5GJWC

Structure of the mammalian voltage-gated calcium channel cav1.1 complex for classii map
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
197
structure length
178
Chain Sequence
VPPYDVVPSMRPIILVGPSLKGYEVTDMMQKALFDFLKHLFDGRISITRVTADISLARSSLAEVQSEIERIFELARTLQLVALDADTINHPAQLSKTSLAPIIVYIKITSPKVLQRLIKSRGKSQSKHLNVQIAASEKLAQCPPEMFDIILDENQLEDACEHLAEYLEAYWKATHPPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Voltage-dependent L-type calcium channel subunit alpha-1S
publication title Structure of the voltage-gated calcium channel Cav1.1 at 3.6 angstrom resolution
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Membrane protein
total genus 49
structure length 178
sequence length 197
ec nomenclature
pdb deposition date 2016-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00625 Guanylate_kin Guanylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5gjwC00
4KJZA 4PZLA 3QE0A 1WBBA 1KJZA 1TUIA 5FTNA 5G3YA 1KK3A 4C0LA 3SN6A 3BB3A 2GWHA 3ETLA 4B3DA 1YE8A 5HPYB 2CLCX 3L8ZA 2BIFA 2NO1A 3K0FB 4JLJA 1W47A 1Z0KA 1MO3A 4TWZA 4C0HA 2GJAA 5IF9A 4DLWA 2ATXA 2GTPA 4MUAA 1EWRA 4BFSA 4LYJA 2CBZA 2BJWA 3HWSA 3MAAC 3MG9A 4RFVA 1GILA 2RAPA 3RDPA 4PX9A 1E2MA 2ZANA 1HE1C 3O47A 5B2ZA 1N0WA 3MRSA 3TLXA 4QGGA 4C0KA 1VCMA 1D2EA 1D8TA 1FTNA 3QUSA 4EFMA 1K8RA 4GRAA 1JJVA 1FNMA 3RHFA 5FOSA 3WY9A 3BS4A 1I4TD 5L3QB 4J0QA 2BEKA 3THWA 2K5UA 4B32A 2EU8A 2YINC 3TAHA 1P6XA 2A2ZA 5FOXA 4MGIR 3P27A 4D81A 2J5XA 2ZVQX 1EESA 2V3CC 3AVVA 4JBXA 3WBJA 3TSWA 2VP6A 2ZE6A 3MWJA 3WHLA 3K9GA 5IDVA 4RD0A 3GLGE 3LWNA 3U61B 1ELOA 3LLUA 3ZDQA 3VAAA 1ZM2A 4N0DA 3VR2A 2EYUA 1CBUA 2DFKB 4D82A 4DWJA 1IY1A 1N5IA 1U0LA 4D0LB 4O2LA 2YVUA 1LV7A 3BJIC 3QKTA 3WP0A 3GEEA 2VP0A 4PPQA 2HV8A 1L4UA 3SFZA 5AUOB 1GL9B 2ZXUA 2OEPA 2QORA 1FQJA 2EFHB 3NH6A 4G5GA 4GOKA 4II7A 3N2IA 2O5VA 3EIEA 1Q20A 3FMFA 4UJ5A 2WJGA 3ZVMA 1FUKA 4H1VA 5C46F 3VFDA 1VKJA 2ZJBA 1VYTA 3A6PC 3WYAA 3L2OB 2YOHA 4C30A 2AL7A 1NBMD 1HEIA 4M9ZA 4CT5A 1NBMA 3C7KA 4GPTA 4UNSA 2RGDA 4RKEA 5C2JB 2I1VB 2DWPA 4JBWA 1CR4A 4DLTA 2IHBA 1Z0AA 1COWD 1OXSC 2Q3HA 2PEZA 4JJKA 2ZETA 1BIFA 1COWA 1I2MA 4QBFA 3GLIB 2J9RA 4BUJA 1OH8A 1Z2AA 2SHKA 1TUEA 3P1JA 1HQYE 1W44A 3ADBA 3W6OA 2YHSA 5FL7A 4GMXA 4IVQA 5FBRB 1RFLA 3AVPA 3MCAA 2PJZA 3EX7C 2GETA 4DLRA 1G3QA 1VHTA 1ZU4A 3NBXX 4M21A 5DHFA 3T1OA 2FFAA 2WWGA 3AM1A 3W5IA 1HE8B 1NVUQ 2Q3FA 3CO5A 4DXAA 2IUUA 3BH6A 4HZIA 4JJZA 4C0QC 5FOTA 2ORVA 2ZITA 1OW3B 3GLHE 1E9DA 3ZLJA 3JZMA 3PV0A 1U99A 2PMDA 4QBHA 1EG7A 1GRNA 2GJ9A 1W5SA 1SXJC 1KJYA 1R6BX 4F4JA 1AIPA 3UXMA 4GMDA 1Q0UA 3MWYW 4FN5A 1N6NA 2LWIA 2ZE5A 2D2EA 1NMZA 4M4SA 1XMIA 1O87A 3N70A 1E9BA 3D31A 3RSOA 3QSYA 3K09A 5KSOA 2JLZA 3WMFA 3AF2A 3OIWA 4KFRA 5SZHB 5JCZA 4Q9KA 1YR9A 4NYJQ 1N0UA 2YWEA 1SVOA 2Z5FA 3QXCA 4LJAA 2FFQA 4IXNA 1KOFA 4N1AA 1XTRA 1QVAA 3FMIA 3GLGB 2JLVA 1X8LA 3GLFB 1MV5A 4UNQA 1QDEA 4DLUA 6Q21A 1W4AA 1X8KA 2GXAA 4OYHA 2GCPA 2IYSA 1CF4A 1JR3E 4F92B 1KZGB 5EP3A 5JWOA 1ZNXA 4US2R 2IWHA 2WWHA 1EX6A 4K81B 2Z4SA 2GAOA 4B73A 4A8JB 2WSMA 1Q1BA 1UFQA 5ANRB 1NG1A 5E95A 3THXA 2QQEA 1CJMA 5CB6A 1JALA 2ZI7A 4C7OA 2JGNA 1RYFA 1XP8A 4LPKA 2GNOA 3B1WA 2KE5A 1XBTA 3AVWA 1M6NA 2P5TB 1XXHA 1E9RA 3CRW1 5JBQA 1Z6AA 3QBTA 5DISB 2JLQA 2CCGA 2P3SA 2QU8A 5AUQA 1VYUA 2IUSA 1GRRA 3VR6A 1KJWA 3I72A 3UG6A 4ACAA 1G291 4EPXA 1U0HC 3LAWA 2W2TA 3W3ZB 2OESA 3GPLA 3T35A 4Q9LA 4I1UA 1NJGA 3ZGXA 2QSZA 3U7EB 1X6VA 1DAGA 4URYR 8OHMA 1N0VC 4BLOA 4M22A 4ACBA 2J46A 2ZUDA 2HCJB 3FB4A 3NHAA 1G7CA 1G5PA 1W4RA 4IRUB 2RGEA 4W7SA 2I3BA 2GJ8A 2PZGA 4LSGA 2PT7A 1GKUB 2KWIA 4E03A 1FOEB 3QKSA 3KKNA 2KB0A 2ZJYA 1EXMA 4B76A 5EP1A 3GLHB 3V4FA 3E5HA 1GL7A 4DEXA 3HJNA 3BFVA 1BMFD 1MR3F 3UG7A 3IQXA 3ZH9B 1W5TA 1BMFA 1NLFA 1OHHD 1ZCBA 3SEAA 1YZLA 4WXPA 4EPTA 2IW3A 1OHHA 1E96A 4YMWA 4A0HA 4I4LA 2IWRA 4IKEA 1K5GA 2ZJ5A 1NG9A 2ODEA 4L9SA 2HXSA 4HLQB 1NNEA 2BMFA 2CJWB 2YC4C 4OBEA 5F3WB 2A5YB 3GFOA 1EFCA 1P9WA 2QP9X 3QI2A 5JWHA 4PANA 2V55B 4CEHB 4A6XA 2OFXA 2IYTA 1XMJA 1QF9A 1H8HA 4IJMA 2O0KA 1X1RA 5L3RA 3L0PA 1R0ZA 2ZI5A 5JRJA 3TSZA 3K0EA 1M7GA 2G83A 2XAUA 4ZIRB 4HB2A 1F2TB 2OCPA 5KSYA 4NH0A 3GQBA 5GJBA 2H18A 4XVQA 1OV4A 1XJ0A 4UQOA 1CXZA 3QEOA 2VP9A 5CIWA 4OHXA 1EFUA 4UNNA 2BMEA 2ATVA 3AUYA 3RS5A 1AKEA 2I4IA 3TUZC 4Q7MB 4JSTA 2YWGA 2OG2A 2QGZA 1FL9A 1Z22A 2W6JA 3DMNA 3NKVA 5L3SB 3O8CA 3AUXA 3G82C 2GHIA 2Q9AA 2PCJA 1R5BA 2XEXA 3OEED 2X19A 3AVUA 1XDBA 3OEEA 4C0BA 1P60A 4D4JA 2Y8EA 4D4MA 4WIAA 4PHTA 1Z47A 4B6EA 1W1WA 4LOAA 1VHLA 1SVLA 4JL5A 4F4IA 4QHTA 5JJLA 1G17A 2A5FA 1KAGA 1EFRA 2ODWA 3NXSA 1X86B 3EPHA 3KQKA 3R9XA 3FPAA 1TQ6A 1KK0A 2FSHA 4Q02A 4WA7A 1UEIA 1XFAA 4M1SA 4H1UA 3ZQJA 3TK1A 2V9PA 2BCGY 2QM8A 3UK6A 3LBHA 1RRGA 2JLWA 3F5FA 2F1HA 4KI0A 1IXSB 4JL8A 2VO1A 4LHVA 4Q9IA 4D25A 5HZHA 1ZUNB 4ITRC 2ZREA 5LB4A 3ZIAD 4P4SA 3D6TB 3TKLA 2NGRA 3ZIAA 3CUEF 2RGNC 1YU9A 2JLUA 2WJHA 3QPWA 3M0EA 1XEXB 3AF3A 1GG2A 3X1YA 3B6EA 1JPNA 1KMHB 1G1MA 2EYQA 1OFHA 1R0WA 3HU1A 1Q22A 1A2BA 4FWTA 1WP9A 3TIFA 4URWR 1U9IC 1AKYA 2IA5A 5AUPB 1E1QD 2HJVA 2JLXA 2CMKA 3QKRB 2WIBA 2BBOA 4AY2A 2EFEB 3P26A 2DCUA 3TR5A 5KPJA 2J87A 1X8JA 3VU9A 4QKQA 4Q7KA 3NDBB 1GDDA 2IF2A 4X8HA 4XWKA 2J7KA 3QEJA 1G4AE 2XXAB 2BCJQ 1WBDA 2OCYC 4EAQA 1NF3A 4TL9A 1D9ZA 4TT3D 4LJ8A 4D0GA 1ZYUA 4TT3A 1MT0A 1KO1A 3D8BA 1ZM4A 3CF2A 2RMKA 1E9CA 1SZPA 5J4KA 2FDCA 2YWHA 1E99A 2IYVA 3E1SA 3B60A 4JSYA 3C8UA 1KDRA 1U2RA 3K0CA 3U44B 1OH7A 4M9QA 5EE3A 1Z08A 2OSBA 3JVUA 3SI7A 4ESHA 1W0JD 1E9FA 4A2WA 4HUTA 3UWOA 3FHTA 2H57A 4JLBA 1ZIOA 4YC7A 3TJZA 1G8GA 4Q1FA 4B74A 3QF7A 3LO5A 4A0GA 1NVVQ 3QF4B 2ZSDA 2XOKA 2YKGA 3VNVA 4HB0A 4IVRA 3QG5A 1G8HA 1ZNZA 1E1RD 3CF0A 3TUIC 3PUZA 2WBLC 3E2IA 3KKQA 3U4QB 1U8YA 5FH9A 1N6RA 2QMHA 3DKPA 3VNUA 3PFIA 1PUJA 2O0HA 1NMYA 1A7JA 4FI3C 4HDQB 1UBGA 3D3QA 4G0NA 1YHNA 5FUXA 1XJQA 4I1SA 1G6OA 2X8AA 3L0OA 5E4FA 2V7QD 1AK2A 1XU4A 5F9HA 2V7QA 1YR6A 1VYVA 1G19A 1W36C 1P75A 5IRCD 3LY5A 2FGKA 4WOPA 4QJ3A 2VQSA 1QHNA 1P3JA 3TUJC 2F1RA 4MRNA 5C4GB 3SYNA 1FMLA 1S8FA 4S35A 2PT5A 1QHSA 4DKXA 5FOVA 1F2UA 3CNLA 5M04A 2H5EA 4MGYR 4B35A 2QMUA 1SXJB 3MJHA 4B3BA 1ESMA 1WCV1 4B3XA 4BZQA 2VRWA 5FPKA 721PA 3CLVA 2GILA 1E2DA 3AKDA 4WVFA 2IUTA 4TTPA 5FBVB 2I1QA 4WAUA 1FTSA 3QY0A 3SYKA 2JJ2D 3NHBA 4TN1A 3MWKA 5H70A 3B1YA 2E9SA 5TXGA 2QP4A 5CYOA 3T12A 1XRJA 1NY6A 5KO2A 4ASUD 5A5GA 3QXXA 3EIQA 4B3FX 3TRFA 3SZRA 1IONA 4DLXA 4ASUA 4KXFB 4P32A 1WDTA 4YMUA 5G3ZA 2ZJOA 2VIIA 3ZD6A 1B0UA 5CM9C 3Q85A 3GJ7A 1XPUA 3EXAA 1HV8A 4BFTA 1IHUA 1RVDA 4P33A 4XVUA 2NMVA 1XD9A 3BORA 2ZRJA 4NP6A 5JHGB 1Q1ZA 3THXB 4CYMA 4XSHA 3W6PA 2IL1A 2P6NA 4LPSA 2WSSD 2ZRFA 1A2KC 1JXMA 4FCWA 2PZEA 3I73A 2CE2X 2WSSA 4BFUA 4OQXA 2D06A 3EIHA 1E2KA 3HPQA 2WOJA 2J7PA 3KFXA 1P62B 1ZUIA 1GKIA 4BFYA 3FOZA 3THOA 4Q01A 4M8NE 5DIFA 4KHZA 5AJVB 1US8B 3W5JA 3PCRB 3CPEA 3VR1A 3CBQA 1G8PA 5CK4A 4RZ3A 1OSNA 4Z1MD 1E4YA 1E98A 1XNJA 2AXPA 4Z1MA 4ABYA 4YMTA 2QSYA 3EPKA 4JLAA 1CJUC 4LYFA 2FSGA 4BEBA 1LF5A 2ZEJA 1O3YA 1S3GA 4Z8YA 1IAQA 2XJ4A 4M1YA 3VKGA 3CWZA 2ZE8A 5F2EA 1XTIA 3PIRA 2P6UA 1GKYA 3KB2A 4OQLA 3TW8B 1G3RA 2WJYA 4NPHA 3K0AA 3NH9A 1VMAA 2CLSA 4Q4JA 4PXAA 2BBTA 4BFZA 2ERYA 3PQCA 1N6HA 2Z6VA 4EFLA 4DEYA 1VG9B 2VF8A 1XF9A 3QXHA 3X2SA 1KIMA 1UBFA 1Z28A 2GEUA 4Q47A 4UKDA 1KSGA 4R2HA 3DL0A 4FCTA 1NVWQ 1P5ZB 1QHYA 3K70C 4JBYA 3WXMA 4ON9A 4CRWB 4CDGA 2VF7A 1W7AA 1XPRA 1U90A 3B9PA 3SDZA 1EGAA 2GCOB 3T15A 3DPUA 2BBWA 2KI5A 2QE7D 1N6IA 3AVTA 2XGJA 2NOAA 2QE7A 4EJSC 1AS0A 1E2IA 1T91A 4B48A 2V8OA 1MABA 5CLLA 1T0HB 2ZI6A 4HI0E 1PUIA 4B34A 3I61A 3WNBA 5BN3A 4XWAA 1JAIA 1R2QA 3UIEA 2D62A 4AKIA 1XD2B 2V1UA 3GJ8A 4IVPA 3HR8A 1Q1EA 3WHKA 1E9EA 4NYMR 1TF2A 4IFBA 2ZQ5A 4P4UA 3EARA 3PR1A 5EJEA 1T5LA 5EE9A 4BZPA 5FBQB 1XEWY 3CRVA 1RYHA 4Q1DA 1HURA 2WWXA 2GCNA 4HAYA 4U02A 1IN8A 2QUZA 2R65A 4GOJA 1OT3A 4Q4AA 1RC8A 5BYKA 2FFBA 5EXXA 3JZAA 2ZRIA 1G41A 2F55A 3GP8A 1JR3D 4TYPA 3WMEA 1E32A 3LVRE 1E2QA 1ZU5A 2PEYA 4QNMA 2BBSA 1R7RA 2WOOA 4UNRA 3EA5A 3KJEA 1NRJB 2PLFA 1T9HA 2CL0X 4I1OA 4L15A 5FTKA 1TF7A 3LNCA 4FD2A 2PX3A 1PV4A 2HT1A 4K46A 5HTKA 3AB3A 4ARZB 1J8YF 1HTWA 5FL3A 5SZJA 1NKSA 3OAAD 4Q7JB 2R6CA 4V0LA 4AIIA 1CIPA 3DDCA 2IS6A 3OAAA 2P0EA 1ZD1A 4CF7A 3MMPA 1Q57A 3QIAA 4KITB 1NVXQ 5JZVA 1U81A 3VKHA 3KTAB 1IJFA 5FFMA 2IK8A 1XD8A 2WIAA 2RHMA 3KKMA 1KI3A 3AKCA 2PLRA 4EKDA 4EUNA 3PUWA 4JVMA 2W6ID 4U00A 4ZDKA 4DCVA 1AS3A 5H1YA 1CR0A 4JT4A 2QBYB 1Q3HA 1CR2A 3C41J 3REFA 1WMSA 3AF4A 2FZLA 4RZ2A 1KI1A 3GD7A 4G1UC 1KYIA 1KSHA 3BOSA 3U5ZB 2FSIA 2YOFA 5BN5A 3GJ5A 3B82A 4JLVA 3AVXA 3AVYA 3A36A 3Q7QA 5FPSA 2ECKA 2YV5A 4LJ4A 4V0NA 1RJ9A 5KTYA 4JIMA 4JLNA 3C5HA 5DO9A 2OM2A 3CM0A 3WYGA 1S0UA 1GP2A 3LXXA 4JLMA 2GXSA 4PAMA 2BC9A 1AQUA 3ZVLA 2J0QA 3HU3A 2ZSEA 2F9LA 1YRAA 3H1TA 3H4MA 5KNDA 1KTVA 3M1IA 4GT1A 2A30A 1CJVC 521PA 5F98A 3KZ1E 4ESVA 1I4LD 2BM0A 1R0YA 5DI3A 4F38A 3A1SA 3PITA 1Q21A 4Q18A 2OO7A 1JBKA 1T5IA 4RZUA 1XMVA 2QN6A 5CB8A 4NU0A 2DB3A 1Z6XA 2RGBA 4YMSA 1L4YA 2ZE7A 4DSNA 3CB4A 1JR6A 4QJ4A 4TZ0A 4FIDA 3GJ4A 2BM1A 1X1SA 1MH1A 2UZ3A 2B21A 4DHEA 4ZKDA 4L4UA 1E0KA 2VH5R 3C14C 4HAUA 3FVQA 2WWIA 2IC5A 4B71A 2C9CA 2FOLA 2FNAA 3IO3A 4KU4A 4E5UA 1QZXA 2JEOA 4Q1CA 3OIVA 3BAFA 2IYXA 1N6OA 1AQYA 1J8MF 1T6NA 3AQ4A 4XTRA 5H68A 1KKLA 1E2NA 4AYWA 4D2IA 4KODA 3MFYA 3EC2A 4L8GA 1ZC4A 2QPOA 3B5JA 4C2UA 2OFOA 2IYRA 4HZUA 3OESA 1KI4A 1W49A 1XEWX 3H86A 3TAUA 2QTHA 2BV3A 1E94E 1H8ED 4URVR 4TYNA 1G3UA 1IN4A 1E6CA 1L2TA 2BEJA 2F43A 1H8EA 2VSOA 2XITA 3ECCA 4HB3A 3R7WA 3BIFA 4XOIA 2PCLA 4QM7A 4LJ5A 2GZHA 2XB2A 2RCNA 4LYAA 1FP7A 2ZU6A 3TBKA 4IEEA 2ZJ2A 3PG5A 2QENA 3ADCA 3HDTA 4D6PA 3CKLA 4C0SA 3A4NA 3CZQA 1KZ7B 2O8FA 4ZO4A 4R7ZA 3U6BA 4Q5IA 4BLSA 4B2PA 4WBSA 2GESA 4R9UC 5G40A 2C5LA 3Q8XB 2ZSAA 2A5GA 4Q9JA 3ADDA 2FJUA 2PX0A 4KSCA 2IS2A 3FMPB 2FFHA 1G7RA 3B78A 1Z2CA 3AF0A 1II8B 2W83A 2CVFA 1OFTA 4EPWA 4PSKA 4QJ5A 4KLZA 2GVZC 1R8QA 1R10A 2XNSA 1TAGA 1TQDA 1RE0A 4Q21A 3X1ZA 1MRNA 3K09C 1F3OA 4U7DA 2WKQA 2ONJA 3GEHA 3O8BA 3EG5A 4IDNA 3QJYA 2JJ1D 3TE6A 1B23P 2H17A 3T61A 2JJ1A 1T0JB 3DKVA 2YNMA 1X3SA 1UJ2A 1QHHA 1GIAA 2ZAMA 4LV8B 1KI6B 1ZNWA 2OBNA 5KUTA 4MKIA 3NEYA 3LQRA 4IOJA 4CW7A 2R8RA 4GL2A 2O8EA 3P4XA 2ZRKA 3MJRA 1KSJA 3PENA 1OH6A 4TYQA 3K9HA 4I99A 4AURA 2C03A 1DAIA 3A4MA 3CPJB 3IIJA 4RFSB 4NCJA 4DRZA 1W2GA 2A78A 2GVDC 2EFCB 4LBYA 3NC0C 1E4VA 5KDDA 1SXJD 2IYZA 4UJ3A 1II0A 1IBRA 3TNFA 2HF9A 1NIPA 2F6RA 4YXWD 4NBSA 3I62A 4TMXA 1YZGA 3IHLA 2DFLA 1KI2A 2YWFA 1W36B 3EZFA 4QG7A 4EQ6B 4US1R 1G64A 1IM2A 3GEIA 1G21E 4ZI2A 1UBEA 4O0MA 3DHWC 4NKRA 5TARA 3S1AB 2KBEA 3X1WA 1C4OA 3CRMA 3DM5A 2V6JA 2BOVA 1P7CA 3RRYA 4V02A 1ZMXA 4LHXA 4MKGA 5TV2A 1W0KD 1HA3A 3RRZA 3BFXA 3PVSA 4DSUA 2XZOA 1AGRA 4F7WA 3IEVA 2DY1A 5G53C 2XTMA 3M6AA 2FPMA 1U94A 4PPGA 3N2EA 4TYWA 4URUR 1GFIA 1SKYE 2V1XA 2QRZA 2XNDD 1Z6TA 4LJYA 5DH9A 5EE0A 3WMGA 2WWYA 1S2MA 2XNDA 3PEUA 4FMBB 3U3JA 1NJFA 5HCNA 5AK0A 2DPXA 3DVLA 1QHGA 4NZYA 4US0R 1YR7A 1IN7A 4P31A 1KK2A 2P65A 2JLRA 2O8BA 1JB1A 1N3BA 1JECA 5EUMA 2WVJA 4NYIR 3SOPA 4DB2A 3KDSE 5BN4A 1OXXK 2XSZD 3PJRA 2XSZA 2PZFA 2QY9A 221PA 5CYPA 5FBWB 2OBMA 4OKSA 4LV6A 4DC9A 4MGKR 2Z0MA 5D3MA 1TU4A 4CVNA 3T1TA 3QENA 4CEIB 4QL3A 2X77A 4Q4HB 3THYA 3IEUA 2X2EA 4GP7A 1GUAA 5JCPA 5FPTA 1OIVA 3OE7D 4I1VA 1ZVQA 4LHZA 5JRZA 2BWJA 3OE7A 3VX4A 4YMVA 5JSZA 1NN0A 1MO5A 2FN4A 2VEDA 1XB2A 3MD0A 1SHKA 3WRYC 1KK1A 2NO6A 1OYWA 3NDPA 4GI7A 3MLEA 1HT2E 4MQBA 4TTQA 4P4TA 1KO4A 1Z3IX 1IQPA 2BDTA 4KLNA 1L8QA 4GBMA 4Q4JB 3VX3A 2OXRA 1TMKA 1V43A 4V03A 3EZ6A 1E3MA 2ZI3A 3A4LA 1JEDA 2ZR9A 5L3VA 2WWWA 3LV8A 4PAQA 1JJ7A 3U6KA 4HLUA 5GJWC 3KQHA 2J0UA 1CRPA 1SHZA 1MO6A 1Z6GA 1G7TA 1E2FA 3AF1A 4DDUA 1YZTA 4JKIA 2O8CB 1E2EA 1TX4B 5GADl 1Z06A 5AJYA 4YONB 1AM4D 4FINA 1SQ5A 5AJZA 3RRMA 1OIWA 4TQ9A 2FPKA 3U3OA 5EXTA 1BYIA 1DG3A 2DHRA 1D9XA 4HUQB 2IBMA 3K70B 1C1YA 4L5BA 4O25A 1L7VC 3SJAA 1DAFA 2VP5A 2L0XA 3RS0A 3CIOA 3EA0A 1GSIA 5AUNB 4KVGA 5K8TA 2GEDA 3W6NA 3EAQA 4DT1A 4EJSB 3L43A 4BEJA 5K8IA 1ZC3A 3OIYA 3ZVNA 1W46A 1NBME 1ZIPA 3IIKA 3M4YA 4M1KA 3BB4A 3NBFA 2BKEA 3KKPA 3I4LA 1I2DA 2GA8A 5EUQB 4UXHA 4LC0A 1NIJA 4A6PA 4A2QA 4G01B 3GFPA 5UKDA 2NG1A 4PAOA 3BXZA 1DAMA 5FOUA 2ZAOA 3QPUA 2CK3D 3VR5A 3T1QA 1FX0B 1QHXA 2AHOA 3W9YA 3ASYA 2F1JA 2GBLA 3SU8A 4PR0A 1KKMA 1SKYB 1ONBA 2WMNB 2ZM5A 2GF9A 4B43A 2ERXA 4BRWA 3NVAA 1MOZA 3K0FA 1CTQA 3RS2A 1GOTA 4AD8A 2AR7A 3F0TA 2VPPA 2FG5A 2DR3A 2F3TA 4FMDB 4D80A 5C1BA 1J7KA 5HZKA 2W00A 1S9HA 5CK5A 3WNCA 2XB4A 4WZ6A 2OUKA 1ZD8A 3FHOA 3CX6A 4P3YA 1OLOA 2AWNA 3Q72A 3AV0B 3K53A 2HXYA 4HB4A 4OJKA 4LWZA 5L3QA 3ZS8A 3VR4A 2JLYA 4MUBA 1NLZA 3RS4A 2D7DA 1Y3AA 2OT3B 3THWB 1TEXA 1XZQA 4LCBA 5SZKB 1NMXA 4FMCB 3EZ9A 1D2NA 4D4KA 4MITA 2OV2A 4V0KA 4TTRA 3BB1A 3KXLA 1TADA 4Q48A 4FMDF 4FWIB 1EWQA 2AFIE 4QBGB 1XCMA 3TW4A 4DZZA 1JQJC 5ELXA 1RZ3A 5J4HA 4QHSA 2IF0A 3RAPR 4M1TA 4KSBA 3ICQB 4WW0A 2YZ2A 1E1QA 1UKEA 1W2HA 3FWYA 2ODNA 1DE0A 3KKOA 4MYUA 4PO9A 4DLYA 4YDHB 1M34E 2FA9A 3SJZA 4JKYA 3HPRA 3RWMB 2WJVA 4ZCLA 2A9KA 2RGAA 4HAZA 3RWOA 3CH4B 3EZ7A 4LHYA 4FMCF 4DBLC 2R6FA 2AKAB 3K0CC 1GNPA 2JJ8A 5JLJA 1ZAKA 2J3EA 3A1VA 2IX3A 3EWSA 2OCBA 2REBA 5GVRA 1WB9A 2Z4RA 3KXKA 2FH5B 1GRQA 5D3QA 1XXHE 2H1LA 2W2VA 1BS1A 3K8YA 2ZUCA 1JXOA 4RJLA 1W0JA 1CU1A 2QL6A 4AKGA 3FFBA 4AK9A 3GLIA 1BH2A 1VDZA 1D5CA 4PQYA 2BVNA 2MSCB 3G5UA 1Z83A 2J0SA 1DBSA 1W48A 1YZUA 3I1FA 2ZROA 4OQFA 1E1RA 2R6AA 1SKQA 3BFKA 3F3YA 1ZBDA 3RSLA 1VCNA 4M9SA 1PZNA 2VSXA 2ASEA 4M53A 1P2VA 3MSXA 4DJTA 1ZJ6A 2JCSA 1R0XA 2NIPA 4KYIB 3H2YA 4D26A 5C4MA 1GAJA 1PJRA 3RLFA 1CKEA 2WM9B 3PUVA 4OHWA 4WZAE 2OCAA 3U7FB 1M8PA 2KBFA 5K8UA 1E0JA 5KSZA 3B7GA 2NPFA 1ZRHA 3L0IB 4PPNA 4TMVA 4G5OA 4GP6A 1Z8FA 4W5JA 4F4CA 4RVCA 4ZDJA 1R5NA 1XWIA 3REGA 2A5JA 1Y63A 3OHMA 4IDOA 3G0HA 5CM8B 2VA8A 1U8ZA 3EW9A 2CLDX 2IYLD 3IUYA 1NL3A 3P4YA 2XZPA 2CCJA 4QGAA 4RD6A 1XTQA 2Q9CA 4MDEA 1P61B 4WXRA 2GXUA 2ZS8A 4M0LA 4PC6A 2WAYA 5JI3E 1TNDA 4PQFA 5CJ2A 2B92A 4Q1AA 3GLGA 1E9SA 2JJ2A 2JATA 3GLFA 2ZRBA 2AFHE 2C78A 3I32A 4OHZA 3FKSD 4W5WA 3WNDA 2ZIAA 3ZD7A 3FKSA 4OK5A 3LX5A 1G5TA 4BASA 4R71A 5B64A 1Z0DA 2DWQA 2WHXA 4C0JA 4E07A 1SVIA 1P72A 1GTVA 1UDXA 4A8JA 4MYCA 1DAKA 5BYJA 3EWAA 2N42A 1NSTA 1RW4A 2JASA 3CONA 2FPLA 2C9OA 4QXAA 1SGWA 1ZNYA 1KO5A 5IHPA 5JECA 4MDFA 4CGZA 2G6BA 2D7CA 2O0JA 2YJTD 4LX0A 4C7OB 1RRCA 4HAXA 2ZTSA 4W9MC 3BC1A 1GWNA 5DN6D 1OXVA 4Q03A 2H7VA 4HEJA 4AWXA 5DN6A 1ZUHA 1G18A 1G7SA 2MMGA 4KFUA 4MKHA 4TL7A 1XXHB 1ZM9A 3CNOA 4HAWA 4TLAA 3UANA 3W3AA 5H8WA 2J45A 4GZMA 4GOXA 5JS8A 2OHFA 3B1ZA 5DYGA 1U0JA 4M1WA 2A3RA 4X8MA 3AVQA 1LVGA 2JAQA 1LY1A 4BLTA 1KY2A 2OXCA 1XJCA 1D2MA 1S96A 3WBKA 4O2RA 1V5WA 5JMTA 1DEKA 4BECA 2G77B 1I4DD 1D6JA 1R8SA 2ZSBA 2VL7A 4B47A 1VIAA 2WTUA 4AKEA 3AGQA 5KNCA 5HE8A 1KDPA 2GJSA 2VSFA 3CPHA 3FHCB 1T8TA 1KO8A 4OHYA 4KCGA 4BLRA 2GZDA 2QPAA 2IYYA 1VIYA 2BJVA 3GLHA 2RB4A 3QKSB 4Q7LA 4FW9A 1RRPA 2YYZA 1ZCAA 2CDNA 2W2XA 2ZI9A 3WYFA 3R9IA 2DBYA 3W8NA 4LGMA 5EP2A 4CZ2A 2NZJA 5JI2E 3UKDA 3PEWA 2BMDA 2Z43A 1WRBA 3RANA 4ILEA 821PA 2ZS9A 4TSFD 3A1UA 2G3YA 2B7CA 4MRSA 1M1YE 2AD5A 2R2AA 4RD4A 1TQ2A 1XTSA 2C96A 1GNRA 5J47A 1OYYA 1U98A 2GRJA 2WJIA 1HUQA 2CJWA 3K9LA 2N46A 2CVHA 4POAA 1HH4A 1AZTA 3IO5A 2LKCA 4CEHA 2QAJA 2ZRMA 1PLKA 5A0FA 4JZKA 1P2SA 3KX2A 4LJ9A 4IOLA 1CJTC 2DWOA 1DG1G 1S1MA 2CHVA 4QNRA 2MSDB 5FTLA 2OZEA 5KHOC 1JPJA 1S1CA 4ZIRA 1F2TA 2ZRHA 1R4AA 4LDJA 5KDOA 1J99A 5JJIA 5FBLB 2WMOB 3Q7PA 1J90A 2F3RA 1A4RA 2QT0A 1JR3A 1KDOA 2OILA 3T5GA 3VHLB 3OIUA 2IT1A 2P67A 1DAEA 3MWLA 1OF1A 2QTFA 2ZR7A 2QM7A 3SC3A 1NN3A 1CULC 4JLDA 4PO8A 2JLSA 3LD9A 3UMRA 5B57C 2WICA 3RC3A 4BGDA 3B9QA 2KSQA 2QGNA 5LDDC 3I5YA 4NYMQ 2AD1A 3SE0A 5L3SA 2ORIA 1M7HA 5TDHA 4HDOB 1KO7A 2O52A 2FV8A 1Q1QA 2RKOA 2UVQA 1GM5A 3B85A 3T1VA 4DDWA 1LB1B 1K6MA 2FE4A 1S9DA 4IOKA 1GL6A 4RD2A 3CR8A 2QTVB 3L0SA 1OB2A 3B2EA 2WZQA 2W6IA 4OI0A 2PBRA 4L9WA 3EPJA 1OKKD 4JVSB 2WJJA 1F5NA 3L8YA 3WRXC 4B6FA 5L8VA 5JJKA 1OKKA 3K1JA 2FMXA 3GJ3A 4A9AA 1OE0A 621PA 5IT5A 3ADKA 1FW6A 2IXFA 5C18A 1ZP6A 5AJXA 4LY6A 1AA9A 2GAAA 2ZI4A 5DLQC 4LZZA 4BFWA 4G3XA 2MMCA 3UATA 3PEYA 2NO7A 3U2QA 4LV5B 2ANCA 2EQBA 1VG0B 4XTCS 3AKYA 5DHAA 2OLJA 3SQXA 3ZVRA 4NL4H 2P5SA 1OXTA 2R62A 1N5KA 4QC2A 4JYCA 4OI2A 4GNKA 2CCKA 1CR1A 3I8XA 4JYBA 4V0MA 5F9FA 2EFGA 1F6BA 3QG1A 3PUXA 1FFHA 2B6HA 3Q5DA 4AYXA 4GZLA 1EFHA 2N1BA 1YR8A 1DPFA 4P4SB 2H92A 2HYDA 4D0NA 1XEXA 1N6PA 2B8TA 4RCYA 5J4VA 3A8TA 3OEHD 2ZPTX 5EP4A 5KYKA 2EWWA 1KMHA 3OEHA 2NO0A 1QG2A 1P9RA 1TQ4A 3HR7A 2ZSFA 1OFUX 3B1VA 2FWRA 4B75A 3LH5A 3NC1C 1RPZA 3CX8A 4OJQA 4KFSA 4AYTA 1Z07A 3ND9A 3GLFE 1GNQA 4CEJA 1W4CA 2VLIA 3I3SR 1N5LA 3C5CA 3SJBA 2VHCA 4X8OA 1J2JA 5IK2D 3QKRA 5IK2A 4HLCA 2ZS7A 2BMJA 4AKHA 3MUFA 1XTJA 3OF5A 1IN6A 1WQ1R 2CHGA 5P21A 3RRNA 5BXQC 4TMKA 3IDQA 4JLKA 3VU9B 4M9XA 2EW1A 2XXAA 3A58B 3FMOB 1TL7C 3BH7A 3KJIA 4YLGA 5EE1A 2F1IA 3OFND 4TQUS 1KMQA 3GJXC 3K9NA 3OFNA 3MGCA 4DCUA 2HDNB 4TMWA 2XZLA 1QBKC 3LVQE 3LFUA 2A5DA 5DE3A 4PC3A 2WKRA 3U44A 4Q1EA 2AN9A 1P2UA 2P2LA 2Q9BA 4QGHA 1VG1A 5SZIA 2QEQA 1G8YA 4ZPXA 5B30A 5EZ6B 3KQLA 2C99A 2GKSA 3PEVA 3X1XA 5EE5B 3DMDA 4CIDA 4HSEA 4DCTA 3CW2A 3QF4A 2ZRLA 4B3CA 3ZZ0A 3QOFA 4TMTA 1TTTA 2REXB 5BWMA 1F60A 1QVRA 3CF6R 5FL7D 3N5CA 3HYRA 1AZSC 4TL8A 4F93B 1YVDA 1VTKA 1DAHA 3IBGA 5JWRA 1LTQA 3IBYA 2Z83A 3U4QA 1DADA 1P9NA 3KL4A 3SHFA 4A0RA 2FGJA 3GJ6A 4PSVA 5CDFA 1G20E 1M74A 1XCPA 2OAP1 4R98A 1E2PA 3Q3JB 3SFVA 4Q4LA 1M7BA 3NBYC 1P4SA 2IXEA 4NYJR 3V9PA 5LD2C 3Q9LA 1OIXA 1G3IA 1HQCA 2ZUBA 4AI6A 1T3SA 3GMTA 4XD7D 1VCIA 1K5DA 4G5QA 2FU5C 3FYHA 5G41A 4OI4A 4XD7A 1G8FA 2RHDA 1WXQA 2V6IA 1Z6YA 3ASZA 5HCIA 2QZ4A 4PQRA 4JVLA 2A7QA 3KQUA 3T34A 4DVGA 2ZJAA 1VG8A 4OQNA 4PO1A 2W0MA 1SXJA 2LCFA 3CX7A 5FR1A 4QRHA 5DI9A 5J40A 5J5CA 1F2UB 1YJ5A 3DZ8A 4PC1A 4B44A 1UDWA 4YXWA 2V54A 1CLUA 2J59A 2IEZA 5FI1B 4DDVA 1DOAA 1NN1A 2C95A 3NEJA 5LB2A 3UWKA 2W58A 2CHQA 4BLPA 4LI0A 4KFTA 3BGWA 3SQWA 1A1VA 2O8DA 2ZRCA 1E2HA 3TH5A 1UKZA 2QMEA 1AN0A 1T4GA 2WV9A 1SVMA 3QXSA 1G9XA 1FMJA 2GK6A 4QBIA 4ZDWA 5KDLA 3RVBA 4W5HA 2ZVPX 1W0KA 4B33A 3KXIA 3TSOA 4V0OA 2FEOA 4Q19A 2JA1A 3UMSA 1LNZA 4AC9A 3B13B 3UMFA 1KI7A 1BO6A 2UKDA 4WZBE 4Z51A 4LYHA 1ZM7A 4YDSA 2QPTA 5FR2A 1FQKA 4A36A 4L16A 4PHGA 4KVAA 1Z29A 3VHXA 3ZYCA 4XSGA 2C77A 4RD1A 1OFIA 2HEIA 2JDID 4NCNA 1UKYA 1US8A 2JDIA 1UEJA 4BZXA 2G0TA 4Q1BA 2HCBA 3VMFA 1T3LA 4NONA 3DM9B 3KFVA 1VPLA 1IXRC 1TF5A 3QXJA 5FTMA 3KJGA 3U3RA 4TQAA 2FEMA 421PA 3SBEA 2W0SA 1SVWA 1T8UA 4LK2A 3FFAA 1SVKA 2G1JA 2WKPA 5CLQA 3IKJA 5EXSA 3ZJYA 3J81k 4MGZR 1II9A 2CL6X 2QAGC 4E09A 1OXUA 4ZKEA 4IXMA 2AKYA 2HLDD 1FP6A 3BD9A 4HLUC 2HLDA 3K0AB 3B1XA 5JEDA 3IPYA 4NYIQ 3NTUA 1IY2A 5GJCA 2QAGA 2WPDD 3JVVA 5TB5A 3BH0A 5JS7A 2WPDA 2LKDA 4V0ME 1E2GA 5DNYB 2R6DA 5HKKD 1Z63A 1XZPA 4JMPA 1ZD9A 2DYKA 4LUCA 2EWVA 5HKKA 2ZJZA 4JVNA 2NPIA 4XJXA 3AEZA 3PUYA 5LBIA 5EQTA 2XTZA 1YKSA 2ZYTX 1JAHA 2GJKA 4AG5A 4DUGD 1KSFX 5J4YA 5FI0B 3V4RA 1DELA 1ZINA 2GCOA 4DLZA 1YZKA 4DUGA 5K8LA 5KPDA 2DFTA 2CEAA 1P2TA 1Q12A 3LW8A 3U3KA 2D3WA 4B2LA 2NTYC 2H8KA 4ZDIA 4OL0A 2IHYA 3ZQ6A 3A37A 1E2JA 2HUPA 4EPVA 3VKWA 3UPUA 3TMKA 3H0KA 4TLEA 1MABB 3NBZC 3ZS9A 2F9MA 4ZI3A 1YZQA 1XD2A 2VTKA 2XX3A 5AJWA 2B8WA 3I8SA 2PL3A 2ZRDA 4DDTA 3A1WA 1QHIA 1Z5ZA 1F48A 1DS6A 3ZZUA 3ONWA 1N2CE 2ZJ8A 3DEFA 2GDJA 1AS2A 1ESNA 3IIMA 5KU1A 4TZ6A 2FX3A 1H8HD 3GFTA 4A2PA 2IS1A 5KNBA 3BERA 3P20A 2GEVA 2GBLC 2BHRA 2IXGA 4M1OA 1E0AA 2ZRPA 5E7IA 3IGFA 2C04A 4Q4AB 3RNLA 5KOYA 2VP2A 4Y0VA 3KQNA 5FTJA 2C98A 4QOSA 2CK3A 1XPOA 1XMSA 3FE2A 4LBVA 5FUWA 5LPNA 3EPLA 1UAAA 1CEEA 1G5RA 2VP4A 3KJHA 2C8VA 3IHWA 3AVOA 4ARZA 1CRQA 1NSFA 2VHQA 1P73A 1JNYA 5JFGA 4LJ6A 2XTNA 3W8RA 1IY0A 3QPVA 2W6JD 4A0FA 3KB1A 1OB5A 3KTAA 5DGXA 1TU3A 2ANBA 1KI8A 1WE2A 2REOA 1M2OB 3LBIA 4PZYA 5GVSA 2HT6A 2QNRA 2XJ9A 3U7GA 4Z54A 1MRSA 3LW7A 3C16C 3P32A 4NCKA 3PXGA 4N3NA 2MSEB 2QBYA 1DARA 3BWDD 3DO6A 4NTZA 3R8FA 3TGPA 1KAOA 3QQ5A 1UF9A 5CDFE 1EFRD 1S4QA 4BPBA 3AGPA 4PZZA 4TLDA 1LFDB 1XTKA 5FUYA 4EPRA 2YC2C 4PHFA 3C4JA 3QKUA 4HATA 3LQQA 2GZAA 1RJ9B 1N5JA 3NWJA 4A1FA 4EFNA 4C4PA 1G3MA 4XWOA 1T3HA 2ZYVX 3O8RA 5BQ5A 4JLPA 4HAVA 3LXRA 3F8TA 1IN5A 2G1KA 2CE7A 3W90A 4E22A 1A82A 1E69A 4BWYA 4NDZA 2AK3A 2FSFA 3CH5A 1IOZA 1SXJE 2X2FA 3T06B 3TQCA 1ANKA 5JHHB 1UKVY 3I92A 1H65A 1Q44A 5DI3B 2NQ2C 4XVRA 2AXNA 3DOFA 1UADA 1E9AA 4IOMA 4BFXA 1U8AA 4LBWA 2IYQA 4G5SA 2C9YA 3K0SA 3QVVA 2RGNA 1LF0A 2PMKA 2HYIC 2QG6A 2FF7A 4XH9B 3AKEA 2OBLA 3AP1A 3IPXA 4CEJB 3ICEA 121PA 1N6KA 2GF0A 3CNNA 4UXIA 2Q0HA 1NP6A 2UZIR 4DLSA 3I5XA 1Z0JA 1YZNA 2ODBA 4OI1A 2WWFA 2IS4A 2R9VA 2D4HA 1MO4A 1U9IA 2HJGA 4OHVA 4Q9HA 5B58C 4PTLA 2VYFA 4DSTA 1NVVR 2RGXA 3TQFA 1TPZA 1NN5A 4IDQA 4BRUA 1SVSA 3EASA 4HZUB 1C9KA 1BYUA 2PJRA 1NLYA 5KSPA 2F43B 1PLJA 4LBZA 4B2IA 5FUVA 2D2FA 1FUUA 3R7WB 2Q6TA 2VHTA 2R6GA 4MRRA 3ND8A 5TY0A 3HYTA 1RRFA 3R9WA 3EZ2A 1YQTA 3HP1A 3U3MA 2BKUA 4UXJA 2VHJA 4GSYA 1QRAA 4DIEA 1JI0A 2Q21A 1WF3A 1ZW6A 1E2LA 3LLMA 4JS0A 2O8FB 2ZRGA 3AP2A 2B7BA 1OH5A 3LA6A 1KHTA 3W34A 1KDTA 2XOKD 2F7SA 1E0SA 3GJ0A 2ONKA 4URZR 1II8A 4MRPA 1EK0A 1IJEA 1KY3A 1DO0A 3KUDA 4RD3A 4KBGA 1KNXA 1CJKC 1SULA 1NKTA 2ZYWX 3DZDA 4F91B 4M1MA 2ZRNA 2ZU0C 1WA5A 2QT1A 2ZR0A 4B3GA 3LDAA 4NCIA 3BK7A 4H9GA 5E7MA 3DOEA 4DB4A 4ZV4A 4ZCIA 4AG6A 3LRPA 4MKFA 2J41A 4GFDA 1KI6A 1HY3A 5EXPA 2QQ0A 4IW3B 1QHHB 5GJVC 2EVWX 4LHWA 1DO2A 2G88A 1E79D 3QBVA 4BFVA 1E79A 4O3MA 1J70A 1Z0IA 1XEFA 2CXXA 2RGCA 1AJEA 1XX6A 3OZXA 2O8EB 1LS1A 5LD2B 3FTQA 4RFSA 4A15A 2JIZD 3X1DA 2OE2A 4MA4A 1NI3A 2JIZA 4A8JC 4Y0AA 3AH8A 4C3ZA 4EIWA 4ZCMA 4Z8XA 2PH1A 1W36D 2X1VA 4IDPA 3L82B 1YRBA 4A82A 4MYHA 3CZPA 1W4BA 2GXQA 4XIGS 4EQ6A 4YQFA 2VHUA 4PFSA 3SJCA 3S1AA 3WP1B 5TVKA 4EPYA 3RYTC 1CS4C 2YOGA 3CR7A 3CWQA 1MKYA 1XCGB 3EC1A 4BLQA 4C0AC 2O8DB 3D7MA 2RH5A 5J4LA 1KI9A 3O8DA 4TLCA 1UPTA 4CT4B 4DSOA 3NG1A 3TVTA 4UNPA 4PHHA 1HT1E 4RKFA 5EZ5A 5AWFC 4QHYA 4HDCA 5FOWA 2ORWA 3TR0A 1HYQA 3QNUA 4RCZA 2OAQ1 2EFDB 4A4DA 2C2HA 2QMOA 1FNNA 5A4JA 4LC1A 2IYUA 3LX8A 4DCNA 5DSZA 3GCGA 4C9BA 4RZXA 3VQTA 1NY5A 3FGNA 2J1LA 4DLVA 1KNQA 5CIQA 2NZ8A 1FZQA 2O8BB 2J7PD 4C2TA 1N6LA 3SNHA 2V4ZA 3R8CA 1EFTA 2G9NA 1BKDR 1DVRA 4HLDA 2D74A 4RSGA 3SBDA 5CJPA 4CEIA 1LW7A 4Q4HA 2OFWA 5D3MB 2Q3MA 3BBPA 4BE7B 1Q3TA 2R44A 4JL6A 1S3SA 3THYB 5E3HA 5E7JA 2AK2A 3QVUA 5BW8A 1PVOA 3Q5EA 4R2IA 3SR0A 1KGDA 5JSZB 3BRWD 2QP3A 1VCOA 1G4UR 4NHOA 4QGFA 1OJLA 2CL7X 5JEEA 2CNWD 4DIDA 1CP2A 3C15C 2CNWA 3V00A 3H84A 1ETUA 4OK3A 4TMZA 2DFNA 4PC2A 4TLBA 4X8LA 1DTSA 2QAGB 2QI9C 4I81A 4LJ7A 2E87A 4TSFA 3NIBA 2AX4A 2NO9A 3FKQA 4LRWA 2WAXA 2QRNA 2OLKA 4K8OA 3IILA 4FXPA 2ZRAA 4Q00A 5FPHA 5FPYA 3RS3A 2J0UB 3SHWA 3SS8A 2O8CA 2QROA 3CRRA 4OQMA 1JQLB 4KAXA 4MYTA 4NCHA 4IEIA 4S2EA 2IYWA 4TL6A 2IEYA 1VECA 1ZM3A 3LBNA 3KUCA 4QFMA 3TVDA 5AR1A 4U5XA 5HE9A 3A1TA 4P0TA 4MRVA 1GVNB 3CRQA 4M2LA 3B8HA 3K70D 1RKBA 4RY2A 1RIFA 5DYIA 1GITA 4HUQA 1IXZA 1G16A 2ZYUX 4DCSA 4KBFA 4QM6A 3U60B 4D4LA 4GDFA 4MH0R 2P6RA 2KJQA 3HU2A 1A5TA 4A92A 1G6HA 4NMMA 1PLLA 3BE4A 4IFEA 3T5DA 4FCVA 1UBCA 3ZZTA 3RABA 4KV9A 1GZSA 2G0NA 2QA5A 4G5RA 4EJSA 2TMKA 1BOFA 1EX7A 1R5OA 2HF8A 3E70C 2AWOA 4JT2A 1LS6A 4PC7A 3AP3A 4JLOA 1N25A 4DT1B 1UM8A 1ODFA 4IHQA 1JEEA 2RGGA 4PPFA 1AGPA 4URXR 5HR5A 4KYUA 4NE2A 2FZ4A 4Q66C 2H16A 3VTKA 5TMPA 3RC8A 3R20A 1TEVA 3GLIE 1Z0FA 3FDIA 4HYYA 4N0EA 1OPXA 3U7HB 3RS7A 2J0VA 2VBCA 3SYLA 3VR3A 2E1RA 4BQSA 4TYYA 1FPMA 5CITA 4KO8A 4OK6A 1QG4A 4PSAA 4EDHA 4IDHA 1FX0A 2GK7A 3IQWA 4ERNA
chains in the Genus database with same CATH superfamily
4L2IB 3ZLBA 3SR3A 1ZS9A 5LQSA 1WBBA 1KJZA 1N32B 1YCDA 4NMXB 5G3YA 3FFTA 2XCTB 1ZR2A 3RTEA 4N5DA 2GWHA 1XZNA 2XNKA 3ZEIA 1I3NA 1OCEA 2JGLA 3JQCA 3QE3A 5AK4A 4QOHA 1YR1A 5HFNA 3WZMA 3L8ZA 5BUZA 1JIQA 4CETA 3L4BA 3K0FB 3NJRA 2C94A 4M55A 1CUAA 2CXSA 3MERA 4IICA 4C7KA 4DLWA 2KX7A 1ZD2P 2JAHA 5IBPA 4D3XA 1AQLA 4BFSA 4BTVA 1F2VA 3WLAA 2OP1A 3HWSA 2D2XA 1JDPA 2NQTA 4JR0A 1YULA 4EATA 1N0WA 3ESXA 3MRSA 3VZPA 1AQNA 2POCA 1OLSA 1W5FA 3MFQA 3BMQA 3RC2A 3AEXA 4EFMA 1U0BB 2LNDA 4GRAA 4TROA 3P96A 3ZX5A 4IO0A 1AHNA 3RHFA 3L6OO 1M8KA 5FOSA 1F9EA 1H85A 3WLSA 3A9VA 1GXSB 2K5UA 3OU6A 3M8KA 4KZPA 1S01A 4B32A 3TAHA 2A2ZA 4RF2A 5FPPA 5KREA 3JQQA 2QNBA 2JPDA 4YP0A 2J5XA 1EESA 2FN9A 5LUAA 3S5UA 4UVIA 2PDAA 3K1TA 2R4TA 2Q27A 4N65A 4V3BA 5HXAA 4CMAA 2RG1A 4L22A 3UAWA 4XM1A 3VAAA 2Q6KA 1OI3A 2H1CA 4N0DA 3CF4G 1ADBA 3E4CA 1CBUA 4B6JA 2H54A 5BN3B 4DWJA 1DO8A 4TVBA 1E61A 1RM3A 4I7EA 4ZRNA 3QKTA 5AW3A 4LIPD 4KNYA 1MAWA 1DWOA 4PPQA 2HV8A 3CG0A 4GX2A 1GL9B 1PFKA 1BJRE 4GHWA 4YS6A 4N48A 2VZ9A 4B31A 2COUA 1PIWA 2HDWA 2A1TS 2FJ0A 3AOEC 3F67A 2LDBA 5LQRA 2HQRA 4R0VA 1K5PA 4QTZA 4UJ5A 4MI3A 2FKNA 4UAVA 4WY2A 4XPIB 2WJGA 4YREA 4DG9A 1DFIA 2CYAA 1FUKA 2RBKA 3JQGA 4H1VA 3OJWA 5CM8B 2PBZA 3WJ2A 5JPCA 1VKJA 3SLRA 2ZJBA 5KNDH 1VYTA 3A6PC 1JG1A 2JZCA 3AW8A 4HXEB 4JP8A 4B82A 5JRDS 4IIEA 3RVRA 3MBOA 4J8PA 2VTBA 1UKBA 4M9ZA 1NBMA 1JR4A 2IJGX 2PRJA 1P1RA 3DXXA 3QLVA 2BMWA 2RGDA 4GPTA 4G0UA 1E59A 2DWPA 1WHTB 1J9EA 1RWBA 5TX7A 1V7PC 1P18A 1CY1A 2Q3HA 4U2DA 2PEZA 4CHTA 3TZ6A 5KTRA 3PXXA 2OO5A 3IDAA 1OH8A 1CQPA 3RK0A 3H6HA 1TRKA 2LZ0A 1FSFA 3TTSA 1T6ZA 3WAKA 2OGWA 3W6OA 5CLHA 1YOBA 2GKGA 2WG2A 1LI5A 5J63A 1VB5A 5FBRB 3AVPA 5IC4A 2ZJ1A 3MCAA 1S8AA 4N54A 3USZA 4CE6A 4RKWA 3RVPA 3MF4A 1SUEA 1VHTA 4W9RA 2QG4A 4LNUA 2I67A 1OA0A 3D8NA 1HNNA 4IQFA 3W5IA 1VPTA 2Q3FA 3CUKA 4DXAA 3OP1A 3HJBA 1PR2A 2PR7A 3CPSA 3LU1A 5FOTA 2ORVA 3HXKA 3O0TA 4A8PA 3WR5A 4DM4A 5C8DA 3ZGNA 1U7PA 3RUCA 1MG0A 1WTAA 2C4WA 2PH5A 2PKQP 2M6KA 1RQ7A 2R1TA 1U99A 2PMDA 3QX8A 4W1RA 3W5HA 1ZN8A 2V7XA 3WK8A 1GRNA 3NPAA 4MEBA 2EKLA 2RK6A 5JAMA 1TXGA 2YXPX 3UXMA 3OFJA 4E11A 1LBQA 4I6JA 3H5NA 4FN5A 1GLVA 1GRCA 1SUAA 1RXIA 2IIVA 2ZE5A 5C8YB 1K7YA 1GTRA 1NMZA 1ZJJA 4M4SA 2B98A 3MCVA 4C4TA 1DNPA 3VJRA 5EIXA 1FDOA 3MLBA 1O87A 2G9QA 1MC4A 1JWLA 1TT7A 4FU0A 3D3KA 1D7OA 1Y7HA 4DR7B 5C4IA 2FMKA 1QGYA 1QIKA 5F3RA 5SZHB 4KIFA 1YR9A 1UH5A 2FSVC 2FRDC 3PDJA 4NYJQ 4O4JB 1EX9A 4OQZA 3O2JA 3UICA 3QXCA 4LJAA 1CIVA 2AFIA 1P17A 3V7WA 3UA4A 1XTRA 2KLBA 1QVAA 1J20A 1RP7A 2WU1A 3GLGB 3RSHA 1PSWA 2R1ZA 1N8KA 4FEYA 3GLFB 1KP3A 1V9CA 1K06A 2KYRA 5HJEA 4BX9A 4NIMA 2H7CA 4N8DA 4DLUA 4Z6KA 6Q21A 3UBMA 4QECA 3WGNA 1X8KA 2Q4DA 4WKBA 3GNQA 4OYHA 4F11A 1WMDA 3GLKA 5CA1B 4D44A 5C8YF 2GM4A 4S0XA 3ZGVA 2WWHA 2J07A 3C3BA 4B73A 4A8JB 1BFDA 1MVLA 2WSMA 3F6BX 2ESRA 5ANRB 1NG1A 3RIGA 2VAPA 3G9UA 3CLRD 4YT8A 3UKJA 1JZTA 3AUTA 3ZE8A 5A5DA 2JD0A 4FFBA 4PFKA 1RYFA 5F2KA 3SHOA 7GPBA 1RCUA 1OX4A 1W75A 2I3DA 2Q50A 1WP4A 1M2VA 1P4RA 2J3HA 4FHCA 4O4JF 4G09A 4RYDA 2HLHA 2GNOA 4XGRA 3PNOA 3PDUA 1DOHA 1SK8A 4TRJA 2E48A 2PS1A 4AL4A 3TL3A 3MIIA 4I5GA 2WUVA 5C35A 5JBQA 1Z6AA 1VE7A 1D4OA 2O54A 1V1JA 4YRFA 2G7ZA 4P54A 1LJUA 2P3SA 3DCYA 3R3YA 3E5NA 1PR1A 1ZH4A 4NX2A 5AUQA 3V8MA 5HKAA 3NJ8A 2I7TA 2G5GX 1CK4A 1FSSA 1M8GA 2IUSA 5KYUA 5DBGA 4XM0A 3UHFA 4DR1B 1QVZA 3OT1A 1K4MA 5CA1F 1Y6JA 5AIAA 2ZR8A 4JCCA 1U63A 2H9AA 4Q9LA 3AR6A 4HGQA 4A7PA 1RC0A 1IOVA 4YJHA 3MIZA 1IRXA 2QSZA 2ZYGA 1F4PA 2XKBA 3EFEA 1DAGA 3DVRX 3GY0A 4HBGA 4URYR 1DEXA 8OHMA 1N0VC 1TW3A 2YH2A 4OGKA 4TV8B 2CKDA 4Y7DA 2Q1UA 3T7SA 4X6XA 2ZUDA 4BMZA 2HCJB 5JROA 3O8NA 5DNVA 2QRGA 3V2GA 2VCEA 3C5VA 1JA0A 1W4RA 3RV4A 2XCSB 4CFSA 3GFFA 4IRUB 1KHHA 1U2GC 5CA0A 5FKJA 2GJ8A 3I2KA 1SXGA 2LPMA 1BSVA 4UOQA 4MUMA 4B3HA 1UJ6A 1QFMA 5FYQA 4E03A 5IJZA 4M9RA 4GXQA 1HFJA 3PDIA 3QKSA 5C7LO 1BG6A 1P0FA 4D98A 1EXMA 5EP1A 3DHNA 4D8VA 3QVLA 2HJSA 2VHXA 3E5HA 1ULUA 2F9FA 4JT8A 3KU1A 3HJNA 4G84A 4YMHA 4WZAA 2G5CA 3TJMA 4X3CA 3D6JA 1FP1D 2ZLBA 3SEAA 1B43A 2AQHA 2MU1A 3CSDA 3OJXA 2IW3A 4ZYZA 3DLAA 2XUZA 5JE8A 4I1YA 3AHCA 1EPUA 3D2LA 4YT2A 3KVRA 1EUDA 4TV8F 2OZVA 5AM5A 3ZJ5A 5IDQA 1SB8A 2JIDA 3FRHA 3SNKA 3K6SA 4C3UA 1YRWA 3ZXSA 1Y81A 3TW0A 1JILA 3A6LA 1RBZA 3GFOA 2BFAA 4G8BA 4MKXA 1N7GA 2WQ7A 3BG5A 2W4QA 2D5CA 2IDJA 3PXDA 4XW2A 3WBFA 1YGPA 4LC9A 4CEHB 1JEQB 2OFXA 3OPVA 3AWDA 1UJ4A 3WB0A 5EJ6A 5A4KA 4X54A 2HX1A 1K08A 1IJBA 4WY8A 1MNQA 3L0PA 4OHBA 1TCUA 3PPWA 4HWSA 1A2QA 3LDFA 4DG8A 2XZTA 2XAUA 5A4AA 2VUTA 5BUCA 1TVEA 1Z5PA 2X1LA 2ERCA 3R5KA 1N0IA 3T3EA 4FHFA 4NH0A 1KFJB 4YHHB 2GCEA 2X22A 4RFLA 2QD5A 2FEAA 2PUCA 1CXZA 2DPLA 3KWMA 2ZB7A 4FFOA 1ECFA 3AFMA 4PPYA 1RHUA 4OHXA 4YT5A 3T6KA 1XU7A 2IUEA 3IMFA 5ALWA 3T7JA 4B4KA 1YL5A 1V6AA 4OUDA 2I2DA 1RJGA 2JVIA 4F71A 2WLTA 3TUZC 1HZZA 4DN6A 3HB7A 2J4FA 3QXGA 1TM1E 4LF5B 2G72A 3KEQA 4NLLA 2VOJA 4AJIA 4EBFA 1FL9A 4MQFB 3TSAA 4MAAA 1VHJA 4BVGA 4ZV7A 3O8CA 3AUXA 1U7XA 4NZZA 1SOUA 2Q3JA 2I8AA 2OAGA 2Q41A 2IYAA 3E3AA 3H9QA 2DY0A 3A14A 3N2KA 3SLKA 5JCXA 4NBRA 1I6WA 1R5BA 5THXA 2XEXA 3IUPA 4C0BA 3WV4A 2C7OA 3V4OA 3F9CA 5EJ8A 4YJDA 2GCGA 3MJFA 5JZOA 3OIGA 4I46A 1W1WA 4LOAA 3V1NA 1SVLA 2O9JA 4F4IA 5AVSA 3BT7A 2HC9A 4V0RA 2A5FA 2ZKIA 3GYBA 4XB1A 1ORVA 4J0IA 3DBOB 4JQZA 5JC8A 1BKYA 3DL2A 3S2UA 2YYSA 4DR5B 2LDXA 3NXSA 2BGWA 1Q14A 3G88A 1OI7A 3WZ2A 1WM1A 3KQKA 2RIRA 2QZPA 4NXNB 3IDOA 1HDCA 3DVAA 1FDWA 1KK0A 1SQSA 2C5BA 2BT4A 3PC7A 4I14A 4M1SA 3U0VA 1R74A 5BURA 2BCGY 3WGMA 1TK2A 1QMPA 5JAZA 2W8BB 2VJCA 1R8JA 1XA3A 1TZJA 3W9UA 1RRGA 1U9CA 2PQ0A 1JXQA 2JGDB 2M6RA 4S2UA 4ZCQA 4PU0A 3FYTA 3IQGX 4S1PA 3BJEA 1WXXA 1CPYA 3O2NA 4FC7A 4GG1A 4JR1A 4UU8A 4WERA 3RC1A 1X15A 3BUSA 5FO1A 3L1IA 2G8LA 1EIWA 4LHVA 2XHEA 4RZIA 3FCAA 4D25A 5HZHA 4ITRC 5LB4A 4C08A 1X1DA 2YXBA 1K4KA 3HR4A 4RA9B 3TDNA 3C45A 3TKLA 3WDSA 3ZIAA 4EUEA 5EVCA 2H4WA 4YV7A 4UCWA 3NV7A 4G1MB 2O2SA 3RSGA 4E31A 4HG2A 4I50A 4KMOA 4FD3A 4YRMA 3GRRA 5CFMA 2W2MA 1JPNA 3HN2A 2O3TA 4HEHA 2A1UB 2BTOA 2VWPA 4JQYA 1G1MA 4RS3A 4U7WA 1OFHA 2X23A 3E9MA 3Q2OA 4GUAA 2C5GA 1EK1A 2NM0A 5K3FB 3OQMA 1ULZA 4D9NA 2P77A 3E2MA 4X1IA 4MV7A 3GC6A 5F77A 5AKYA 4W1SA 1P77A 3DD1A 3KVYA 5TGDA 3A28A 5KVCA 2JCVA 5LJIA 2CMKA 3L8CA 3QKRB 4LI3X 2WIBA 1FY2A 3KVOA 4IIVA 4JYPA 2BBOA 4L0DA 1M1NB 1NRWA 1L7DA 2YZ7A 5K7SA 5HUHA 3U31A 1AK9A 5KPJA 1N9ZA 3VYUB 2QHXA 3N8KA 2HSEA 2QLLA 5DBEX 2HTFA 1P5JA 4XWKA 2CUTA 5AVKA 3NDBB 1EFVB 1MW8X 1GGHA 1G4AE 2UUCB 1GZHB 4AY5A 1F17A 2OHOA 2OCYC 4EAQA 1IAVA 3WWZA 4TS3A 4LJ8A 5EIFA 4M8KA 3LUJA 1MT0A 1T9ZA 1THTA 3B48A 4YDRA 2PJDA 1EYZA 1FLAA 2HA6A 2GO7A 3JYLA 1I80A 5LQJA 1E9CA 1RYEA 5ULLA 4AY6A 2FDCA 2YWHA 1E99A 2IYVA 1XDGA 3E1SA 4HZGA 3GAAA 3HA2A 4TT8A 3VOTA 1M6WA 3I12A 2NACA 3U44B 2YXEA 3JYOA 4JBIA 3ZLTA 4ESHA 2JIPA 2EJWA 4M0EA 1YK1A 3HBNA 3WQBA 4CQJA 2JS7A 3GVXA 4K88A 4PZDA 2H57A 3TBFA 1D2GA 3TJZA 1TTPB 1G8GA 1Z18A 1KOJA 4MTLA 1XQ1A 4C5BA 3EGCA 3I9MA 2PWYA 3PUKA 3RUIA 1YMUA 5KYWA 4DV5B 1MA3A 2AG6A 2AGVA 2ZULA 3VNVA 2BR3A 1JJIA 4HB0A 2PKRA 5FWAA 1G8HA 1QJ4A 2G7MC 3I30X 1XOIA 4CR6A 2I3GA 4ND4A 1YRLA 1EMDA 1Y5IA 1E1RD 4RETA 2I34A 3H5RA 4KXNA 4TM7A 1P0PA 2WBLC 4R31A 1AV7A 1FVHA 2FY8A 3DE3X 3PUJA 5EZSA 1RIIA 4BVKA 3UQYS 1UBSB 1NW7A 1N6RA 3DKPA 3IQFA 4C03A 5ADUS 3J80A 3W8FA 1XLVA 2I6QA 4CHGA 3ZNNA 1A7JA 2EWMA 2LTAA 2WIDA 3A4IA 3ITDA 5FUXA 1NSYA 2D1TA 3WWCA 1HOTA 2R85A 3GNTA 2C20A 3E9EA 4Q93A 3L0OA 3ZV4A 4ECAA 4QG3A 4CLRA 1SHUX 1C1DB 2HDOA 1NWCA 2PT9A 4B6GA 1XFDA 5F9HA 2V7QA 4Y2YA 1G1AA 1YR6A 3QH4A 2NUTA 5I7SA 2QYOA 3V5NA 4X3OA 3IVGA 3N5KA 5DLYA 3BHNA 4LTNA 4JP3A 1DFHA 4M3NA 4ZVNA 2O0MA 3ESQA 3KPUA 4GZ3A 3FM9A 4HR7A 1QIJA 1I10A 2QN3A 3VHQA 1NF9A 1QHNA 4P80A 3T7RA 1U28C 1NPYA 2YFHA 5LL6P 3MD9A 2PT5A 2IOYA 1QHSA 1TK3A 4J16A 5FOVA 1F2UA 3E3LA 5EWJA 1SXJB 5CT6A 5F7XA 1P7ZA 3TKYA 3ZXUB 1WCV1 4HTAA 5JXIA 3ZKAA 4B3XA 2VRWA 1E3DA 4MMYB 4XDYA 2BP7A 4X92A 2G5PA 2GILA 5DNEA 4C89A 2IUTA 3HKDA 3R6WA 1FTSA 3UKOA 2XA2A 1XE3A 3NHBA 3DBVO 3MWKA 3EIFA 4IQ8A 5EN4A 5H70A 1FTYA 5J5VA 2WI8A 1IZ9A 1U5CA 2WVGA 3MS4A 4YCSA 1XHLA 3F4KA 2QP4A 2JAOA 3DDSA 5CYOA 3RF6A 3T12A 3AIOA 1JFVA 2WYHA 1NXOA 4MVJE 4RM3A 4TSRA 1DINA 3TRFA 4EECA 1GEGA 1KFBB 3DC2A 3LPAA 4P32A 4ASUA 4YMUA 3JQAA 5G3ZA 4JC0A 2I54A 4HDRA 3BGDA 3OTHA 1JMKC 4ZZ2A 3C3PA 3UK0A 4FFMA 3SKXA 1F14A 2C83A 4Y9TA 5CM9C 3RODA 1U0FA 2DC1A 3HLTA 4EHHA 2XBLA 1NI5A 2EEPA 5AVRA 1ISPA 1RVDA 4P33A 4XVUA 3RK4A 3UMJA 1YTUA 2QR5A 3I1IA 4E15A 2BSXA 5G0VA 5JHGB 4O4LB 1B15A 1SPBS 5TF0A 1Q1ZA 4DGSA 4ZJPA 1B0AA 1P39A 1RU3A 1PTKA 2IL1A 3C43A 4LPSA 4XSHA 2ZRFA 4BO3A 1PW7A 4MNTA 2OKCA 5EZYA 2H1IA 4UD6A 1VE3A 3I73A 3PEYA 5AESA 2D06A 2EATA 3EIHA 3H7IA 1E7RA 5B1DA 3W4JA 1ORRA 5HUQA 4F60A 3PQ2A 7ABPA 2X40A 1ZUIA 3P19A 4Q05A 5KTNA 5MN6A 3FOZA 3ZBTA 3G0OA 1J8QA 1QORA 1UXOA 4KHZA 4X62B 1FPQA 4KWCA 1B1CA 1LPSA 2JKYA 3T3PB 3A6ZA 3CBQA 4Z1MD 1OSNA 1YC2A 4DJJA 2P9GA 3I1JA 2PTHA 2Q8NA 1N2ZA 2FPRA 3WFZA 3VDXA 4YACA 3RYIA 5AP9A 2PYZA 1LF5A 2YMQA 2ZEJA 4NULA 4RLSA 3T99A 4UEKA 3MYYA 4M1YA 3VRHA 3MTQA 3V8RA 5F2EA 2VLBA 5K3SA 4MDYA 1JWBB 1G3RA 1QTIA 1YE5A 3C3MA 5IKEA 1Z2PX 4FGSA 1T9GR 2ILVA 4O4LF 1GPLA 1MOQA 3DSRA 4YCCA 1U0EA 3UTDA 1MJGM 3ZPXA 2YXLA 1WABA 2E7ZA 2WFLA 3JATB 4HMQA 2QVLA 2Z6VA 1DL5A 4I8XA 1CY2A 3WSTA 3VPCA 4EFLA 4EUHA 4G86A 5JYDA 5HG0A 3PF9A 4OREX 1PVDA 4DL9A 2VF8A 5JDCC 4U7TB 5FFNA 4R68A 3JR7A 2AUMA 2GEUA 2HPVA 1G20A 2YY5A 1K0UA 3K5IA 3NOOA 1JAZA 4HPWA 4IV0A 1KSGA 3RVLA 3JCZA 3LLSA 5D6OA 4BMPB 4AQDA 4C29A 1QHYA 4DLNA 2A9OA 4JBYA 2PMWB 5AXBA 3WXMA 1IZ7A 2R7AA 4D0SA 2V0NA 2IKQA 3ENWA 3FWHA 3LK6A 4NMLA 1CV2A 1E5DA 1U90A 1MDBA 2JFNA 6PFKA 1EGAA 1RXYA 3C24A 3O3CA 1DQSA 3R5FA 8ABPA 1APBA 3BREA 4ZI7A 4XR4A 1OA1A 1FFCA 1VHWA 4JGIA 3GNLA 3J81A 1J9GA 2NOAA 6LDHA 1DKQA 2MDTA 4HNHA 1E2IA 3WYDA 1EP1B 1J09A 2V8OA 1ZVJA 3M83A 1JAYA 1T0HB 2ZI6A 3DYIA 4HI0E 1WB6A 1H0HA 4IEFB 4N0PA 4NV0A 3UH0A 3WNBA 3I6IA 3OFKA 5JAUA 4AKIA 4L08A 2DKNA 3MN1A 3K30A 1YVUA 3FGOA 4IVPA 2VXYA 4RADA 2PMBA 2O6LA 4QEDA 1Q1EA 1WWKA 3O95A 4IDAA 4QXRA 1MIOB 1P0CA 3C3WA 4P4UA 3AETB 4ZTBA 2I29A 1T5LA 3IALA 2WAAA 1L0BA 1MB0A 5JPDA 5FBQB 1XEWY 2LBPA 3WRVA 5BWCA 2VNHA 3QFCA 1HURA 2PVSA 2WWXA 1CZHA 3ZXIA 3QPCA 2BTQB 1O95A 4Z9XA 4N76A 2BEVA 2FR8A 3JZAA 2F55A 1X1CA 3FA2A 3LC1O 5DBHX 5K09A 3WMEA 4NFLA 5IPFA 3STVA 4R8MA 5HJ7A 3WKCA 4WSOA 2PEYA 3SQLA 5C1DA 1DDIA 2WOOA 3DCIA 4J7XA 4WCFB 5B1SA 1JHPA 5TEWA 4X00A 5HOEA 4D8TA 1T0BA 1Y3HA 2GERA 2PLFA 1IQ0A 4MVJI 1QPZA 3ZC3A 2PUDA 3LNCA 1KARA 4FD2A 4N3CA 4PYLA 2RH9B 3GGOA 4XYMA 3SXJA 1C7JA 3RFCA 3ZU3A 1NKSA 3OAAD 1E66A 1VMEA 2CZCA 2IS6A 1CZOA 4IMJB 1PJ4A 2WE7A 1M2OA 4HRXA 2P9FA 1U81A 4LSZA 3D7LA 4O29A 3FWKA 5FFMA 2R1VB 1KC3A 3QMMA 3IVMA 5DRTA 3VDQA 1VP9A 4IIJB 4EUNA 3KJZA 5IU6A 5K3OA 5L6MB 4U00A 4PYIA 3I53A 5H1YA 1M83A 5T4EA 3W4IA 3C41J 4QOIA 1SBYA 2IXAA 2RONA 2WSBA 3GD7A 4L8VA 4RZ2A 2C4UA 1VKNA 4BO8A 4BNMA 4BO0A 1XVVA 1D6NA 4FS8A 1LLCA 2YUIA 2FSIA 5IUNC 4AJ2A 3QE9Y 1MVOA 3HCEA 1FTGA 1Z8NA 3S44A 4PM4A 1PGNA 4TPKA 3W8EA 1BD4A 4B6PA 3CZ5A 3DEAA 5FB3A 2XVZA 4CM3A 1MC8A 3LBYA 2BZ1A 1RJ9A 4LJ4A 4F56A 1CQWA 3DPIA 3U81A 4B3SB 3FTPA 5IKPA 2HWXA 1K9SA 1XAGA 4R7TA 1X7XA 4KN8A 4WKOA 1T35A 4PAMA 1SHLA 3BVPA 3DAFA 3GPDG 2WWVD 2F9LA 1YRAA 1EZ4A 3H1TA 3DQZA 1VL6A 3EUWA 3L7JA 4IIJF 5A6VA 4X6LA 3F98A 4ZMRA 1BWPA 2EGUA 3D1LA 1CJVC 3TEFA 1P91A 521PA 4UW9A 2ZZKA 5DI3A 4F38A 2CC2A 4WV3A 4M1EA 4AECA 3A1SA 3GZNB 2VK8A 4QDXA 1AV6A 2QNIA 3IBSA 1B2RA 1TM5E 1PZFA 5H4GA 1ZH8A 3DTVD 1T5IA 5AMXA 4BYGA 3T41A 5CB8A 2ZT8A 5BMVA 2YFQA 3P9RA 1Z6XA 4II2A 3FXAA 2ZE7A 4RF5A 4UAJA 4BNLA 1L5FA 1W96A 2WJ3A 2ZK7A 2RHTA 3RBAA 2BM1A 4KVZA 1X1SA 2Y1WA 3KHUA 4L4ZA 4IIDA 2YBDA 5G4KB 1MG5A 3CF4A 3VH4A 5DHPA 2WWIA 2IC5A 4NE7A 4B71A 1GLNA 2FOLA 2ID4A 1R0SA 2OP0A 3VYSB 1Z2OX 5J2UB 2CL5A 2FPGB 2IYXA 1N6OA 2YN4A 4XTRA 5H68A 3IDZA 4Z4EA 1KKLA 1UMBB 4M76B 5IJ9B 2FE1A 3PUHA 1LPPA 3P9YA 3HRKA 3QLUA 3TQOA 1TCBA 3HJRA 4G0WA 3EVEA 1STOA 4KODA 3W2TA 4FGUA 4HDNB 1U3GA 3B5JA 4H1HA 4XQGA 2OFOA 2ZJ3A 3EDMA 3MLAA 4G0YA 1U0SY 3FGPA 2BV3A 2GEFA 1KP2A 1SG0A 3QELA 3GAMA 4L51A 4DBVO 1G3UA 1IN4A 2F43A 4O4IF 4URVR 5IJWA 5LZ9A 4S05A 1H8EA 2DUJA 3C3KA 4J7UA 1GPH1 1K7CA 3VC1A 2BL4A 2XIJA 2XB2A 1V6SA 3D6NB 4JBNA 3EEOA 2IUFA 4LYAA 4UBIA 1O97C 5CT9A 1C30A 2ZU6A 3FLAA 2J3MA 3A2KA 4K9SA 4DV6B 2V7GA 4D6PA 1FJXA 3RU9A 2HHCA 4J1NA 5JCOA 3A4NA 3A04A 4ZD6A 1BROA 1KZ7B 3ZVKA 1ZHOA 4HVCA 5ES4B 5KQRA 4Q5IA 3WIUA 4BLSA 1PX2A 3U6BA 5J2UF 3OJ0A 4WBSA 4KIJA 2R8ZA 2PAAA 1NOJA 2WQ6A 2C5LA 3Q8XB 1ILEA 4GGMX 2A5GA 2VRBA 3ADDA 5IAJA 1OAAA 3N3AC 2LRHA 3O0DA 1G8AA 3OLZA 2J33A 1UKAA 1CQIB 4FNGA 5L95A 2A92A 1Q11A 1O96B 3L41A 5ALOA 2W83A 1UBNA 2CVFA 4EG4A 1UPFA 2GVZC 5C3MA 2E3JA 5ERYA 5CCEA 4MUEA 3LQ4A 1T5SA 4CKXA 1JYEA 2XWJI 1B6GA 3CR3C 3K09C 3MQ2A 3LOUA 4OJNA 4UUNA 4YUWA 1UFRA 5CVTA 3E3NA 4MWZA 2GLTA 1DWPA 2P4EA 3DZGA 2R84A 2JJ1D 3CVVA 4FFNA 1V8PA 3HADA 4FJ1A 4S0ZA 3T61A 3TE6A 3WI7A 3OKFA 3B6ZA 2E18A 1HLGA 2YNMD 1JP7A 1T0JB 1JE1A 2B9EA 2IH4A 1X3SA 4CQLB 1XRNA 1IVNA 1Q5PA 2DFPA 2G63A 5KI6A 1Y5LA 4D9CA 3TM5A 3LQRA 5IW8A 4TLLB 1PS9A 5JY6A 4IOJA 4CW7A 2RHJA 1CVRA 5KOHA 4KR9A 4RWEA 2O8EA 5E6UA 2WEKA 2PO7A 3GN1A 4K3UA 1OH6A 4TYQA 4I99A 4TRRA 1TE2A 1QH0A 4R3UC 1PQPA 2C03A 3S2GA 4JLWA 3T8YA 4RFSB 1IZ8A 2AOUA 2DHDA 2GVDC 2YHUA 3UJAA 1CNFA 5REQA 1II0A 4CM9D 4MUNA 4PY2A 1O94C 2UVPA 4OHFA 1A27A 4X1YB 4ERXA 4NBSA 5JH7A 4TMXA 3RBVA 1YZGA 3W2FA 3GZ4A 4EQ6B 3EGDA 2NXWA 1UIRA 1IM2A 1XQXA 1G21E 1GTJ1 3E2PA 3GEIA 3LUKA 3UN1A 3NHMA 5C5IA 1KEEA 5TARA 1UWLA 3I9V1 2QLMA 4KTVE 3TBHA 4AJ4A 4IAOA 2OQ2A 1LI7A 3F5DA 3FB1A 3PP8A 4PGGA 2PLNA 5I8ZA 3V1YA 4V02A 3OQOA 4WWHA 3OLYA 5BT9A 1W0KD 4XA8A 3D1JA 5BWNA 5AVZA 3KZXA 2WAOA 1NURA 2Q4RA 2Q6VA 4F7WA 2SECE 1VKRA 5G53C 4GXTA 3SIPA 3WA6A 2FPMA 2W6QA 3H2HA 3I52A 2GI4A 4TYWA 1LBHA 1YS2X 2XNDD 1E6EA 1Z6TA 4MWCA 1Y6RA 4N4AA 5JD4A 4R1LA 3KOOA 2QU7A 4Y1RA 2B6NA 3KXPA 4D42A 5KTKA 3G0DA 4JR2A 3U3JA 3V7UA 3VUEA 2DPXA 4C7BA 4HNVA 1YCFA 3C5WP 2IU0A 1GN9A 1YS9A 4P3KA 4TUYB 4EA8A 5F23A 3HL0A 3TZBA 5EIWA 4BQEA 2JCYA 1NJ5A 1N3BA 1PAUA 1JECA 1MV8A 4B84A 1R1DA 2I5PO 2VPTA 2XSZD 1G38A 3FCUB 1YIDA 2YHIA 3HCNA 3RUEA 5E1BA 2PE5A 1H94A 3FPKA 2JZOA 2IEAA 2EL7A 3IXQA 3MS7A 4WE3A 1L6RA 5TGZA 5KMGB 2FPOA 2Z0MA 1A8IA 1V16B 2VYND 3L9WA 4CVNA 4DUPA 4ZQFA 1GGVA 5I4KA 1KWKA 3T1TA 4QL3A 3UGJA 4XX0A 3L1HA 4Q4HB 4ESEA 4P7GA 1Z7YA 1U1IA 2YX1A 5FPTA 1OIVA 1EX1A 4EGJA 4MW5A 1XWWA 2O2XA 3DV2A 5KQSA 1BHSA 2E1PA 4YMVA 1VYHA 4EG5A 2ACKA 4W5TA 1MO5A 1R0RE 2FN4A 3PFCA 1KS2A 1ORIA 4NFYA 1KK1A 1NATA 3UZUA 3G3EA 3WRYC 1WPRA 5B3LA 3MLEA 1R6XA 2HIHA 2H63A 3ESBA 3HACA 4TV9A 3S2IA 1Z75A 4TUYF 2Q8QA 4LQCA 3EVBA 1L8QA 2C2KA 5HS6A 3SZ3A 4GBMA 3UTCA 2WE8A 1SXPA 1V43A 2RB5A 1CQJA 4CV2A 3CZ4A 3F8SA 1ISRA 5JBNA 1IVYA 1JEDA 1BE8A 1BX3A 1GPAA 3ILHA 4JGBA 3QVKA 4Q4DA 4Y6QA 1HRKA 3BMOB 4RIIA 1JJ7A 5SY6A 4ATNA 5IHXA 1ML4A 3EG9B 4UTOA 4WCVA 3D4PA 3L7OA 1Y80A 2ZYHA 1I01A 3FYSA 5K3BA 3KR9A 4REOA 4C4ZA 1SHZA 1MO6A 2BFPA 3NIDB 4MKRA 3WBBA 4DDUA 1YZTA 4MHSA 5ALQA 5K0TA 3NFYA 1F7UA 1C7QA 4FINA 1SQ5A 3RRMA 2O2ZA 3GBSA 4GRDA 3K71B 3L6UA 2GPNA 1R4MA 2XGMA 1CY6A 1V8DA 4EG8A 2F3PA 3OQHA 3QFSA 4E46A 1DG3A 2HM7A 5I7RA 5KU7A 3G68A 4QE3A 2R5NA 4KN9S 3NV9A 4L5BA 2AFHA 1O0CA 1KZ4A 1L1FA 2H0RA 3RS0A 3CB2A 3C3DA 4N8SA 3OO0A 4Q3CA 1OVMA 2Q0XA 1QKKA 3W6NA 4B3IA 4B3JA 3NNDA 1ZC3A 1TOAA 1NBME 1ZIPA 3M4YA 3MRXA 3BB4A 1RQGA 3LX6A 2BKEA 4RA6A 4MW0A 4EITA 1I2DA 4ZO8A 3AK4A 4CMEC 2GA8A 1KFCB 3CUTA 3LT1A 4LC0A 1NIJA 3UCFA 3UMYA 3ZKWB 5TPWA 5KHLB 3CNQS 2ETVA 4K87A 5ITWA 5IT9A 5UKDA 1O8CA 1VZ3A 2YQZA 3VR5D 1ZRSA 1I9GA 3JAKB 3W1VA 2C8JA 3BXZA 3HJCA 1KH1A 1AUXA 1RRMA 4L2IA 3W9SA 1XRQA 2F1JA 5A6SB 2GBLA 2TMDA 3C97A 5DTRA 4PR0A 1KKMA 4C4SA 2QGFA 3B6MA 2WMNB 1Z0UA 1DBRA 5TT0A 1VL1A 3PHLA 1QTRA 1UZMA 1MMFB 3T1YB 1LPBB 2AQIA 3K0FA 5DHRA 4XCXA 3RS2A 1GOTA 3F0TA 2NZUG 2O7QA 3G9QA 4H2DA 3C3YA 2DR3A 2HCRA 4FMDB 5ICMA 4MO9A 1F7VA 1KPHA 3UC5A 4YO8A 4RANA 3II6X 4OLBA 2JK0A 3IERA 1A3CA 5ALGA 5HF5A 1UK6A 1WD7A 3WNCA 2XB4A 1PYDA 2MYPA 2OUKA 4FQ8A 2DGDA 4R05A 4LFAB 1IUOA 1GSOA 2GZ3A 2PWBA 1H6CA 5HKLA 2X3UA 3HDQA 4PF1A 1ECPA 4F2WA 5M29A 1EFDN 3P0IA 3UXYA 1JMVA 1QQTA 1UZAA 2QZ9A 3K53A 4HB4A 5IC6A 3ZS8A 1GXSA 1YL7A 4B8WA 3N07A 2JLYA 3RS4A 2D7DA 3Q12A 3QP9A 4UTVA 3BF7A 5JMWA 1F0YA 4LCBA 4RH3A 5E3IA 4B4WA 3VVLA 2M6SA 3JPYA 1JIJA 3EZ9A 4RZHA 4PLGA 4B79A 2OPBA 3BSFA 4QPCA 4D4KA 1X77A 2AEJA 3KJFA 2SKCA 2Y6UA 3BXXA 1Z2EA 1NUUA 3ZW8A 1BWRA 3HDJA 4C4YA 1TADA 3S40A 3M34A 3AJAA 4FMDF 5P8WA 2AFIE 2P2NA 4QBGB 1XCMA 1HM5A 3GJSA 4YCJA 2OHJA 4FQ7A 5L9AA 4QHSA 4ZQIA 3KZVA 1XTTA 3N6VA 3RAPR 3ZBPA 2DHCA 4WW0A 2HDHA 2VHWA 3NCTA 1PR0A 3KKOA 1DE0A 4ZQGA 3DBHB 4DLYA 5EFOA 1RBQA 2UYCA 5GV8A 1JVSA 3ANLA 3BA1A 4EHLA 5ALJA 3SJZA 3TM4A 1CDDA 2PS9A 1TKRA 1OGJA 3WLRA 3TECE 1LLDA 4OUKX 4RU1A 1L8XA 3UO8B 3F9RA 3HK2A 1H2RS 3RWOA 4CI9A 3EY9A 3PC8A 4OSPA 1LPNA 3K6KA 4QOJA 5BV0A 4EH1A 4XPIA 3L0ZA 2PGLA 4OVKA 3RADC 8GPBA 5K0NA 2P9ZA 2JJ8A 4JQCA 1ZAKA 4IJUA 5DGTA 2CLFB 2WFMA 1JG7A 4PG5A 3RIMA 3BK2A 1QCYA 2Z4RA 3KXKA 1VJ0A 5CVJA 5D3QA 3UJCA 3RVJA 5DZSA 4RSRA 1RQ2A 3GWGA 5FLKA 1SCKA 2RHLA 1Q7CA 1JYFA 1S5PA 5AI5A 4C14A 3OU2A 1WHTA 2XTAA 4RVOA 1JHMA 2BE7A 3GCXA 5LYJB 5EKXA 2YQ4A 3ZCPA 3WB1A 3VZDA 4OOFA 4D3ZA 1KFKB 5IT4A 3X0DA 1DRJA 3JD3A 3ECSA 1CY7A 3BDVA 5GTDA 4LQDA 5KINB 4ZCPA 1MJFA 3EAFA 1GAWA 5ALEA 1DQPA 3G5UA 5HX7A 5WRFA 2CD7A 2RHCA 2J0SA 1DBSA 1YZUA 1CG6A 3I1FA 3NCHA 3COSA 4OQFA 1YS4A 2W42A 4MLPA 5IP5A 1NVMB 2B5OA 2FPPA 2R6AA 4YAJA 1NC3A 4X71A 3Q9UA 3F3YA 2PBFA 4XB6B 4NESA 1JDBC 4M9SA 1C41A 2Y2VA 4GAEA 1MUUA 4K6FA 1BE6A 4LRYA 4NU5A 1JH8A 2NNLD 1T5BA 3RHSA 2JGRA 1U1FA 1FTWA 2JCSA 1R0XA 4LGVA 3UUFA 4B83A 4B81A 1PJRA 5T3YA 5LYJF 1CKEA 4AMUA 3KD2A 3PUVA 4WZAE 1NW5A 2NZXA 3U7FB 3COJA 1R5JA 1M8PA 2KBFA 1GCIA 3QK7A 1MB3A 4PPNA 3VAYA 1FZTA 2IIPA 1J8DA 1KEKA 4IZ6A 1PN3A 1R5NA 4RVCA 5C8YA 1JU3A 3GUZA 5AKHA 5A03A 1QQ5A 4MB2A 1Z34A 4IDOA 3AY7A