2FL7 A;  4XTU A;  1WI7 A;  4HKE A;  1A0N B;  1M8V A;  2E4H A;  3I9Q A;  4KGZ B;  4ESR A;  2VUB A;  2WSC E;  1H64 1;  3L2Q A;  2LRQ A;  3P8B B;  1R0C B;  1KQS A;  2DL5 A;  2LVM A;  4QQD A;  4HCC A;  2OTJ A;  3HRT A;  1I4K 1;  2EQK A;  2EYX A;  4HT9 A;  4RTT A;  2ROL A;  3BFM A;  2KAF A;  3CC2 Q;  1D1C A;  4C92 D;  4HCZ A;  4JZ3 A;  3HHT B;  4BE0 A;  1N8R C;  1QWE A;  1W6X A;  2RN8 A;  4IUP A;  4M75 B;  3CCR T;  2ESW A;  2JT4 A;  2RJC A;  4M78 D;  1D0Z A;  1Q81 C;  3FLG A;  2K5L A;  1KD1 C;  4CI0 C;  4O6J A;  5CR2 A;  3MJX A;  2OAU A;  1QVF S;  1ARK A;  3SD4 A;  4M75 E;  2P84 A;  8AT1 B;  4J7F A;  1O75 A;  1D1B A;  2LJ3 A;  4PJN A;  1R8O B;  2SRC A;  3X20 B;  2MYS A;  1Q7Y R;  3CCR Q;  2V8I A;  1NJI R;  2MK5 A;  2J06 A;  3JB9 J;  3RKY A;  4GY5 A;  1NZ9 A;  2I2L A;  2JXB A;  2CDT A;  3MP1 A;  2PQW A;  2HCK A;  2Y90 A;  1D0X A;  5FU6 C;  5IXF A;  4LUD A;  3C4S A;  3H8Z A;  2L2P A;  3CCQ T;  3QYG B;  1TUG B;  5AT1 B;  4RG2 A;  4F7U E;  1BCO A;  2H3J A;  4KRT A;  2F5K A;  1LVK A;  1YCY A;  2RHX A;  3EGD B;  1Y57 A;  2RQT A;  1RAB B;  1UJY A;  4II1 A;  2E70 A;  3J81 E;  3L2V A;  2YRV A;  2YUP A;  1VQ6 A;  1GCQ C;  1R77 A;  2RJE A;  1AWJ A;  1E7O A;  2QYZ A;  3CCM A;  1UGQ B;  5IHN A;  1M3B A;  2YHT A;  2ED1 A;  4C0D C;  1M27 C;  2E3H A;  2DZ9 A;  3PMT A;  1KQS P;  1PKS A;  1G3W A;  3CCV T;  3A8G B;  3DB3 A;  3JCM J;  2FPE A;  2K79 A;  5CQY A;  3RIR A;  3VS3 A;  3LH0 A;  3DKM A;  1M1K U;  4K11 A;  2L0A A;  4FT2 A;  3PT9 A;  3OYH A;  2HAX A;  4KGX B;  4J6X A;  4BUG A;  1GCQ A;  4ZGD B;  1QCO A;  2PNI A;  2VYT A;  2E12 A;  3G71 T;  3EFO A;  4BY6 C;  2RPN A;  1QKX A;  2A37 A;  3I55 T;  3CCV Q;  3VRY A;  3M5A A;  5GAM h;  1JQQ A;  2F69 A;  4ZN1 A;  4AG2 C;  2X3W D;  2GFA A;  2RQU A;  1MNE A;  2J05 A;  1PHT A;  1QWF A;  2DNU A;  4P5N A;  1N8R R;  5KYW A;  3KFV A;  1VQM T;  1YFN A;  4L6V 5;  2KT8 A;  3G71 Q;  1O9S A;  3L2R A;  1RAG B;  5GMK h;  2HNI A;  5IHK A;  2LCL A;  4J6W A;  4J9I A;  3DLL A;  4M75 F;  2JTE A;  3EFR A;  5I2M A;  2P0K A;  4C0Z A;  1GRI A;  1UTI A;  4J9B A;  1VQL T;  1TUC A;  4DBF A;  2DD4 A;  4HCK A;  3VS6 A;  1VQM Q;  4C0G A;  1YJN Q;  5GMK i;  2BE9 B;  2VC8 A;  5D7U A;  1MMN A;  4A54 A;  3UA7 A;  1N9R A;  3M56 A;  5FU6 B;  2VWF A;  4ZN3 A;  1U5S A;  3H0H A;  4OB2 B;  4C0F A;  1MMD A;  1WHH A;  1QW1 A;  3BE3 A;  1WHM A;  5KYN A;  5LJ3 e;  2IIM A;  2RQR A;  1UGR B;  1VQL Q;  1WA7 A;  1VQP A;  1X69 A;  4F7U F;  4BDY A;  2CT4 A;  1X01 A;  4DOW A;  1ZUK A;  2MWP A;  1N5Z A;  3SWN C;  3MP8 A;  1RLQ C;  3HPW A;  5LJ5 f;  1B34 A;  3KBG A;  3CCE T;  2C06 A;  3U23 A;  1M3A A;  2CGH A;  3QWX X;  1HK9 A;  1X43 A;  2LX9 A;  1UGV A;  3NTH A;  5LJ3 j;  4M7A C;  2A08 A;  1IXD A;  4F16 A;  1VYV A;  3VYH B;  1OOT A;  4B6M A;  2JTF A;  2NUP A;  1VQ8 T;  2DL8 A;  4J83 A;  1Y7X A;  2QGG A;  5CKD A;  4OP0 A;  2DET A;  3P8D A;  1OX8 A;  2RH2 A;  3MEU A;  3S3M A;  2CH4 W;  1I1J A;  4JS4 A;  4X9C A;  5CKE A;  3EGX A;  4MMK A;  2C0T A;  3SWN A;  1N27 A;  2CP2 A;  1JJ2 A;  3PVQ A;  2QG9 B;  1M5Q 1;  2MOX A;  2ATC B;  2DIQ A;  2EYY A;  1R0B G;  3OYI A;  5KYU B;  4BY6 B;  1KJW A;  3GNF B;  4M7A A; 
#chains in the Genus database with same CATH homology
 1TG0 A;  2EBP A;  2KYB A;  1YNZ A;  4JJD A;  3VS1 A;  1SRL A;  2O9V A;  2OJ2 A;  1S1N A;  2GNC A;  1ZSG A;  4OMN A;  5GJV B;  2M0Y A;  4HVW A;  3EG3 A;  3VS2 A;  2KXD A;  2ED0 A;  4OML A;  1KIK A;  1K4U S;  1UHC A;  2LQW A;  4AFZ C;  3M0P A;  1UDL A;  1NYF A;  2V1R A;  2YT6 A;  3THK A;  1X27 A;  2KXC A;  3REB B;  2JM8 A;  2BZX A;  5ECA A;  2HBW A;  3VS7 A;  4Y92 A;  2KYM A;  2RQW A;  2JS2 A;  1T3S A;  2GTO A;  4JZ4 A;  2YUN A;  1PWT A;  2B86 A;  2FG0 A;  3EHQ A;  2KRS A;  3CQT A;  4RTX A;  2NUZ A;  1Y0M A;  2C0I A;  4WCI A;  1SSH A;  1FYN A;  2FRW A;  2CH4 A;  3JV3 A;  2DRK A;  3H0F A;  1AZE A;  2DL7 A;  1KFZ A;  2DBK A;  1AZG B;  2A36 A;  1OPL A;  2JM9 A;  3H0I A;  1ABO A;  2YDL A;  4AFS C;  1WXT A;  2DX1 A;  1V1C A;  1MUZ A;  2K7A A;  4Z88 A;  2F2W A;  5FW9 A;  3REA B;  3NMZ C;  1WLP B;  5GJW B;  2J7I A;  2J6F A;  2LX7 A;  4AFQ C;  2VKN A;  1E6G A;  2GQI A;  1XOV A;  1YN8 A;  5I11 A;  4LN2 A;  1GBR A;  1WX6 A;  3NPF A;  4ZNX A;  2YUO A;  3I35 A;  1VYU A;  2SEM A;  1T3L A;  4QT7 A;  2BZY A;  1M30 A;  1WFW A;  3VS5 A;  2RMO A;  1SPK A;  5EC7 A;  1NYG A;  2L3S A;  1EFN A;  1ZUY A;  4Z89 A;  1I0C A;  3RBB B;  1YCS B;  3RNJ A;  1WXB A;  2VVK A;  2D8J A;  1PRL C;  1CKB A;  4OMQ A;  2FEI A;  4M4Z A;  2AZV A;  2GGR A;  5HCK A;  3SEM A;  3TSW A;  3EG0 A;  2A28 A;  2QDL A;  2AKK A;  2DMO A;  4J9C A;  4E6R A;  4JJB A;  4CC3 A;  2P4R A;  2EW3 A;  3SHW A;  3UF4 A;  4CC7 A;  3M0U A;  3VRZ A;  2O31 A;  5IXB A;  1LCK A;  1MV0 B;  1VA7 A;  2EPD A;  1X6B A;  2CUB A;  1YWP A;  1UJ0 A;  1WI7 A;  2MIO A;  1A0N B;  2EGC A;  1WYX A;  4RUG A;  3I9Q A;  4ESR A;  2FO0 A;  2DRM A;  2JMC A;  4ORZ A;  2DL3 A;  2EGA A;  1M8M A;  3O5Z A;  2CRE A;  2W0Z A;  2DL5 A;  1CSK A;  3I5R A;  2ROT A;  2YSQ A;  3PVL A;  2EYX A;  2CUD A;  2RF0 A;  4RTT A;  2EYW A;  2ROL A;  2BTT A;  4JZ3 A;  3EG1 A;  2LP5 A;  2CSQ A;  2EYZ A;  1QWE A;  1W6X A;  2RN8 A;  3M0R A;  2ESW A;  2JT4 A;  4RTV A;  2EQI A;  2DLP A;  2AKL A;  3NGP A;  1NEB A;  3VS0 A;  1ZX6 A;  4JJC A;  1ARK A;  2KR3 A;  4A63 B;  2CT3 A;  2CSI A;  2JS0 A;  3UA6 A;  1BK2 A;  1HD3 A;  2KBT A;  1RUW A;  1X2Q A;  1AD5 A;  4RTY A;  1Z9Z A;  1OV3 A;  2ECZ A;  2C0O A;  1K76 A;  2LJ3 A;  4GLM A;  3UAT A;  2SRC A;  3C0C A;  4J9D A;  2J06 A;  2DJQ A;  1AEY A;  4DEY A;  1GL5 A;  2DL4 A;  2V1Q A;  4X1V A;  2JXB A;  1JXO A;  2CDT A;  1B3Q A;  3A98 A;  2HCK A;  5IXF A;  4LUD A;  1JEG A;  2LQN A;  1MV3 A;  1HJD A;  1NEG A;  2RNA A;  1AWW A;  1H8K A;  2DA9 A;  2L2P A;  2LJ1 A;  1ZUU A;  2OI3 A;  4GBQ A;  2JMA A;  4Z8A A;  2E5K A;  2H8H A;  4KRT A;  1W70 A;  1WXU A;  1UG1 A;  2K2M A;  1BU1 A;  1SHG A;  5FWB A;  1J3T A;  1Y57 A;  2J6O A;  2HEQ A;  2KE9 A;  2RQT A;  4EIK A;  1GFC A;  1HSQ A;  1UJY A;  1KSW A;  1WIE A;  1YWO A;  4LE9 A;  1WDX A;  1NG2 A;  2YUP A;  2BZ8 A;  3TSZ A;  1GCQ C;  4J9E A;  1AWJ A;  1E7O A;  2OAW A;  4J9H A;  5IHI A;  5IHN A;  1M3B A;  2M51 A;  1U06 A;  2ED1 A;  1M3C A;  1JU5 C;  4AFU C;  2PZ1 A;  1M27 C;  4HVV A;  2LCS A;  3R6N A;  2LJ0 A;  1FMK A;  3EG2 A;  1PKS A;  2DVJ A;  1UHF A;  2KNB B;  2L3Q A;  2KRM A;  4HVU A;  4CC4 B;  4J9G A;  1AWX A;  3ZL7 C;  1PNJ A;  2FPE A;  1QKW A;  2K79 A;  3VS3 A;  1BB9 A;  1IO6 A;  1NLO C;  4K11 A;  2L0A A;  2DYB A;  1K1Z A;  2YUQ A;  2DF6 A;  4IIO A;  1ZLM A;  4FSS A;  1GCQ A;  4J9F A;  2J6K A;  2PNI A;  5IH2 A;  1RLP C;  2RPN A;  1X2K A;  1QKX A;  2A37 A;  5FWC A;  2L3P A;  3VS4 A;  1TUD A;  3VRY A;  2FPD A;  1JQQ A;  2DM1 A;  2DIL A;  4AG2 C;  2X3W D;  3FJ5 A;  1PKT A;  2GBQ A;  2RQU A;  2J05 A;  1G83 A;  1CKA A;  2F2V A;  1PHT A;  2EVR A;  1QWF A;  2DNU A;  1OEB A;  2FPF A;  2GTJ A;  2K9G A;  3EHR A;  1U3O A;  1G2B A;  3KFV A;  2PTK A;  3QWY A;  2KT8 A;  4OMP A;  2O2O A;  1BBZ A;  1AWO A;  4F17 A;  1ZBJ A;  2G6F X;  3IQL A;  5IHK A;  2LNH B;  1K9A A;  4J9I A;  2K3B A;  1JXM A;  1AOJ A;  2JTE A;  2KT1 A;  1GRI A;  1UTI A;  1T0J A;  2EKH A;  2KRO A;  2RQV A;  1X6G A;  3M0T A;  4J9B A;  1TUC A;  2D1X A;  4HXJ A;  4HCK A;  1SEM A;  2DE0 X;  3VS6 A;  2NWM A;  2I0N A;  1OPK A;  2LMJ A;  1K0X A;  1NLP C;  1VYT A;  2O88 A;  1H3H A;  1YP5 A;  2D0N A;  4RTU A;  3UA7 A;  2VWF A;  2KRN A;  2FRY A;  1UFF A;  1E6H A;  1U5S A;  3H0H A;  4RTW A;  1NM7 A;  1UUE A;  4RTZ A;  2IIM A;  2ABL A;  2RQR A;  2O9S A;  4JPB W;  1WA7 A;  1T0H A;  1X69 A;  3M0Q A;  3PE0 A;  2CT4 A;  2KEA A;  1GFD A;  1RI9 A;  4OMM A;  5L23 A;  1ZUK A;  1K0S A;  3ULR B;  5I22 A;  3M0S A;  1PRM C;  1AVZ C;  1N5Z A;  2XMF A;  2KGT A;  1RLQ C;  3EGU A;  4LNP A;  2EGE A;  3U23 A;  1M3A A;  1W1F A;  2HSP A;  2K6D A;  1I07 A;  3GBQ A;  1Z9Q A;  4AG1 C;  1SRM A;  2LZ6 B;  3NHN A;  1GCP A;  1X43 A;  2HDA A;  3QWX X;  1UGV A;  2ENM A;  1SHF A;  2D8H A;  1UE9 A;  4DEX A;  2A08 A;  4F16 A;  1VYV A;  2AZS A;  1OOT A;  3I5S A;  3TVT A;  1GBQ A;  2X3X D;  4D8D A;  2DBM A;  2DL8 A;  4LUE A;  4OMO A;  1QCF A;  1JO8 A;  2MCN A;  1UEC A;  3LH5 A;  2W10 A;  2AK5 A;  3H41 A;  4IIM A;  2CH4 W;  1I1J A;  1ABQ A;  1QLY A;  2C0T A;  4D8K A;  3PVQ A;  2MOX A;  2EYY A;  2JW4 A;  2F2X A;  4F14 A;  1H92 A;  4R0K A;  1KJW A;  1B07 A;  4CC2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...