5GLFA

Structural insights into the interaction of p97 n-terminal domain and shp motif in derlin-1 rhomboid pseudoprotease
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
170
structure length
170
Chain Sequence
PNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLKGKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEGEPIKRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into the interaction of human p97 N-terminal domain and SHP motif in Derlin-1 rhomboid pseudoprotease.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/transport protein
molecule keywords Transitional endoplasmic reticulum ATPase
total genus 48
structure length 170
sequence length 170
chains with identical sequence C, E, G
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 2016-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02359 CDC48_N Cell division protein 48 (CDC48), N-terminal domain
A PF02933 CDC48_2 Cell division protein 48 (CDC48), domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 5glfA01
3.10.330.10 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 5glfA02
1FDIA 3IR6A 3GTOA 1PQEA 1UHDA 1TWFA 4DMRA 1YLEA 2V3VA 1I3QA 4RV0A 4GA5A 5FTMA 2R93A 1R27A 5EPPA 1E18A 1CZ4A 1SIWA 5FTNA 4AZDA 2VPYA 1OGYA 5FTKA 4KLNA 1TWGA 1SFOA 3GTQA 3GTMA 1DMRA 4CRZA 1KQGA 5GLFA 2YU9A 1G8JA 3CF2A 2VPZA 2DMRA 3GTPA 1E61A 3CQZA 4KO8A 1AW8B 1ZC1A 1H0HA 3TIWA 5T5MD 2PJHB 3QWZA 1PYQA 2JV2A 1PPYA 1AA6A 1VC3B 1PYUB 1PT0A 1Y4ZA 4AONB 1KQFA 1H5NA 2PMZA 2E2HA 4AAYA 1R7RA 2JA7A 1Y5IA 2VPXA 3HKZA 4CRYG 1G8KA 1UHEA 3TM7B 1Y1WA 1S3SA 1TMOA 1E5VA 3HU1A 1K83A 2VUMA 1CZ5A 2YUJA 1TWCA 2JA5A 5DYIA 2WAQA 1TWHA 3HU2A 2JIOA 1QCSA 1E60A 2VPWA 1PT1A 1DMSA 1IW7D 3GTJA 1WCMA 1FDOA 1TWAA 4C2MA 3QQ8A 2B63A 3OUGA 3ML1A 2NAPA 1WLFA 4AOKB 1Q16A 2NYAA 2WB1A 1CR5A 2JIPA 3DMRA 3HU3A 3IR5A 3GTKA 4KODA 2JIMA 1E32A 2NVYA 2R7ZA 5C18A 5B6CA 2E2IA 3FKIA 1Y1VA 2EEOB 4GA6A 3QC8A 5DYGA 2JIRA 4CS0A 2IV2X 3QQ7A 2C45A 4QIWA 1QDNA 5T5ID 2R92A 5C1BA 3GTGA 3PLXB 2V45A 4KDIA 3IR7A 3GTLA 1I50A 2NVXA 1EU1A 3O5AA 4AYBA 1PQHA 2Y0SA 4KDLA 5FTJA 2E7ZA 5FTLA 1PQFA 2JIQA 4D7ZB 1R9TA 3H0GA 2JA6A 2KI8A
chains in the Genus database with same CATH superfamily
4FG2A 1FDIA 3IR6A 3GTOA 1PQEA 1UHDA 1TWFA 2G5DA 4DMRA 2AE0X 3LGAA 1YLEA 5EQJB 2V3VA 1SMYD 1I3QA 4RV0A 2O5JD 4GA5A 5FTMA 1ZYRD 2R93A 1R27A 5EPPA 1BW4A 1E18A 4JP6A 5CD1A 1CZ4A 1SIWA 5FTNA 3X2JA 4AZDA 2VPYA 1OGYA 5FTKA 3X2MA 2B25A 4KLNA 1TWGA 1SFOA 3GTQA 3FPRA 3GTMA 1DMRA 4CRZA 1KQGA 2PJJA 4ARIA 5GLFA 2PNWA 2YU9A 2GAEA 3ENGA 3BQBA 1G8JA 2A68D 3CF2A 1HD5A 2VPZA 3CZBA 2DMRA 5GM9A 3GTPA 1E61A 3CQZA 3X2PA 4KO8A 1AW8B 1ZC1A 4UC4A 1H0HA 3TIWA 3ZJUA 2PICA 4AQ7A 5T5MD 2PJHB 3QWZA 1PYQA 2JV2A 1PPYA 5ERGB 1AA6A 1I9GA 1VC3B 1PYUB 4JP7A 4JS7A 1PT0A 3SULA 3X2LA 1Y4ZA 4AONB 1KQFA 2Q18X 2QQRA 1H5NA 2PMZA 2E2HA 2GFAA 4AAYA 1R7RA 2JA7A 1Y5IA 2VPXA 3HKZA 5GLXA 3X2IA 4JJOA 3ZGZA 4CRYG 1G8KA 1UHEA 3TM7B 4CQNA 1Y1WA 1S3SA 1TMOA 3M3GA 4FG4A 1E5VA 3HU1A 1K83A 2VUMA 1CZ5A 2YUJA 1TWCA 2JA5A 4AS1A 5DYIA 2WAQA 3X2OA 1TWHA 3HU2A 2KY9A 2JIOA 5CCBA 1QCSA 1E60A 2VPWA 2MM0A 1L8FA 1PT1A 1DMSA 1IW7D 4L48A 2LW6A 3ZJVA 3GTJA 1WC2A 1WCMA 1FDOA 1TWAA 4ENGA 4C2MA 4FFTA 2HCZX 3QQ8A 2B63A 4ARCA 4NOHA 3SUKA 2BE5D 3OUGA 3ML1A 2A6ED 2NAPA 1YNJD 1WLFA 2Q1AX 4AOKB 1Q16A 4FERA 1N10A 2NYAA 2WB1A 3X2GA 2PI8A 3LHDA 1CR5A 2JIPA 3DMRA 3HU3A 3IR5A 3GTKA 3X2NA 4KODA 5D6YA 3X2KA 2JIMA 1YNND 1E32A 2CW0D 2NVYA 2R7ZA 2BH0A 3D30A 5GLYA 5C18A 5B6CA 2Q1DX 2E2IA 1Y1VA 3FKIA 2EEOB 4GA6A 3FPUA 4FIBA 3QC8A 3FPTA 5DYGA 2JIRA 4CS0A 2YVLA 3ZJTA 2IV2X 2A69D 3QQ7A 1OA7A 2C45A 3SUJA 4QIWA 2Q19X 2QQSA 1QDNA 5T5ID 1O54A 5D6XA 2R92A 5C1BA 3GTGA 3PLXB 2V45A 4KDIA 1BW3A 3IR7A 3SUMA 2KQAA 3X2HA 2G6GA 3GTLA 2PWYA 1I50A 4ZM7A 4JCWA 2GF7A 2NVXA 1EU1A 3O5AA 4AYBA 1PQHA 2A6HD 2Y0SA 1OA9A 4KDLA 5FTJA 5D6WA 2E7ZA 5FTLA 1PQFA 2JIQA 4D7ZB 2XDPA 3MB5A 4AVRA 2ENGA 1R9TA 3H0GA 2JA6A 5H4UA 2MM2A 5CCXA 2Q1CX 2KI8A
chains in the Genus database with same CATH topology
1FDIA 3IR6A 3GTOA 1PQEA 1UHDA 1TWFA 2G5DA 4DMRA 2AE0X 3LGAA 1YLEA 5EQJB 2V3VA 1SMYD 1I3QA 4RV0A 2O5JD 4GA5A 5FTMA 1ZYRD 2R93A 1R27A 5EPPA 1E18A 5CD1A 1CZ4A 1SIWA 5FTNA 4AZDA 2VPYA 1OGYA 5FTKA 2B25A 4KLNA 1TWGA 1SFOA 3GTQA 3FPRA 3GTMA 1DMRA 4CRZA 1KQGA 2PJJA 4ARIA 5GLFA 2PNWA 2YU9A 2GAEA 3BQBA 1G8JA 2A68D 3CF2A 2VPZA 3CZBA 2DMRA 3GTPA 1E61A 3CQZA 4UC4A 4KO8A 1AW8B 1ZC1A 1H0HA 3TIWA 3ZJUA 2PICA 4AQ7A 5T5MD 2PJHB 3QWZA 1PYQA 2JV2A 1PPYA 5ERGB 1AA6A 1I9GA 1VC3B 1PYUB 1PT0A 1Y4ZA 4AONB 1KQFA 2Q18X 2QQRA 1H5NA 2PMZA 2E2HA 2GFAA 4AAYA 1R7RA 2JA7A 1Y5IA 2VPXA 3HKZA 3ZGZA 4CRYG 1G8KA 1UHEA 3TM7B 4CQNA 1Y1WA 1S3SA 1TMOA 1E5VA 3HU1A 1K83A 2VUMA 1CZ5A 2YUJA 1TWCA 2JA5A 4AS1A 5DYIA 2WAQA 1TWHA 3HU2A 2KY9A 2JIOA 5CCBA 1QCSA 1E60A 2VPWA 2MM0A 1PT1A 1DMSA 1IW7D 2LW6A 3ZJVA 3GTJA 1WCMA 1FDOA 1TWAA 4C2MA 4ARCA 3QQ8A 2B63A 4NOHA 2BE5D 3OUGA 3ML1A 2A6ED 2NAPA 1YNJD 1WLFA 2Q1AX 4AOKB 1Q16A 2NYAA 2WB1A 2PI8A 3LHDA 1CR5A 2JIPA 3DMRA 3HU3A 3IR5A 3GTKA 5D6YA 4KODA 2JIMA 1YNND 1E32A 2CW0D 2NVYA 2R7ZA 2Q1DX 5C18A 3FPUA 5B6CA 2E2IA 1Y1VA 3FKIA 2EEOB 4GA6A 4FIBA 3QC8A 3FPTA 5DYGA 2JIRA 4CS0A 2YVLA 3ZJTA 2IV2X 2A69D 3QQ7A 2C45A 4QIWA 2Q19X 2QQSA 1QDNA 5T5ID 1O54A 5D6XA 2R92A 5C1BA 3GTGA 3PLXB 2V45A 4KDIA 3IR7A 2G6GA 3GTLA 2PWYA 1I50A 2GF7A 2NVXA 1EU1A 3O5AA 4AYBA 1PQHA 2A6HD 2Y0SA 4KDLA 5FTJA 5D6WA 2E7ZA 5FTLA 1PQFA 2JIQA 4D7ZB 2XDPA 3MB5A 1R9TA 3H0GA 2JA6A 2MM2A 5CCXA 2Q1CX 2KI8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FDI A;  3IR6 A;  3GTO A;  1PQE A;  1UHD A;  1TWF A;  4DMR A;  1YLE A;  2V3V A;  1I3Q A;  4RV0 A;  4GA5 A;  5FTM A;  2R93 A;  1R27 A;  5EPP A;  1E18 A;  1CZ4 A;  1SIW A;  5FTN A;  4AZD A;  2VPY A;  1OGY A;  5FTK A;  4KLN A;  1TWG A;  1SFO A;  3GTQ A;  3GTM A;  1DMR A;  4CRZ A;  1KQG A;  5GLF A;  2YU9 A;  1G8J A;  3CF2 A;  2VPZ A;  2DMR A;  3GTP A;  1E61 A;  3CQZ A;  4KO8 A;  1AW8 B;  1ZC1 A;  1H0H A;  3TIW A;  5T5M D;  2PJH B;  3QWZ A;  1PYQ A;  2JV2 A;  1PPY A;  1AA6 A;  1VC3 B;  1PYU B;  1PT0 A;  1Y4Z A;  4AON B;  1KQF A;  1H5N A;  2PMZ A;  2E2H A;  4AAY A;  1R7R A;  2JA7 A;  1Y5I A;  2VPX A;  3HKZ A;  4CRY G;  1G8K A;  1UHE A;  3TM7 B;  1Y1W A;  1S3S A;  1TMO A;  1E5V A;  3HU1 A;  1K83 A;  2VUM A;  1CZ5 A;  2YUJ A;  1TWC A;  2JA5 A;  5DYI A;  2WAQ A;  1TWH A;  3HU2 A;  2JIO A;  1QCS A;  1E60 A;  2VPW A;  1PT1 A;  1DMS A;  1IW7 D;  3GTJ A;  1WCM A;  1FDO A;  1TWA A;  4C2M A;  3QQ8 A;  2B63 A;  3OUG A;  3ML1 A;  2NAP A;  1WLF A;  4AOK B;  1Q16 A;  2NYA A;  2WB1 A;  1CR5 A;  2JIP A;  3DMR A;  3HU3 A;  3IR5 A;  3GTK A;  4KOD A;  2JIM A;  1E32 A;  2NVY A;  2R7Z A;  5C18 A;  5B6C A;  2E2I A;  3FKI A;  1Y1V A;  2EEO B;  4GA6 A;  3QC8 A;  5DYG A;  2JIR A;  4CS0 A;  2IV2 X;  3QQ7 A;  2C45 A;  4QIW A;  1QDN A;  5T5I D;  2R92 A;  5C1B A;  3GTG A;  3PLX B;  2V45 A;  4KDI A;  3IR7 A;  3GTL A;  1I50 A;  2NVX A;  1EU1 A;  3O5A A;  4AYB A;  1PQH A;  2Y0S A;  4KDL A;  5FTJ A;  2E7Z A;  5FTL A;  1PQF A;  2JIQ A;  4D7Z B;  1R9T A;  3H0G A;  2JA6 A;  2KI8 A; 
#chains in the Genus database with same CATH topology
 4FG2 A;  1FDI A;  3IR6 A;  3GTO A;  1PQE A;  1UHD A;  1TWF A;  2G5D A;  4DMR A;  2AE0 X;  3LGA A;  1YLE A;  5EQJ B;  2V3V A;  1SMY D;  1I3Q A;  4RV0 A;  2O5J D;  4GA5 A;  5FTM A;  1ZYR D;  2R93 A;  1R27 A;  5EPP A;  1BW4 A;  1E18 A;  4JP6 A;  5CD1 A;  1CZ4 A;  1SIW A;  5FTN A;  3X2J A;  4AZD A;  2VPY A;  1OGY A;  5FTK A;  3X2M A;  2B25 A;  4KLN A;  1TWG A;  1SFO A;  3GTQ A;  3FPR A;  3GTM A;  1DMR A;  4CRZ A;  1KQG A;  2PJJ A;  4ARI A;  5GLF A;  2PNW A;  2YU9 A;  2GAE A;  3ENG A;  3BQB A;  1G8J A;  2A68 D;  3CF2 A;  1HD5 A;  2VPZ A;  3CZB A;  2DMR A;  5GM9 A;  3GTP A;  1E61 A;  3CQZ A;  3X2P A;  4KO8 A;  1AW8 B;  1ZC1 A;  4UC4 A;  1H0H A;  3TIW A;  3ZJU A;  2PIC A;  4AQ7 A;  5T5M D;  2PJH B;  3QWZ A;  1PYQ A;  2JV2 A;  1PPY A;  5ERG B;  1AA6 A;  1I9G A;  1VC3 B;  1PYU B;  4JP7 A;  4JS7 A;  1PT0 A;  3SUL A;  3X2L A;  1Y4Z A;  4AON B;  1KQF A;  2Q18 X;  2QQR A;  1H5N A;  2PMZ A;  2E2H A;  2GFA A;  4AAY A;  1R7R A;  2JA7 A;  1Y5I A;  2VPX A;  3HKZ A;  5GLX A;  3X2I A;  4JJO A;  3ZGZ A;  4CRY G;  1G8K A;  1UHE A;  3TM7 B;  4CQN A;  1Y1W A;  1S3S A;  1TMO A;  3M3G A;  4FG4 A;  1E5V A;  3HU1 A;  1K83 A;  2VUM A;  1CZ5 A;  2YUJ A;  1TWC A;  2JA5 A;  4AS1 A;  5DYI A;  2WAQ A;  3X2O A;  1TWH A;  3HU2 A;  2KY9 A;  2JIO A;  5CCB A;  1QCS A;  1E60 A;  2VPW A;  2MM0 A;  1L8F A;  1PT1 A;  1DMS A;  1IW7 D;  4L48 A;  2LW6 A;  3ZJV A;  3GTJ A;  1WC2 A;  1WCM A;  1FDO A;  1TWA A;  4ENG A;  4C2M A;  4FFT A;  2HCZ X;  3QQ8 A;  2B63 A;  4ARC A;  4NOH A;  3SUK A;  2BE5 D;  3OUG A;  3ML1 A;  2A6E D;  2NAP A;  1YNJ D;  1WLF A;  2Q1A X;  4AOK B;  1Q16 A;  4FER A;  1N10 A;  2NYA A;  2WB1 A;  3X2G A;  2PI8 A;  3LHD A;  1CR5 A;  2JIP A;  3DMR A;  3HU3 A;  3IR5 A;  3GTK A;  3X2N A;  4KOD A;  5D6Y A;  3X2K A;  2JIM A;  1YNN D;  1E32 A;  2CW0 D;  2NVY A;  2R7Z A;  2BH0 A;  3D30 A;  5GLY A;  5C18 A;  5B6C A;  2Q1D X;  2E2I A;  1Y1V A;  3FKI A;  2EEO B;  4GA6 A;  3FPU A;  4FIB A;  3QC8 A;  3FPT A;  5DYG A;  2JIR A;  4CS0 A;  2YVL A;  3ZJT A;  2IV2 X;  2A69 D;  3QQ7 A;  1OA7 A;  2C45 A;  3SUJ A;  4QIW A;  2Q19 X;  2QQS A;  1QDN A;  5T5I D;  1O54 A;  5D6X A;  2R92 A;  5C1B A;  3GTG A;  3PLX B;  2V45 A;  4KDI A;  1BW3 A;  3IR7 A;  3SUM A;  2KQA A;  3X2H A;  2G6G A;  3GTL A;  2PWY A;  1I50 A;  4ZM7 A;  4JCW A;  2GF7 A;  2NVX A;  1EU1 A;  3O5A A;  4AYB A;  1PQH A;  2A6H D;  2Y0S A;  1OA9 A;  4KDL A;  5FTJ A;  5D6W A;  2E7Z A;  5FTL A;  1PQF A;  2JIQ A;  4D7Z B;  2XDP A;  3MB5 A;  4AVR A;  2ENG A;  1R9T A;  3H0G A;  2JA6 A;  5H4U A;  2MM2 A;  5CCX A;  2Q1C X;  2KI8 A; 
#chains in the Genus database with same CATH homology
 1FDI A;  3IR6 A;  3GTO A;  1PQE A;  1UHD A;  1TWF A;  2G5D A;  4DMR A;  2AE0 X;  3LGA A;  1YLE A;  5EQJ B;  2V3V A;  1SMY D;  1I3Q A;  4RV0 A;  2O5J D;  4GA5 A;  5FTM A;  1ZYR D;  2R93 A;  1R27 A;  5EPP A;  1E18 A;  5CD1 A;  1CZ4 A;  1SIW A;  5FTN A;  4AZD A;  2VPY A;  1OGY A;  5FTK A;  2B25 A;  4KLN A;  1TWG A;  1SFO A;  3GTQ A;  3FPR A;  3GTM A;  1DMR A;  4CRZ A;  1KQG A;  2PJJ A;  4ARI A;  5GLF A;  2PNW A;  2YU9 A;  2GAE A;  3BQB A;  1G8J A;  2A68 D;  3CF2 A;  2VPZ A;  3CZB A;  2DMR A;  3GTP A;  1E61 A;  3CQZ A;  4UC4 A;  4KO8 A;  1AW8 B;  1ZC1 A;  1H0H A;  3TIW A;  3ZJU A;  2PIC A;  4AQ7 A;  5T5M D;  2PJH B;  3QWZ A;  1PYQ A;  2JV2 A;  1PPY A;  5ERG B;  1AA6 A;  1I9G A;  1VC3 B;  1PYU B;  1PT0 A;  1Y4Z A;  4AON B;  1KQF A;  2Q18 X;  2QQR A;  1H5N A;  2PMZ A;  2E2H A;  2GFA A;  4AAY A;  1R7R A;  2JA7 A;  1Y5I A;  2VPX A;  3HKZ A;  3ZGZ A;  4CRY G;  1G8K A;  1UHE A;  3TM7 B;  4CQN A;  1Y1W A;  1S3S A;  1TMO A;  1E5V A;  3HU1 A;  1K83 A;  2VUM A;  1CZ5 A;  2YUJ A;  1TWC A;  2JA5 A;  4AS1 A;  5DYI A;  2WAQ A;  1TWH A;  3HU2 A;  2KY9 A;  2JIO A;  5CCB A;  1QCS A;  1E60 A;  2VPW A;  2MM0 A;  1PT1 A;  1DMS A;  1IW7 D;  2LW6 A;  3ZJV A;  3GTJ A;  1WCM A;  1FDO A;  1TWA A;  4C2M A;  4ARC A;  3QQ8 A;  2B63 A;  4NOH A;  2BE5 D;  3OUG A;  3ML1 A;  2A6E D;  2NAP A;  1YNJ D;  1WLF A;  2Q1A X;  4AOK B;  1Q16 A;  2NYA A;  2WB1 A;  2PI8 A;  3LHD A;  1CR5 A;  2JIP A;  3DMR A;  3HU3 A;  3IR5 A;  3GTK A;  5D6Y A;  4KOD A;  2JIM A;  1YNN D;  1E32 A;  2CW0 D;  2NVY A;  2R7Z A;  2Q1D X;  5C18 A;  3FPU A;  5B6C A;  2E2I A;  1Y1V A;  3FKI A;  2EEO B;  4GA6 A;  4FIB A;  3QC8 A;  3FPT A;  5DYG A;  2JIR A;  4CS0 A;  2YVL A;  3ZJT A;  2IV2 X;  2A69 D;  3QQ7 A;  2C45 A;  4QIW A;  2Q19 X;  2QQS A;  1QDN A;  5T5I D;  1O54 A;  5D6X A;  2R92 A;  5C1B A;  3GTG A;  3PLX B;  2V45 A;  4KDI A;  3IR7 A;  2G6G A;  3GTL A;  2PWY A;  1I50 A;  2GF7 A;  2NVX A;  1EU1 A;  3O5A A;  4AYB A;  1PQH A;  2A6H D;  2Y0S A;  4KDL A;  5FTJ A;  5D6W A;  2E7Z A;  5FTL A;  1PQF A;  2JIQ A;  4D7Z B;  2XDP A;  3MB5 A;  1R9T A;  3H0G A;  2JA6 A;  2MM2 A;  5CCX A;  2Q1C X;  2KI8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...