5GJWC

Structure of the mammalian voltage-gated calcium channel cav1.1 complex for classii map
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
197
structure length
178
Chain Sequence
b'VPPYDVVPSMRPIILVGPSLKGYEVTDMMQKALFDFLKHLFDGRISITRVTADISLARSSLAEVQSEIERIFELARTLQLVALDADTINHPAQLSKTSLAPIIVYIKITSPKVLQRLIKSRGKSQSKHLNVQIAASEKLAQCPPEMFDIILDENQLEDACEHLAEYLEAYWKATHPPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Voltage-dependent L-type calcium channel subunit alpha-1S
publication title Structure of the voltage-gated calcium channel Cav1.1 at 3.6 angstrom resolution
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Membrane protein
total genus 49
structure length 178
sequence length 197
ec nomenclature
pdb deposition date 2016-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00625 Guanylate_kin Guanylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5gjwC00
3N5CA 1L7VC 3NVAA 1G8GA 421PA 4L4UA 3WYFA 2XB4A 2YZ2A 4MITA 1QHSA 3ZIAD 2OCBA 4RZ2A 4EQ6B 4M0LA 1E3MA 4PAMA 2WV9A 4KYUA 4HATA 1E4VA 1Q22A 2VLIA 3T06B 3IPXA 1G1MA 3CRQA 4B74A 1W47A 2ZI4A 4Q02A 4B2LA 5C2JB 3P4XA 3GLFB 1Z07A 1KI1A 4JL6A 4MKHA 2JLRA 2O0KA 3EW9A 1H8ED 2FN4A 4FWIB 121PA 5G40A 1CTQA 4Q03A 2QGNA 4LBZA 1KDPA 3R9IA 3SYNA 2JGNA 3U6BA 2C9CA 1P3JA 1IN7A 1LS1A 5CIWA 4V0ME 2QPOA 1OHHA 1FNMA 3A1WA 5HPYB 4PC2A 5H1YA 4WIAA 2OCYC 3BB4A 2FSHA 4OJKA 1MT0A 4XH9B 1CJKC 4ILEA 1EK0A 1KK1A 4HUQB 2V6IA 1DARA 5KSZA 1GL6A 4MYUA 5FPKA 2Q0HA 1NI3A 2J45A 3B7GA 1M7HA 1G9XA 3BRWD 3IIMA 1DAKA 1I2DA 4IEEA 3WRYC 3MWKA 2W0SA 3W5JA 3MLEA 1UM8A 2OILA 4CT4B 4ZDWA 2GBLC 4XWOA 1ZYUA 4HLQB 5EUMA 4ZKDA 4ESVA 2YV5A 2QMEA 1QVAA 1TX4B 2ODWA 2SHKA 2IYLD 3OAAA 2WTUA 1XEWY 5AJVB 4AG6A 2ZRDA 3REFA 3KJEA 1RRFA 2AK2A 3RWOA 4ESHA 2XJ4A 4MUBA 2ZJOA 4KSCA 5EJEA 2HYIC 3CRMA 3SYKA 4B6EA 3ZVMA 2XXAA 3QPWA 1ZNWA 1W36B 3EARA 1NIPA 2PEZA 1VPLA 3CPHA 3EPLA 1C1YA 3SDZA 1VCIA 3W6NA 2OBLA 5LD2C 3SQWA 1M6NA 1A7JA 2GK7A 4YXWA 2GZHA 4TLDA 3VX4A 2CHVA 3VR1A 2BMFA 4B3FX 5DN6D 4ASUD 1Z0AA 3WMFA 4MGYR 2C2HA 4MQBA 1G3QA 2Z5FA 5FBWB 4HAZA 1S4QA 1FP6A 4CVNA 5JLJA 3CF2A 1HE1C 1NBME 3GLFE 1NF3A 5KOYA 4IVPA 1XDBA 2QM8A 3E70C 5AWFC 4C7OB 4QBIA 1ZNXA 4WZAE 2ZROA 1WP9A 3TW4A 3HR7A 1C4OA 4KHZA 5JHHB 3PEWA 2EYQA 3AH8A 4C2UA 4JVNA 2OXCA 4TL9A 4JBWA 4JSYA 2EWVA 1N6LA 4PHHA 3TMKA 3K1JA 4NPHA 5FOUA 1OXUA 4H9GA 1QBKC 1NMXA 3BOSA 3NH6A 621PA 2BVNA 5KHOC 1F60A 1XD9A 2ZS8A 4C0JA 3GLIA 2XJ9A 3KKOA 5EUQB 4HB2A 4EFMA 2WICA 3GLHB 4A8JA 4XVRA 2GEUA 5FUWA 1G8PA 2AX4A 3R9WA 3LXXA 3OFND 4LI0A 3I4LA 3SJBA 2B7BA 1XMVA 4OHYA 2N1BA 3NIBA 3UKDA 1F2UA 1AK2A 1D2MA 1G21E 4C30A 3SZRA 2IS6A 2ONJA 2XGJA 3RANA 1K5DA 2GJ9A 1E1QD 1Z2CA 1ZD9A 1NRJB 1NN0A 3T35A 1BYIA 2XZLA 2HLDA 1VCNA 4Q1CA 3RSLA 4PC1A 3I8SA 2G6BA 2YWFA 4E22A 1W0KD 4ZV4A 2ZR9A 4D80A 2IYWA 2WOJA 2EFGA 1AQUA 4JLKA 4AYXA 1G6OA 5E4FA 4P0TA 1Q12A 1TQ2A 4IJMA 3CNOA 2JA1A 2CMKA 2D4HA 1P9RA 3NTUA 2VO1A 3UATA 2XNDA 3ZD7A 2RGAA 1Z2AA 2ORIA 3R7WA 1HEIA 1S9HA 2R6GA 3RS4A 1S1CA 3FDIA 5FPSA 3I72A 4G0NA 3UG7A 2FZLA 3QQ5A 4CRWB 1DAFA 4HLUC 1L4UA 2CK3D 2MMGA 4H1VA 4LJ7A 5EXSA 2V7QA 2RCNA 1JXOA 5FPTA 2HJVA 1CF4A 2ZAMA 2H16A 3MWLA 2ZU0C 3K70B 4LJ9A 4RZXA 3ZJYA 2CE2X 2RB4A 2ZRKA 4B3XA 1F2TA 5EE3A 4GL2A 1X8LA 3THWA 1D2EA 2A2ZA 5GJWC 1UAAA 3IEVA 4AK9A 1U9IA 2I1QA 3RS0A 4FXPA 3UIEA 3SOPA 2FPKA 4DDVA 1KAGA 2X8AA 3W6PA 4PPFA 1E9SA 1GNQA 1XX6A 1OIVA 1SXJB 2BJVA 3QY0A 3A1SA 3PIRA 4F92B 1IOZA 1MO3A 4G1UC 1KGDA 3A8TA 4ZDIA 2R2AA 3BFVA 4I1UA 2BM0A 4QGGA 2NZJA 4XVUA 4ZO4A 4WXRA 1G4UR 2P0EA 4P4SB 3CB4A 2P2LA 4DBLC 1IAQA 1KJWA 3B9PA 2A5FA 2NMVA 3U44A 2JLQA 4KFTA 1CR4A 3THYB 3ZZTA 3L8ZA 4M1OA 3NWJA 1T5LA 5UKDA 3FKSD 4JMPA 3FOZA 2NTYC 3KTAA 1W36D 2OAQ1 4DUGA 2WAYA 2ONKA 2ZRNA 5JFGA 5EP4A 1HT2E 2ZI5A 4EJSC 1KKMA 3H1TA 2GXUA 2WJHA 2JIZD 3GJ8A 1XWIA 3U2QA 2MMCA 1KY2A 1S96A 1AKEA 4NCHA 2TMKA 2R6AA 4DIEA 5A0FA 3OIYA 4CT5A 1OV4A 4Q66C 2CCKA 2MSEB 3P4YA 4B3GA 2KJQA 2R6CA 1ZUHA 3DVLA 4HDQB 2REXB 5L3QA 5G41A 3BERA 2Q3HA 3CPJB 1PV4A 3OE7A 3OESA 3AVWA 3FHCB 2GJSA 5FFMA 2IUUA 3RC8A 2VF7A 5J4KA 4DSTA 2F6RA 3T1VA 5KYKA 1P5ZB 5SZHB 3CBQA 5M04A 1Q1EA 1YR9A 3JVVA 2J0VA 1N6HA 2JLWA 3FB4A 4GP6A 1WBBA 4WVFA 4LWZA 1XU4A 1T9HA 1EFUA 4BFWA 4X8LA 2O8DA 1B0UA 4A0RA 1KDRA 4EPTA 2IXGA 2FF7A 4MRSA 4QNRA 1E79D 2OEPA 3NHBA 2FFAA 3VR5A 2GXSA 3FHOA 4Q1DA 4E03A 2PJRA 1COWA 2G0NA 5EZ5A 3A4LA 1GIAA 3LRPA 4W5HA 1OFIA 1W4CA 4FMCB 1YZNA 3V9PA 4DDWA 1X3SA 2GCOA 2E87A 2WWYA 2QAJA 3QVVA 2EWWA 4DSNA 5B58C 4CEIB 4AI6A 1BS1A 1G5PA 1ZM2A 3PEVA 5FTJA 1DVRA 5B64A 5FI0B 4BWYA 3EC1A 4DEXA 5FL7D 1Z6AA 1OXSC 1J8YF 1MRSA 4MKGA 4IKEA 1VG1A 4JLAA 1M74A 2Z0MA 2BBWA 2E1RA 1NJGA 1FPMA 4HEJA 5G3YA 4FWTA 1R8SA 1CXZA 1ELOA 3L0SA 3VR3A 3U7GA 5AJZA 1QHYA 5TVKA 4G5RA 1VHTA 5HE9A 2FZ4A 5CM9C 1PJRA 4F93B 1NSTA 1P73A 4HLDA 721PA 3AF4A 2JLZA 1XCMA 2GILA 2CJWB 1OKKD 4OBEA 1QHXA 2IUTA 4CEJB 4LC0A 2VSFA 3ZDQA 2GCNA 3AF3A 4OQLA 1IXRC 3BORA 2A30A 2RGGA 3C5HA 1ZU5A 2GAOA 1J7KA 5EP3A 2HF8A 2QROA 3AVTA 2WKPA 2ZE5A 1DELA 4TMXA 3NBFA 4JVMA 4MH0R 1GAJA 3E1SA 2PEYA 3I73A 2YYZA 4KAXA 3TR0A 1R0YA 3KFVA 1EFRA 4DLSA 3C8UA 4I1SA 5J5CA 3FYHA 4TQUS 4V0OA 3DDCA 1NVUQ 4URUR 4WZ6A 3J81k 1KI2A 2V6JA 3BAFA 4H1UA 2Z4SA 4DWJA 5L3SA 2QGZA 5JWHA 5FTMA 2OFOA 4TMKA 1E2QA 3OIVA 1W7AA 1JJVA 1FUKA 3C41J 3OIWA 3GFPA 1SVWA 3D6TB 5AUNB 2D7DA 5DNYB 1U8ZA 1XD8A 4K8OA 2IWHA 2OCAA 2QTHA 3IEUA 4M1TA 1G41A 2JASA 3WMGA 3GLIB 4AURA 3VX3A 1R5BA 4D81A 2VF8A 4PQRA 1KTVA 4MRRA 1DPFA 4WA7A 3K9NA 4TSFD 5JMTA 1Z0FA 3VU9A 1E2PA 2QP9X 3CPEA 4OHWA 2JJ2D 2IEZA 4OQFA 4X8OA 5DIFA 4RCYA 2KBFA 2XAUA 1CLUA 2F55A 2DWOA 4QM7A 1P62B 2VP5A 4P4UA 4E09A 2D06A 1C9KA 4QJ3A 3PQCA 4BLTA 2CL6X 3KQLA 3GPLA 1JEEA 1S0UA 3G5UA 3ZZUA 5HCIA 4DJTA 1NG1A 4TTQA 2RGCA 1II9A 2JLYA 1T8TA 2RGBA 1KNXA 2QMOA 4KU4A 4PPNA 3QIAA 2J9RA 5C46F 2AKAB 5DYIA 3UMFA 5LB4A 2AXNA 2VP9A 3KJHA 4NYMR 4HLCA 4QM6A 1G3MA 3VAAA 1R5NA 3RAPR 4US1R 3FE2A 3THXA 5FUVA 4YONB 3AV0B 2REOA 4FD2A 1N5LA 2DWQA 1G5TA 4ZDJA 5IHPA 3QG5A 3F0TA 1NIJA 2YOFA 3THWB 4KI0A 2V8OA 1V5WA 221PA 2IYYA 4GMDA 2KSQA 4AY2A 3RABA 3GJ0A 3GCGA 4TMZA 1GVNB 2OBNA 2ZRBA 5JRJA 1G7CA 1JQLB 1OXXK 2WAXA 3I8XA 1WBDA 4Q4JA 4TTPA 4BZXA 3TR5A 2GHIA 3GJXC 3QSYA 1E32A 3CZQA 4GDFA 2QEQA 1AA9A 3PITA 4GT1A 1CJMA 3CNNA 4FN5A 1YZKA 3KKQA 3GLGB 2QT1A 3EPKA 1OLOA 1QHHB 3KQKA 4YQFA 2OBMA 2GBLA 4BZPA 1G8HA 1N6KA 1N5JA 3PEYA 4KYIB 5CK4A 1G16A 5KTYA 3JZMA 3KKPA 3B85A 2Q21A 3SJAA 4KLNA 2XTMA 3U44B 5KPDA 4ZIRA 1NY6A 4W7SA 4PO9A 1CR1A 1E2MA 4TZ0A 3KKMA 3PXGA 2YJTD 1CRQA 3L8YA 5JS8A 1R0ZA 4WZBE 2J0UA 3U7HB 2LCFA 1M2OB 1ZUNB 1A2BA 4NYMQ 3TBKA 2AD1A 3X2SA 4Q1BA 4D26A 2BJWA 5JBQA 3ADDA 4PHTA 2L0XA 1EG7A 2OT3B 4A6PA 4NKRA 1BMFA 4YXWD 4QJ4A 5HE8A 1GNPA 5JRZA 2F1JA 5EE0A 3SJCA 3JZAA 1GKUB 3KUCA 2ZSFA 4DCVA 2ZYTX 2R6FA 1Z47A 1OFUX 2ORWA 2R8RA 1UDWA 5CJPA 2J5XA 5KSPA 5JWOA 1SKQA 2IYTA 3AP1A 1W4RA 5J47A 1OXVA 4UXJA 2H8KA 2OLKA 2F43A 2VSOA 1TNDA 1IHUA 3OEHA 4B32A 3CWQA 3AF2A 4XD7A 1J8MF 1E2JA 1DEKA 3EZ9A 4HYYA 2GTPA 1KSGA 1P2TA 4DCNA 3T1TA 2OCPA 3FWYA 3AQ4A 3T5GA 2QE7D 1E9DA 3WYGA 1JR6A 2GVDC 3K9GA 3P20A 4TYPA 1PZNA 2WM9B 4LSGA 1YRAA 3ZVRA 4BASA 3QXXA 4FMBB 4C4PA 1E6CA 3FVQA 3QEOA 1JNYA 4FCVA 1SHZA 3SI7A 1E2IA 2NOAA 1J90A 1G64A 1AZSC 3SHFA 4CZ2A 2O8DB 1YR7A 4A6XA 3Q8XB 1MH1A 3K09C 1NVVR 4FCWA 3A1TA 1JAIA 4OI2A 2ERYA 1P4SA 1A4RA 1W49A 2WIBA 4NCIA 1US8A 2WZQA 3QJYA 4B71A 3KQHA 1Q0UA 4IHQA 1K6MA 2B8TA 2XITA 4B3CA 1HH4A 1X8KA 4UQOA 3BFKA 5GJVC 2BC9A 4AC9A 1IQPA 2BHRA 5FOWA 3I61A 1Z0JA 4L16A 4POAA 4JLJA 3N70A 2FJUA 4BFZA 4NONA 2DWPA 4RZUA 3U4QA 2F9LA 4PZZA 3B5JA 3G82C 4HI0E 3K9LA 3I62A 3S1AB 1ZINA 3MWJA 2HYDA 3TUJC 2C96A 3Q85A 4BRUA 3TIFA 2DY1A 2IHBA 3LXRA 5DHAA 2H17A 1W44A 1Z28A 2W83A 3AVPA 4YDSA 1E9BA 3KQNA 1KMQA 3BB3A 2QAGB 4HLUA 2VHUA 1LFDB 3H2YA 2I4IA 2ZRPA 2XSZD 1M1YE 4RD1A 4Z1MD 2EQBA 4PO8A 4Q4AA 5TB5A 4ARZA 4QGAA 2IBMA 2N46A 3IDQA 3BBPA 3TE6A 5IK2A 1QF9A 2WJYA 2P3SA 1EWRA 2O0HA 1T3LA 3I32A 3K8YA 1Q44A 5A4JA 1NJFA 4JT2A 5JJIA 1KI9A 3SBDA 1XPUA 2AD5A 1NVVQ 2WWFA 1G7RA 4I4LA 4UNSA 4F4CA 1XPOA 3MJHA 4LY6A 1NN1A 4TTRA 3BH6A 3U60B 2QZ4A 1KO5A 1OH7A 5GVRA 1AZTA 1SGWA 2EU8A 4LZZA 5C18A 5BQ5A 3WYAA 2ZI9A 3GQBA 1X1RA 2KB0A 2JLUA 5CITA 3LNCA 2BMEA 4ABYA 4BFVA 4LK2A 3I3SR 1Z0KA 3L82B 4RD4A 3B1ZA 1JJ7A 4RKFA 5B57C 3QKSB 4QG7A 4O3MA 1CBUA 1KO8A 4UNRA 3MG9A 1CJUC 2WSSD 1E9CA 3SNHA 3LBIA 3CH4B 3THOA 1EESA 4KBGA 2XTNA 2ZIAA 4UXHA 4PC6A 2O8FB 2WKQA 3TRFA 1MO4A 3ND9A 1YZLA 4BLQA 4NMMA 5FOSA 2F7SA 2ZAOA 4B35A 3VU9B 1OT3A 1RJ9B 4EJSA 3K53A 1U98A 3AKYA 4OK5A 3DPUA 3PUWA 2JDID 2JLSA 2NO6A 2BBTA 2QORA 2DYKA 4TLCA 5TY0A 1G8YA 3P27A 3T1OA 1W4BA 3U3RA 3WP0A 3ADCA 1UEJA 3PEUA 2BDTA 1MR3F 4GRAA 2WPDA 5CM8B 3CNLA 2NO7A 1W4AA 3AKCA 1RZ3A 3HYRA 1U8YA 4LV5B 4C0KA 3IKJA 3CKLA 4FIDA 3ZQ6A 4BFYA 3PCRB 3CX8A 1P61B 4Q1AA 2O8BA 2JJ1A 5B30A 3OEEA 2ZRCA 4PAQA 4EPVA 1GITA 4AD8A 1GRRA 1LS6A 5BWMA 1EX6A 4I99A 1II8A 4N3NA 4TQAA 3IQWA 3C5CA 2W6ID 4V03A 3VR6A 4M9XA 4IW3B 2VP6A 3KXIA 1XZPA 5F3WB 1R7RA 1XEWX 5KNDA 1IJFA 2B92A 5DH9A 2G3YA 1KO1A 2D74A 2I1VB 1BYUA 2CE7A 3M0EA 2OE2A 2BEJA 2HV8A 1A2KC 2ZUCA 5CIQA 3QF7A 2YC2C 4RZ3A 4IOLA 1G8FA 4DT1A 3B13B 4A0GA 2X1VA 4XIGS 5DGXA 4PPGA 4D4JA 4ACBA 1D9ZA 4JLVA 2FGKA 1U81A 4JBYA 4TN1A 1A1VA 1AGRA 2EVWX 4IDOA 3CWZA 1ONBA 2CCGA 2R6DA 1MABB 1T3HA 3QXSA 1LY1A 2WSMA 3EASA 4R71A 1TQ4A 2IYRA 4BEJA 3B8HA 1XMSA 3VKHA 3B2EA 3MJRA 4KVGA 4IVRA 4PZYA 5KU1A 5FBVB 2DHRA 2H7VA 4BZQA 1KK2A 2OSBA 4G5SA 4QGHA 4DLRA 3E2IA 3QVUA 2HF9A 1IXSB 1UFQA 4JL5A 2A9KA 2ZE6A 2D3WA 3RNLA 4URYR 5J4HA 4KJZA 2CHQA 3KJGA 1MO6A 1MKYA 2G83A 2QMUA 4TMVA 3TUZC 4IFEA 5KSOA 4TYNA 1T0HB 3D3QA 3WHLA 2QN6A 1DBSA 2R44A 2YINC 1EX7A 2YWHA 3MUFA 4ON9A 1OW3B 4D4MA 5C4MA 4Q7LA 1HT1E 1JR3E 2ATVA 4B6FA 5CDFE 4LRWA 5FH9A 1N25A 2IEYA 2ZU6A 4BLSA 4M9QA 1YZGA 2NPIA 2J0UB 2ZANA 2AN9A 5JI2E 2P5SA 1KDTA 3BXZA 3IHWA 1Q3HA 4IXNA 3RS7A 4XTCS 5LD2B 2QP3A 2J41A 1MV5A 4AYWA 4ZI2A 1FOEB 2OAP1 1N5KA 1KK0A 1W46A 4Z54A 1UEIA 3VKGA 4C0SA 2BMDA 4MYTA 4JZKA 1E1RA 2G1KA 1WB9A 2PMKA 2D62A 2BIFA 2WOOA 4JL8A 3UWKA 4KBFA 4BECA 4F7WA 4LYJA 2VBCA 5CB6A 2VL7A 2W00A 1GRQA 3O8DA 3SHWA 2QSYA 1T4GA 1NKSA 2F43B 4LHYA 5EP1A 5GJCA 2GWHA 1NP6A 3L0PA 1YJ5A 1JQJC 2FOLA 5J40A 3L0IB 2FMXA 3AF1A 1ZD8A 4RD0A 3U7EB 4D0GA 4F38A 4K46A 4M4SA 4A4DA 4QKQA 2QUZA 1T8UA 1Q21A 5EZ6B 4K81B 3AVUA 3QPVA 3MGCA 3SE0A 2VSXA 3PUZA 3QXCA 4L9SA 4LJAA 4OHVA 1ODFA 4YLGA 5HTKA 1XJQA 1HURA 2GETA 1GILA 1II0A 1OFHA 4RY2A 4NE2A 3NEJA 1E69A 4QBGB 2ANCA 3NG1A 2V9PA 2QA5A 1JR3D 2DR3A 1NLZA 4DDTA 1OFTA 2ZSAA 2NQ2C 1N6NA 2DFLA 4ZDKA 3RC3A 1KI6B 3W8NA 4B3BA 3GMTA 4KFRA 3FMIA 5EXTA 3KXLA 1H65A 1AS2A 2GJAA 2VRWA 1XXHB 2FE4A 1GDDA 2D2FA 5TARA 3K0FA 3MMPA 1NN3A 5IRCD 4MGZR 3I5YA 1XTQA 5CYOA 1H8HA 3W6OA 5JCZA 3U4QB 1YRBA 1J99A 1ZD1A 4LHXA 3QUSA 1P7CA 4BRWA 3RSOA 3QE0A 1G7SA 4B76A 1QG2A 4PSKA 4Q4HA 3ZYCA 4QHYA 1XRJA 1EXMA 1ZP6A 3WY9A 1GKIA 4HZUA 2IW3A 2ZSEA 3M6AA 2G88A 4IRUB 5EE1A 2F1IA 4PTLA 5TDHA 4EFLA 1HQCA 2WWGA 2WIAA 2ZE8A 5KNBA 1Z6XA 2OUKA 4WOPA 3A1VA 3UXMA 2J7PA 3GLHE 4Q4LA 5FUXA 4X8HA 4A2WA 1EGAA 4LYHA 2G1JA 4PSVA 2ZSDA 2F3TA 1SZPA 2UKDA 2ZRAA 4E5UA 1KMHA 3SEAA 3TK1A 2K5UA 1R4AA 3QG1A 5DI3B 2J46A 4XSGA 1XCPA 1FX0A 4JLBA 3DKVA 3UMRA 4DLUA 4C9BA 1VMAA 2G77B 2O5VA 1KJYA 4M1SA 3DKPA 5JEEA 4Z8YA 4US0R 2GZAA 2WJGA 2GZDA 3H84A 3LBNA 4RFSA 1ZC4A 3CONA 3PUYA 2X77A 3C16C 2V3CC 1E2FA 1XBTA 1E98A 1WCV1 1QHNA 3CUEF 4RFVA 3FFBA 3ZIAA 3QNUA 3PENA 1RIFA 3N2IA 2IX3A 4OK3A 3O8BA 3RWMB 3WP1B 4B44A 5K8LA 3LX5A 4UJ5A 4DLVA 1ZMXA 2ZJAA 3GFTA 3EZFA 1KI4A 4EPWA 1I4LD 1Q1ZA 3RLFA 4E07A 2OFXA 3B1XA 1AKYA 1EFHA 3L0OA 2PH1A 2RGXA 4HB3A 2VHTA 3BGWA 4M1YA 4S2EA 5E95A 5C4GB 5C1BA 4XVQA 3I5XA 4HAYA 1KSFX 4B34A 1XXHE 4EJSB 5IDVA 1N6PA 1GRNA 4KODA 4IVQA 4PHFA 3QF4A 4Z51A 3KDSE 1DG3A 4HDCA 4MKFA 1VTKA 1AIPA 4JJKA 4NH0A 3AVYA 4N1AA 3NC0C 3SBEA 2PBRA 4PHGA 3NC1C 1FW6A 3ZGXA 5JWRA 2KI5A 3WBJA 3H4MA 2AR7A 2IYQA 1D5CA 2QQEA 1E9AA 1SXJE 3K0EA 3V00A 1PUJA 3TQCA 1GL7A 3F5FA 3OEHD 4JBXA 1VG8A 4CIDA 1SVKA 4TYYA 1II8B 2NPFA 4M1WA 2C04A 4EDHA 1VYUA 4PC3A 3FFAA 2OV2A 3EIEA 1LNZA 4EUNA 1I4DD 4TMWA 3LV8A 2ZVPX 1Q1QA 1ESMA 2NO1A 3CX6A 4TLEA 3AB3A 2HCJB 1KI8A 1WF3A 1E2NA 3AKDA 3ZS8A 2VH5R 4HAWA 3LFUA 3LX8A 4TYQA 4C0AC 3K09A 4DT1B 4DVGA 2N42A 1BH2A 3LY5A 3REGA 2IC5A 4MRPA 5E7IA 2PMDA 4PFSA 2O0JA 1NMYA 5BW8A 1U90A 3NDBB 3GJ4A 1RW4A 2P6NA 2Q9AA 3R8FA 2ERXA 4LHZA 1K5GA 2E9SA 2BMJA 1KI3A 2V1XA 2XXAB 3K70D 4A0HA 1E9EA 1Z5ZA 1EFCA 2FGJA 5DN6A 1JECA 4Y0VA 3TAUA 1Z08A 2B6HA 2P67A 4V0MA 5ELXA 1ZNYA 1CR2A 1XCGB 1GUAA 3EA5A 2CXXA 3W8RA 2XOKD 2G0TA 3JVUA 3U3MA 4GI7A 1KZGB 2BEKA 2AWOA 3IBGA 4JLOA 1G3UA 4RJLA 4G01B 4LJYA 4Q7JB 1N6IA 1SXJD 4NYJR 5KO2A 1IN6A 521PA 3W9YA 1W5TA 1TF7A 1EFTA 3D31A 3GJ3A 3TAHA 5AUOB 2IYSA 3C7KA 3SC3A 3K0CA 4IDHA 1AQYA 1NKTA 4XWKA 1FQJA 1S3SA 2CNWD 5FI1B 5IK2D 1FUUA 2JEOA 3M1IA 4I1OA 3EG5A 4US2R 2VP4A 1L8QA 2PT5A 3ETLA 3OFNA 2ZYUX 1LVGA 3HU1A 1Z22A 3PFIA 3RRMA 3VKWA 4BLRA 3TGPA 4TZ6A 1O3YA 4A8JB 5BN3A 2RH5A 4M1KA 1E1QA 1G20E 3HU3A 1TEXA 2AK3A 2AXPA 2JATA 3QKRA 3MSXA 4BGDA 3Q7QA 3PJRA 1F2UB 3UWOA 3OZXA 3AVQA 4WAUA 3V4FA 3ASZA 4HUTA 2C77A 2ZUDA 2A78A 2HCBA 4O0MA 2P6RA 2W2TA 3TSZA 1E2EA 2W2XA 4FW9A 2WMOB 3QBTA 3P26A 3OF5A 2R9VA 1FZQA 2RAPA 2ZRMA 3LVRE 1IONA 3ZLJA 1XMJA 5JJKA 4C0QC 2ZETA 2PZEA 4EQ6A 3IBYA 1R6BX 3BIFA 3LAWA 4LV6A 1AN0A 3AEZA 3WRXC 2X2FA 3H86A 3B60A 2AWNA 1PLLA 1VYTA 2FPLA 3EXAA 3C14C 1NBMA 4NCKA 4R2IA 5L3VA 2QTVB 3GLFA 2V4ZA 3AUYA 4AIIA 4F91B 5JHGB 1UDXA 2CK3A 2DCUA 2PCJA 4NYJQ 1HV8A 1KJZA 3R7WB 5JJLA 2EFHB 4HAXA 1QDEA 1G3RA 2FA9A 1ZIOA 3A4NA 2GVZC 4G5OA 2DB3A 3R9XA 3ICQB 3AF0A 5TV2A 2ZI7A 1R5OA 5LBIA 2V1UA 2FX3A 2ZI3A 1IY2A 1WDTA 4Q5IA 1NMZA 2J7KA 1ZW6A 1F2TB 1A5TA 1OHHD 2ZPTX 1SVOA 3K0FB 4HUQA 1GZSA 2JJ1D 1KAOA 4OQNA 5FBRB 3TLXA 3OEED 1TL7C 2GCPA 2XEXA 4MYHA 1SKYB 2DBYA 4JKIA 5HZHA 3BB1A 1XD2A 2FEMA 3TUIC 1BIFA 1ZBDA 1IXZA 3TH5A 4Q4HB 1DAEA 3ZZ0A 1OH8A 4IEIA 5CLQA 2BOVA 2JJ8A 3NEYA 2O8EA 1ZJ6A 3U7FB 4FMDF 4TT3A 4LCBA 5SZKB 1F3OA 1LV7A 2ZYWX 3Q5DA 4PSAA 1OE0A 2NZ8A 2WJJA 2PX3A 4PANA 5CB8A 1XJ0A 3GLIE 4DC9A 3Q72A 5CK5A 1G291 2ZRGA 3KKNA 2IUSA 5K8IA 3ZH9B 3QKUA 3FKSA 3FMOB 4FCTA 4Q9JA 3KB2A 1KIMA 1UKYA 3VR2A 2V55B 3OAAD 2ZVQX 2F9MA 1DAHA 2ODEA 1KMHB 2IYZA 1DAGA 1B23P 3T12A 4JLNA 2HDNB 5DISB 1FX0B 4M21A 3K9HA 1NY5A 3KTAB 2JIZA 4G3XA 4LC1A 3W3ZB 4PQYA 5JI3E 1S9DA 2PT7A 1RRGA 4F4JA 2YKGA 4NZYA 1VECA 3DM9B 4C0HA 4GSYA 2QBYA 1GKYA 3U3OA 3HYTA 4DCTA 3EWAA 4C7OA 4AKIA 2AFHE 4WXPA 4JLPA 4FMCF 2B7CA 3D8BA 1XTSA 2X2EA 3OIUA 1OIXA 2QI9C 4KFUA 3WNCA 5HKKA 2ZXUA 3PUVA 5FOTA 2NGRA 1R0XA 2IYUA 5L3QB 1U0LA 4A0FA 2R62A 5KDOA 1J2JA 1G18A 3HU2A 4TMTA 4YMWA 5FPYA 1R8QA 3E5HA 1SHKA 5H8WA 1GG2A 2ZRFA 5BYJA 3RS2A 5D3QA 1Z6GA 2H1LA 3GLHA 4OQXA 1NLFA 5JZVA 4UXIA 5KNCA 4JYBA 2Z4RA 1OIWA 3AGPA 4BFSA 4JT4A 2VA8A 1E79A 2RGNC 1SKYE 3HDTA 2ZREA 1E9RA 4LYFA 4ZCLA 2ECKA 4Q47A 1KOFA 2QMHA 4B47A 1LTQA 4JVLA 1GNRA 3GJ6A 2BV3A 1RC8A 1YR6A 1YQTA 3F3YA 4M1MA 2J59A 2QT0A 3LQRA 1FMJA 1KKLA 2C5LA 4MRNA 3GLGE 4JSTA 4WW0A 2HLDD 1Y3AA 2GCOB 1UKZA 1N6RA 3CR8A 4DDUA 3DHWC 4CF7A 1E2HA 4W5WA 1SQ5A 4G5QA 3LW8A 3AM1A 2OM2A 2QSZA 3NXSA 4RCZA 2BBSA 2IT1A 3KZ1E 4NCJA 4BQSA 2RKOA 2VHJA 3BE4A 1RKBA 4MYCA 1ZM9A 4IXMA 1NVWQ 2XNDD 2FSGA 3FKQA 8OHMA 2FH5B 5TMPA 3GEIA 2W0MA 4U7DA 3UMSA 1YVDA 4P33A 1F5NA 1VG0B 4NDZA 4RD2A 4ERNA 2HUPA 3LWNA 1OKKA 2V7QD 1Q57A 3WMEA 4PPQA 1W1WA 1ZCAA 1P9NA 3K0CC 1IN4A 1Q20A 2HXSA 2PCLA 4Z8XA 2IL1A 1LF5A 2C8VA 1GTVA 2ZJ8A 5E7JA 3EAQA 1U8AA 1XTJA 1UBFA 1SVIA 3TW8B 1Z06A 1H8HD 3UG6A 4PZLA 3X1WA 2PJZA 3EZ6A 5LDDC 2CVFA 4TWZA 2YOGA 2XZOA 4J0QA 1G3IA 5KSYA 3BS4A 1OJLA 2FFHA 1W0JA 3CM0A 3FMPB 5E3HA 3ND8A 1W5SA 1RRCA 4P4SA 1DTSA 3H0KA 1E2LA 3CZPA 1XJCA 2PZFA 2W58A 2BCGY 4DZZA 3PV0A 5L3SB 2HT1A 4G5GA 1IN8A 2LKDA 2D7CA 1ETUA 3QOFA 1RYFA 2ZRIA 3AGQA 5KDDA 1QRAA 1FP7A 1HTWA 1KZ7B 3D7MA 3ZS9A 2PLFA 4LJ6A 5KPJA 4TSFA 2WWHA 1JEDA 4NHOA 1OYYA 3EIQA 1GFIA 1TUIA 2JJ2A 2QU8A 4ACAA 1GWNA 2H18A 3CLVA 3QKRB 1TPZA 2WWWA 4DUGD 1UBEA 1PLKA 3DO6A 1TAGA 4A15A 2A3RA 5EXPA 4TLBA 1Z29A 4KV9A 2JCSA 1G5RA 2A5YB 2XTZA 3EWSA 3A6PC 1OPXA 1NG9A 4OHZA 2JLXA 1QZXA 5F9HA 1VKJA 1NNEA 5A5GA 1Z6YA 1DAMA 3NDPA 3DMNA 1EWQA 1YE8A 2IWRA 5SZIA 2WHXA 1FNNA 1DADA 3PR1A 3UANA 1IBRA 5FTKA 3TKLA 4QGFA 1VCMA 3OE7D 4JJZA 1XPRA 3OHMA 4LHWA 5G3ZA 3TVDA 1VIAA 1VDZA 1YKSA 3Q9LA 1JALA 1P9WA 4A36A 3VNVA 1KSJA 1S3GA 1PUIA 1E9FA 3O8CA 1Z6TA 1E99A 1DO0A 3B6EA 3RS3A 2RHDA 3FHTA 4Q9LA 1XP8A 4CDGA 1P2VA 1KK3A 1G19A 2Y8EA 4DHEA 1XEFA 4KXFB 2C78A 4U5XA 2ZM5A 3THXB 3DM5A 4KO8A 1OH6A 3AVXA 3AVOA 1OH5A 4IFBA 2CVHA 2HT6A 1N0VC 4JKYA 1NL3A 3QXJA 3L2OB 4YMUA 1AJEA 2JLVA 2AL7A 1COWD 3A4MA 1JPJA 2J87A 3K0AA 1W36C 2J0SA 2FFBA 2FSIA 5DE3A 3KXKA 4TYWA 4LBWA 4CEIA 4MGKR 4DLZA 1JB1A 1XD2B 3QXHA 4LUCA 4AG5A 1W2HA 3KFXA 4QBHA 3EPJA 4M9SA 2R65A 1RFLA 3P1JA 1XEXA 2IK8A 4BEBA 3MCAA 1JAHA 1ZVQA 2QY9A 1M34E 4Q4JB 2O8EB 1CJVC 2W2VA 3FMFA 3LLUA 2ZJ2A 3ZQJA 2O52A 3B1WA 1BO6A 1JPNA 3B9QA 1OSNA 3DOFA 4B33A 4JVSB 2FDCA 2G9NA 2D2EA 4S35A 5J4YA 3Q5EA 1KI7A 2ZI6A 3DMDA 3ICEA 4UNNA 3TQFA 2WWXA 1X1SA 3MRSA 4P4TA 1P6XA 1SULA 4R7ZA 2QRZA 2GNOA 3BD9A 3C4JA 2GXQA 1K8RA 2VYFA 1YR8A 2OFWA 4DCUA 3KX2A 2CJWA 1E0AA 2XX3A 4ZIRB 2MSDB 3CX7A 4R2HA 5CYPA 4CEJA 6Q21A 1ZM3A 1AS0A 2GK6A 2Q9BA 3ECCA 5DO9A 1RYHA 4LBVA 3BC1A 2RGDA 3SYLA 4URVR 1QHIA 4M53A 2GA8A 4B2IA 2IA5A 4NL4H 4JIMA 4AKHA 3KJIA 4DLTA 4NCNA 4O25A 5FBQB 5AR1A 2OHFA 4UKDA 3LVQE 2OLJA 2W6JA 1E2DA 4A92A 2VTKA 4A2QA 2QBYB 1U2RA 2NO9A 5CLLA 4AYTA 3BWDD 4DB4A 4OK6A 3NBZC 4OI0A 5AUPB 1XF9A 2QPTA 1U0JA 3GEHA 4KFSA 5FOXA 4GZLA 1ZUIA 3BFXA 1EFRD 2REBA 1FMLA 3CIOA 2IXFA 4LGMA 4NP6A 5HZKA 3VNUA 2GESA 3QI2A 1Z83A 4IDQA 1GL9B 5K8TA 4EFNA 4KITB 1SVMA 3UK6A 2QE7A 3T15A 2Z6VA 4QNMA 4RD6A 2ZQ5A 1IJEA 1X6VA 1SVSA 1ZAKA 5B2ZA 2YVUA 3KB1A 5CJ2A 1E0KA 3QEJA 4DLXA 1XFAA 3AP3A 4TLAA 1Q1BA 2VEDA 3LQQA 5JEDA 4U00A 1I4TD 4HAVA 1PLJA 4GNKA 4P3YA 1ZM4A 2YHSA 3C15C 5EXXA 4C0LA 3QKTA 1P75A 3IILA 4HDOB 1QG4A 1KY3A 4AKGA 3FTQA 1P2UA 3PUXA 3A1UA 4V0KA 1U99A 3K70C 3B1VA 1US8B 2GAAA 5AJXA 2EFCB 1VHLA 1QHGA 3RRYA 3BH7A 1BKDR 1KYIA 1Q3TA 4MA4A 2Q3FA 4BFUA 1XNJA 1YZQA 2ZJ5A 3LW7A 4DLWA 4D4LA 4A82A 3ADBA 1E0JA 1R0WA 2ZE7A 3X1YA 4EPRA 3KQUA 1KDOA 1RRPA 5DHFA 2WVJA 1NBMD 3B1YA 2FPMA 2ZR0A 1SXJC 1M7GA 4ZCIA 3CRW1 2XZPA 2BM1A 4HB0A 1DS6A 4LPKA 3T5DA 2XSZA 2OG2A 2GRJA 1UADA 3EIHA 4Z1MA 5JS7A 1RVDA 3MD0A 4PX9A 3X1DA 2NIPA 5FPHA 1NLYA 1OXTA 4ZCMA 4MUAA 2DFNA 4WBSA 3CRVA 4X8MA 3VR4A 4Q19A 1T91A 4Q4AB 3NBXX 4ARZB 2H92A 3DZ8A 3MAAC 3VHLB 4AWXA 4JLDA 1O87A 4V0NA 1UKEA 3EX7C 4NU0A 3GFOA 1UKVY 1N6OA 2J1LA 4R98A 1AGPA 4CEHA 4L9WA 3HWSA 2J0QA 2VHQA 1XZQA 2VPPA 1J70A 1D9XA 4QRHA 1U94A 2QG6A 1D8TA 1N0UA 1WXQA 1NVXQ 2ZYVX 2CCJA 3GLGA 5GADl 4HAUA 3IIJA 1QHHA 3WHKA 1TF5A 5J4LA 2Q3MA 5GVSA 3GJ7A 4TT3D 4Q18A 1ZNZA 2A7QA 2WMNB 5TXGA 4ZI3A 2WSSA 2GXAA 3CO5A 1Z0IA 5EE5B 4QXAA 2ZEJA 2Q9CA 5IT5A 4OJQA 2OZEA 3EA0A 1N3BA 1P60A 2KE5A 3R8CA 2O8CA 1CULC 2QENA 4B3DA 4GOKA 4OYHA 3IO5A 1Z0DA 1TUEA 2GJKA 5JSZA 2CHGA 4HSEA 4QHSA 4UJ3A 1YU9A 2JDIA 1CRPA 2PL3A 1H8EA 5FUYA 3SFZA 4BFXA 5P21A 1S1MA 2OXRA 3O47A 3EZ2A 4DIDA 4CW7A 4FMDB 4URWR 4C3ZA 3VQTA 1W48A 3VTKA 4RD3A 3I92A 2QP4A 4CYMA 4MKIA 1BMFD 4DLYA 3VMFA 3I1FA 1TADA 4QL3A 1M8PA 1CU1A 3V4RA 3CF0A 2RGEA 3Q3JB 4D25A 4Q48A 3O8RA 3RRZA 2I3BA 2ZRLA 3A58B 3ADKA 5F9FA 1VG9B 1SVLA 1ZU4A 5L3RA 1L4YA 2CLCX 2QTFA 3WNBA 5EP2A 4OI4A 5D3MA 3HPQA 1HY3A 2ZITA 3IQXA 5AJYA 5HKKD 1FQKA 1GP2A 4XOIA 2O8BB 2W6IA 4PC7A 1ZC3A 4QC2A 5BN5A 4EAQA 2Q6TA 1XMIA 4M8NE 2A5GA 4Q9HA 2Z43A 2IS4A 4I81A 4XD7D 2C9YA 3HR8A 3DZDA 3FPAA 1F6BA 4Q1FA 2ZS9A 2QNRA 3LA6A 4UNPA 1ZM7A 4PO1A 3LBHA 3GP8A 5FL3A 1N0WA 1TU3A 4BLOA 2FG5A 2RGNA 5DYGA 1V43A 5F98A 1FFHA 821PA 2C9OA 3AVVA 1WMSA 3CR7A 4MGIR 2IS2A 2EFDB 3UPUA 3IIKA 4YC7A 2VHCA 5BXQC 3K0AB 5AK0A 1DO2A 2C03A 3KUDA 2PLRA 4ZKEA 3HPRA 3SN6A 2AHOA 1UF9A 1LW7A 2BKEA 2YNMA 4GFDA 4LJ5A 4EKDA 1XEXB 4BUJA 1KO7A 1IM2A 5KDLA 4B73A 2AKYA 2C98A 4O2LA 2VP0A 4ASUA 3S1AA 4D82A 2QM7A 1OB2A 5FBLB 2BWJA 3NKVA 2QL6A 4MDEA 1UBCA 2DPXA 2IYXA 2OO7A 4NYIR 5FR2A 2VQSA 1CS4C 2ORVA 4URZR 4YDHB 4MDFA 5GJBA 1FL9A 2QAGA 1OF1A 4GZMA 2A5JA 3U5ZB 3EC2A 4XJXA 4B48A 1WE2A 3HJNA 3P32A 4TL7A 2IS1A 1HQYE 2A5DA 1MRNA 4O2RA 2IF0A 1IN5A 4PR0A 3IO3A 1NSFA 1DG1G 1JI0A 2IXEA 3DOEA 1OB5A 4JYCA 4PQFA 3EPHA 3WNDA 4D0LB 4Q1EA 4QHTA 4DRZA 4OI1A 1G4AE 3CW2A 2ZRHA 2UVQA 1E96A 2P65A 3TJZA 3EZ7A 1XTIA 4A8JC 4GP7A 4OKSA 1KSHA 3TSWA 2WJVA 2YOHA 1CEEA 3RDPA 3LO5A 2FV8A 4P31A 1DOAA 2PZGA 4F4IA 1HUQA 1GOTA 5J4VA 4CGZA 2DFTA 3GJ5A 4Q21A 5BYKA 1W0JD 1CP2A 1WRBA 3NBYC 5FTLA 1R10A 3DL0A 1X8JA 3A36A 3MWYW 3QKSA 1W0KA 2PX0A 2WJIA 4Y0AA 1Z3IX 2GKSA 4Q9KA 4D2IA 1ZIPA 4Q7KA 1TQ6A 5E7MA 1JBKA 5JCPA 4TL8A 3W5IA 1G17A 2CLSA 3ZVLA 5F2EA 4D4KA 4BFTA 1TQDA 3U3KA 2O8FA 2JAQA 5IF9A 3G0HA 2VP2A 4A9AA 4NYIQ 1RJ9A 3KL4A 2NO0A 5CDFA 1JR3A 1KO4A 1UPTA 4DXAA 3IPYA 4B2PA 3U61B 4ZPXA 4B75A 1CR0A 2BKUA 4XSHA 2DFKB 5AUQA 4KSBA 4GMXA 1TMKA 4FINA 4KCGA 1MOZA 3R20A 3SJZA 1RPZA 4P32A 1P2SA 2FWRA 3U3JA 4L5BA 2WPDD 2UZIR 3CF6R 2CBZA 2Z83A 4PXAA 1U9IC 2GEDA 1ZCBA 4IOMA 5HCNA 2ZJYA 4LBYA 1ZRHA 3BK7A 5L8VA 3SQXA 4UNQA 2ZJBA 2B8WA 4AKEA 3W3AA 3AKEA 2UZ3A 2WWIA 5HR5A 2CDNA 1DE0A 3PVSA 4I1VA 2AFIE 1QVRA 5SZJA 1CKEA 1TF2A 1E4YA 1A82A 4NTZA 2X19A 3CH5A 1D2NA 2GJ8A 4HZUB 4IDPA 3T1QA 4OHXA 4RSGA 2V54A 1VCOA 4IOJA 2CEAA 2GF0A 3Q7PA 2QPAA 2BCJQ 2XB2A 1HA3A 2YC4C 5EQTA 1E94E 1X86B 1KNQA 3B78A 3GEEA 3X1XA 4DB2A 4LV8B 5H68A 5DI9A 4Q7MB 4V0LA 3SFVA 4EPXA 4M2LA 1RE0A 2BBOA 4HZIA 5KUTA 4ITRC 2ZJZA 5DLQC 4DCSA 3W90A 1T0JB 1TTTA 1LB1B 2QRNA 2ZS7A 4IOKA 3IUYA 4CEHB 1MO5A 1MABA 3T34A 3WXMA 1PVOA 2IF2A 4DKXA 3SU8A 4QOSA 4OL0A 4KLZA 1TU4A 2YWGA 3N2EA 3RVBA 3T61A 4N0DA 3PG5A 4XTRA 4LYAA 4LJ4A 1G7TA 2ZTSA 3QPUA 4LDJA 5EE9A 4PAOA 2IYVA 4RFSB 4YMVA 2H5EA 5BN4A 3LDAA 3U6KA 3BH0A 3A37A 4II7A 4HB4A 1T6NA 2FFQA 1S8FA 4IDNA 5G53C 3X1ZA 5LPNA 4URXR 1HYQA 2KWIA 2ATXA 2GEVA 3B82A 2LWIA 3AP2A 2O8CB 3IGFA 3M4YA 3ZVNA 5JSZB 5K8UA 5H70A 2ZUBA 5FTNA 2KBEA 3K0SA 2FNAA 1ANKA 3LLMA 4YMTA 3LH5A 1WQ1R 1XTRA 4L8GA 1FTNA 4DEYA 1CIPA 4TL6A 2W6JD 3QF4B 4A1FA 5AJWA 4LOAA 3BJIC 4NBSA 1TEVA 2HJGA 4BE7B 1R2QA 1NN5A 3TSOA 1E1RD 5DSZA 2OESA 4RVCA 3RYTC 1VYVA 4JS0A 1E2KA 2ASEA 4MRVA 5D3MB 2FEOA 2GDJA 2P5TB 2NG1A 2HEIA 4DSUA 2HXYA 1OYWA 4D6PA 4LHVA 2H57A 2CL7X 2ZRJA 2QQ0A 2VIIA 3QBVA 1D6JA 2CL0X 3ZD6A 3FGNA 4LJ8A 2P6UA 5FL7A 3LD9A 1I2MA 3CRRA 1N5IA 2CLDX 3DEFA 4B43A 2C99A 2EYUA 3IHLA 4RKEA 3VFDA 3TNFA 1XB2A 3ONWA 4M22A 2F3RA 1LF0A 3RHFA 4XWAA 1Z63A 2QAGC 1CJTC 2ZR7A 4D0NA 4GBMA 1KI6A 1U0HC 2RMKA 4Q01A 2ODBA 1AS3A 4N0EA 1VIYA 2ZSBA 1L2TA 4W9MC 1XXHA 3MFYA 2GF9A 4LPSA 1Y63A 1W2GA 1IY0A 1IY1A 4U02A 1N2CE 2J3EA 1GM5A 3SS8A 4EPYA 2XOKA 2FSFA 3SR0A 5ANRB 2F1HA 4EIWA 1DAIA 3NH9A 2B21A 4TQ9A 2ANBA 2C95A 1UBGA 1YZUA 1UJ2A 2EW1A 1YZTA 4QFMA 1HE8B 3GD7A 3HP1A 5FR1A 1SXJA 1P72A 2RHMA 4A2PA 1AM4D 4V02A 4LX0A 1ESNA 4W5JA 4QJ5A 4FI3C 5LB2A 3VHXA 4L15A 1FTSA 4C2TA 1Z8FA 3RS5A 1XTKA 4GPTA 4KVAA 1BOFA 5FOVA 1S2MA 1T5IA 4JLMA 2IHYA 5JECA 2CNWA 3AUXA 2WBLC 3L43A 2J7PD 3ASYA 3RRNA 3NHAA 3THYA 1JXMA 3TVTA 4Q00A 5DI3A 3WBKA 1KHTA 4GOJA 4M9ZA 4BLPA 1GSIA 2MSCB 1YHNA 2WKRA 4OQMA 2F1RA 1M7BA 4C0BA 1F48A 4DSOA 4YMSA 3W34A 2ODNA 1WA5A 2XNSA 4GOXA 2LKCA 2FU5C 1E2GA 1E0SA 2EFEB 4Q9IA 4R9UC 4BPBA 2YWEA 1T3SA 3QENA 4QBFA 3F8TA 1G6HA
chains in the Genus database with same CATH superfamily
3ESDA 1O5IA 1PL7A 3N5CA 4YCBA 3NC4A 1W8DA 2HIHA 3NVAA 3PFWO 3WLFA 2VDNB 4YO7A 421PA 1NVAA 5C81A 5LWHA 3IX7A 3DFIA 3E61A 3IAM6 1T2UA 2G28A 3RYHB 3SX0A 3ZIAD 1YC2A 1AQJA 4M0LA 4N40A 2Y67A 4D3SA 3K05A 1XQ1A 1WW8A 4FT4A 3T06B 1XWFA 2JBHA 3BTUA 4Z4IA 2YVQA 2OENG 5HYVA 1DV2A 3I2GA 2CV2A 4AU1A 4Q02A 1MT3A 3BF7A 3EMVA 4JL6A 3ABQB 2JLRA 2O0KA 3T7EA 1Y98A 4IJQA 3EW9A 3D3JA 1M6HA 1NMSA 4FPXA 3LCUA 4MSUA 4NNOA 3REQB 3OKPA 5DXAA 1K6JA 4PCAA 4W63A 3TOSA 3V1UA 4Z86A 2OKCA 3U6BA 2P75A 3GRFA 5A6SA 2PUFA 1IN7A 5JJ5A 2XY4A 2AOUB 2QPOA 4BJ1A 4MAFA 4ZAFA 1FNMA 4BPRA 1U2GA 5HPYB 2ECOA 1SQGA 3UXEA 5CCDA 3BK2A 1Y8QA 2ECPA 4OJKA 2Q9UA 1MT0A 3UXYA 3VTAA 1CJKC 3KQWA 3GUVA 1LGYA 3BFJA 2H11A 3K2IA 1QGYA 5F12A 1C8LA 3GH1A 1GL6A 1LEHA 2Q0HA 1W6RA 3QX7A 1M7HA 1H2YA 4MVJE 1REQB 2D1SA 1E3TA 5HILA 1G5HA 4GWKA 5JISA 2W0SA 3W5JA 1UJ5A 4GGMX 1YTUA 1GPUA 3DV2A 3A0UA 3KB8A 4EAQA 5JY6A 4ESVA 3OEYA 4DBZA 2YV5A 1MZVA 2FW1A 2ODWA 1NR1A 3HVJA 1A8HA 2IYLD 1WCYA 3OAAA 4AAYA 1EVKA 2CDCA 4U63A 5I7VA 1ORTA 4YCNA 1I32A 3GRCA 5GTDA 1RIIA 5I6DA 4LAFA 2NU6A 2AK2A 2AKEA 2JPDA 2Q45A 2XKKA 1V8BA 3RWOA 1FUIA 1RQXA 2ZJOA 3A32A 4KN5A 2Y68A 4PG5A 4UASA 5K99A 4FCCA 4RXTA 1IVSA 2XXAA 5DYTA 3ZLVA 3CVWA 5ALKA 3VYSB 5K45A 2PEZA 1VPLA 3CPHA 3P9XA 4B84A 4W82A 3ZV4A 1UOQA 3Q7IA 3SDZA 1GL3A 2OBLA 4E12A 1G8AA 5LD2C 3SQWA 5C3UA 1M6NA 2IEDA 2GK7A 3RKUA 1XZLA 2P77A 4DKJA 4WACA 4CG0A 3SF8B 3M2TA 1EUYA 5DN6D 1FFYA 4R69A 4JB0A 1UFOA 1CR6A 3NBKA 2HQSA 1KJJA 3LS2A 1S4QA 1FP6A 4FR2A 1P81A 5JLJA 3ZQ4A 4DZTA 2B3TA 3GLFE 5L4NA 1P7YA 4X1IB 1XDBA 2Q4RA 2C5HA 3FPFA 4C7OB 4QBIA 2F3PA 2BE9A 3B3JA 1J5XA 1M66A 3ER6A 1QHEA 1S89A 1W581 1K5PA 3LRXA 3OE4A 2L19A 1RWVA 4HZGA 1OGIA 3BTOA 1I13A 4O29A 5AVZA 1QV9A 2ZROA 3DDOA 2E4ZA 3HR7A 1C4OA 3AOEA 2FQXA 3MWDB 5TQJA 2RE8A 2QTAA 3TQTA 1PDOA 3HCRA 2SKCA 2OXCA 4JJAA 1TRKA 1XTUA 2EWVA 4JSYA 2EATA 2AOTB 3K1JA 5ALGA 3HA5A 2HGZA 1ABFA 1OXUA 1QBKC 3BOSA 1R4MB 1VSVA 2LTAA 2NXCA 3M33A 2QRKA 3R3UA 4JBIA 4GX2A 4PBRA 5IDYA 2YS6A 1WHTA 2ZT7A 3TTVA 3GLIA 3WTBA 2BM8A 1Y82A 3H65A 2WICA 4MW9A 3UCFA 1C3XA 4L78A 5FUWA 5JNSA 2AX4A 1QF6A 3VR6H 1WR8A 2FSVA 3E9CA 3SJBA 3H1PA 5CX1A 3TEMA 5I3CA 2EZTA 2PAAA 1D2MA 3JRNA 2VPYA 5FD8A 1A27A 2VP3A 4JNKA 2LRHA 1K5DA 4OXQA 1TVMA 1P0PA 2NUPA 2GUGA 4PX5A 4BNFA 1G38A 1GGNA 2JHPA 2Q2VA 1BDBA 5IAOA 3SVTA 1KBOA 3DZIA 4ZV4A 1GPNA 3H9BA 4D80A 1CD5A 1T34A 3QU4A 1YA6A 3PEFA 4E46A 3BMQA 4Q3DA 2DU8A 2ZVDA 5GONB 4AYXA 5IXSA 2C5GA 3DNFA 2O23A 4TKMA 3O26A 4FKMA 2OUIA 2QTVA 1E8NA 2D4HA 1PJZA 1P9RA 1K8ZB 2QR2A 3RAFC 1VA4A 5D2CA 5ALZA 2WT8A 1DL5A 3ETHA 3I9LA 4U2EA 4IHJB 1MC4A 3LKZA 1HM5A 3SP1A 1LBHA 2HGSA 3FZEA 5DHSA 2R6GA 3FDIA 1SBIA 1P3Y1 4G0NA 1YOVB 3TQRA 4CRWB 5K0GA 1KFJB 2BUAA 2MMGA 4MVJF 1QH8A 1GRVA 4HNAB 2RCNA 4DOMA 2O54A 2R84A 1ISGA 2ZAMA 3L7KA 1VPEA 2H16A 3KP1A 2ZU0C 3R3JA 1D2CA 1FDUA 4NJMB 5F78A 2CE2X 1Q7CA 2C7OA 1MMFB 1RKQA 4RJJA 5IARA 4BVHA 3THWA 2O2JA 3IEVA 2RKBA 5JOQA 1AUOA 4AK9A 2HY7A 3E9NA 3UEOA 1EM6A 1NOKA 1TKBA 4FGKA 1Y7HA 3QLTA 1NMEA 2I1QA 5HDQA 1TE2A 4FXPA 3SE7A 3SOPA 1QTQA 3GGPA 4ZQEA 3GP3A 3QY9A 5D3KA 2GS9A 1TCAA 3W6PA 4ZO6A 4B81A 1L4HA 3ES9A 2I03A 3UJPA 1Y37A 3WOHA 3DWGA 1SXJB 1Y9AA 1CUSA 2AC7A 2CF5A 2IU3A 2OWEA 4PYLA 1BFDA 1JSZA 2C8LA 4XWTA 4I1UA 6YASA 5K0LA 3K4HA 1G9SA 1QNLA 3O2NA 3ZIDA 4R1NA 5IX8A 5CLHA 4N76A 2HQ1A 1JVBA 1JDVA 3Q3HA 1DJQA 1Z3CA 3PQ7A 4ALJA 1IBKB 2NMVA 2JLQA 4KFTA 3EK2A 3N28A 2IODA 3VU0A 1ODLA 2O48X 3L8ZA 1V7ZA 1ONNA 3IODA 3JWEA 4QQRA 4XEHA 5AHWA 1I36A 3OQHA 5UKDA 2ZBRA 2I99A 4IY1A 4ZJYA 3KCNA 3LFTA 4RJIA 1CUJA 4BO9A 3PX3A 4G1MB 4G5FA 4C2AA 1Z8HA 4LMAA 2AGVA 3CFYA 3Q9UA 2ONKA 4EHDA 4W8OA 5A5FA 5EP4A 1HT2E 1KH3A 2HJ9A 4EJSC 3BSFA 3FUVA 5FV7A 2PGXA 1KMMA 2VZLA 3H1TA 5CFZA 4UVHA 5IN5A 5IYZF 1UKCA 3GJ8A 1XWIA 3EXIB 3HUUA 4QULA 1DKMA 4ED9A 5LLTA 4PLYA 3ND6A 1AQNA 2NP6A 2R6AA 3VSBA 4FYKA 3T5CA 4CT5A 2EKLA 1U3WA 1LPBB 1P91A 2WM2A 2ZWIA 2V6BA 2R6R1 1ABEA 2KJQA 2PDAA 2HPZA 4REOA 4RIIA 3BERA 4E4RA 4WFKA 1PV4A 1EM8A 3OE7A 1QQ5A 2PYZA 4HKTA 2IUUA 3S2IA 1X19A 1TGYA 1KDVA 2VUSA 2HNBA 3NTLA 4ZO9A 1OX4B 1TJPB 2C9MA 3GVHA 2F6RA 4RVUA 3T1VA 4RDCA 1FMTA 1B2RA 3WK9A 4AMVA 3KHTA 4BBPA 4BRSA 5KYKA 3LU1A 4YUXA 1YR9A 3F9CA 2QRMA 3QJGA 5JPIA 3Q3CA 2C58A 4GSKA 4LC9A 4S1WA 3JZIA 4WVFA 3NVMB 2VTBA 1XU4A 2XUAA 4BS9A 4DMRA 1AMNA 4MAAA 2J48A 4X8LA 4YB8A 4A0RA 3R0VA 1HDEA 5A6SB 1HI9A 1Q2XA 2FF7A 1E79D 2WK1A 2IIBA 4GH5A 2CB0A 2X1MA 2GXSA 2OP0A 4E03A 2OZPA 4R31A 3HUEA 4DZRA 1QU3A 1VLHA 1V5GA 5EZ5A 3ZCSA 4F56A 4EATA 1AKVA 1GIAA 1U0FA 3MFQA 4EKEA 1Y8QB 9LDBA 5CA0F 1YZNA 2H63A 2O1WA 3IDSA 1X3SA 4UW9A 5FXMA 2PUEA 1G20B 2XIQA 4JODA 1T10A 3QVVA 5C53B 2FPOA 2PO7A 3U81A 5F3DA 3J7AC 1EUQA 1XI2A 5ADWA 3WB2A 3UHAA 3GCDA 1HLFA 3HYNA 5TPWA 2VDOB 3ZE0B 1LA2A 1OXSC 3OT4A 2XR1A 1ULHA 2R11A 4IIYA 1FBTA 2ZULA 1C0LA 1UDBA 3IMCA 4JLAA 3V1KA 3RIHA 4DM3A 1RM0A 4CV3A 1O9BA 1A8IA 1JHXA 3DE4X 3WLKX 1QFSA 1CY1A 4HEJA 1KWKA 2DLCX 1CXZA 3I04A 4PNPA 3GV0A 4CDMA 1MUUA 4R1SA 3ZEAA 4IXWA 4XGRA 3U7GA 1QHYA 3VKFA 4FOPA 4G5RA 1GSAA 3HH8A 2QXYA 4QU5A 4D8TA 3OZRA 1GAEO 1Q0PA 3IXMA 5EJGA 3GY0A 1RHJA 3H5VA 721PA 1IY9A 1XCMA 2CJWB 3KV1A 1HYGA 4B0PA 1QHXA 3TCKA 4C21A 2JD2A 2VF4X 2YN2A 3OEWA 2IUTA 4DM4A 5CD9A 2MIIA 3I6YA 1M2GA 3RRJA 2G72A 2GCNA 1TLLA 2OC4A 1EFKA 4I5IA 1IXRC 3BORA 3DJFA 3NW9A 2A30A 4BX8A 4OY3A 2RGGA 3ZBQA 5EP3A 2JAHA 2HF8A 2QROA 2WKPA 5CVCA 3P97A 3F49S 3K96A 1AO3A 4JVMA 4MH0R 1F0PA 5LWQA 3TKAA 3B38A 3QU2A 4KAXA 3TR0A 3WJ7A 1YBFA 1R0YA 4FQ7A 1EFRA 1WF6A 2VH2A 3HDVA 1VL1A 5C34B 4PYJA 1J33A 3CGGA 3FYHA 1T2DA 4JENA 5JZMA 1PWZA 2EDAA 3EGIA 2NZ2A 4URUR 4RTKA 1NC3A 4YRFA 2VNSA 4H1UA 4L57A 1BGVA 2O8NA 4FFBA 4YREA 2CZCA 4FFWA 4H6VA 4ZZ0A 2GYVA 4KHPB 2R48A 2AYYA 2V4MA 2QMZA 4TMKA 4UCWA 5HS4A 1NW6A 1W59A 1BC5A 2RG7A 3AYXB 5FWDA 1SVWA 5FNVF 1Z4OA 4X7BA 4LNHA 4PN7A 3DQQA 3OMXA 3OTGA 1CJCA 3WWZA 4CIBA 2PKWA 1DHTA 3GLIB 1NDUA 4RTMA 4IIGA 4F4DA 3TVYA 3L07A 4MRRA 1HTBA 1AXRA 1WUYA 3DEKA 3VPXA 2JK0A 4DBVO 1Z0FA 3OWXA 2A9OA 1USVA 2FLWA 1E2PA 3AO0B 4QDJA 3VU9A 2NU8B 1WMBA 4E3ZA 4EY7A 5ITWA 4NV0A 2YHBA 1DWPA 4KOEC 2IEZA 4ALKA 4PX3A 4J0KA 3N6VA 3ETNA 3RARA 4U6SA 2Y6VA 3I0MA 3W4IA 2KBFA 3EOAI 1U5BA 3F8SA 5B36A 2NYVA 4M9UA 2DWOA 1YZYA 5HP4A 5CDGA 1QU2A 2HA6A 1L5MA 1CZUA 1ZJJA 4BEWA 4OPMA 1FFGA 2MYNA 2RONA 4LTNA 4C2BA 5LZ2A 1Z25A 1P77A 1HG1A 2QOEA 5PNTA 4DW8A 3KQLA 4Z99A 3GPLA 4N6NA 4GR4A 3RM3A 5JIBA 3TAXA 1O54A 3G5UA 5EJMA 3ZZUA 5BUCA 1KS2A 4PPYA 4RVDA 4UTOA 5HCIA 3I9KA 4PQGA 3TNLA 3SIPA 1XCBA 3FDZB 4PG4A 3UAVA 4DAEA 3E3MA 4LJSA 2XBUA 3K7EA 4YI3A 2KMLA 2JLYA 4L02A 2QMOA 3EXHB 3QIAA 3WK4A 2J9RA 5C46F 2FFRA 3MTDA 2OYSA 3KTFA 4IHKA 3L6OO 1DO8A 1V7QA 4LDPA 4FHDA 3R3ZA 1QH8B 4I8XA 2E21A 2NYUA 4HDMA 4YONB 3AV0B 2DWQA 4EMUA 4RV5A 3KJZA 4KO4S 3USES 2I8LA 3DFFA 3CEPB 3JRXA 2YOFA 3THWB 2CY0A 1N2IA 4KI0A 2V8OA 2P8SA 5HJ2A 3WWCA 5AYVA 1N2XA 221PA 3M5WA 4IJ5A 2LR0A 3RABA 1BTOA 1G9TA 3CW9A 3QELA 1GVNB 5JRJA 5KQGA 3ZCXA 4UE6A 1G42A 1JQLB 2BGNA 1E6EA 2X9QA 4ZO7A 3ZU5A 3F7TA 1NQAO 5JZSA 1WBDA 1P7VA 1UCFA 3RFTA 4TTPA 2AT1A 4QXMA 1ILWA 3GJXC 5U4XA 4BZXA 2PN1A 4C43A 4GDFA 2HRBA 1MN6A 4GT1A 4CMJA 4EL5A 4KQFA 3OSZA 1ECLA 1L5HB 3PUIA 3EPKA 1QK3A 1OLOA 2K87A 1YU6A 3EAGA 1QHHB 1VOTA 3T9AA 3R5XA 5F5NA 5C8DA 2YDYA 2V7XA 3PEYA 3WYNA 4FYWA 4KYIB 2JZOA 1IOVA 2ISCA 4S1VA 3B85A 4H7IA 3AU9A 5BSRA 2VCYA 1PK9A 2ARKA 2DHDA 5CURA 3NWPA 5L45A 1N7JA 2OR3A 5CH8A 1JQDA 3PXGA 1CRQA 3L8YA 1A8PA 2NTEA 1LBIA 4EYSA 2HU7A 2J0UA 3N59A 5T57A 2LCFA 2TRSB 4ROTA 1C41A 3HB9A 5ALXA 4BVLA 4EP1A 1HDXA 3QYFA 2AD1A 2GHTA 1J00A 3H9JA 2FPRA 3KOOA 3KLBA 2WWVD 4V0RA 1VP3A 1XYYA 1PE0A 2O0MA 2V7GA 5CW1A 1VLLA 5LZ8A 3UOAB 3S5UA 5AM1A 1KEEA 3FZGA 4QJ4A 1S7CA 5HE8A 3D3NA 3RJ9A 2BTQA 3IB6A 2AE2A 2JI8A 5K3EA 2GM3A 3VPBA 2Y05A 4GI2A 4YAGA 3HZRA 1MIOA 6NULA 5THQA 1CUDA 1CUEA 4DIMA 1HZJA 1Z47A 2ORWA 2R8RA 4LY3A 1H9BA 1QH1A 1UDWA 3D0QA 4NZPA 3ND5A 4KQ2A 5NLLA 2IYTA 1XQ6A 4AMZA 5E2IA 5J47A 4ZVUA 2FN7A 2HJHA 3S28A 4V1CA 1H2FA 3EGDA 5I8ZA 2OV1A 2BI8A 4PGGA 4YP6A 2QL5A 1YFJA 1TNDA 4B32A 4RMHA 3CWQA 1GTG1 2IZ5A 2Y1OA 4XD7A 3ZWYA 1J8MF 3PXEA 4HYYA 1KSGA 5JU6A 2GTPA 3COSA 3VH3A 2OCPA 3KOYA 4UEOA 5F1PA 1OLSA 2GVDC 2HBQA 3K31A 1VB5A 3N8NA 4E51A 2PSEA 1YRAA 1Y6FA 1KXJA 3W04A 2JIBA 2ZTUA 4FMBB 3FOWA 1KZ9A 2Z1MA 2VTBB 1QVZA 3VC2A 1ST2A 3Q2IA 1SHZA 1DLJA 4LIPD 2QUJA 3WDLA 1J90A 3ZI7A 1AZSC 4YO8A 1XMOB 5TS3A 1QP4A 1PFUA 1YR7A 5ALNA 3Q8XB 5MGNA 3K09C 3KSZO 3R5SA 4AY5A 1DCTA 2BGIA 4FCWA 2QWXA 4KIWA 1Z4MA 4A8HA 5LJIA 1LK5A 2QMQA 3A1TA 3G2JA 1Z8DA 4XAQA 4NCIA 1US8A 2WZQA 5IVIA 3KQHA 4D8UA 1J5EB 3F78A 3JYHA 3DAHA 4TUYA 4K28A 4MQ5A 1Z88A 3DDNA 2VQDA 3HKEB 5AKZA 1BXGB 3EGOA 3KSAC 2LCIA 1L5GB 4D9NA 1JMKC 1HDGO 1MXFA 5CHYA 5FOWA 1Y1TA 3FNIA 1Z0JA 4GQIA 4POAA 1BW9A 2OK7A 2FJUA 5G0SA 3UJ7A 1KA9H 2EG5A 2RJOA 3DGFC 4NONA 1EUDB 3DT8A 4F6RB 4RZUA 1G0OA 2YFQA 4B6GA 2ZVJA 4FP9A 3B5JA 5JXWA 2R85A 5EJ7A 2PUGA 5JAOA 4MCIA 4WI1A 5ALHA 1XUOA 5DX0A 3S1AB 3I62A 2QE6A 3K8QA 3Q85A 4M9CA 2OYCA 4G4IA 2DY1A 2IHBA 5AKGA 1QR6A 3Q12A 1ODTC 3D81A 1Y8RA 1QMGA 2W83A 3UYLA 3AVPA 1GSOA 3DBHA 3MB5A 2SCUB 2CMGA 1KMQA 2MTBA 3KQNA 2H1VA 4F2DA 3NKLA 1M5RA 2B37A 2OQ2A 5DU2A 2XSZD 2NTVA 2I3ZA 4H4DA 4OIFA 3HFJA 4PO8A 4RD1A 5TB5A 3TD2A 1IQRA 4EBFA 5BPFA 4QGAA 2IBMA 3KDPA 2N46A 5C7OO 4C6RA 1JKIA 4PTZA 4UTXA 3LUPA 2WJYA 1EWRA 3I32A 1SZCA 4ZQBA 2F3QA 4AJIA 3OZBA 2QXTA 5A4JA 1V1MA 4J7AA 3GBSA 4JT2A 4LHEA 3NTVA 4L8WB 3QFSA 4XDHA 3COJA 4JCOA 1U8XX 4R0VA 2JFXA 3D4BA 4A6DA 2B9EA 4MVJI 3JVEA 5KCZA 3FHJA 3PGA1 1PG2A 4A7PA 2NO5A 2EZUA 3NHKA 3KYBA 2C8JA 5JBNA 3BH6A 2QZ4A 3SLRA 3FPBA 3GEBA 3DV0A 2C5FA 3E9DA 1AZTA 2EKQA 3HABA 2EU8A 4I6JA 2C2KA 5C18A 4Q0MA 3QEAZ 1TVCA 3MCTA 2ZI9A 3CS3A 2XUZA 2KB0A 1V95A 5FA6A 2HO5A 5CITA 3LNCA 1CFZA 2H1IA 2QPLA 1NF9A 2WRZA 4FFBB 5A05A 1Z0KA 1UZAA 4MVYA 5B57C 2ZYAA 4QG7A 1GNLA 3MQ2A 3BD8A 4L2IA 2CSXA 1FUYB 4UNRA 3UMGA 3C5WP 3UJDA 2HJRA 1E9CA 3K4PA 1Z2EA 1J6UA 1PG5A 5IT9A 4BQNA 3AEUA 4H27A 5KKNB 1YKFA 1GR0A 2XQGA 1L4FA 2XTJA 4UXHA 3RRFA 4CKYA 4ENTA 4KR6A 2O8FB 3RODA 4GC5A 4BE9A 1MO4A 1THTA 4XCVA 2XE4A 3C7CB 3UH1A 4BLQA 2F7SA 4MVJM 3O8NA 3UMYA 4B35A 3VU9B 1RJ9B 2IIVA 4X6UA 1AF7A 3SLGA 4EJSA 3ZHZA 1WD5A 4OLHA 1PGNA 1Q17A 5A4DA 3HKBB 2NO6A 2QVYX 4TLCA 2IBSA 5IAGA 5F4BA 1U5BB 1IUNA 3CSSA 5JMWA 4MUFA 4GRAA 1DQPA 3OZGA 1F8GA 3GAFA 4ZOEA 2Y1EA 4BQEA 4YYZA 4ZTZB 3BCUA 4ARSA 3GMIA 3AKCA 1I7QB 1U9ZA 4OHPA 4R3UC 3OZEA 2FTKE 5WRFA 1JG1A 5ARDA 4EI7A 4LV5B 4CTOA 1RQGA 3CKLA 3CH7A 5AXCA 3ZQ6A 3PCRB 3CX8A 1P61B 4INPA 4OJMX 5HIJA 2JJ1A 3HSYA 4NS1A 4U4AA 1NW4A 4JSRA 4LOLA 2O8BA 3GGSA 2IIPA 3UAWA 2ZRCA 5DK4A 1PQPA 3O93A 5IAEA 2C42A 3H1FA 3IALA 4E2WA 5BWMA 1J9ZA 1SCAA 1CUVA 4TQAA 2HBYA 3BIJA 1L5ZA 2YHIB 3TRKA 3S55A 4MB6A 2WD7A 2WYWA 1JL3A 1ZXLA 1FA9A 4ZAGA 1Z45A 1LU9A 4QGSA 1FNDA 4OYYA 3N05A 4QQ8A 1XGKA 3COYA 1PJ3A 5U1PA 4EZEA 2XUKA 3P45A 2B92A 2G3YA 1KO1A 2D74A 4FR0A 1BYUA 4QSMA 5JR3A 4YRGA 1A2KC 2ZUCA 4HDMB 3QF7A 4IJVA 3DYIA 2X1HA 1G55A 5EWMA 2X1VA 1B74A 3TLCA 1T0PA 4J1NA 4Y6QA 5DGXA 3TSAA 2B8NA 3VH1A 2WE7A 3PQDA 4DQVA 1SXPA 4P1ZA 3LUBA 4ACBA 4DXHA 4RK1A 1AQLA 4JLVA 4MLPA 3TN7A 1YASA 1ZNQO 1QZTA 1CY7A 2J4CA 4R54A 4NZZA 1N2ZA 2QLBA 1AGRA 4ALIA 5EIEA 1X7XA 3PI6A 2GN1A 1JMVA 1SUPA 3ECSA 1FSZA 5JH7A 1SBZA 1F0KA 4GD3Q 3QXSA 5K0CA 5L53A 3EASA 4FDMA 1TQ4A 3B8HA 1XMSA 3MJRA 4KVGA 4IVRA 2PS1A 2YNMD 3IVXA 5FBVB 4BZQA 2H7VA 2OSBA 2O5RA 4G5SA 2Z98A 4TPKA 3PGLA 2XWSA 1IXSB 3G2IA 1TO6A 1DQNA 1O6BA 2WKSA 2DPMA 4JL5A 2W43A 4LOKA 4TV9A 3RIGA 5J4HA 2FWAA 4X9XA 3L7BA 2CHQA 2H9IA 3OICA 4BMNA 2FPUA 2G83A 4TS3A 5F73A 5J2UF 3GHHA 3B6KA 2FP3A 1RTTA 4IFEA 4FR5A 3IFSA 4TYNA 1QOPB 4LXGA 4NXMB 1DB3A 3WHLA 2QN6A 3NALA 4D4MA 3BL8A 3MUFA 5C4MA 5C7LO 1HT1E 4HFRA 2IEBA 3OLYA 4L6IA 3GF4A 1R4ZA 2IEYA 2ZU6A 3P71T 2R7NA 1JGTA 3DZHA 1LLFA 4BLSA 2NPIA 4EHFA 4F5EA 1CSEE 2J0UB 5BWCA 2ZANA 1FY2A 1T9ZA 3QE3A 1C5KA 3AIIA 4FS8A 5JI2E 2TMYA 2YZKA 3IHWA 2JLBA 4IXNA 2P3OA 1SPXA 2V58A 4QU8A 5LD2B 1G98A 1T5TA 3HV0A 1GTJ1 1KEEB 4MVJP 4OM7A 3WO0A 1ZJ5A 3NHYA 2B2XA 1HT0A 4TTAA 4JUCA 4Z54A 3N8GA 3VKGA 3F6PA 1F9AA 1O4WA 4C0SA 1R00A 1P4AA 4OO3A 3AESA 4QX6A 4MHTA 4JWTA 2R8OA 1Z68A 2YQZA 3OWOA 2G1KA 3SWWA 2ZJFA 3BHNA 2C31A 4H7PA 2NVOA 4OJNA 4GAEA 2XQFA 2OFFA 5CB4A 2WOOA 1QH1B 4DJAA 1URPA 4KBFA 1J39A 4CPDA 4F7WA 4XDZA 4QPCA 4QQKA 4NBUA 3ITKA 4V1CB 3O8DA 4H0FA 1CC1S 4HPJB 4LHYA 5BWBA 4LCJA 2D8MA 2I2XB 2HBZA 4DN6A 5J40A 4E7PA 2AE1A 1ZJWA 3NX4A 1T8WA 3CIFA 1DOZA 3DDUA 4P35A 2IY8A 2Q2WA 3AWDA 1Z5GA 5BNZA 4HPWA 1OLSB 2PVPA 3DTNA 2X5NA 3LPAA 1GG5A 2Z2IA 4ZT7A 1ESEA 4A4DA 1A98A 2H52A 4BQRA 2VPIA 1H2XA 1T8SA 1Q21A 2XMRA 3KPJA 3IULA 4XFJA 2HREA 1M8GA 2DBRA 1C80A 2V9CA 3L6RA 4K81B 5EZ6B 1B26A 1WVMA 1Y6RA 3QXCA 4NNPA 3R24A 1ODFA 5HTKA 1B16A 2TECE 4F8JA 1HURA 3S44A 2NVBA 3FPLA 3N86A 3WFJA 3HFGA 1GEGA 4D9GA 4R2MA 4WZBA 4ZICA 3BRQA 1W5BA 4B79A 2QA5A 3GO4A 1BE0A 1EUCA 4YJ2F 1OFTA 1CZHA 3DAOA 1C0EA 5HWSA 1N6NA 2DFLA 2ZBEA 4PS0A 3WC4A 2VQFB 1FTQA 2C7GA 4J9UE 1MO2A 2HUNA 4KFRA 1V1JA 3FMIA 2PD3A 1NE2A 1T2AA 4EMBA 3H8VA 3KXLA 2Z30A 2VRWA 3EBLA 3IP9A 4HR7A 1R0SA 1SUSA 1XXHB 2FE4A 1BW9B 2D2FA 3FOAA 5TARA 3K0FA 4MO2A 4MV9A 5HEKA 3IJPA 5EMLA 2VSQA 3GZ4A 3I5YA 4U7JA 1XDWA 1XTQA 5JCZA 2COUA 2GPSA 4D3YA 4N5DA 2WHRA 1BJKA 3GLUA 3QUSA 5DLPA 4PGFA 4DWOA 1YZFA 1JX6A 1QG2A 2YUTA 4XYBA 4ZARA 4Q4HA 1S6YA 4QHYA 3ZYCA 1XRJA 2PS0A 1N77A 3NMUF 4MI1A 1GKIA 5ILOA 2IW3A 2MWMA 3CX3A 4NABA 4QPPA 5EE1A 4A3SA 1L4KA 1IHPA 1Y8RB 2C57A 4I9NA 1JTFA 3WWDA 4H3KB 1P1JA 4XCQA 1DAPA 2V3WA 4KWTA 3A1VA 4ATNA 1I94B 4H7FA 2GPYA 4U2GA 3G0CA 3ZDXB 2OHGA 3GLHE 4Q4LA 5CA1B 3OWHA 2AN3A 3A7EA 1P4RA 4HX5A 4A2WA 4N7BA 5K3OA 1E63A 4G8JA 1XMXA 4YCMA 5J23A 3GJRA 4KV7A 1KMHA 1V1MB 2WIGA 3JYQA 4WY8A 2IYOA 2WJPA 4G07A 4U3JA 5DI3B 3W1EA 4W6ZA 1FX0A 3GFQA 4JLBA 4UDOA 4EJ6A 1FFDA 3UMRA 1AUXA 5IT0A 2DPGA 4JB3A 3GFBA 1PD1A 1RS0A 3G0OA 1YS2X 5AOAA 1PYGA 3CZ4A 3W06A 4CI0B 4AJJA 3ELWA 1C3LA 3NTOA 2IQIA 1CETA 3DV0B 6ADHA 1GGJA 2VXCA 3PUYA 2X77A 1EVIA 5CPFA 4EKNB 4HRVA 3A1DA 3L0BA 2QN9A 4RS4A 3CBGA 4RLQA 4D44A 1QCCA 1ISPA 1NNLA 1R50A 1YGPA 2H5JA 3EFEA 4OH1A 4C29A 3QW4B 4L2IB 3N2IA 2IX3A 4HXEB 3RWMB 1GUFA 2WM3A 3WP1B 3KDAA 2BKVA 4B44A 3LX5A 4UJ5A 5K8LA 3AEUB 2X9NA 1ZMXA 1L5QA 2ZJAA 3QVGB 2V96A 3GFTA 4CM4B 4RJTA 3D6VA 5KVVA 3T9CA 3A2KA 1I4LD 1NXVA 1JFFA 1HT3A 5CFLA 3LZ6A 2OFXA 2PH1A 3AJEA 3HR4A 2AG1A 2WNHA 4L5AA 4M1YA 2P1ZA 2Y71A 1E3IA 4XVQA 5CGZA 5K1ZA 5C4GB 1KSFX 2XUHA 3F71A 4EJSB 1X1BA 5C52B 2B4RO 2M2IA 1GRNA 2JAUA 1C29B 5ADVA 3ETEA 1UM9B 1N0HA 1CFJA 1DG3A 4LSWA 3OIGA 4TS4A 4MW2A 4YRTA 3AVYA 1XZJA 4YGXB 4F12A 1ZKMA 4QVGA 4N1AA 4WCVA 1LTKA 1NAHA 1E61A 1M1ZA 3A6ZA 1DKUA 2AMLA 2I3DA 2PBRA 3FTCA 4X7PA 3OZ7A 5JVDB 4C7MA 3ZGXA 3DHYA 1Y7IA 3RFFA 3G8AA 3H4MA 3VJMA 1XAJA 2H2DA 5JWRA 3RR2A 1D1TA 1E9AA 3PFBA 3P0RA 3HDGA 3K0EA 3BGDA 1Y0BA 3V00A 3TQCA 1GL7A 3KSRA 2P9BA 2R5WA 3F5FA 3BQ9A 1YXMA 3BRWA 3QNMA 4FN4A 4TYYA 3G3EA 1PGOA 1QFJA 3A9UA 2NPFA 1SG6A 3B1KA 3DUFA 5DNWA 4I4IA 2VJPA 4NK5A 1VYUA 2VHWA 5LLDA 1E1KA 4EKIA 3KAJA 4Z2AA 3GU3A 3LQ4A 2JFGA 3WZ2A 1U7XA 4G0UA 3GOHA 1I4DD 1Y89A 3G89A 4FYXA 4TMWA 5JPDA 3DE2X 1Q1QA 4KGVA 1FJ2A 1E20A 2CL5A 2HPAA 2JAXA 4LXUA 4PLHA 1OTHA 5DP2A 2AIRA 4H3HB 5J2TF 3UUWA 4BYMA 3AKDA 1MB0A 1W35A 1MORA 3G5AA 3TQIA 4UAVA 1BE8A 4EO9A 4IJKA 4AUNA 4RFLA 3K09A 3IAHA 5K5EA 5EWMB 1L7AA 5ULLA 3HQ4O 2ERCA 3AJRA 3REGA 5KWIA 2IYAA 3PNMA 1ZZEA 5BW8A 1U90A 2WYHA 3GJ4A 4XGNA 1HBJA 1L4MA 2P6NA 3F1KA 3LCMA 2GN6A 3OC0A 1INLA 4KPUA 1X7XB 3B5IA 2E3JA 4P7GA 4RE5A 2V1XA 3LHDA 4L08A 5EOVA 3ZWXA 3ZWOA 3K70D 2UYOA 4A0HA 1JJFA 2OBXA 4G0YA 3WMWA 5DGCA 1FLVA 2IV7A 1EZ4A 3H18A 2VHVA 4Y0VA 1SPBS 4UATA 4PRYA 3ZNOA 5K0FA 2FWNA 4K1XA 2Q3EA 5FOQA 1GUBA 1GUAA 3B3GA 1NPYA 3E7DA 3L6BA 3PR2B 3ZUPA 2VTEA 3NANA 2P2CA 5HGXA 3BYZA 3JVUA 3U3MA 1QVWA 2ZSIA 1SA0A 4YJFB 3EDMA 1KZGB 4B2YA 3GROA 4INZA 4F5ZA 4OU5A 3A6HA 1QG6A 2EDCA 2O59A 1RJGA 4DUPA 1BS2A 1MX9A 1WABA 3OO1A 3ZQUA 4C89A 2YJGA 5KQLA 1J0AA 5KO2A 521PA 3CUVA 3GJ3A 4JU9A 3TAHA 3QMWA 5B1HA 3VNQA 2YW2A 1JG3A 3C45A 3UFXB 1KEPA 1NKTA 2HA4A 3GW8A 2PQMA 5FI1B 3I37X 5CX4A 2N1MA 1TA4A 1WPXA 1XDUA 2VP4A 3FOCA 5GZ6A 3OFNA 4URFA 3RC7A 3CKKA 1GGVA 1ORIA 2WF9A 1M6WA 1XRNA 3AB8A 4UUQA 2VNKA 4JJ4A 3VKWA 3IKTA 3CURA 3SG0A 2UZ4A 1RI5A 2CVPA 1M2WA 4M1KA 5IM5A 5A71A 1E1QA 2JGLA 2VJQA 3HU3A 3L4EA 3OUUA 3ZNPA 3QKRA 2P0AA 1JHYA 3MSXA 3SFTA 1DC8A 4EI8A 4RLHA 5CB4B 3UWOA 3AUUA 4HS9A 4Q3KA 4MHOA 2C77A 2ZUDA 2P6RA 6AT1A 1NRXA 3UMVA 2IVZA 5AI5A 5AMXA 1H69A 3ESCA 4PZUA 2C82A 5IBQA 7MDHA 3OF5A 3EISA 1FZQA 4H7HA 5ALFA 3OG9A 2QN2A 3TRHA 3UT5B 2R0QC 3V80A 1TUGA 3EN0A 1R6BX 3KSUA 4L8YA 4ZJZA 3WRXC 3TFQA 3Q9NA 3QFTA 2XCOA 5F21A 3F98A 4JQZA 4ZCQA 5LIPA 3UHPA 3SAJA 2NQ8A 1BMTA 4YAJA 1ZEMA 4NCKA 3GLFA 2D7JA 3GLTA 2V4ZA 4KIGA 3KCQA 1TJ5A 3ZW8A 2QUAA 4F91B 1CVRA 1DBIA 4JI4B 2CK3A 2DCUA 2WTEA 4NYJQ 3GN1A 2X40A 1DBQA 4BV8A 2EFHB 2OC9A 5CGQB 4W1SA 4DA4A 1ZIOA 2GVZC 3SZUA 3M4ZA 1EUCB 2IXTA 3K6KA 3LGXA 3R9XA 1Q1NA 3ICQB 1L4NA 4P80A 5LBIA 3L7YA 5TF0A 2FX3A 2QW0X 3MJDA 4YP7A 2CYAA 3NDJA 4PINA 4WUVA 4O2AA 5ALDA 1F2TB 4Q16A 1OHHD 2R751 2ZPTX 5AD1A 1YZ3A 3K0FB 5E4YA 1Y5IA 1YL7A 4JFRA 5FBRB 3U4DA 4Q37A 1USWA 2XEXA 1C1XB 5HZHA 1SKYB 1SM4A 2V6FA 4U2CA 1VBMA 2QXUA 1IEWA 1D7AA 2DJ5A 3ZWWA 3HRHA 2YVKA 4NENB 1CEXA 3TUIC 4IIFA 3ET4A 5DHPA 3OU2A 4Q4HB 2NSLA 3QU5A 2RDMA 5DGHA 1QE3A 3WLHA 4RIGA 5KJ1A 5SZKB 1LRJA 1V8ZA 1MX5A 2V7UA 3AXTA 4JEMA 1PEKE 4IKOA 2ODPA 4PSAA 3Q11A 4PANA 3ETGA 2IOFK 1XJ0A 4PVDA 5CB8A 2I8AA 1GPBA 4DC9A 1OX5A 2EF0A 5AVYA 4AUKA 2ZRGA 2AJTA 2X0KA 3T9FA 3FYSA 1VFNA 2FDRA 1KXZA 4WV3A 3QOWA 2ZVQX 3RW9A 1UZNA 3O92A 1O6CA 2ZBPA 2F9MA 3JR3A 4TT8A 1KMHB 2XNHA 3PD0A 1T3TA 3GD5A 5HIMA 3T12A 4JLNA 4B80A 1XQ9A 4U3JB 5DISB 1FX0B 4M21A 3WJAA 4H1TA 2G4LA 3MJSA 3KTAB 1Z4IA 3R77A 3VC3A 4G3XA 2H0AA 5ERYA 3C98A 2E5FA 1T9GS 1NVGA 3ZHYA 3HN2A 4X61A 2PT7A 4F3YA 1FIUA 2ZCJA 2QX9A 1LQUA 1K2WA 4J29A 1RXVA 1ZWKA 3DM9B 5K0EA 2GEBA