5GLFA

Structural insights into the interaction of p97 n-terminal domain and shp motif in derlin-1 rhomboid pseudoprotease
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
170
structure length
170
Chain Sequence
b'PNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLKGKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEGEPIKRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transitional endoplasmic reticulum ATPase
molecule tags Hydrolase/transport protein
source organism Homo sapiens
publication title Structural insights into the interaction of human p97 N-terminal domain and SHP motif in Derlin-1 rhomboid pseudoprotease.
pubmed doi rcsb
total genus 48
structure length 170
sequence length 170
chains with identical sequence C, E, G
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 2016-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02359 CDC48_N Cell division protein 48 (CDC48), N-terminal domain
A PF02933 CDC48_2 Cell division protein 48 (CDC48), domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 5glfA01
3.10.330.10 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 5glfA02
3GTOA 4AOKB 3GTPA 2NVXA 1R7RA 1WLFA 1FDIA 2VPXA 2VPYA 2JA7A 1H5NA 2C45A 1OGYA 1PPYA 2VPWA 3OUGA 1PQHA 2JIPA 1PQFA 1SFOA 2JV2A 2VPZA 3IR6A 3H0GA 2EEOB 1E18A 1FDOA 1Y1WA 1H0HA 1Y5IA 2PMZA 3QQ7A 2JIRA 1UHDA 1Y1VA 2YUJA 1VC3B 2B63A 2IV2X 2JA5A 4DMRA 1E61A 1R27A 1I3QA 1KQGA 1TWAA 2JA6A 1AW8B 1TWHA 2YU9A 3HKZA 4CS0A 2NVYA 1TWCA 1CR5A 2Y0SA 1PT1A 3FKIA 1K83A 4AAYA 1ZC1A 2WAQA 2PJHB 4AONB 1G8JA 3IR5A 2JIOA 1TWGA 2NAPA 1I50A 5GLFA 4CRZA 2E2IA 1G8KA 1TWFA 1EU1A 2NYAA 3GTGA 3PLXB 3ML1A 3QWZA 4GA6A 4KO8A 3TM7B 5C1BA 4KDLA 3HU1A 3O5AA 1UHEA 3QC8A 2WB1A 5B6CA 3GTKA 4AYBA 2R7ZA 4GA5A 4AZDA 2VUMA 5FTJA 3CF2A 1YLEA 3GTQA 4KLNA 1TMOA 1Y4ZA 1Q16A 2V3VA 2R92A 5FTNA 5C18A 3QQ8A 4KODA 2KI8A 1E5VA 1S3SA 2V45A 1IW7D 1KQFA 1E32A 1CZ5A 3CQZA 1QCSA 1PT0A 4RV0A 3DMRA 1PQEA 1WCMA 3GTJA 2E2HA 1PYUB 1DMRA 5FTMA 1QDNA 3GTLA 1AA6A 5EPPA 3TIWA 5DYIA 4D7ZB 3IR7A 5FTLA 2DMRA 2JIQA 1E60A 1PYQA 3HU2A 1CZ4A 5FTKA 4CRYG 2E7ZA 4KDIA 2JIMA 5DYGA 5T5MD 3GTMA 1SIWA 4QIWA 1R9TA 5T5ID 4C2MA 1DMSA 2R93A 3HU3A
chains in the Genus database with same CATH superfamily
1BW4A 3GTOA 4JCWA 4AOKB 3GTPA 1R7RA 2NVXA 5CD1A 1WLFA 1FDIA 2Q19X 4AQ7A 2GAEA 2VPXA 2VPYA 3LHDA 3M3GA 2JA7A 2A6ED 1H5NA 3MB5A 2C45A 1OGYA 1PPYA 2VPWA 3OUGA 1PQHA 2JIPA 1PQFA 1SFOA 2JV2A 2VPZA 3IR6A 4ARIA 2G5DA 3H0GA 5ERGB 2EEOB 1E18A 1FDOA 1Y1WA 3ZJUA 1H0HA 3X2GA 1Y5IA 2PMZA 4ENGA 2BE5D 3QQ7A 1HD5A 5EQJB 2JIRA 1UHDA 1SMYD 5GM9A 1Y1VA 2AE0X 1VC3B 2YUJA 1BW3A 2B63A 2IV2X 2JA5A 3CZBA 3SUMA 3X2HA 4DMRA 5CCBA 1E61A 1R27A 1I3QA 4NOHA 1KQGA 3X2NA 1I9GA 2MM0A 4JJOA 2Q1CX 4UC4A 1TWAA 2JA6A 1AW8B 1TWHA 2YU9A 3HKZA 1O54A 4CS0A 2NVYA 1TWCA 2G6GA 2KY9A 1CR5A 5CCXA 3D30A 2Y0SA 1PT1A 3FKIA 2B25A 1K83A 4AAYA 2Q18X 3FPRA 1ZC1A 3SULA 3FPUA 4CQNA 2WAQA 2PNWA 2PJHB 5GLXA 4AONB 1G8JA 2JIOA 3IR5A 4ARCA 4FG4A 1TWGA 2NAPA 5D6YA 2GFAA 3ZJVA 1I50A 5GLFA 3X2JA 4CRZA 2E2IA 3X2MA 2MM2A 5D6XA 1G8KA 2QQRA 3ENGA 1TWFA 1EU1A 2NYAA 4FG2A 1OA9A 4L48A 3GTGA 3PLXB 3ML1A 3QWZA 4GA6A 4KO8A 2ENGA 3TM7B 4FERA 5C1BA 4KDLA 1L8FA 3HU1A 2A69D 3O5AA 3FPTA 1UHEA 3QC8A 2WB1A 4JS7A 5B6CA 1YNJD 3GTKA 4AYBA 2R7ZA 4GA5A 4AZDA 2VUMA 2CW0D 5FTJA 1N10A 3CF2A 2LW6A 1YLEA 4JP6A 2O5JD 3GTQA 2PICA 4KLNA 1TMOA 1Y4ZA 1Q16A 4FIBA 2V3VA 2R92A 5FTNA 2YVLA 2BH0A 3X2OA 5C18A 3QQ8A 4KODA 2KI8A 1E5VA 1S3SA 2V45A 3BQBA 4AS1A 3X2KA 3X2LA 1IW7D 1KQFA 1E32A 3X2IA 1CZ5A 3CQZA 1QCSA 1ZYRD 2Q1AX 1PT0A 4RV0A 3DMRA 3SUJA 1PQEA 1WCMA 2PWYA 3X2PA 3ZJTA 3GTJA 2E2HA 1PYUB 2KQAA 1DMRA 1YNND 4FFTA 1OA7A 1QDNA 4JP7A 5FTMA 3GTLA 1AA6A 5EPPA 2PJJA 3TIWA 2A6HD 2XDPA 3LGAA 5DYIA 3SUKA 4D7ZB 4AVRA 2PI8A 3IR7A 5FTLA 2DMRA 2GF7A 2Q1DX 2JIQA 1E60A 1PYQA 3HU2A 1WC2A 1CZ4A 5FTKA 5H4UA 4CRYG 2E7ZA 4KDIA 2JIMA 5D6WA 5DYGA 2A68D 5T5MD 3GTMA 1SIWA 2HCZX 4QIWA 5GLYA 5T5ID 4ZM7A 4C2MA 1R9TA 1DMSA 2QQSA 2R93A 3ZGZA 3HU3A
chains in the Genus database with same CATH topology
3GTOA 4AOKB 3GTPA 2NVXA 1R7RA 5CD1A 1WLFA 1FDIA 2Q19X 4AQ7A 2GAEA 2VPXA 2VPYA 3LHDA 2JA7A 2A6ED 1H5NA 3MB5A 2C45A 1OGYA 1PPYA 2VPWA 3OUGA 1PQHA 2JIPA 1PQFA 1SFOA 2JV2A 2VPZA 3IR6A 4ARIA 2G5DA 3H0GA 5ERGB 2EEOB 1E18A 1FDOA 1Y1WA 3ZJUA 1H0HA 1Y5IA 2PMZA 2BE5D 3QQ7A 5EQJB 2JIRA 1UHDA 1SMYD 1Y1VA 2AE0X 1VC3B 2YUJA 2B63A 2IV2X 2JA5A 3CZBA 4DMRA 5CCBA 1E61A 1R27A 1I3QA 4NOHA 1KQGA 1I9GA 2MM0A 2Q1CX 4UC4A 1TWAA 2JA6A 1AW8B 1TWHA 2YU9A 3HKZA 1O54A 4CS0A 2NVYA 1TWCA 2G6GA 2KY9A 1CR5A 5CCXA 2Y0SA 1PT1A 3FKIA 2B25A 1K83A 4AAYA 2Q18X 3FPRA 1ZC1A 3FPUA 4CQNA 2WAQA 2PNWA 2PJHB 4AONB 1G8JA 2JIOA 3IR5A 4ARCA 1TWGA 2NAPA 5D6YA 2GFAA 3ZJVA 1I50A 5GLFA 4CRZA 2E2IA 2MM2A 5D6XA 1G8KA 2QQRA 1TWFA 1EU1A 2NYAA 3GTGA 3PLXB 3ML1A 3QWZA 4GA6A 4KO8A 3TM7B 5C1BA 4KDLA 3HU1A 2A69D 3O5AA 3FPTA 1UHEA 3QC8A 2WB1A 5B6CA 1YNJD 3GTKA 4AYBA 2R7ZA 4GA5A 4AZDA 2VUMA 2CW0D 5FTJA 3CF2A 2LW6A 1YLEA 2O5JD 3GTQA 2PICA 4KLNA 1TMOA 1Y4ZA 1Q16A 4FIBA 2V3VA 2R92A 5FTNA 2YVLA 4AS1A 5C18A 3QQ8A 4KODA 2KI8A 1E5VA 1S3SA 2V45A 3BQBA 1IW7D 1KQFA 1E32A 1CZ5A 3CQZA 1QCSA 1ZYRD 2Q1AX 1PT0A 4RV0A 3DMRA 1PQEA 1WCMA 2PWYA 3ZJTA 3GTJA 2E2HA 1PYUB 1DMRA 1YNND 5FTMA 1QDNA 3GTLA 1AA6A 5EPPA 2PJJA 3TIWA 2A6HD 2XDPA 3LGAA 5DYIA 4D7ZB 2PI8A 3IR7A 5FTLA 2DMRA 2GF7A 2Q1DX 2JIQA 1E60A 1PYQA 3HU2A 1CZ4A 5FTKA 4CRYG 2E7ZA 4KDIA 2JIMA 5D6WA 5DYGA 2A68D 5T5MD 3GTMA 1SIWA 4QIWA 1R9TA 5T5ID 4C2MA 2QQSA 3ZGZA 1DMSA 2R93A 3HU3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTO A;  4AOK B;  3GTP A;  2NVX A;  1R7R A;  1WLF A;  1FDI A;  2VPX A;  2VPY A;  2JA7 A;  1H5N A;  2C45 A;  1OGY A;  1PPY A;  2VPW A;  3OUG A;  1PQH A;  2JIP A;  1PQF A;  1SFO A;  2JV2 A;  2VPZ A;  3IR6 A;  3H0G A;  2EEO B;  1E18 A;  1FDO A;  1Y1W A;  1H0H A;  1Y5I A;  2PMZ A;  3QQ7 A;  2JIR A;  1UHD A;  1Y1V A;  2YUJ A;  1VC3 B;  2B63 A;  2IV2 X;  2JA5 A;  4DMR A;  1E61 A;  1R27 A;  1I3Q A;  1KQG A;  1TWA A;  2JA6 A;  1AW8 B;  1TWH A;  2YU9 A;  3HKZ A;  4CS0 A;  2NVY A;  1TWC A;  1CR5 A;  2Y0S A;  1PT1 A;  3FKI A;  1K83 A;  4AAY A;  1ZC1 A;  2WAQ A;  2PJH B;  4AON B;  1G8J A;  3IR5 A;  2JIO A;  1TWG A;  2NAP A;  1I50 A;  5GLF A;  4CRZ A;  2E2I A;  1G8K A;  1TWF A;  1EU1 A;  2NYA A;  3GTG A;  3PLX B;  3ML1 A;  3QWZ A;  4GA6 A;  4KO8 A;  3TM7 B;  5C1B A;  4KDL A;  3HU1 A;  3O5A A;  1UHE A;  3QC8 A;  2WB1 A;  5B6C A;  3GTK A;  4AYB A;  2R7Z A;  4GA5 A;  4AZD A;  2VUM A;  5FTJ A;  3CF2 A;  1YLE A;  3GTQ A;  4KLN A;  1TMO A;  1Y4Z A;  1Q16 A;  2V3V A;  2R92 A;  5FTN A;  5C18 A;  3QQ8 A;  4KOD A;  2KI8 A;  1E5V A;  1S3S A;  2V45 A;  1IW7 D;  1KQF A;  1E32 A;  1CZ5 A;  3CQZ A;  1QCS A;  1PT0 A;  4RV0 A;  3DMR A;  1PQE A;  1WCM A;  3GTJ A;  2E2H A;  1PYU B;  1DMR A;  5FTM A;  1QDN A;  3GTL A;  1AA6 A;  5EPP A;  3TIW A;  5DYI A;  4D7Z B;  3IR7 A;  5FTL A;  2DMR A;  2JIQ A;  1E60 A;  1PYQ A;  3HU2 A;  1CZ4 A;  5FTK A;  4CRY G;  2E7Z A;  4KDI A;  2JIM A;  5DYG A;  5T5M D;  3GTM A;  1SIW A;  4QIW A;  1R9T A;  5T5I D;  4C2M A;  1DMS A;  2R93 A;  3HU3 A; 
#chains in the Genus database with same CATH topology
 1BW4 A;  3GTO A;  4JCW A;  4AOK B;  3GTP A;  1R7R A;  2NVX A;  5CD1 A;  1WLF A;  1FDI A;  2Q19 X;  4AQ7 A;  2GAE A;  2VPX A;  2VPY A;  3LHD A;  3M3G A;  2JA7 A;  2A6E D;  1H5N A;  3MB5 A;  2C45 A;  1OGY A;  1PPY A;  2VPW A;  3OUG A;  1PQH A;  2JIP A;  1PQF A;  1SFO A;  2JV2 A;  2VPZ A;  3IR6 A;  4ARI A;  2G5D A;  3H0G A;  5ERG B;  2EEO B;  1E18 A;  1FDO A;  1Y1W A;  3ZJU A;  1H0H A;  3X2G A;  1Y5I A;  2PMZ A;  4ENG A;  2BE5 D;  3QQ7 A;  1HD5 A;  5EQJ B;  2JIR A;  1UHD A;  1SMY D;  5GM9 A;  1Y1V A;  2AE0 X;  1VC3 B;  2YUJ A;  1BW3 A;  2B63 A;  2IV2 X;  2JA5 A;  3CZB A;  3SUM A;  3X2H A;  4DMR A;  5CCB A;  1E61 A;  1R27 A;  1I3Q A;  4NOH A;  1KQG A;  3X2N A;  1I9G A;  2MM0 A;  4JJO A;  2Q1C X;  4UC4 A;  1TWA A;  2JA6 A;  1AW8 B;  1TWH A;  2YU9 A;  3HKZ A;  1O54 A;  4CS0 A;  2NVY A;  1TWC A;  2G6G A;  2KY9 A;  1CR5 A;  5CCX A;  3D30 A;  2Y0S A;  1PT1 A;  3FKI A;  2B25 A;  1K83 A;  4AAY A;  2Q18 X;  3FPR A;  1ZC1 A;  3SUL A;  3FPU A;  4CQN A;  2WAQ A;  2PNW A;  2PJH B;  5GLX A;  4AON B;  1G8J A;  2JIO A;  3IR5 A;  4ARC A;  4FG4 A;  1TWG A;  2NAP A;  5D6Y A;  2GFA A;  3ZJV A;  1I50 A;  5GLF A;  3X2J A;  4CRZ A;  2E2I A;  3X2M A;  2MM2 A;  5D6X A;  1G8K A;  2QQR A;  3ENG A;  1TWF A;  1EU1 A;  2NYA A;  4FG2 A;  1OA9 A;  4L48 A;  3GTG A;  3PLX B;  3ML1 A;  3QWZ A;  4GA6 A;  4KO8 A;  2ENG A;  3TM7 B;  4FER A;  5C1B A;  4KDL A;  1L8F A;  3HU1 A;  2A69 D;  3O5A A;  3FPT A;  1UHE A;  3QC8 A;  2WB1 A;  4JS7 A;  5B6C A;  1YNJ D;  3GTK A;  4AYB A;  2R7Z A;  4GA5 A;  4AZD A;  2VUM A;  2CW0 D;  5FTJ A;  1N10 A;  3CF2 A;  2LW6 A;  1YLE A;  4JP6 A;  2O5J D;  3GTQ A;  2PIC A;  4KLN A;  1TMO A;  1Y4Z A;  1Q16 A;  4FIB A;  2V3V A;  2R92 A;  5FTN A;  2YVL A;  2BH0 A;  3X2O A;  5C18 A;  3QQ8 A;  4KOD A;  2KI8 A;  1E5V A;  1S3S A;  2V45 A;  3BQB A;  4AS1 A;  3X2K A;  3X2L A;  1IW7 D;  1KQF A;  1E32 A;  3X2I A;  1CZ5 A;  3CQZ A;  1QCS A;  1ZYR D;  2Q1A X;  1PT0 A;  4RV0 A;  3DMR A;  3SUJ A;  1PQE A;  1WCM A;  2PWY A;  3X2P A;  3ZJT A;  3GTJ A;  2E2H A;  1PYU B;  2KQA A;  1DMR A;  1YNN D;  4FFT A;  1OA7 A;  1QDN A;  4JP7 A;  5FTM A;  3GTL A;  1AA6 A;  5EPP A;  2PJJ A;  3TIW A;  2A6H D;  2XDP A;  3LGA A;  5DYI A;  3SUK A;  4D7Z B;  4AVR A;  2PI8 A;  3IR7 A;  5FTL A;  2DMR A;  2GF7 A;  2Q1D X;  2JIQ A;  1E60 A;  1PYQ A;  3HU2 A;  1WC2 A;  1CZ4 A;  5FTK A;  5H4U A;  4CRY G;  2E7Z A;  4KDI A;  2JIM A;  5D6W A;  5DYG A;  2A68 D;  5T5M D;  3GTM A;  1SIW A;  2HCZ X;  4QIW A;  5GLY A;  5T5I D;  4ZM7 A;  4C2M A;  1R9T A;  1DMS A;  2QQS A;  2R93 A;  3ZGZ A;  3HU3 A; 
#chains in the Genus database with same CATH homology
 3GTO A;  4AOK B;  3GTP A;  2NVX A;  1R7R A;  5CD1 A;  1WLF A;  1FDI A;  2Q19 X;  4AQ7 A;  2GAE A;  2VPX A;  2VPY A;  3LHD A;  2JA7 A;  2A6E D;  1H5N A;  3MB5 A;  2C45 A;  1OGY A;  1PPY A;  2VPW A;  3OUG A;  1PQH A;  2JIP A;  1PQF A;  1SFO A;  2JV2 A;  2VPZ A;  3IR6 A;  4ARI A;  2G5D A;  3H0G A;  5ERG B;  2EEO B;  1E18 A;  1FDO A;  1Y1W A;  3ZJU A;  1H0H A;  1Y5I A;  2PMZ A;  2BE5 D;  3QQ7 A;  5EQJ B;  2JIR A;  1UHD A;  1SMY D;  1Y1V A;  2AE0 X;  1VC3 B;  2YUJ A;  2B63 A;  2IV2 X;  2JA5 A;  3CZB A;  4DMR A;  5CCB A;  1E61 A;  1R27 A;  1I3Q A;  4NOH A;  1KQG A;  1I9G A;  2MM0 A;  2Q1C X;  4UC4 A;  1TWA A;  2JA6 A;  1AW8 B;  1TWH A;  2YU9 A;  3HKZ A;  1O54 A;  4CS0 A;  2NVY A;  1TWC A;  2G6G A;  2KY9 A;  1CR5 A;  5CCX A;  2Y0S A;  1PT1 A;  3FKI A;  2B25 A;  1K83 A;  4AAY A;  2Q18 X;  3FPR A;  1ZC1 A;  3FPU A;  4CQN A;  2WAQ A;  2PNW A;  2PJH B;  4AON B;  1G8J A;  2JIO A;  3IR5 A;  4ARC A;  1TWG A;  2NAP A;  5D6Y A;  2GFA A;  3ZJV A;  1I50 A;  5GLF A;  4CRZ A;  2E2I A;  2MM2 A;  5D6X A;  1G8K A;  2QQR A;  1TWF A;  1EU1 A;  2NYA A;  3GTG A;  3PLX B;  3ML1 A;  3QWZ A;  4GA6 A;  4KO8 A;  3TM7 B;  5C1B A;  4KDL A;  3HU1 A;  2A69 D;  3O5A A;  3FPT A;  1UHE A;  3QC8 A;  2WB1 A;  5B6C A;  1YNJ D;  3GTK A;  4AYB A;  2R7Z A;  4GA5 A;  4AZD A;  2VUM A;  2CW0 D;  5FTJ A;  3CF2 A;  2LW6 A;  1YLE A;  2O5J D;  3GTQ A;  2PIC A;  4KLN A;  1TMO A;  1Y4Z A;  1Q16 A;  4FIB A;  2V3V A;  2R92 A;  5FTN A;  2YVL A;  4AS1 A;  5C18 A;  3QQ8 A;  4KOD A;  2KI8 A;  1E5V A;  1S3S A;  2V45 A;  3BQB A;  1IW7 D;  1KQF A;  1E32 A;  1CZ5 A;  3CQZ A;  1QCS A;  1ZYR D;  2Q1A X;  1PT0 A;  4RV0 A;  3DMR A;  1PQE A;  1WCM A;  2PWY A;  3ZJT A;  3GTJ A;  2E2H A;  1PYU B;  1DMR A;  1YNN D;  5FTM A;  1QDN A;  3GTL A;  1AA6 A;  5EPP A;  2PJJ A;  3TIW A;  2A6H D;  2XDP A;  3LGA A;  5DYI A;  4D7Z B;  2PI8 A;  3IR7 A;  5FTL A;  2DMR A;  2GF7 A;  2Q1D X;  2JIQ A;  1E60 A;  1PYQ A;  3HU2 A;  1CZ4 A;  5FTK A;  4CRY G;  2E7Z A;  4KDI A;  2JIM A;  5D6W A;  5DYG A;  2A68 D;  5T5M D;  3GTM A;  1SIW A;  4QIW A;  1R9T A;  5T5I D;  4C2M A;  2QQS A;  3ZGZ A;  1DMS A;  2R93 A;  3HU3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...