5GLFA

Structural insights into the interaction of p97 n-terminal domain and shp motif in derlin-1 rhomboid pseudoprotease
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
170
structure length
170
Chain Sequence
b'PNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLKGKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEGEPIKRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transitional endoplasmic reticulum ATPase
publication title Structural insights into the interaction of human p97 N-terminal domain and SHP motif in Derlin-1 rhomboid pseudoprotease.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/transport protein
total genus 48
structure length 170
sequence length 170
chains with identical sequence C, E, G
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 2016-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02359 CDC48_N Cell division protein 48 (CDC48), N-terminal domain
A PF02933 CDC48_2 Cell division protein 48 (CDC48), domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 5glfA01
3.10.330.10 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 5glfA02
1DMRA 1PPYA 1PT1A 1I3QA 2NVXA 5FTJA 5B6CA 1G8JA 5DYIA 1WCMA 2KI8A 2E2IA 3FKIA 3GTQA 2R93A 3HU3A 1E32A 1E61A 1H5NA 2VPWA 1Y1VA 4KDIA 2R7ZA 5FTLA 1SFOA 4GA6A 1G8KA 3DMRA 4KLNA 1QCSA 1TWFA 2JIQA 3GTGA 1I50A 3TM7B 2NVYA 1EU1A 2B63A 1KQFA 1E60A 5FTKA 2PMZA 3ML1A 2WB1A 1FDOA 1YLEA 1K83A 1Y1WA 2VPZA 3HKZA 2JIOA 2E2HA 1TWHA 4C2MA 3CF2A 2NAPA 4AZDA 2YUJA 1R7RA 4AONB 1TWGA 1PQHA 1Y5IA 2VPYA 2WAQA 3QQ8A 1PQFA 5EPPA 1H0HA 4KODA 1VC3B 2VPXA 1UHEA 2Y0SA 3GTKA 4AYBA 3TIWA 3IR6A 2JIMA 1FDIA 1SIWA 1E5VA 3IR7A 1PT0A 4CRYG 5GLFA 5C18A 2NYAA 1E18A 1TWCA 1AW8B 5T5MD 3QQ7A 3CQZA 5C1BA 2VUMA 3OUGA 1ZC1A 3GTJA 4QIWA 2YU9A 2C45A 1TMOA 1Q16A 2JA7A 2JV2A 5FTMA 1S3SA 5FTNA 4AAYA 2DMRA 4DMRA 2JA5A 1CZ4A 1PYQA 1R27A 2V3VA 2IV2X 1OGYA 3O5AA 1PYUB 2JIRA 3QWZA 3H0GA 1CZ5A 1PQEA 5T5ID 2EEOB 2JIPA 4KDLA 1QDNA 1KQGA 1UHDA 2R92A 2E7ZA 4KO8A 4AOKB 1AA6A 1CR5A 3QC8A 3GTMA 3PLXB 1TWAA 2V45A 1IW7D 1WLFA 3HU2A 3IR5A 5DYGA 4CS0A 4CRZA 1R9TA 4RV0A 4GA5A 4D7ZB 3GTLA 3GTOA 2JA6A 3GTPA 3HU1A 2PJHB 1DMSA 1Y4ZA
chains in the Genus database with same CATH superfamily
4L48A 1DMRA 1PPYA 4NOHA 3SUKA 1OA9A 1PT1A 1I3QA 2NVXA 4UC4A 1O54A 2Q1AX 2PI8A 5FTJA 5B6CA 1G8JA 5DYIA 2Q1DX 3M3GA 1WCMA 2BH0A 2KI8A 2E2IA 4FIBA 3FKIA 3GTQA 2R93A 3ZJVA 4JP7A 3HU3A 1E32A 1E61A 2YVLA 1H5NA 5CCBA 2VPWA 2XDPA 1Y1VA 2PJJA 4JP6A 4KDIA 2R7ZA 5FTLA 1SFOA 4GA6A 1G8KA 2A6HD 3DMRA 4KLNA 1QCSA 1TWFA 2JIQA 3GTGA 2G6GA 3CZBA 2A68D 3X2MA 4ENGA 1I50A 2KY9A 3TM7B 1L8FA 4JJOA 2O5JD 2NVYA 1EU1A 2B63A 3FPRA 1KQFA 2GF7A 1E60A 5FTKA 2PMZA 3ML1A 2WB1A 2AE0X 2Q18X 2QQSA 2ENGA 3X2GA 1FDOA 1YLEA 4FERA 1K83A 1Y1WA 2VPZA 1BW4A 3BQBA 3D30A 3HKZA 2JIOA 2E2HA 1TWHA 4C2MA 4JS7A 2YUJA 2NAPA 3CF2A 4AZDA 3FPUA 4JCWA 1R7RA 3LHDA 4AS1A 3SUMA 4AONB 1TWGA 3X2IA 1PQHA 1Y5IA 2VPYA 2WAQA 3QQ8A 5D6WA 2LW6A 3X2LA 1PQFA 2PICA 3SULA 5EPPA 3ZJTA 1H0HA 4KODA 1VC3B 3ZGZA 2VPXA 1UHEA 5H4UA 2Y0SA 5GLXA 4AQ7A 3GTKA 4AYBA 3ZJUA 1ZYRD 3TIWA 5CCXA 1YNND 3IR6A 2JIMA 5GM9A 1FDIA 5ERGB 1SIWA 2PNWA 1E5VA 3IR7A 3MB5A 2A6ED 1PT0A 2BE5D 4CRYG 5GLFA 5C18A 2NYAA 1E18A 2HCZX 2MM2A 1TWCA 4AVRA 1AW8B 5T5MD 1I9GA 3QQ7A 3CQZA 4ZM7A 5C1BA 5GLYA 2A69D 3X2JA 2VUMA 3OUGA 1ZC1A 3GTJA 4QIWA 3X2OA 2YU9A 2C45A 1TMOA 1Q16A 4FFTA 5D6YA 1N10A 5EQJB 2PWYA 5D6XA 2JA7A 2JV2A 5FTMA 4CQNA 1S3SA 5FTNA 4AAYA 2DMRA 4DMRA 1SMYD 2CW0D 4FG2A 3X2NA 2JA5A 2Q1CX 1CZ4A 1PYQA 1R27A 2V3VA 2IV2X 1OGYA 3O5AA 2G5DA 2KQAA 1PYUB 2JIRA 3QWZA 3H0GA 3LGAA 1BW3A 1CZ5A 1PQEA 4FG4A 5T5ID 1WC2A 1OA7A 2EEOB 4ARIA 2JIPA 4KDLA 3X2HA 3X2PA 2MM0A 1QDNA 1KQGA 1UHDA 3X2KA 2R92A 2E7ZA 4KO8A 5CD1A 4AOKB 1AA6A 1CR5A 2B25A 2GFAA 3FPTA 3QC8A 3GTMA 3ENGA 3PLXB 1TWAA 2V45A 1IW7D 1WLFA 3HU2A 3IR5A 5DYGA 3SUJA 4CS0A 4CRZA 1R9TA 4RV0A 4GA5A 4D7ZB 2Q19X 3GTLA 3GTOA 4ARCA 2JA6A 3GTPA 2GAEA 3HU1A 2PJHB 2QQRA 1DMSA 1YNJD 1Y4ZA 1HD5A
chains in the Genus database with same CATH topology
1DMRA 1PPYA 4NOHA 1PT1A 1I3QA 2NVXA 4UC4A 1O54A 2Q1AX 2PI8A 5FTJA 5B6CA 1G8JA 5DYIA 2Q1DX 1WCMA 2KI8A 2E2IA 4FIBA 3FKIA 3GTQA 2R93A 3ZJVA 3HU3A 1E32A 1E61A 2YVLA 1H5NA 5CCBA 2VPWA 2XDPA 1Y1VA 2PJJA 4KDIA 2R7ZA 5FTLA 1SFOA 4GA6A 1G8KA 2A6HD 3DMRA 4KLNA 1QCSA 1TWFA 2JIQA 3GTGA 2G6GA 3CZBA 2A68D 1I50A 3TM7B 2O5JD 2NVYA 1EU1A 2B63A 3FPRA 1KQFA 2GF7A 1E60A 5FTKA 2PMZA 3ML1A 2WB1A 2AE0X 2Q18X 3BQBA 1FDOA 1YLEA 1K83A 1Y1WA 2VPZA 3HKZA 2JIOA 2E2HA 1TWHA 4C2MA 2YUJA 2NAPA 3CF2A 4AZDA 3FPUA 3LHDA 1R7RA 4AS1A 4AONB 1TWGA 1PQHA 1Y5IA 2VPYA 2WAQA 3QQ8A 5D6WA 2LW6A 1PQFA 2PICA 3ZJTA 5EPPA 1H0HA 4KODA 1VC3B 3ZGZA 2VPXA 1UHEA 4AQ7A 2Y0SA 3GTKA 4AYBA 3ZJUA 1ZYRD 3TIWA 5CCXA 1YNND 3IR6A 2JIMA 5ERGB 1FDIA 1SIWA 2PNWA 1E5VA 3IR7A 3MB5A 2A6ED 1PT0A 2BE5D 4CRYG 5GLFA 5C18A 2NYAA 1E18A 2MM2A 1TWCA 1AW8B 5T5MD 1I9GA 3QQ7A 3CQZA 5C1BA 2A69D 2VUMA 3OUGA 1ZC1A 3GTJA 4QIWA 2YU9A 2C45A 1TMOA 1Q16A 5D6YA 5EQJB 2PWYA 5D6XA 2JA7A 2JV2A 5FTMA 4CQNA 1S3SA 5FTNA 4AAYA 2DMRA 4DMRA 1SMYD 2CW0D 2JA5A 2Q1CX 1CZ4A 1PYQA 1R27A 2V3VA 2IV2X 1OGYA 3O5AA 2G5DA 1PYUB 2JIRA 3QWZA 3H0GA 3LGAA 1CZ5A 1PQEA 5T5ID 4ARIA 2EEOB 2JIPA 4KDLA 2MM0A 1QDNA 1KQGA 1UHDA 2R92A 2E7ZA 4KO8A 5CD1A 4AOKB 1AA6A 1CR5A 2B25A 2GFAA 3FPTA 3QC8A 3GTMA 3PLXB 1TWAA 2V45A 1IW7D 1WLFA 3HU2A 3IR5A 5DYGA 4CS0A 4CRZA 1R9TA 2KY9A 4RV0A 4GA5A 4D7ZB 2Q19X 3GTLA 3GTOA 4ARCA 2JA6A 3GTPA 2GAEA 3HU1A 2PJHB 2QQRA 1DMSA 1YNJD 1Y4ZA 2QQSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DMR A;  1PPY A;  1PT1 A;  1I3Q A;  2NVX A;  5FTJ A;  5B6C A;  1G8J A;  5DYI A;  1WCM A;  2KI8 A;  2E2I A;  3FKI A;  3GTQ A;  2R93 A;  3HU3 A;  1E32 A;  1E61 A;  1H5N A;  2VPW A;  1Y1V A;  4KDI A;  2R7Z A;  5FTL A;  1SFO A;  4GA6 A;  1G8K A;  3DMR A;  4KLN A;  1QCS A;  1TWF A;  2JIQ A;  3GTG A;  1I50 A;  3TM7 B;  2NVY A;  1EU1 A;  2B63 A;  1KQF A;  1E60 A;  5FTK A;  2PMZ A;  3ML1 A;  2WB1 A;  1FDO A;  1YLE A;  1K83 A;  1Y1W A;  2VPZ A;  3HKZ A;  2JIO A;  2E2H A;  1TWH A;  4C2M A;  3CF2 A;  2NAP A;  4AZD A;  2YUJ A;  1R7R A;  4AON B;  1TWG A;  1PQH A;  1Y5I A;  2VPY A;  2WAQ A;  3QQ8 A;  1PQF A;  5EPP A;  1H0H A;  4KOD A;  1VC3 B;  2VPX A;  1UHE A;  2Y0S A;  3GTK A;  4AYB A;  3TIW A;  3IR6 A;  2JIM A;  1FDI A;  1SIW A;  1E5V A;  3IR7 A;  1PT0 A;  4CRY G;  5GLF A;  5C18 A;  2NYA A;  1E18 A;  1TWC A;  1AW8 B;  5T5M D;  3QQ7 A;  3CQZ A;  5C1B A;  2VUM A;  3OUG A;  1ZC1 A;  3GTJ A;  4QIW A;  2YU9 A;  2C45 A;  1TMO A;  1Q16 A;  2JA7 A;  2JV2 A;  5FTM A;  1S3S A;  5FTN A;  4AAY A;  2DMR A;  4DMR A;  2JA5 A;  1CZ4 A;  1PYQ A;  1R27 A;  2V3V A;  2IV2 X;  1OGY A;  3O5A A;  1PYU B;  2JIR A;  3QWZ A;  3H0G A;  1CZ5 A;  1PQE A;  5T5I D;  2EEO B;  2JIP A;  4KDL A;  1QDN A;  1KQG A;  1UHD A;  2R92 A;  2E7Z A;  4KO8 A;  4AOK B;  1AA6 A;  1CR5 A;  3QC8 A;  3GTM A;  3PLX B;  1TWA A;  2V45 A;  1IW7 D;  1WLF A;  3HU2 A;  3IR5 A;  5DYG A;  4CS0 A;  4CRZ A;  1R9T A;  4RV0 A;  4GA5 A;  4D7Z B;  3GTL A;  3GTO A;  2JA6 A;  3GTP A;  3HU1 A;  2PJH B;  1DMS A;  1Y4Z A; 
#chains in the Genus database with same CATH topology
 4L48 A;  1DMR A;  1PPY A;  4NOH A;  3SUK A;  1OA9 A;  1PT1 A;  1I3Q A;  2NVX A;  4UC4 A;  1O54 A;  2Q1A X;  2PI8 A;  5FTJ A;  5B6C A;  1G8J A;  5DYI A;  2Q1D X;  3M3G A;  1WCM A;  2BH0 A;  2KI8 A;  2E2I A;  4FIB A;  3FKI A;  3GTQ A;  2R93 A;  3ZJV A;  4JP7 A;  3HU3 A;  1E32 A;  1E61 A;  2YVL A;  1H5N A;  5CCB A;  2VPW A;  2XDP A;  1Y1V A;  2PJJ A;  4JP6 A;  4KDI A;  2R7Z A;  5FTL A;  1SFO A;  4GA6 A;  1G8K A;  2A6H D;  3DMR A;  4KLN A;  1QCS A;  1TWF A;  2JIQ A;  3GTG A;  2G6G A;  3CZB A;  2A68 D;  3X2M A;  4ENG A;  1I50 A;  2KY9 A;  3TM7 B;  1L8F A;  4JJO A;  2O5J D;  2NVY A;  1EU1 A;  2B63 A;  3FPR A;  1KQF A;  2GF7 A;  1E60 A;  5FTK A;  2PMZ A;  3ML1 A;  2WB1 A;  2AE0 X;  2Q18 X;  2QQS A;  2ENG A;  3X2G A;  1FDO A;  1YLE A;  4FER A;  1K83 A;  1Y1W A;  2VPZ A;  1BW4 A;  3BQB A;  3D30 A;  3HKZ A;  2JIO A;  2E2H A;  1TWH A;  4C2M A;  4JS7 A;  2YUJ A;  2NAP A;  3CF2 A;  4AZD A;  3FPU A;  4JCW A;  1R7R A;  3LHD A;  4AS1 A;  3SUM A;  4AON B;  1TWG A;  3X2I A;  1PQH A;  1Y5I A;  2VPY A;  2WAQ A;  3QQ8 A;  5D6W A;  2LW6 A;  3X2L A;  1PQF A;  2PIC A;  3SUL A;  5EPP A;  3ZJT A;  1H0H A;  4KOD A;  1VC3 B;  3ZGZ A;  2VPX A;  1UHE A;  5H4U A;  2Y0S A;  5GLX A;  4AQ7 A;  3GTK A;  4AYB A;  3ZJU A;  1ZYR D;  3TIW A;  5CCX A;  1YNN D;  3IR6 A;  2JIM A;  5GM9 A;  1FDI A;  5ERG B;  1SIW A;  2PNW A;  1E5V A;  3IR7 A;  3MB5 A;  2A6E D;  1PT0 A;  2BE5 D;  4CRY G;  5GLF A;  5C18 A;  2NYA A;  1E18 A;  2HCZ X;  2MM2 A;  1TWC A;  4AVR A;  1AW8 B;  5T5M D;  1I9G A;  3QQ7 A;  3CQZ A;  4ZM7 A;  5C1B A;  5GLY A;  2A69 D;  3X2J A;  2VUM A;  3OUG A;  1ZC1 A;  3GTJ A;  4QIW A;  3X2O A;  2YU9 A;  2C45 A;  1TMO A;  1Q16 A;  4FFT A;  5D6Y A;  1N10 A;  5EQJ B;  2PWY A;  5D6X A;  2JA7 A;  2JV2 A;  5FTM A;  4CQN A;  1S3S A;  5FTN A;  4AAY A;  2DMR A;  4DMR A;  1SMY D;  2CW0 D;  4FG2 A;  3X2N A;  2JA5 A;  2Q1C X;  1CZ4 A;  1PYQ A;  1R27 A;  2V3V A;  2IV2 X;  1OGY A;  3O5A A;  2G5D A;  2KQA A;  1PYU B;  2JIR A;  3QWZ A;  3H0G A;  3LGA A;  1BW3 A;  1CZ5 A;  1PQE A;  4FG4 A;  5T5I D;  1WC2 A;  1OA7 A;  2EEO B;  4ARI A;  2JIP A;  4KDL A;  3X2H A;  3X2P A;  2MM0 A;  1QDN A;  1KQG A;  1UHD A;  3X2K A;  2R92 A;  2E7Z A;  4KO8 A;  5CD1 A;  4AOK B;  1AA6 A;  1CR5 A;  2B25 A;  2GFA A;  3FPT A;  3QC8 A;  3GTM A;  3ENG A;  3PLX B;  1TWA A;  2V45 A;  1IW7 D;  1WLF A;  3HU2 A;  3IR5 A;  5DYG A;  3SUJ A;  4CS0 A;  4CRZ A;  1R9T A;  4RV0 A;  4GA5 A;  4D7Z B;  2Q19 X;  3GTL A;  3GTO A;  4ARC A;  2JA6 A;  3GTP A;  2GAE A;  3HU1 A;  2PJH B;  2QQR A;  1DMS A;  1YNJ D;  1Y4Z A;  1HD5 A; 
#chains in the Genus database with same CATH homology
 1DMR A;  1PPY A;  4NOH A;  1PT1 A;  1I3Q A;  2NVX A;  4UC4 A;  1O54 A;  2Q1A X;  2PI8 A;  5FTJ A;  5B6C A;  1G8J A;  5DYI A;  2Q1D X;  1WCM A;  2KI8 A;  2E2I A;  4FIB A;  3FKI A;  3GTQ A;  2R93 A;  3ZJV A;  3HU3 A;  1E32 A;  1E61 A;  2YVL A;  1H5N A;  5CCB A;  2VPW A;  2XDP A;  1Y1V A;  2PJJ A;  4KDI A;  2R7Z A;  5FTL A;  1SFO A;  4GA6 A;  1G8K A;  2A6H D;  3DMR A;  4KLN A;  1QCS A;  1TWF A;  2JIQ A;  3GTG A;  2G6G A;  3CZB A;  2A68 D;  1I50 A;  3TM7 B;  2O5J D;  2NVY A;  1EU1 A;  2B63 A;  3FPR A;  1KQF A;  2GF7 A;  1E60 A;  5FTK A;  2PMZ A;  3ML1 A;  2WB1 A;  2AE0 X;  2Q18 X;  3BQB A;  1FDO A;  1YLE A;  1K83 A;  1Y1W A;  2VPZ A;  3HKZ A;  2JIO A;  2E2H A;  1TWH A;  4C2M A;  2YUJ A;  2NAP A;  3CF2 A;  4AZD A;  3FPU A;  3LHD A;  1R7R A;  4AS1 A;  4AON B;  1TWG A;  1PQH A;  1Y5I A;  2VPY A;  2WAQ A;  3QQ8 A;  5D6W A;  2LW6 A;  1PQF A;  2PIC A;  3ZJT A;  5EPP A;  1H0H A;  4KOD A;  1VC3 B;  3ZGZ A;  2VPX A;  1UHE A;  4AQ7 A;  2Y0S A;  3GTK A;  4AYB A;  3ZJU A;  1ZYR D;  3TIW A;  5CCX A;  1YNN D;  3IR6 A;  2JIM A;  5ERG B;  1FDI A;  1SIW A;  2PNW A;  1E5V A;  3IR7 A;  3MB5 A;  2A6E D;  1PT0 A;  2BE5 D;  4CRY G;  5GLF A;  5C18 A;  2NYA A;  1E18 A;  2MM2 A;  1TWC A;  1AW8 B;  5T5M D;  1I9G A;  3QQ7 A;  3CQZ A;  5C1B A;  2A69 D;  2VUM A;  3OUG A;  1ZC1 A;  3GTJ A;  4QIW A;  2YU9 A;  2C45 A;  1TMO A;  1Q16 A;  5D6Y A;  5EQJ B;  2PWY A;  5D6X A;  2JA7 A;  2JV2 A;  5FTM A;  4CQN A;  1S3S A;  5FTN A;  4AAY A;  2DMR A;  4DMR A;  1SMY D;  2CW0 D;  2JA5 A;  2Q1C X;  1CZ4 A;  1PYQ A;  1R27 A;  2V3V A;  2IV2 X;  1OGY A;  3O5A A;  2G5D A;  1PYU B;  2JIR A;  3QWZ A;  3H0G A;  3LGA A;  1CZ5 A;  1PQE A;  5T5I D;  4ARI A;  2EEO B;  2JIP A;  4KDL A;  2MM0 A;  1QDN A;  1KQG A;  1UHD A;  2R92 A;  2E7Z A;  4KO8 A;  5CD1 A;  4AOK B;  1AA6 A;  1CR5 A;  2B25 A;  2GFA A;  3FPT A;  3QC8 A;  3GTM A;  3PLX B;  1TWA A;  2V45 A;  1IW7 D;  1WLF A;  3HU2 A;  3IR5 A;  5DYG A;  4CS0 A;  4CRZ A;  1R9T A;  2KY9 A;  4RV0 A;  4GA5 A;  4D7Z B;  2Q19 X;  3GTL A;  3GTO A;  4ARC A;  2JA6 A;  3GTP A;  2GAE A;  3HU1 A;  2PJH B;  2QQR A;  1DMS A;  1YNJ D;  1Y4Z A;  2QQS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...