5GJWC

Structure of the mammalian voltage-gated calcium channel cav1.1 complex for classii map
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
197
structure length
178
Chain Sequence
VPPYDVVPSMRPIILVGPSLKGYEVTDMMQKALFDFLKHLFDGRISITRVTADISLARSSLAEVQSEIERIFELARTLQLVALDADTINHPAQLSKTSLAPIIVYIKITSPKVLQRLIKSRGKSQSKHLNVQIAASEKLAQCPPEMFDIILDENQLEDACEHLAEYLEAYWKATHPPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Voltage-dependent L-type calcium channel subunit alpha-1S
publication title Structure of the voltage-gated calcium channel Cav1.1 at 3.6 angstrom resolution
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Membrane protein
total genus 49
structure length 178
sequence length 197
ec nomenclature
pdb deposition date 2016-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00625 Guanylate_kin Guanylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5gjwC00
1JBKA 4DLRA 1KSHA 3RS0A 1Q21A 2GEVA 1HQCA 1P2SA 2VF7A 4DIDA 4F92B 3DDCA 1YZUA 2R6CA 5FBQB 2ZEJA 4LSGA 5J40A 1ZRHA 5DSZA 5E3HA 5AUOB 3NBZC 4Q1BA 4I4LA 4TYYA 5LPNA 5JEDA 2K5UA 3FHCB 4LDJA 3UPUA 2ORWA 4D25A 2XNSA 2QE7A 4DZZA 4Q4HB 2NG1A 4OHWA 2PX0A 3VMFA 4CVNA 1Z28A 3BB4A 1P4SA 3OEEA 4QJ3A 4A36A 4XJXA 2ZRDA 1FTNA 2ZVQX 4NCKA 1D9XA 1T5IA 1RFLA 2I1VB 1K8RA 1AGPA 4YMVA 1WB9A 1CULC 1FNNA 1E2JA 1OIVA 1WRBA 1ZU5A 4FN5A 4X8OA 5GJCA 5ANRB 1Z0KA 1WMSA 1K6MA 4DRZA 3Q9LA 5BYKA 4N3NA 4QBGB 4OHZA 1II8A 2IWHA 2XNDA 1GZSA 3OAAA 3WBJA 2PT5A 3GMTA 1J8MF 2GCOB 2YWHA 1BIFA 3VR6A 1FZQA 1OXTA 2F9LA 4IOJA 4QHSA 3CKLA 1GG2A 1I4TD 3T1VA 4PSAA 1G19A 2WOOA 1G21E 2CNWA 1KSFX 3C4JA 4FWIB 3TMKA 2QGNA 4EPXA 5CB8A 2QAJA 1FP6A 2AKYA 3RAPR 5CJ2A 3BJIC 5GJBA 4HLQB 5FR2A 3FDIA 4RFVA 2ZSDA 4P0TA 4LOAA 4ASUA 1EX6A 4QJ4A 3EX7C 3AKCA 4OKSA 5E7JA 2O52A 3CNOA 2OO7A 4GOXA 4M9SA 1E4VA 3MLEA 4PQYA 3QEOA 5E7IA 1YHNA 3QI2A 5HE8A 2HLDA 4TYQA 3ZVLA 4JVMA 5KHOC 1N6HA 2FJUA 1YR7A 2GJ9A 3ADCA 1KI1A 1JECA 4JVNA 4PX9A 1G4AE 3R9WA 5HCNA 3T61A 2IYYA 4IXMA 2ZE8A 2FE4A 3GFPA 4EFMA 1MRNA 4CGZA 2OFOA 3NVAA 3CPEA 4FMCF 1KGDA 4WBSA 2VP0A 4MKFA 1JEDA 3CR7A 4EPVA 2RGEA 4L15A 1SULA 4D82A 2GETA 3R20A 1P60A 2HCJB 2QAGB 3ZVMA 2WIBA 4A82A 5TMPA 4FCWA 3BD9A 1Z07A 4IFEA 3MMPA 3PEWA 2BBWA 2GJ8A 3K0FB 4NPHA 5FUXA 3SBDA 4C0JA 1NN3A 3B9PA 4CDGA 3TGPA 2QBYA 4TTRA 2GF9A 3SEAA 3QXXA 2JJ2D 1K5GA 3F8TA 2FFHA 1I4DD 2GVZC 5D3MA 2W2XA 4DCSA 2ZREA 4Q4AB 3BOSA 1ZP6A 2ORIA 1PUJA 2VRWA 5A5GA 1ZD9A 1YR8A 2WAYA 4TLEA 2VSFA 4TLDA 4HLUC 4V0LA 1R10A 4TQUS 1E94E 4JSTA 3T1OA 3CW2A 1E9SA 2BJVA 3BXZA 1P2VA 3PFIA 4RKEA 4A2QA 1KAOA 2XEXA 3CH4B 1NN0A 5J5CA 3N70A 1CR0A 1LVGA 2W0MA 3WYFA 2QQ0A 4LV6A 1XMJA 4EFNA 1T5LA 5JCPA 1Q1EA 3Q5EA 1Z29A 1UADA 3W5IA 2FH5B 5KSYA 2AK3A 3NBXX 5IK2D 3ZZTA 3AGPA 1II0A 2BM1A 4E22A 4YDHB 2IEZA 4JT2A 4N1AA 4IDNA 3PUXA 4LPKA 4DSNA 1W0JD 5FUVA 4P3YA 4QGAA 3RSLA 1QHYA 4IEIA 3I5XA 3Q7QA 2JLYA 3TVTA 2CHQA 2XJ9A 4IOLA 2VEDA 5GVSA 3KKQA 5AJZA 5JFGA 4Q4HA 1UDWA 4S2EA 3PVSA 1D8TA 2JIZD 3N5CA 1R8QA 4M1SA 4MKIA 5EXXA 3CRVA 3KJIA 3QUSA 3WNDA 3EW9A 1EFCA 2R6DA 3E2IA 1UEJA 5EP2A 3RNLA 4ZV4A 2CCJA 2RAPA 1RRCA 2QMHA 5JWHA 1LF0A 4RCZA 4YXWA 4IJMA 3O8RA 4OK5A 3BS4A 2F1RA 6Q21A 1T0HB 2BCGY 3A58B 4AG6A 1RVDA 2VP2A 2BC9A 2ZI7A 1X1SA 5ELXA 3BFVA 2WKQA 2GCOA 2QUZA 5DGXA 1G7CA 2GESA 5J47A 2YHSA 2J9RA 4A6PA 5JMTA 5JI2E 1MOZA 2QE7D 3AP2A 1G8PA 4NTZA 4PZLA 4R71A 4RJLA 1IBRA 2YYZA 3OEED 3VKGA 3EPHA 5KDDA 2BEKA 2AXNA 1Q3TA 1W0KA 1P5ZB 4DLWA 1VG0B 4EIWA 1TEXA 3MWLA 1V43A 2HEIA 4TLAA 1RYFA 1WA5A 4PSKA 4TYNA 1E4YA 4FMCB 4D0GA 4EPRA 4HSEA 3B85A 3PUZA 4GMXA 2Z4RA 3U6BA 2R44A 4C7OB 1Q22A 2XNDD 1Q57A 1LS1A 3P4YA 5AJVB 2PEYA 2QTHA 1W36C 1SVSA 1N6NA 3A1UA 1GDDA 2BM0A 3LO5A 3EIEA 2CHGA 2WWFA 1UBCA 2ZU0C 3O8BA 4MUAA 4LBWA 4QRHA 3TSWA 1E2KA 2C03A 2ZPTX 2YJTD 1NY6A 1P7CA 3LBHA 2GZHA 1Z3IX 3MWJA 1W49A 1L7VC 4Q66C 1M74A 4G5GA 3X1XA 2IS1A 1A5TA 4PPGA 1OJLA 3IPYA 4URXR 4RZ2A 5KPDA 1SXJB 4ASUD 1ZW6A 3CBQA 1CR4A 1KI7A 1HYQA 1MABB 1U0HC 2IW3A 3C5CA 3AVUA 2IWRA 2FFAA 2JJ1A 3QPUA 2ATXA 2ORVA 3NH9A 5E95A 2QAGA 1LV7A 1E98A 3WP1B 4B34A 2DCUA 1W7AA 2JASA 3ZH9B 1IXSB 1WE2A 1TNDA 4DXAA 4EJSC 1G5RA 3K0FA 1WDTA 5BN5A 2JLWA 3OZXA 1R0YA 1OIXA 1KDTA 3H2YA 5KSZA 1XEXB 3MGCA 3AKEA 4HI0E 4PAMA 2XJ4A 1IY0A 1KKMA 4P31A 1TQ2A 1EESA 3WRXC 1Q20A 4TL6A 3UMFA 3ICQB 4K8OA 3RS5A 2YWGA 2D2FA 2OSBA 1IN4A 1LY1A 4Q4AA 3LVQE 3TNFA 4CIDA 1LTQA 4BFTA 5JRJA 2FSFA 1Q1QA 1ZNZA 1D9ZA 1ZC3A 4WIAA 1KO8A 2C5LA 1P3JA 2G1KA 2XOKA 2Q21A 5JCZA 2B8TA 3QEJA 3K09C 2DFLA 3FHTA 4P4UA 4QFMA 2OZEA 1XD2A 1ZM4A 4TL7A 5L3SB 2IBMA 5HCIA 3H84A 5IDVA 4QKQA 1PJRA 1FNMA 2AFIE 3NXSA 5AUPB 2FN4A 3KB1A 1F60A 1XD8A 4MKGA 1XFAA 3EAQA 1W2HA 3QE0A 5H8WA 3Q72A 4LYAA 5HTKA 4MYUA 2FGKA 4TMTA 4DLYA 2P3SA 2B7CA 2HYDA 2R2AA 3IEUA 2QI9C 4BGDA 2CLDX 1VHTA 2HCBA 1KHTA 2EFCB 2ZRKA 4C0BA 3BH6A 1Q1ZA 4NCIA 3F0TA 2V1XA 1T6NA 1KYIA 1PLLA 2OBNA 3TIFA 5JJLA 5FOUA 2AK2A 5G3ZA 1E9EA 4C0HA 4EPTA 1Z47A 1G9XA 4JVLA 3ND9A 4BFVA 4LK2A 1AS3A 1FFHA 1UDXA 2JLSA 1R0WA 1T8UA 1VPLA 2V7QA 4UXHA 3WHKA 4BFWA 5C18A 4CEJB 2QM8A 2RGNC 1OPXA 2BV3A 2G77B 2VP4A 2A7QA 2P5SA 4HB4A 1I4LD 3U4QB 1XJQA 4EPWA 2NZ8A 4FINA 4D4KA 1EFHA 3W3ZB 1IJFA 4NYJQ 2CVHA 3WMEA 1OXUA 1DG3A 1KK1A 1SKYB 4N0DA 3ZS9A 2EWWA 1PV4A 4JYCA 5DO9A 4GNKA 1Z06A 1GVNB 1R5BA 3C16C 4RD2A 4QJ5A 1EWQA 2RGBA 1CR2A 4IFBA 1G3QA 3B8HA 4Q7MB 1R5NA 2ONKA 1JPJA 2X2FA 3KKNA 5K8UA 1TQ4A 1W46A 2GVDC 2HXYA 4E07A 2O8DB 5JZVA 3BC1A 4V0NA 1UKYA 2F3RA 4MRNA 5B58C 3KL4A 2ZR9A 2FZLA 4ZDJA 2ZRHA 1Z6XA 2N42A 5CYOA 2ZSFA 4ARZB 3KXKA 4URWR 3MSXA 4NH0A 1G4UR 4C7OA 1NKSA 1HTWA 1QBKC 1SVIA 3KXLA 2IHBA 2PEZA 2ZE7A 3D8BA 1UBGA 3LDAA 3UATA 5J4LA 1DE0A 2C9OA 2RHMA 4MYHA 3MRSA 2KBEA 1U0LA 3QF4B 2OCAA 3EXAA 3WNBA 1KNQA 1ZM7A 4AYXA 1PLKA 1W0KD 4NE2A 4ZKEA 3EZ7A 4I1VA 2Z6VA 4NYMQ 1NSTA 1G20E 1XCGB 4WZ6A 3TRFA 1XZQA 4IVPA 4ZCIA 3U61B 3AH8A 4CEIB 1QVAA 4PHHA 4O2RA 4FCVA 1OH6A 3TW4A 3ZVNA 2VSOA 1SXJA 2RCNA 4F93B 1CJUC 1N6PA 2OXRA 1Q1BA 4HAYA 5BXQC 1KJZA 5DE3A 3U6KA 1IHUA 4TTPA 1E2DA 1F2TB 1YZTA 2YC4C 2ANCA 2ZJ8A 5IRCD 1TMKA 1HV8A 2HT6A 2XB4A 2IYWA 2DWQA 5GJVC 3QJYA 4KU4A 2CL7X 2WWWA 3IUYA 1UAAA 3FTQA 2VHCA 4KFTA 1XEXA 4M21A 4LJ7A 5CK4A 1P2UA 3VQTA 4XWOA 1SXJE 2FU5C 1XZPA 3BB3A 1GL9B 4W7SA 2GTPA 3FMFA 1KK2A 3HP1A 3ZLJA 4Q03A 2A3RA 1ESNA 3VR2A 3EIHA 3REGA 1MT0A 2L0XA 2ZM5A 4BRWA 5AJXA 4B76A 4C2TA 1T3HA 5B30A 3SC3A 3CIOA 3QVUA 1KIMA 1NBMD 1FQKA 2O8EA 4DC9A 1S0UA 5IF9A 4PPQA 2RB4A 3G0HA 2ZI3A 1G8GA 2BKUA 4A8JB 5L3SA 3RRZA 3I62A 1XDBA 3AVPA 3PIRA 4ESHA 5JBQA 3U5ZB 2XTZA 1SVMA 4NHOA 3U3JA 1GL7A 5C4MA 3RWMB 2P0EA 2ZE5A 1HH4A 5FUYA 1SVKA 1E2FA 4F38A 2IA5A 2ANBA 4C0SA 1I2MA 1OFIA 2DFTA 1RRFA 2G9NA 2F6RA 1NF3A 2XOKD 2J45A 4B2PA 1II9A 5CITA 1G5TA 5KNCA 1T3LA 2XTNA 1XEWY 5LB2A 2VTKA 721PA 1UKZA 1AGRA 2FGJA 4JLJA 5FOTA 1J90A 1S9DA 4ZDKA 1A4RA 3L0PA 4LWZA 1JAHA 2IYXA 2QTVB 3LNCA 1TPZA 3SHWA 1F6BA 4CEJA 1MO5A 3K9LA 4HAUA 1IN6A 3U4QA 5TARA 4GZMA 4IHQA 2AFHE 4OI4A 2QQEA 3UG6A 4LJAA 3BAFA 2C98A 2R6GA 3QG5A 5GJWC 1ZU4A 1WBDA 1YR6A 2PJZA 4K46A 3PQCA 2NTYC 2PZEA 4MUBA 5FBVB 1L2TA 2OESA 2IUUA 4M9QA 1US8B 4JT4A 5HE9A 1S1MA 2FOLA 1W4RA 1TU3A 1Y63A 3NHAA 3NC0C 3AVTA 1ZYUA 2RHDA 3C14C 1NNEA 2V7QD 821PA 2O8DA 3U3KA 4LCBA 2J41A 4TMWA 3FMIA 2IXFA 3IKJA 1JXMA 4E03A 1SKYE 1D2EA 1S4QA 2QM7A 4ILEA 1F3OA 2EYUA 4PC7A 1ZBDA 4EDHA 2ODWA 2Z83A 4XVRA 4GMDA 1NRJB 2ZITA 2IYZA 5DH9A 2CCKA 5JSZB 1W1WA 3AVOA 4B3BA 4DDTA 1N5IA 1X8LA 1BO6A 2FSHA 2TMKA 2V6JA 2WJJA 3KTAB 2W00A 3KKMA 2FF7A 2ZI4A 5GADl 2AHOA 2QEQA 4NYIR 4QBIA 1VYVA 1ANKA 2GZAA 2JJ2A 2MMCA 4TT3A 1C9KA 2WZQA 1XP8A 4B33A 1MH1A 2YINC 1FMLA 1CRQA 3DOEA 3IBYA 3PUWA 4F7WA 4CEIA 1H8ED 4Z8XA 2ATVA 4UJ5A 5L3RA 5EXTA 3TKLA 4QNRA 5E7MA 5EE3A 4R98A 5IT5A 1NLZA 3W3AA 4QGFA 1AN0A 2F9MA 4L9WA 4MGYR 1Z8FA 2IYUA 2GDJA 3HU2A 4PQRA 3ECCA 1F2TA 3CZPA 1T8TA 3B1VA 2QP4A 2ZJYA 1Z0JA 4M0LA 4RCYA 2G88A 2YVUA 4RD6A 2ZRNA 1OKKA 3WBKA 3NG1A 4DDUA 2JLRA 1VG1A 1E79A 4QG7A 5IK2A 3GJ3A 3QKSB 2IUTA 4IDHA 5CK5A 3C41J 3U60B 3DKVA 3DPUA 2GA8A 1SXJD 4M1MA 5AJYA 2ZI6A 1FL9A 3K70C 3QOFA 2OAP1 2C9CA 3KUCA 2IYTA 2H8KA 3QBVA 4TMZA 2REOA 1SQ5A 1TUIA 1ZIPA 1VTKA 2A30A 2E9SA 4MITA 2IYRA 2Q9CA 1K5DA 1G7SA 3QG1A 1U8ZA 3KZ1E 5KNBA 2QSYA 2CCGA 4A0RA 1BYUA 2KI5A 2ZR0A 2VHTA 4BFZA 3VHXA 2KWIA 3H0KA 2W58A 3MJHA 2YKGA 1Z6AA 4LGMA 4MRVA 3LVRE 1OXXK 1JR6A 1R6BX 1N0WA 1BH2A 5DN6A 3KKOA 1SZPA 4IW3B 3TUJC 1N5KA 2FPMA 3V00A 1E1RD 4DT1B 2BBTA 1XEWX 3RDPA 4XVUA 1W48A 4D80A 1FTSA 4EUNA 4Q1AA 1NG9A 3U7GA 2CK3D 4JLVA 4DDVA 2VP9A 2R6FA 4BLTA 1NP6A 1L4UA 4MRRA 5EJEA 3AUYA 3FFBA 4NYIQ 4TLBA 2QRZA 3CNLA 2ZAMA 3AF3A 3GFTA 4RKFA 4LYFA 3MD0A 2DR3A 2QENA 5FBWB 3T1TA 4BFSA 4NCHA 3K0EA 5DISB 1E2QA 1E2IA 2IYVA 1T0JB 1RZ3A 2JEOA 2OFWA 2AL7A 3CF2A 3PXGA 2NPFA 2A9KA 3PEYA 4ZI3A 2QMUA 4QL3A 1US8A 2IYLD 1M7GA 2W6IA 5G3YA 3VR3A 3QY0A 3ADKA 2AD1A 1TU4A 3NHBA 2WTUA 1IY1A 4HEJA 1E2GA 3NTUA 3X1ZA 1E1QD 3NBFA 5FR1A 2FNAA 2BMEA 1PUIA 3BE4A 2LKCA 4CEHB 5KOYA 1IAQA 4QC2A 4H9GA 1ZJ6A 2ZS8A 4JLNA 2Q9BA 2QMOA 5AUNB 2GBLC 3I3SR 4D26A 3KXIA 2WWIA 1G8FA 1AQYA 4W9MC 4AY2A 4UKDA 3LV8A 2WWHA 4B71A 4Q9IA 5JSZA 5JWRA 4FMDF 1VCNA 4TQ9A 4DSTA 4B75A 5HR5A 3EZ6A 3B2EA 4FIDA 3KTAA 3SYNA 3VFDA 4C2UA 3R7WB 2O0JA 2XZPA 3EPKA 4B35A 4AYWA 1R0XA 4TYWA 2BEJA 2BJWA 4QBHA 5A4JA 4Y0AA 2GXAA 1G64A 4IXNA 5EZ6B 3CRQA 1R0ZA 3MAAC 3SFZA 3LW7A 5EUQB 2YNMA 3LLMA 3AF0A 3BB1A 2BMFA 3QQ5A 5EP1A 1S2MA 3NIBA 4OQXA 4PC2A 2IT1A 2EFEB 3AP3A 3I72A 3KB2A 5CJPA 5FOXA 3AVWA 2C99A 1SKQA 5D3QA 4A9AA 2D74A 4A0HA 2V8OA 2YOFA 3R9XA 3UG7A 2KBFA 4L5BA 3DMDA 1DO0A 3M0EA 1Z5ZA 5CDFA 1TX4B 1DS6A 2OILA 4TT3D 3VAAA 5CM9C 5FBRB 3K09A 2I1QA 4UNQA 2QG6A 4DLSA 2P6NA 2ZETA 3BRWD 4JLPA 1OH8A 2PMDA 1YZQA 1TUEA 3QKSA 5J4YA 2IL1A 4EAQA 3P1JA 2R6AA 2PCLA 5G41A 5JLJA 5LD2B 2UKDA 2JA1A 4YDSA 1UPTA 4MYTA 1WCV1 1WXQA 2D62A 3Q5DA 1IQPA 4YMSA 3Q8XB 4PANA 3QNUA 1W4CA 1W47A 3MUFA 4JL6A 1GFIA 5FPSA 4RD1A 4R9UC 4L9SA 4QHTA 4KVGA 5CDFE 2ODBA 1XD2B 1UKEA 2ZJBA 2IS6A 1W4AA 1OKKD 3AVQA 3LQRA 2A5GA 4JZKA 1GITA 1E79D 3SJCA 2HJGA 5F3WB 2R62A 1OE0A 1QHIA 2VBCA 3I73A 2QPTA 1R5OA 1WQ1R 4XSGA 2R9VA 2VHJA 4ZIRB 2WOJA 4E09A 1SVOA 1HUQA 2EFGA 2RGNA 4LRWA 4D0NA 2F55A 1ZAKA 3N2EA 3OF5A 2HUPA 2BDTA 4DT1A 2PZFA 2G1JA 3A37A 3RABA 1KMQA 1ZM3A 2QNRA 3ZQJA 1AIPA 1YZGA 5JRZA 4OJQA 4V02A 4EFLA 3IBGA 1NLYA 1Z6GA 3SS8A 4YMUA 3EASA 3EIQA 1N6KA 2PLRA 2VQSA 2DFKB 5DN6D 5C1BA 3GEHA 3QPVA 3ND8A 2XZLA 3AKDA 4NONA 2WBLC 3OEHD 2Q0HA 5H68A 3CPHA 3RS3A 2IEYA 4FMDB 3JZAA 3QKTA 3AF4A 3RLFA 4DKXA 5KUTA 3QXCA 1GL6A 4FI3C 3FE2A 3QF7A 3MFYA 3SNHA 1JXOA 3UXMA 4TTQA 2ZS7A 1GSIA 3C8UA 3GJ6A 3WP0A 4DCVA 2QN6A 4FMBB 4QOSA 4CEHA 2ECKA 1DVRA 4WOPA 3KDSE 5FI1B 1A2BA 4M4SA 4P4SB 1C1YA 1DAMA 2LCFA 3M1IA 4I99A 3J81k 2ZQ5A 2PZGA 1GAJA 1B0UA 3RSOA 1CJVC 5JI3E 2ZS9A 3U3OA 4D4JA 2ZSBA 3GLHA 1LW7A 4P32A 3T5DA 4XWKA 4D81A 4L16A 3RWOA 4H1VA 1AKYA 3UK6A 1N5LA 1H65A 1CIPA 2WWGA 1Z6TA 2W6ID 1Z2AA 2WAXA 3PR1A 4RD0A 5BQ5A 3R7WA 4DB4A 2ZR7A 4URUR 2GJAA 1S3GA 3KX2A 3PG5A 1XPRA 4LBVA 1CP2A 2H5EA 4DSUA 1DAFA 3K0AA 1M7BA 2ZTSA 3IIJA 2P5TB 4GI7A 4NKRA 4HLDA 3FYHA 1UBFA 3VX4A 1MKYA 5JECA 3T5GA 4LI0A 2I3BA 2WVJA 2C04A 2AWOA 3X1WA 3I61A 1E6CA 3GLHE 4JBYA 1DAHA 3O8DA 1LF5A 1BMFA 4AD8A 1NVVR 3CF0A 2ODEA 2QGZA 1R2QA 3FVQA 3L0IB 3ZVRA 3SYLA 4DEXA 3VHLB 1NBMA 1XTKA 1T3SA 5EZ5A 1Q3HA 2D06A 3DOFA 3SU8A 3KQLA 3DM9B 3WMFA 4G5QA 4C0KA 1KJYA 2V55B 4TMVA 5J4HA 1E0JA 2CEAA 2FPLA 2P2LA 4G0NA 1OXVA 1CS4C 1X86B 1E2LA 4WA7A 1XD9A 3CNNA 4AG5A 2RGAA 5CLQA 1AZTA 3GD7A 4BPBA 1XXHB 3WYAA 3NEJA 4O25A 1AM4D 1G7TA 3BFXA 4BQSA 4UNRA 2ZYVX 1EWRA 1NMXA 4PFSA 1NBME 1YZKA 4Q1CA 3BERA 3GJ5A 1HT1E 3W5JA 4B3CA 5JWOA 2O8EB 4JIMA 4TWZA 2ERYA 3MWKA 2HV8A 1CEEA 2QTFA 4C9BA 3OE7D 3EC1A 1G6OA 4JBXA 1UM8A 4JLAA 3RHFA 1CJKC 1TQDA 2X2EA 5EP3A 1U94A 3ZDQA 3T35A 4IVQA 4BZQA 2PCJA 2G0NA 4MYCA 4DDWA 2QPAA 4M1WA 4WW0A 2WJYA 4F4JA 4A4DA 3FGNA 3HYRA 1E9BA 1QHNA 4A2WA 5DNYB 1DAEA 4ZIRA 1DG1G 1VHLA 3TUIC 3GP8A 1VMAA 1G41A 2MSEB 1B23P 2OCYC 2AKAB 2BBOA 4RVCA 5TY0A 4I81A 2Q3FA 3U3MA 1Y3AA 1G17A 4HZUB 4IDQA 2IF0A 1JQLB 3P4XA 4M9XA 2WJGA 2ZROA 4BFYA 5EXPA 4ZPXA 3V9PA 1ZUHA 5KPJA 4OHYA 3BH0A 3P20A 4M1KA 3UKDA 1IJEA 2ZAOA 4ZDIA 1G16A 4RY2A 1CBUA 1GIAA 3Q3JB 2W83A 3SZRA 1ONBA 2G3YA 1GWNA 2HF9A 1FQJA 1ODFA 1QVRA 2PL3A 1RYHA 4V03A 4TLCA 3DKPA 1YJ5A 3GPLA 2IUSA 3NEYA 2KSQA 2NO9A 2WM9B 4D0LB 2HDNB 3ZYCA 2VA8A 1DELA 4PR0A 1CU1A 2GF0A 2ZXUA 4A15A 1ETUA 4FD2A 4XD7A 1NVVQ 4GOJA 3SN6A 1CJMA 4BECA 3WHLA 3DO6A 1DAIA 4Q48A 1ZCBA 5BYJA 4Q01A 3T15A 3ICEA 1JPNA 3X2SA 4JS0A 1XMIA 4JKIA 2NPIA 1EFRA 3K9NA 4KSCA 5HZKA 5K8LA 2PMKA 1ZINA 4CW7A 3VR1A 3I92A 1H8EA 5DYGA 4P4SA 5AJWA 1AKEA 2REBA 3LBIA 5LBIA 5KTYA 3A4NA 2A5DA 1DARA 3GJXC 2P65A 3EPJA 2ONJA 1Z63A 121PA 1XPUA 2V1UA 4OI0A 2NQ2C 4POAA 4KI0A 2BMJA 4B48A 1TF7A 3UWOA 2FSGA 4IVRA 1NKTA 1T9HA 4H1UA 1M6NA 421PA 4YMWA 2SHKA 2XB2A 4IOKA 1D5CA 1PZNA 3FB4A 5FUWA 2ZRGA 1NL3A 1U9IA 1VIAA 1ZUNB 2CLSA 1G8YA 3EWAA 3TBKA 2V54A 4YMTA 5HKKA 2XZOA 1YQTA 4Z51A 3LH5A 1E0AA 5H70A 4UXJA 1ZNXA 4HB3A 4JYBA 2QMEA 4JSYA 3SYKA 3B13B 1J7KA 2W6JA 1EG7A 2GEUA 3RRYA 2YOGA 3EA0A 3AV0B 2ZYTX 3F3YA 1TL7C 4PZZA 4XTCS 5SZJA 4MRSA 2AD5A 3LXRA 4JLKA 4LPSA 4M9ZA 4AI6A 1G1MA 4ZCLA 4DWJA 2DBYA 1D2NA 1ZD8A 1P75A 4OI1A 4EQ6B 1KOFA 2R8RA 4BEJA 2OCPA 5FBLB 2J0UA 4MRPA 3IEVA 3W34A 2HXSA 3HU1A 4TL9A 2WSMA 1JJVA 2J87A 1E9FA 2VYFA 4DBLC 3RC8A 3LWNA 4DLXA 1CR1A 1N6OA 4KHZA 5DI9A 3FFAA 4GZLA 3UIEA 3K9GA 1SHZA 4Q47A 4EPYA 2GCNA 1XXHA 2ZI9A 4OI2A 1L4YA 1E1RA 1O87A 1WP9A 5FTMA 1BMFD 4HZIA 3B82A 4US2R 1N25A 5TVKA 4AK9A 1N6IA 4HDOB 3R8CA 2KE5A 2DY1A 2NO6A 4D2IA 5FTKA 2CK3A 3TSOA 2XSZA 4LHYA 2XTMA 4GP6A 4PO9A 1S9HA 4UXIA 2QSZA 3W8NA 1QHGA 1COWD 1U8YA 1DO2A 2F1JA 3RS4A 4MGKR 3CX8A 1KJWA 3VR4A 2QAGC 1YZLA 2BKEA 2QL6A 4B44A 1E0KA 3GJ8A 1XXHE 4B3DA 1E9CA 4HAWA 4BRUA 1A7JA 2RGGA 4JLBA 1GNQA 1U98A 4OJKA 3AEZA 4LHZA 5K8IA 2QZ4A 2BBSA 4HB0A 5FL7D 5UKDA 4DHEA 2OBMA 4B32A 4US0R 3E70C 1JR3A 4HZUA 2FWRA 1P72A 4G5RA 1GP2A 4Q9KA 2MSCB 1GKUB 3ZZUA 1MRSA 3OESA 1G8HA 2REXB 4IKEA 4X8HA 1GRQA 1OFUX 2ZSAA 2RGDA 2OXCA 2ZRFA 3EZFA 1E1QA 3K0CC 3SJBA 2FMXA 2FX3A 3T06B 3HJNA 4HUQA 4C30A 5AR1A 2EQBA 4G5SA 4C0QC 3LQQA 4AYTA 4JKYA 4GSYA 2GHIA 1KI6B 2NMVA 1ZUIA 1TTTA 4DCTA 1G3UA 3EG5A 2VL7A 3PUYA 4ERNA 1N6LA 3FKQA 4NU0A 1JR3E 3JZMA 4TN1A 3B9QA 1XF9A 4B3FX 2JLQA 1J2JA 2DFNA 2GBLA 2R65A 3THXB 3KFXA 3B78A 4AIIA 2VHQA 3PUVA 1DPFA 5L3QB 4LYHA 5H1YA 4QNMA 2O8FA 4HDCA 2VSXA 2IYQA 4OYHA 3WYGA 1E2MA 3BWDD 3IHLA 4PC6A 5KO2A 1KTVA 1G6HA 1XU4A 2QA5A 4X8LA 2C8VA 3UMSA 1P73A 4AC9A 4BE7B 1G5PA 1NSFA 1PVOA 3TSZA 2G0TA 3AGQA 2RGCA 4XTRA 1OXSC 2CJWA 1IN7A 1Z83A 2QROA 5G53C 2H16A 5EXSA 4QXAA 4NP6A 2Z0MA 3O8CA 1OH5A 3IO5A 4UNSA 2VH5R 1XX6A 4JVSB 4XD7D 4A2PA 4OK3A 4U5XA 1VIYA 2OV2A 1XJ0A 3SHFA 4RZ3A 4I1OA 3NDBB 4URYR 1BKDR 2WMOB 1LFDB 1P9WA 3UANA 2J3EA 3Q7PA 1EFRD 1KNXA 3CZQA 4M2LA 5FOWA 4EJSB 2YWEA 3KQKA 4OHXA 4RZXA 1QHHA 1KSGA 1ZIOA 3PEUA 3SJZA 2IX3A 4B2IA 4OL0A 3VU9B 4KFRA 1CKEA 2NOAA 3PEVA 3RVBA 3KQNA 2PX3A 3OIYA 4MQBA 5BW8A 3CO5A 3L0OA 1VECA 2NO7A 2B6HA 4C4PA 3OIVA 4DVGA 4UQOA 2P6RA 2V4ZA 4HLUA 4WZAE 3RC3A 3GLFA 5B64A 3ZD6A 2J0SA 3JVVA 1P9RA 3OFNA 5TXGA 3CF6R 2OLJA 2YWFA 2V3CC 4KLZA 3X1DA 1WF3A 4KAXA 1OV4A 4EQ6A 4D6PA 4A0GA 1FUUA 1D6JA 2D4HA 4PZYA 5HKKD 4U00A 2DWPA 1P61B 1U99A 3AF1A 4OQNA 1YE8A 4KXFB 5JHGB 1YR9A 4LC0A 4Q1DA 2B8WA 3SI7A 3SQWA 2ZJ5A 1BYIA 1NVXQ 2BOVA 4MH0R 3HR7A 2W6JD 2JCSA 3ETLA 4GP7A 3A4MA 3ZS8A 2GAAA 3GLFE 4JBWA 1KAGA 2P67A 1G18A 3DL0A 2C9YA 1FX0B 1W2GA 4B3XA 4PHGA 3BBPA 2B92A 5P21A 5JS8A 1SXJC 3B5JA 2WJVA 3PITA 2NZJA 1S3SA 1ZD1A 2FEOA 1G7RA 4KV9A 4URVR 4PC1A 3OIWA 1JB1A 1Q0UA 5G40A 3O47A 2H1LA 3EC2A 5FFMA 2GKSA 2GCPA 5KNDA 3A1WA 4Z1MD 1XCMA 2FZ4A 2WMNB 4AURA 2WKPA 3VX3A 4DLZA 1W44A 3OEHA 1DTSA 5FPTA 4HUTA 5LB4A 1Q44A 2AWNA 5JEEA 2GJSA 5C2JB 3EZ2A 3A36A 4GPTA 4KBFA 2OAQ1 2XSZD 3DZDA 3IIKA 2PJRA 1CF4A 1T4GA 5DYIA 2Q6TA 2VLIA 3U3RA 2ZRIA 3GQBA 2DWOA 1F5NA 1QZXA 3S1AB 1MR3F 1QHSA 1GOTA 3W6PA 1RRGA 4HATA 1E32A 1MO6A 3TW8B 3KJHA 1JEEA 1HEIA 5C4GB 4M53A 3F5FA 1KI6A 2BIFA 4LYJA 1N0UA 2ZRCA 1NN1A 1O3YA 2ZANA 3P26A 3L82B 5C46F 4WXPA 2LWIA 4B6FA 1G291 2ZU6A 4LBYA 3IPXA 2JATA 2UZ3A 2IXGA 2HJVA 3GEIA 4PC3A 3THXA 1QG2A 1JR3D 1KO4A 5L3QA 2WIAA 3AQ4A 5FPYA 2GK6A 2A5JA 2ZJZA 3ASYA 4Q9JA 5FH9A 3C15C 3QKRB 2ZSEA 1Z6YA 3LLUA 2JLVA 3CLVA 1NJGA 4V0OA 1JNYA 3PV0A 4CZ2A 1F2UB 3R9IA 2F3TA 3PCRB 1XCPA 1ESMA 2OCBA 5CIQA 4B3GA 2CXXA 1KO7A 4Q1FA 1NN5A 1UFQA 2D7DA 5M04A 5F9FA 2WWXA 1E69A 1TF2A 2H17A 3GLHB 3H4MA 3BIFA 4KBGA 4N0EA 4BWYA 4ZI2A 5SZKB 3TK1A 5B57C 4BEBA 1R4AA 2F1IA 3QXHA 1OT3A 2E1RA 4ABYA 1Z0AA 2XX3A 3H1TA 1XTQA 3OHMA 1EFTA 4IDPA 3CB4A 1DEKA 4G1UC 1C4OA 2JDIA 4BLRA 3UMRA 1FP7A 3E1SA 5BWMA 3K0AB 2NO0A 3K8YA 4EJSA 3M6AA 1KMHB 1WBBA 4M1OA 1NIJA 4QM7A 3HPRA 2VP5A 1TAGA 2EFDB 4BUJA 3P32A 3U7FB 3TVDA 4FCTA 3IIMA 3VU9A 2CL6X 2D7CA 4AKEA 3W6NA 1U81A 2X77A 1P9NA 2PLFA 4L8GA 4BZPA 1GKYA 3TAHA 4KYUA 4Q9HA 3VR5A 5HPYB 3TR5A 1IXZA 2EW1A 3CWZA 1NVUQ 1L8QA 4JJZA 2XXAB 4LJ6A 2UZIR 3OE7A 4M1YA 3MJRA 1RIFA 3TE6A 1AZSC 3ASZA 4A6XA 2FA9A 2ZUCA 4Q02A 2OFXA 1IOZA 4F4CA 3B60A 2J0QA 2HF8A 2ASEA 3T12A 3CRW1 3V4FA 2RKOA 4KCGA 4QGGA 5DLQC 521PA 5CLLA 3FKSD 5DI3A 2GJKA 1FW6A 2C78A 1UF9A 5HZHA 3C5HA 3QSYA 4LX0A 1CRPA 1RC8A 1IONA 1FX0A 1F48A 3LD9A 4LJ5A 3RYTC 4Q21A 2W0SA 4G3XA 2ZRMA 3HPQA 5A0FA 3OFND 3GLIB 1G3IA 1UJ2A 3L43A 4Q00A 1M2OB 4KLNA 4XSHA 5F2EA 1KK0A 1MO3A 3DM5A 1AA9A 3BGWA 4I1SA 3THOA 4O3MA 3CONA 2WHXA 3B1YA 4GDFA 4Q5IA 2QPOA 1DAGA 1Q12A 1YVDA 2Z4SA 1RW4A 2J7PD 4OK6A 3AVXA 3TAUA 4E5UA 1NG1A 4BASA 5FPKA 4AKHA 1CJTC 1KY3A 2A5YB 2IS4A 3QBTA 1XMVA 1EFUA 2OE2A 4IEEA 2RH5A 4KJZA 2QT1A 4W5WA 3NWJA 3MCAA 1EXMA 4MKHA 3HR8A 3A1TA 5B2ZA 4PPFA 4XIGS 3S1AA 2FEMA 3I8SA 4DCNA 5EE9A 5FI0B 4CF7A 1OLOA 3X1YA 2A2ZA 1YRBA 2H57A 2GRJA 4DLVA 1X3SA 2GAOA 4FW9A 2JAQA 4D4LA 4TYPA 2AN9A 4BLPA 2E87A 1RPZA 4WZBE 2EYQA 4A8JC 1V5WA 3U2QA 2OLKA 1KDPA 4KVAA 2NIPA 3FWYA 3NKVA 1E2PA 1X1RA 1U8AA 1HT2E 3A1VA 1MV5A 4XWAA 5KU1A 4IDOA 2FV8A 3G82C 4JLOA 2IYSA 2J5XA 3SR0A 3TQFA 3NH6A 1UKVY 2IC5A 1KDRA 1A2KC 4V0KA 4BFXA 1HA3A 3QKRA 1Z08A 3N2IA 1OH7A 4M1TA 1AQUA 2W2VA 1F2UA 1UBEA 4R2IA 5LDDC 3PJRA 4FWTA 4U02A 3G5UA 1GNRA 1AS2A 1W4BA 3ADDA 1UEIA 1A1VA 2XAUA 3A8TA 4KFSA 4Q19A 1KI4A 3CRRA 2WPDA 4K81B 1W5SA 1X6VA 4CRWB 1HQYE 5FOSA 3TR0A 1U0JA 1ZNWA 2ZJAA 3CPJB 3SJAA 1G3MA 2VPPA 3LX5A 4AKGA 4PAOA 4QHYA 4GL2A 3K53A 5FL3A 3Q85A 1W36D 2CLCX 4ITRC 2ZE6A 3RRNA 2H18A 5KDLA 1J8YF 3BH7A 4B73A 3UWKA 4ESVA 1SGWA 3GLGB 3AP1A 2N1BA 3LXXA 1KMHA 2WSSA 3OAAD 3WXMA 4RSGA 3W9YA 1XEFA 1ZM2A 4O2LA 4LHXA 2IK8A 3QIAA 1XPOA 3I4LA 1SVWA 2CNWD 3DEFA 2KB0A 2Q3HA 4Q4LA 3LX8A 4TZ0A 4AWXA 2X1VA 2P6UA 2O8CB 3K70B 1VG8A 3VTKA 2ZRPA 2O8BB 1COWA 2XXAA 2J0UB 4NYJR 1EK0A 1JJ7A 5SZIA 3REFA 5DIFA 3BK7A 2H92A 2JDID 5BN3A 4MA4A 4Q7KA 5SZHB 1QG4A 3VKWA 2GNOA 4OQLA 5TDHA 1EX7A 4RD4A 1GRRA 2Q3MA 5KSOA 3DMNA 3QPWA 4NL4H 2A5FA 1E3MA 3QKUA 1QHXA 2VF8A 4TSFA 221PA 2Y8EA 4HDQB 1YZNA 4YONB 2HLDD 3I32A 4B2LA 1XTSA 5FL7A 5EUMA 4NDZA 1DOAA 2IF2A 3LA6A 1NMZA 3SBEA 4O0MA 2FSIA 2PT7A 3QENA 1ZC4A 2CBZA 1S1CA 2ZRBA 1OIWA 3DHWC 1YKSA 3IILA 3GLIA 4B6EA 2MSDB 1GRNA 4HAVA 3A6PC 3SFVA 4LBZA 3L8ZA 1KK3A 3RRMA 2XGJA 2G83A 4M8NE 1N6RA 5FPHA 2FDCA 3B1WA 1J70A 4UJ3A 4YLGA 1P2TA 3NC1C 1CTQA 3K0CA 4WXRA 4V0MA 1N0VC 4KODA 4DCUA 1OB5A 4LUCA 2ZYUX 2BMDA 2EWVA 4B47A 3K0SA 3ZJYA 2GXSA 4LC1A 4NYMR 4IOMA 3GLIE 3AVVA 2CE7A 4A92A 3LAWA 1J99A 5TB5A 1Z0IA 5L3VA 4MDEA 1KSJA 3TH5A 1EGAA 3T34A 5JHHB 5JJIA 3W90A 4HAXA 1E2NA 1JI0A 3I8XA 4HUQB 3KJEA 4LV5B 4PSVA 4Q4JB 3K9HA 1OF1A 3FOZA 1XTRA 4C3ZA 2WV9A 4G01B 1PLJA 1AS0A 1KKLA 1AK2A 4V0ME 1XNJA 4II7A 2QU8A 3B1XA 4PXAA 3GJ4A 2OBLA 3U7HB 4NCNA 1FMJA 1MO4A 1XTJA 3AF2A 1VDZA 1AJEA 4PHTA 3T1QA 2ZVPX 4RZUA 3U44B 1P62B 1XWIA 2C77A 4LJ8A 2O8FB 3DZ8A 2DPXA 3PENA 3HWSA 2D3WA 3CWQA 3WNCA 3KKPA 1TADA 4C0AC 2GZDA 3I5YA 3TQCA 1E9RA 5K8TA 5FOVA 4J0QA 4PO1A 3K1JA 2J59A 3MWYW 3ZQ6A 1XBTA 2DHRA 4F4IA 1ZMXA 3L8YA 1OB2A 2F43B 3QXSA 1R8SA 1Z0FA 5L8VA 4RD3A 4Z54A 3RS7A 2ZRAA 1HE1C 2CJWB 1VYTA 5DHFA 4KSBA 2VO1A 1X8KA 1E9DA 1M7HA 4GRAA 4AKIA 4LJ4A 1BS1A 3KQHA 2HYIC 4PPNA 4HAZA 1KI8A 3HDTA 3THWB 4YQFA 4KYIB 3VNUA 2FPKA 4LZZA 1KO1A 2ZIAA 5GVRA 3FHOA 1NIPA 3EARA 3H86A 1RRPA 1E99A 1KI3A 3KJGA 4KITB 5KDOA 2ODNA 4LJYA 5BN4A 621PA 2V6IA 3I1FA 3HU3A 1QHHB 3KUDA 4YXWD 2CMKA 1RE0A 3KFVA 4DLUA 1I2DA 1S96A 3GLGA 4A0FA 2ZYWX 1SVLA 2CHVA 4BLSA 3ZIAA 2FFQA 1NVWQ 4US1R 3TJZA 4UNNA 4X8MA 2J46A 3THYB 3ZD7A 3R8FA 3A4LA 4TL8A 3TUZC 4U7DA 1KI2A 1U90A 1JAIA 1VG9B 2LKDA 4QBFA 2ZUDA 2WPDD 2AXPA 2AX4A 2NO1A 2VIIA 5CYPA 3GLFB 1N5JA 3WY9A 1BOFA 4ZO4A 2Z5FA 3SE0A 4PAQA 4CT5A 1H8HA 4JLMA 2O8CA 4Q18A 1ZVQA 1QF9A 3QXJA 2O8BA 1RJ9B 1W5TA 3CR8A 3NDPA 1LS6A 4JL8A 4DUGA 3IO3A 4L4UA 2I4IA 3GLGE 1OHHA 1GUAA 4W5JA 5E4FA 4GBMA 1Z2CA 5FTNA 2WJIA 3CX7A 3L2OB 3ADBA 4RFSB 1MABA 2NGRA 4Y0VA 4MGIR 4A1FA 2CE2X 2WSSD 4GT1A 4Z1MA 3AUXA 5EQTA 3P27A 4OQFA 4PHFA 1VKJA 1OYWA 3D3QA 3BFKA 1ZNYA 2B21A 3FMPB 4ZKDA 4D4MA 3CM0A 4DIEA 2ZJ2A 1NI3A 1GTVA 1TEVA 3LY5A 4M22A 2XITA 2N46A 2IXEA 3DVLA 2DB3A 3JVUA 4XVQA 4DJTA 2ZRJA 3SOPA 1X8JA 5J4KA 2OHFA 1QRAA 4B74A 1JALA 1KI9A 2EVWX 4QGHA 3D31A 2QP3A 1OFTA 2EFHB 4FXPA 4Z8YA 2RGXA 3AKYA 1FPMA 2CVFA 3SQXA 2HT1A 4PTLA 1KZGB 2JJ1D 5DHAA 3GJ7A 1HY3A 1LB1B 2PBRA 4TSFD 1DBSA 4MGZR 4BZXA 4KFUA 4TMKA 4ON9A 2X19A 1KDOA 2QT0A 2YOHA 4OQMA 2O5VA 4JLDA 1IXRC 5CB6A 3D7MA 4P4TA 4HYYA 4WVFA 5LD2C 3A1SA 3ZZ0A 5EE0A 3FMOB 5AUQA 4ACAA 1SHKA 3HYTA 3KQUA 2QY9A 4ZDWA 3IDQA 4R7ZA 2GEDA 4Q4JA 1E96A 1RKBA 1NLFA 2ZI5A 4LY6A 4BLQA 2BCJQ 1N3BA 4YC7A 2WWYA 1OFHA 4BFUA 2GWHA 5IHPA 4Q9LA 2F1HA 5JS7A 4XOIA 2J0VA 3CUEF 1TF5A 2JGNA 2WKRA 2FG5A 1VCIA 1E2EA 4I1UA 2O0HA 2WICA 3U44A 2RMKA 1E2HA 1HURA 3IHWA 4QM6A 1W36B 4Q7JB 2Z43A 3ONWA 1M8PA 1XJCA 4GOKA 4URZR 2GXUA 2ZUBA 2JLZA 2B7BA 4LHVA 1U2RA 1VCOA 1IM2A 1D2MA 1II8B 4LJ9A 4MDFA 3B7GA 3GJ0A 4XH9B 2DYKA 2EU8A 2F43A 2GXQA 2MMGA 2YV5A 3M4YA 5EP4A 2BVNA 1YRAA 3FPAA 3D6TB 5FTLA 2ZRLA 3GFOA 2UVQA 2OEPA 3LBNA 4OBEA 5TV2A 3LFUA 2OT3B 1GNPA 5KYKA 1P6XA 4ACBA 3CX6A 1XMSA 3MG9A 3THWA 4G5OA 5KSPA 2ERXA 3AVYA 1IN5A 3GEEA 2J1LA 5J4VA 4W5HA 1JQJC 1TQ6A 1NJFA 1YU9A 1VYUA 2KJQA 2YZ2A 4ZCMA 1LNZA 2ZJOA 1ELOA 2IS2A 5CIWA 4ARZA 3TLXA 2V9PA 3B6EA 3RS2A 1R7RA 4CYMA 2O0KA 4P33A 4IRUB 4KO8A 3FKSA 1GM5A 4B43A 3V4RA 4PQFA 2W2TA 4R2HA 1FOEB 3WMGA 3NBYC 3THYA 1OYYA 5F98A 4Q7LA 1NY5A 2BWJA 4JL5A 2X8AA 4TMXA 2A78A 1IN8A 1QDEA 1KZ7B 5F9HA 1S8FA 4UNPA 3QF4A 2OG2A 1Z0DA 3WRYC 2OM2A 1G3RA 3ZGXA 3L0SA 2JLUA 1OW3B 5EE1A 4HLCA 1RJ9A 3IGFA 2QORA 1XRJA 1GKIA 2FFBA 2BHRA 5AWFC 4DEYA 4LHWA 1VCMA 3AB3A 3CRMA 4NBSA 4LV8B 5AK0A 1XB2A 3VNVA 3VKHA 3EA5A 4EKDA 4RFSA 2AR7A 1DAKA 2OUKA 3IQWA 3RANA 3ZIAD 5DI3B 2QP9X 4HB2A 2J7PA 1CXZA 1KY2A 1FUKA 2PH1A 1N2CE 1U9IC 4TQAA 2J7KA 1DADA 2CL0X 4S35A 1IY2A 4Q1EA 2VP6A 2QBYB 1M1YE 1CLUA 2Q9AA 4NCJA 2H7VA 3BORA 1E9AA 2WJHA 1H8HD 3IQXA 4WAUA 2GK7A 3GCGA 5D3MB 3K70D 3U7EB 2C95A 1KO5A 1XTIA 3LW8A 3OIUA 4TZ6A 2F7SA 2YC2C 2JLXA 4DUGD 4CT4B 5EE5B 1GILA 2CDNA 1OHHD 3LRPA 1A82A 2JJ8A 4GFDA 8OHMA 3AM1A 2C96A 2D2EA 1T91A 3EZ9A 1W0JA 4PO8A 4JJKA 2G6BA 1HE8B 1E0SA 3CH5A 5JJKA 2GILA 4C0LA 3B1ZA 4NMMA 3E5HA 3SDZA 4DB2A 2QRNA 4OHVA 2VHUA 1M34E 4JMPA 4BLOA 4DSOA 4NZYA 3W6OA 2C2HA 1ZM9A 3C7KA 2JIZA 1ZCAA 3QVVA 5FTJA 3W8RA 5CM8B 4DLTA 4F91B 3EPLA 2IHYA 1NMYA 1Z22A 4A8JA 3EWSA 1OSNA
chains in the Genus database with same CATH superfamily
4DLRA 4M1QA 2H08A 1P5FA 2GEVA 3SF8A 1HQCA 3I01M 1YGPA 3KZOA 1OTYA 2R6CA 5AUOB 2ENUA 1ZRHA 4MW6A 1NUQA 5DSZA 3NBZC 3NEAA 4Q1BA 3VR2D 2LV8A 4ND5A 2F17A 4CG3A 1FDVA 2QY6A 1QQ7A 3ELUA 1M6VA 3CUVA 3FB1A 2IIBA 4S0XA 5DGTA 7AT1A 2B5OA 2GR9A 3D6FA 4WV3A 3CTPA 2ORWA 4QYMA 3OWHA 5TT1A 4CKCB 2F8TA 2PZMA 4D25A 2PGIA 4O3FA 3LBAA 3G2LA 5HJ2A 4DZZA 4BP8A 5JUWA 1F8YA 2PUJA 3OX1A 3Q9UA 4KACA 4L76A 2B30A 4LS3A 4LKOA 1Z28A 1PQYA 4IBOA 4CVNA 4A36A 2P90A 2C57A 1LDBA 4J0DA 2R751 3COZA 3UJ8A 3LRTA 4GPAA 3OU2A 5IT4A 2I1VB 3R7BA 3W2EA 1HZZC 3WK8A 3EEFA 3TECE 3MXOA 1WB9A 1CULC 1L5MA 2H2DA 4JWKA 2HLHA 4WJKB 3GEGA 4NHEA 1Z0KA 2QM3A 5CX1B 1CE8B 3KTDA 5BNWA 3LWDA 4RLFA 4OHZA 1II8A 2OP1A 3HSSA 2HJWA 1CZRA 4PEVA 5JSFA 2A84A 3GUZA 4GSKA 1J8MF 4TKMA 1BIFA 3VR6A 3OLYA 3AI3A 3I5UA 4ZALA 5BNIA 1R6AA 1I4TD 3T1VA 1NRIA 3MJEA 2MJLA 1BD4A 4MCIA 4NK5A 1AUVA 3UAZA 4D46A 1Y98A 5FWNA 5JSHA 2QGNA 4HYEA 4EPXA 2QAJA 3EGIA 3JX9A 1XQWA 5CB8A 1UANA 3CN9A 3A2KA 5CAEB 3CZ5A 1WW8A 3QV1A 5GJBA 1A5BB 3CBGA 3FDIA 3PVCA 5FR2A 1GZ4A 1QFJA 1HBJA 1X1AA 2ZSDA 2MOKA 1QQ6A 5LLSA 1QC5A 4ASUA 5MFZA 4FT4A 1R0RE 4OKSA 5HMMA 3VNBA 2O52A 4N47A 4OXXA 1LDYA 5T4FA 3ZU4A 2YHUA 3MLEA 3OPVA 4OHOA 4N5MA 1NVAA 3Q3IA 2A59A 2WAAA 3QI2A 3NWEA 5JCXA 4JYMA 2C4VA 4G1FA 2C2WA 4UOQA 1YR7A 2VAVA 3B6MA 4B6SA 4K6MA 3H99A 3ADCA 1TT5B 2EJCA 2IEBA 4IIBA 4KMOA 8LDHA 5DTRA 1RBMA 3KAKA 1RU3A 2DFDA 3T61A 4EVQA 5H16A 8ADHA 2ES4A 4IXMA 1ZESA 1QOZA 4HS4A 2Q1YA 2AOTB 3G9QA 1DKRA 4I4TA 3WLOA 3PEFA 4RF3A 1SCUB 4N5HX 2GERA 3BDVA 3WGZA 4WBSA 5K0JA 1WY7A 1IQUA 4MKFA 3WA6A 5A5VA 2RGEA 2I4MA 4DN6A 1QXSA 5ITZA 3QW4B 3R20A 3IUQA 2HCJB 4MO9A 4G24A 3ZGZA 1YZHA 3JQ7A 1RIIA 2AC4A 4XDYA 3R5HA 1MQ9A 5HHTA 2V7BA 3FBWA 3MMPA 3PEWA 4NPHA 3K0FB 3CE6A 5FUXA 1FCJA 2BFOA 1TGVA 1ZSVA 2EF1A 5EZYB 3TB4A 5K0CA 2QBYA 1RYEA 4BX9A 2PAAA 2D5LA 3N39C 3N28A 3PPIA 1XR3A 3WFIA 1EQUA 1O8CA 4C6TB 3ZD7A 3GMSA 2HMUA 4DG5A 2J0SA 2V65A 3DF7A 4I5IA 1Y9EA 1O94D 3AXSA 5D3MA 1QO0D 2AFIB 2RAVA 2W6MA 2WTAA 3TFQA 4DCSA 1PUJA 5IBPA 4FQ7A 5BOSB 4K8RB 3UGKA 5JAMA 1R10A 1SWVA 4JSTA 1ZDMA 5AI4A 3CW2A 1G1AA 1I0ZA 3L0DA 1L7BA 3EDMA 4M0KA 2VCYA 3PFIA 4IJ6A 2OYCA 2CSUA 1NVKA 3NIGB 3NTOA 4K9QA 4KOAA 3KL2A 5BW4A 2Z5GA 5HF9A 2W0MA 1FRVA 3IUEA 1H9CA 3PGKA 4F21A 4Z4HA 4MNTA 3WYFA 3LUJA 3PC2A 2P9HA 1V3VA 5JCPA 1TU0A 2FUCA 3DSRA 4DY4A 3RTBA 2ONCA 5DLDA 3A4VA 4IDDA 1L7OA 1W30A 2AK3A 2VF4X 4D3ZA 4RE5A 2GM5A 3ZHCA 4N0MA 3H2HA 5IC4A 4FGJA 4GWGA 1F8FA 1X7WA 1Z4IA 4NE9A 4QGBA 4YDHB 1YS7A 3SOZA 2Z4TA 4E22A 4GPEA 4AZ0A 2WFZA 1YQEA 4IHAA 3EXIB 1ODIA 5C8VA 3P9SA 3WA7A 3N9IA 4P3YA 3FVRA 4QGAA 3OF3A 4ZJPA 1Y9JA 1CFJA 3JRXA 4MOWA 3ZNQA 2JLYA 1OX6A 2CHQA 3TVTA 3TXXA 1C0KA 1V8FA 2F00A 2VEDA 4D44A 5JFGA 2GYUA 1CDDA 4AICA 3EGWA 4MDYA 2H2IA 1A4XA 1ONOA 3KFLA 3Q2KA 2C4UA 4LN1A 2NZWA 3RSGA 4C3VA 5EXXA 3CRVA 3KJIA 1TZ2A 2PO5A 4D0SA 2R6DA 1I9CA 2KLHA 1N2BA 2ZDHA 2J5BA 1UEJA 5EP2A 3UAWA 2Y76A 2CCJA 5KQPA 3QE4A 2QMHA 1U8UA 4J16C 2RJNA 3OZBA 3K0HA 4ZMRA 2XRZA 6Q21A 1FLNA 1PR3A 2GPAA 4OMDA 4CLEA 3KJNA 1RVDA 4AG6A 2BC9A 4I1IA 1X1SA 2EKLA 5B7QA 3OZIA 4G1VA 4KQCA 5HJ5A 2A0KA 4NFHA 2B94A 4YUYA 5A4FS 3QMWA 5A6SA 5J47A 2YHSA 3N6RA 3NETA 1HDYA 2IHVA 1FPQA 5JI2E 2O2YA 4HJXA 2QE7D 4NTZA 4PZLA 4WLVA 1LRLA 2EQAA 4HVLA 3NM5A 2P2CA 1IBRA 1NQXA 5LJLA 3NHMA 3HBNA 5BVGB 3ZY3A 1Q3TA 1W0KA 1H1TA 1P5ZB 1VE9A 3FYSA 3ML1A 1WUKS 1Z18A 1QH8B 2G5PA 4TM7A 4TLAA 4F3RA 1RYFA 4MYSA 1DCTA 4EA7A 1JLHA 1WA5A 1QFYA 4L9RA 2FW7A 3TZKA 1U2GA 1UMDA 2B9EA 5KZMB 3JPYA 4DR4B 2WB2A 4A6EA 1G5HA 1L7MA 4GMXA 5EMKA 1Y0BA 2XNDD 1CVLA 1Q57A 1Q77A 3PZRA 1HDEA 1LS1A 3P4YA 3GRUA 1N6NA 4NPCA 1RQPA 5EFOA 1GDDA 2BM0A 3CLKA 3RYFA 5JXJA 4MUAA 1UBCA 3JATA 3QPBA 5BW6B 3WSWA 5GOZA 4BC1A 5IPFA 2DR2A 1QX4A 1E2KA 4ATNA 2ZPTX 3CUYA 1B3BA 1J9ZA 2X13A 1FNSA 1TCAA 1YC2A 5KJEA 4DE5A 4RH1A 1I0LA 3HSKA 3LP8A 3CZ4A 2NYAA 4G0VA 1Y6ZA 4MWZA 2VNIA 2FPUA 3GVXA 4BWGA 5LYJF 4FX5A 3C3CA 4ZWNA 3H5WA 3G68A 3IIEA 3IKVA 4GX1A 4BKOA 4BEVA 4MVYA 4EW2A 1U0HC 2IW3A 3C5CA 2FFAA 2JJ1A 1EP3B 1C2YA 3FVWA 2X23A 5B6IA 3L49A 3NH9A 3GT7A 5E95A 4Y6QA 1A8QA 1T34A 2VJMB 4KGVA 1LV7A 1YBVA 4XGNA 3WP1B 4B34A 1PZHA 1LI4A 3IOYA 4WDQA 4CM4B 1AHHA 2OVBA 5MN6A 3SCZA 1OYVA 1WDTA 1A5AB 3NI2A 4LE2A 5E1DA 3OZXA 1L9XA 4LHEA 1NUTA 1GTZA 1Q7BA 1TCVA 1OIXA 5KSZA 1UK6A 1R4ZA 2P9YA 2BZ0A 1EHCA 2XA9A 5B1IA 4Z3KA 3C1TA 4IYJA 4QJIA 4BJ3A 5DCUA 2YN0A 4DIKA 4B7UA 1EESA 1LTKA 3O9ZA 2X2OA 4TL6A 4DYHA 4EGFA 3GEMA 4J4HA 3L07A 5ARDA 3S5JA 2Q4OA 2RH8A 2YWGA 2D2FA 1CUZA 1IN4A 2XHEA 2AXEA 4Q4AA 2Z6AA 4NU6A 2C94A 3HL0A 1IMJA 1P0QA 1QTIA 1X77A 2REQA 3EQ6A 4QWMA 3NBUA 3B5EA 2C59A 4L73A 3HM9A 5IJ9A 1UPCA 3DFZA 1A8UA 3M5WA 2XOKA 4ALKA 3JW8A 5JS2A 5M34A 3UT6A 4L6AA 4GBJA 3V8MA 1NE2A 1PBTA 4FNMA 2YS7A 4R16A 4P5DA 5LQKA 2CLFB 3ZTYA 4M0CA 3R7NA 2XECA 2BR4A 5L3SB 1UOEA 5LMNB 2IBMA 2JS7A 2QTZA 2GN2A 2R60A 5F73A 3RBZA 2X40A 1FNMA 2AFIE 3AO0B 3HS3A 1YS6A 3KB1A 2H31A 1XD8A 4MKGA 1XFAA 3EAQA 5TT0A 5H8WA 1A77A 1SRQA 3BEOA 3K20A 3Q72A 5CNKA 1VKOA 3E23A 2HHCA 3MBIA 4CCSA 4MAAA 2DTEA 2BHNA 4DABA 2W71A 3VM6A 2R2AA 2X3UA 2YW2A 5LZ5A 2CLDX 2OD7A 2QN9A 2HCBA 1KHTA 5D51S 1GSHA 2V7UA 1UINA 4NK4A 3BH6A 2FKNA 3F0TA 2V1XA 3AOEC 4ZYTA 1N7IA 2NUPA 4X62B 4D9FA 4GQBA 3BGVA 1R0CA 5JJLA 4D42A 5FOUA 2EDAA 4M9RA 5TGTA 5BVHB 3IRUA 2PKYX 2K2QB 3W78A 2HR1A 1DGQA 2PUWA 1TJNA 2ZIVB 4N76A 3AUKA 3E84A 3SX4A 1BDMA 2V7QA 1R0WA 1T8UA 1VPLA 2JLSA 3PSAA 4R1TA 2FR8A 1P45A 3K2EA 3UK0A 3NHUA 3CG0A 1O1YA 1OPXA 2G77B 1P1IA 3SX0A 3A2LA 3UV7A 2UZ4A 1ATIA 1BA2A 1XJQA 2NZ8A 3C39A 3U4QB 4OUDA 5IDQA 1EFHA 2AVNA 3JRNA 1IJFA 5JJBA 4YJ3B 4G09A 2PXXA 1JLRA 2CVHA 1OXUA 4NYJQ 4OXYA 4MI6A 1HEYA 1XI2A 4HY3A 5DO9A 2QNBA 4GNKA 1GKLA 2VWPA 4AX4A 4FN4A 5EYPA 1M0TA 2EW8A 4RACA 3ZTTA 1GG8A 2XCIA 2I7CA 5CM2Z 5EA2A 5DSTA 1Y8QB 1DOHA 3B8HA 4KGZA 5DEIA 4U0JA 8ATCA 2I0FA 1R4NB 3HKDA 1I80A 5CLJA 1UT6A 4FGSA 2H54A 3AFIA 3DYBA 5K8UA 4YCDA 2CVZA 1W46A 1OGYA 3Q88A 1A9ZA 4RTNA 3L5KA 1BXRA 2O8DB 4YI3A 4DNPA 3EVZA 4V0NA 3BWEA 4G4SP 4MRNA 1P8AA 4KRGA 3UT5A 4BUZA 2QUBA 5MF6A 1GYQA 2PK3A 3RK4A 1Z6XA 3TG8A 2CXOA 1M5UA 5DM1A 1EE2A 1NW6A 2Y4OA 1G20A 3RVJA 3RYHA 3UK2A 4ARZB 4NOKA 4MKXA 3RUAA 4J6EA 2J9FA 3MSXA 2XWJI 1JVBA 1DXHA 1JTEA 2PEZA 2XYVA 2ZE7A 3QKIA 4YJFB 2ISQA 2NO5A 2R8OA 4OGFA 4ZVTA 2XQFA 2RHMA 1RHJA 2C9OA 1XYYA 3DE5X 4P83A 4C05A 1A9RA 4KREA 3MRSA 1OLSA 2OCAA 3H2ZA 1P7PA 1EWVA 3ILHA 3OHSX 1CNFA 1GGFA 4NYMQ 3ZLTA 2IQ5A 1NSTA 3F4KA 4K03A 5KNCH 1FFDA 3W9SA 4I7EA 1S8AA 2TECE 1LBTA 3EDRA 1SBIA 3NHJA 1JAXA 2VSOA 4UEWA 3VOTA 5LMZA 4FGZA 3DHVA 3FPHA 4Q3DA 1DQZA 1N6PA 1W85A 1KJZA 4Q0MA 1J0AA 4EHDA 4XQ9A 5DE3A 1QCCA 3U6KA 1G0OA 1SUCA 4MQ6A 4OHFA 1PHRA 3IAHA 4W5NA 3RK1A 4EEZA 4IUYA 2XB4A 4TPKA 4RSMA 1HG0A 4H4CA 1SZCA 4PZCA 3HCRA 1A8HA 2OHIA 3AI7A 5GJVC 3T3HA 5DZSA 1ZK0A 2ZBEA 1OWMA 3I2JA 2GZSA 1XEXA 1YUNA 2EKDA 4XWOA 4M7RA 3U4DA 1NM5C 4ZVNA 4R3NA 5A0VA 2P77A 3FH0A 4W7SA 4CG2A 2BFAA 3ZLJA 2AI2A 2X6RA 3R3JA 4Q03A 1JKJA 3NPAA 1ESNA 3NX4A 3VR2A 4ZMSA 5BQOA 1GQFA 2X7XA 3AM3A 3W79A 2IXDA 4B76A 4BRWA 3UKJA 8AT1A 1U31A 1T3HA 2XB6A 3EVGA 4OLBA 1WPRA 2VZ8A 4ND2A 5TE9A 5B30A 4FS8A 2CLEB 3CIOA 2Q7DA 3QVUA 5J5AA 1KIMA 1VXOA 5ADUS 1FQKA 3HKEA 5DNDA 3HJAA 4YREA 1S89A 1V35A 1FK8A 1HWYA 1ODLA 2VUIB 5FNVA 3FWPA 5T6BA 2RB4A 3OCJA 3DDNA 3OTHA 4CLDA 1G8GA 1RXSA 5BWBA 2ZWMA 5IBQA 4A8JB 3RK0A 5KYUA 2QQGA 3HCWA 3D6VA 4BMDA 1EK1A 4ESHA 3C4QA 4LK3A 4RFLA 2DFPA 1WUIS 4EHNA 5JBQA 1ZR2A 1SU4A 1CV2A 4RS4A 2XTZA 5JZ9A 2YS6A 4Z53A 2XE6A 4QPPA 4YJDA 3VH1A 2ZIFA 1RPAA 5AW7A 1ZVKA 1IWOA 3BXFA 5KC9A 4PRLA 2ZSIA 1GRCA 2ZUVA 3TRHA 2VF5X 4F38A 4OD0A 4B6PA 1UK7A 5CCBA 2HNBA 4C0SA 1RAEA 1J7JA 2EFYA 4PSUA 4IM7A 1ENOA 2F6RA 2ZIZA 1NF3A 1PWEA 4JR0A 2H1CA 4RS3A 4B2PA 1ZN9A 4L5AA 3A6DA 3K96A 1XEWY 3FVVA 2WP0A 3SZUA 2HWUA 1UKZA 2FGJA 4ZDKA 5A7FA 1YZYA 3QIVA 721PA 5BV1A 1KP9A 2AG0A 3L0PA 4LWZA 1HLGA 3L7IA 5EVJA 3SHWA 1F6BA 3S4YA 3PX3A 4MTLA 2I03A 4HZGA 5DM0A 3UWPA 4HOYA 3W2IA 5CT5A 1T2EA 3AHJA 1GR1A 1BN7A 4GZMA 3IT1A 1QAMA 3LLSA 4IHQA 1WQ3A 3H83A 4OI4A 1QBGA 2V4UA 3F9IA 1ZGHA 1TZCA 4JH0A 2XIJA 4AXXA 4BO5A 2JFOA 2PJZA 2E4AA 4EZEA 5K3CA 1S02A 3W7VA 4XR4A 5ALVA 3L5OA 2OESA 1JVNA 1EFVA 3G88A 1EP2B 1V48A 5H5JA 1J9EA 3K5HA 2YZKA 1GGVA 4DNXA 4FB5A 3NHAA 4OLHA 3AVTA 3L8FA 3PFBA 1ZEJA 2EG5A 3HRHA 1WOMA 5EI5A 2JGDA 2LZ0A 5C80A 4LCBA 4B3RB 4J07A 3AF6A 1JXMA 1ZGAA 4XEHA 1W94A 2XVYA 3W9BA 3W9UA 1D2EA 1S4QA 3UJAA 1QRUA 1PYOA 4YPFA 3Q7EA 1WDWB 2ODWA 5ELLA 3HA2A 3IELA 4R31A 4UDYX 3CNEA 1NHGA 4GMDA 4ND6A 3H2JA 4WE3A 3OIFA 4J6FA 1SBYA 2IYZA 3LY8A 5EKDA 4BEWA 1V11A 4HDAA 3LVBA 2B37A 1JF8A 1W1WA 4RPGA 3W7BA 5JSZB 1C7IA 3B70A 3D5EA 4OQQA 1X8LA 3AJ9A 3G5TA 4CLHA 1GU1A 1NQAO 3AHHA 3TIIA 3RH0A 1PG2A 5AI8A 3FHLA 5GADl 1DKQA 4NYIR 1IG0A 5DWQA 1VYVA 3D8TA 1AO0A 3PFCA 5A1TA 2QLJA 4IICA 5ALLA 5I5EA 2Y2UA 3MT9A 3L7OA 1Y4SA 1O94A 4DCCA 2YINC 4L0MA 1CRQA 3DOEA 4KO4S 3IBYA 3DHNA 3GV0A 1O5TA 4U2KA 1ZD3A 2XODA 3GY0A 3QE3A 1PKXA 4IAOA 3A3PA 4KDCA 4CEIA 1R1DA 3ZXIA 2ATVA 4UJ5A 4B40A 1O96A 1N34B 3OSUA 3N2KB 2LXNA 4IIHA 4QUDA 1BJKA 1XVLA 2M6KA 3ZHOA 4YCSA 1DT3A 3VMFA 2JD1A 1TD1A 4M1EA 4YJHB 1H4VB 1AN0A 2F9MA 2YJ5A 1Y7HA 4MGYR 3JAWB 1Z8FA 4CUZA 1JHUA 3Q7SA 3K6RA 4A1OA 2GDJA 2QJTA 3WI7A 4MINA 3ECCA 3PU6A 2EEPA 4IY1A 3WRWA 1F2TA 4HUJA 1MEJA 2X7HA 4M0LA 1ND5A 2YVUA 3G0GA 2XD4A 3NG1A 4KGXA 5JXIA 5KOHA 3F6BX 1VG1A 4NZMA 1XV5A 1AKRA 2CB0A 1KFKB 1SXGA 2HIAA 4QG7A 1Z4JA 4ZICA 5BR7A 1I7DA 4RF2A 5EIAA 5KWEA 5L4SA 4RJKA 4K86A 4UCWA 3S3TA 3HMKA 3GMIA 4LZNA 3K9BA 2H85A 1DZ3A 1SXJD 1D0SA 3DBHB 5F9FA 1T9AA 1Q1AA 1VYHA 4MVJP 3T52A 3QA9A 1FL9A 3DMYA 4WZZA 2HHJA 3QFHA 2EGUA 5CA1A 1T3ZA 2H8KA 3P9ZA 4HXFB 1MNAA 4HRYA 4OXKA 4DIFA 4YCLA 3TFWA 2ONYA 2E9SA 2A30A 3F78A 3NASA 4OM7A 5HIMA 3ODPA 3QG1A 2PZBA 5JATA 2EZTA 2O2XA 2M6SA 2PRJA 3R4CA 5EEGA 5LBTA 1BYUA 3AINA 2Q8NA 5D84A 4AF6A 5B12A 1L4BA 3VHXA 1ULHA 2GTIA 3H0KA 3MJHA 4MHTA 5T8KC 3EW7A 1TB4A 3HBLA 1Z6AA 3OLVA 4MRVA 5M3BA 3ZWYA 2VXYA 4EDFA 1UC5B 1BDBA 1JR6A 2XUGA 3EF3A 1N0WA 4X24A 3OZFA 4ZRDA 1SD2A 5CXQA 1VHWA 3R0ZA 3R24A 1CDEA 1L3CA 4QPNA 4DT1B 2AEEA 2FP3A 5AKLA 5IXYA 4PYOA 3DV0A 3REQA 1C1XB 1W48A 2PRKA 2Q1TA 3H2SA 1G9SA 1NFRA 1S3FA 2KM1A 1A95A 3FOWA 1B6GA 1I1OA 4Y7CA 1XDWA 5J2UA 1MIOA 2PQ0A 4F9GA 2B8NA 2CK3D 4N7MA 3H1GA 3ZPXA 3ABSB 4IHJF 2VP9A 3U0BA 4RKWA 3I6QA 1NP6A 3IPCA 3V9AA 1PEDA 3WLAA 4MRRA 3CH7A 4RENA 1U5CA 4BX0A 5KVSA 2B5WA 3SQLA 5A3JA 3FFBA 3OURA 1BHJA 2C07A 2VNKA 3BPSA 1L1RA 1RWXA 3GFTA 1IE3A 3HJCA 4D02A 3L1UA 2Q1SA 4N8DA 3T1TA 4WERA 3URKA 5TMDA 4NEQA 5DISB 1OQAA 3OQHA 3TN7A 5AVWA 5I8PA 3UJNA 1IVSA 1E2IA 2IFTA 2IYVA 2AG6A 5T4HA 2PS1A 1N57A 2HA4A 5DT2A 3PXGA 3VI3B 4DMCA 3G0DA 2CUTA 1MC4A 2I1WA 3GDFA 4D3FA 1OXBB 1GCOA 2WFLB 3BIWA 3N5KA 4ZI3A 5U9CA 4P53A 3VR3A 1SIWA 3QY0A 1KR5A 5JPIA 4EL0A 3NHBA 3GHYA 2TRSB 2QRMA 4IIFA 1KZYC 1K7CA 3A9TA 4R5HA 5FR1A 4CQJA 4C7XA 3TOZA 3DHEA 2HMYB 3ID6C 4QC2A 2NU9B 3MYRA 2WWVD 1C80A 5AUNB 3K16A 1D3AA 3KXIA 2WWIA 4HSGA 1CVIA 4YP7A 5JS1A 3PJEA 1AQYA 4KQHA 5KNDH 3QLEA 4LQLA 1UPUA 4KAFA 1JLSA 2E18A 3QJ5A 4MVJD 4XM0A 2WWHA 1X70A 4Q37A 4TTVA 3P0IA 2VUSA 4C06A 1VCNA 4DSTA 5AVUA 2PWPA 3AT1A 4S3MA 1KRXA 5IKOA 3BDAA 1OWPA 1B1CA 4J4BA 3ANSA 4N7JA 3LP6A 2PUAA 1Z7GA 1SY7A 2HCRA 1I7LA 3EZ6A 4I8XA 2QW8A 5CNIA 4LF8B 3R7WB 1UOQA 2FRXA 4N9WA 4D74A 3ZQUA 4B35A 2C2ZA 2ODAA 1GFZA 5F2NA 2E4XA 3O4VA 4QBHA 4Y1RB 5A4JA 1NULA 5JXWA 1R0ZA 2AH5A 1HDRA 1MPTA 1SK9A 3LX6A 4J9UE 3EZNA 5DK6A 3SFZA 1ZGCA 2O1SA 2IDKA 3BB1A 3QQ5A 4ZV7A 5EP1A 3RRXA 1NUSA 3TSYA 3C8DA 3NIBA 3T3DA 1ZS9A 5ED4A 2EFEB 5FOXA 5K20A 3I1YA 1MQSA 3LPCA 1JXQA 3P0HA 1BS2A 1UK9A 3EFEA 5D3QA 1YVRA 4B7ZA 4KO1S 1GN9A 4QREA 1DQRA 3X1JA 4RWZA 1GQ2A 3HYLA 1KU0A 3UG7A 3MRVA 2DKNA 4G4SO 5TQJA 4DA9A 2DLCX 4IMPA 2Q2WA 2XDAA 5JANA 5JNSA 4X44A 3V4PB 2VDRB 9ABPA 1UBOS 2OILA 4RXMA 4TT3D 2I7TA 1XIVA 3F9RA 3PXBA 5E8RA 3CG4A 4DLSA 4GYYA 4H3SA 5IT9A 2PMDA 4MUEA 1TUEA 1PRYA 5J4YA 4UBLA 5EHNA 3T9BA 4FSDA 4I4CA 1SCNE 2IPMA 4EYOA 1EIWA 2B2XA 1UPTA 4G6ZA 5K3DA 2VUUA 2A4MA 4YPVA 1IQPA 2XEDA 3E2PA 3TRKA 4PANA 3EEBA 5M29A 3QNUA 2Q5OA 2FPPB 5HFAA 3ZLVA 4YUAA 1GFIA 1PR6A 2YZMA 4FLEA 2J30A 3EH2A 3H9UA 3JVIA 4QHTA 4OHRA 1ZH0A 2J3KA 5CDFE 1F20A 1EVYA 3FROA 2FPIB 1SM4A 2ZJBA 5FADA 1JX6A 1OKKD 1MJNA 2A5GA 3HGTA 5DM4A 1ZVMA 3E3AA 1E79D 3ZWVA 3M83A 5CLFA 3SJCA 3AOGA 4EIWA 1ADJA 1GG9A 3DZFA 2VBCA 3FOBA 3MJVA 5LWHA 2QPTA 1WQ1R 1O95D 3ZI0A 2R9VA 3TTXA 2DQYA 4Z4QA 1A98A 1SVOA 2V6BA 1RJDA 3AYZB 3LC2O 2EFGA 4G4JA 2F55A 3GAFA 4CLOB 3N2EA 3OF5A 4O6VA 3MSCA 2IYNA 1NJ5A 2FR1A 4L7VA 4U2DA 3RABA 4TYMA 1DCKA 1EBFA 4CR8A 1XA4A 4RNDB 4PLZA 1ZM3A 1Z0ZA 5TPZD 3T0FA 3DQQA 3ADPA 5AK5A 5FB3A 5F4ZA 1YB6A 4V02A 4CCYA 3OICA 3IBGA 4QAQA 2D1SA 2Q6IA 1MORA 3CEJA 4C7VA 5TS2A 3D6UA 1JIUA 2I62A 1ZD5A 2MYPA 3QX9A 4P5EA 1I1QB 1NYLA 5E4JA 5DN6D 4YCNA 4WEQA 2VCHA 2XZLA 3G2HA 1YDFA 2VH1A 3STUA 5ITVA 1TM4E 1VQ1A 5DTMA 2Q0HA 5H68A 2Q6OA 3CPHA 3V80A 3RLFA 3RO7A 4I6GA 3OLZA 1OJ7A 2CKMA 2P9FA 3DAOA 1DKOA 1TECE 1Z4NA 2Y66A 3FKJA 4BN4A 4CV0A 6AT1A 3OTQA 3OX2A 4YB8A 2O2ZA 2ZSHA 1RXVA 1PN3A 1DXQA 4UM5A 2LR0A 3DT8A 2DKFA 4MB2A 1RC1A 4UCQA 3ZW7A 3VPAA 1P4AA 4TT8A 1F0PA 3H5TA 4DCVA 1L3IA 2CBGA 3QVJA 1CUHA 2ECKA 1DVRA 3TE7A 2UYCA 4J7UA 3CX4A 1MB4A 5FI1B 3LWBA 1RQ2A 1KL7A 2EJUA 2HOQA 2LCFA 3C43A 3DVQX 3ROZA 1EWKA 5LOVA 3W5UA 2P7IA 4EB8A 5ICCA 1G59A 1PGOA 2OXTA 1EB9A 2ZVDA 3H4VA 3DOOA 4MO2A 3P9IA 1HNWB 4D4JA 2QZ9A 3GLHA 4P32A 4FEAA 1UDCA 3CF4G 3RWOA 2EKZA 3MQ4A 3WLMA 5MFPA 1AKYA 3FOFC 1PJQA 4BP3A 4CM7A 4FR5A 3B8EA 2C4WA 2H51A 4KNVA 2I99A 4OQYA 4RD0A 4IIXA 1FRNA 5KYVA 4MMZB 2JIRA 3M1LA 1P39A 2EHJA 4R0NA 2Q1WA 1Z5OA 2HGZA 3KX2A 1OU4A 5JSYA 4BX3A 4EARA 1CP2A 1HMYA 4DSUA 4CMAA 4QQNA 2ETVA 3S2YA 3IIJA 4ML3A 2P5TB 4NKRA 4OGGA 4Q6WA 3W8DA 3RNOA 4LXXA 3E48A 1UBFA 4EG1A 1P31A 1MKYA 3VX4A 4E5NA 5JDIA 5IZCA 2WVJA 2WWRA 1S4MA 1SUWA 4MQEB 1EFLA 1E6CA 2W6CX 1WDKA 3E7FA 3RLIA 3HHPA 1NVVR 3KP1A 1FVXA 4ZVKA 5BVGA 1WUJS 3HXTA 1AB5A 2GD1O 2GM3A 2HQBA 2NU6A 4PXSA 3ZVRA 4DEXA 2FN3A 5TPWA 2C8JA 1B73A 2K4MA 4JC4A 2I6FA 3DOFA 3ZVKA 2O07A 4M76B 2ICAA 3DM9B 4ZRNA 4EG4A 2NTEA 3J81A 4DMHA 4P92A 3E53A 4TMVA 5J4HA 1NNSA 1E0JA 4QOHA 2FZ5A 2P2LA 4B4KA 3RROA 1E2LA 3N3BC 4LGYA 2D5AA 3KBOA 1YHYA 5C7OO 4Y9DA 3MK31 5CLQA 3B6JA 4S1PA 3WYAA 3NEJA 4BQSA 4QVIA 1X7XB 3F7TA 4PFSA 2GPBA 1BE0A 2I2CA 2J3JA 4X7MA 4BNLA 3I9OA 1NBHA 1IPFA 5GAJA 1JH8A 3HGMA 3U4CA 1UUFA 3W5JA 5EMMA 3V1KA 1N5DA 2O8EB 1TK2A 1WMBA 3CKYA 3UWDA 3VR5D 5BSTA 1YDEA 2GD0A 3DD5A 1LSOA 2PKWA 1N5MA 3VSDA 3ZHZA 2JBAB 4MHOA 3DMRA 1XFDA 4PLHA 1Y5IA 1N77A 1MDBA 4C9BA 3A3KA 3EC1A 2ZTMA 4AY4A 3VYUB 5E9QA 4JBXA 1UM8A 5EPEA 1EWYA 2KLBA 2X2EA 1U94A 4PVCA 2Q7OE 4BZQA 2PCJA 2G0NA 1O9GA 3FNBA 1TVKB 4MYCA 3S68A 4E5MA 4F60A 4DDWA 4KR7A 3IV6A 5HCUA 2FRVA 3HDHA 2WJYA 4UZSA 4A4DA 3FGNA 4IPTA 3LT5A 2PUBA 2XDQB 4MW7A 1DG9A 1DG1G 1GPDG 2Y0PA 2B2CA 1VMAA 3NJ8A 4MMYB 4ZYZA 1B23P 2AKAB 4HWGA 4P80A 5E9WA 1CUBA 4RVCA 1TVEA 5TY0A 2JI4A 3A3OA 3RVRA 4XVCA 3GAAA 2I6TA 3O2NA 3P4XA 5GINE 4ZPXA 2V03A 4EW6A 3H5AA 3RVMA 4DQKA 1SBHA 4R1LA 1GNSA 4DIOA 5KPJA 3WB9A 4QUHA 1XRQA 3N8GA 4ZDIA 1J25A 4RY2A 5HSGA 4EEKA 2HX1A 3ST7A 5EGSA 3OPYA 1CBUA 2HB6A 3G0BA 3UXYA 2JI7A 4LJRA 3H9EO 3FGPA 1LC0A 2ZPUA 3Q3JB 4FBMA 4DREA 2PJDA 4M49A 2HGSA 4UVIA 4J8PA 2G3YA 2J5QA 3D4LA 1KVTA 1W9MA 4D4GA 2FPOA 2HMVA 1XTBA 4BO2A 4JY7A 3IUPA 4V03A 1M6EX 1RPJA 2HADA 3BXGA 1YJ5A 4K26A 4O59O 4TLCA 4RDCA 4WY8A 2VR1A 3EGEA 4ZCSA 2NO9A 2WM9B 3DLCA 1EH5A 3TLGB 2VA8A 2MSLA 2FN8A 3JQBA 3QFSA 2ZXUA 1CU1A 4FFPA 4HTFA 3VXKA 3C1OA 4A15A 3K8OE 2VAWA 2BFFB 4JFAA 2G1PA 3U4MA 3ZNNA 4R2KA 4JLSA 1DXYA 1AK9A 3BMOA 1F3LA 3DO6A 1TEHA 3L8DA 1MU0A 4QAJA 5BYJA 3TQTA 5KQMA 1WX1A 4AO7A 1JPNA 3X2SA 4JS0A 2JANA 3GROA 2XXJA 2C4MA 1EHIA 5CDHA 1H0RA 4R0MA 1A88A 4B31A 4P0PB 1W5BA 3FVTA 3WQBA 3G5MA 4D8TA 1QMPA 1QRTA 5CXUA 4MW0A 4PCAA 2X76A 1NVDA 1MO2A 2GDZA 3C7CB 4C1NA 3ED1A 3R5FA 4IWXA 3A4NA 1DIGA 1DARA 3NUGA 5LBIA 2DEUA 3BWYA 4DL9A 1JDJA 3EG9B 4AS1A 2KQUA 2OD9A 2NQ2C 4ZGBA 1V37A 1Z0UA 3RUCA 1RT9A 4KI0A 2BMJA 2DPHA 8ABPA 4EI9A 3UWOA 3LYAA 3RFTA 4Y30A 4B4DA 3KBBA 1NKTA 2D7JA 4NENA 4ARBA 2KX7A 5IDWA 2ZJ0A 4WZAB 2ZTUA 4C5AA 2ZYDA 1M6NA 4H1UA 3EIWA 4YMWA 3RVLA 4E6EA 1LK5A 3EH1A 5D85A 1URPA 1RDFA 3WC4A 1VIAA 3I2FA 1G8YA 3TBKA 2V54A 3MEQA 4GYJA 3RTDA 4Z51A 4O08A 2Z3VA 1MX3A 3IMKA 1TQ8A 3CB2A 4W7IA 4UXJA 5BYAA 1ZNXA 2Q4RA 4HB3A 1NBEA 2YJNA 4M98A 3OFKA 5JALA 5LZ2A 3FOAA 2WU8A 1QGYA 1Y1TA 3D9QX 2VHZA 1CF9A 2VRBA 3HL4A 3PD1A 5HUJA 2H0AA 4C08A 4HWKA 1POXA 1SA0B 4RA9B 3SSNA 1FDTA 1WV0A 2O54A 1LPAB 2DMRA 3JYPA 3G23A 4I4IA 1U2GC 5EZSA 1XEAA 1RCUA 2XE4A 3KJZA 1G1MA 4CL2A 3EFOB 1WETA 1P7WA 3VGJA 1QE5A 1ZD8A 1YVPA 4NFLA 4B46A 4EQ6B 3RYIA 4U8HA 5C3UA 5A3QA 2FWIA 1A4IA 2PKEA 4BEJA 4RHCA 4ZO6A 1MX1A 1QGUA 2EX1A 1T8YA 1QVZA 1ZHOA 3N2ZB 4XPIB 2J87A 4YA6A 3JQAD 3K4QA 4DBLC 1HE4A 4GC9A 4MQLA 4M0MA 3QQPA 4RVOA 5DI9A 3HFGA 2X9NA 1SHZA 2B36A 3DZGA 3HVIA 4YDRA 3R75A 3M82A 2OENG 3OECA 4RK5A 3CLTD 1NTRA 3MT8A 5FTMA 3AB8A 1IY8A 4JP3A 1SKUA 4AK9A 5DW3A 1N7HA 3H75A 4ZAGA 2UZAA 1Q50A 1WMAA 5I9BA 2HK9A 3P0EA 2PKXA 1ISIA 3C8HA 1AU9A 4G5YA 3NEPX 3BCHA 2CK3A 5FTKA 3TMYA 3VBCA 4D2IA 3L77A 2UYQA 4AL4A 2UUAB 4H6WA 3EOZA 1VGVA 5F12A 5A3VA 5JZSA 4PO9A 1CG6A 3W8NA 4DR6B 4QXRA 1B1AA 1NOIA 3IEXA 4Q24A 1U8YA 2F1JA 1DWUA 3T54A 4YRBA 1EM6A 4HDNB 2WNSA 4JR1A 2GCGA 1JJBA 3IVXA 1D8AA 1FRZA 4CKBB 4J0IA 4XSVA 4BNDA 2DUNA 3DWIA 3GJ8A 2V3VA 4W1PA 5KCZA 5HF8A 3SEQA 1A7JA 1QFMA 1Z4PX 3GZJA 2O5RA 4X60A 1R9NA 1DUIA 4LHZA 1J9GA 3E3MA 2VHYA 2XA1A 3MCUA 4C03A 4HB0A 3I58A 1OZHA 3RBVA 1NOJA 1NW9B 5UKDA 2PV0A 2SCUA 1JR3A 2G5TA 3E9ZA 4MPPA 2FWRA 1P72A 4Q9KA 1GP2A 1LPNA 4MWDA 2HHHB 3OESA 4IKEA 1A50B 1H2FA 3GQBB 1YWGO 4RPIA 3V6LA 5CTJA 2IV3A 2ZRFA 2JVJA 3EZFA 2YMLA 3K0CC 3LL4A 2JZCA 3HJNA 3BJZA 4PONA 3RTAA 4EENA 2Z9DA 3E61A 3BWMA 4N7BA 5EWJB 3S2UA 1SUSA 2GHIA 2P8JA 2V7PA 3P94A 5EXEA 3VKUA 2NZVG 4CLRB 1ORWA 2NMVA 4DCTA 1G3UA 2VDOB 2VL7A 3MD9A 2CVQA