5GLFA

Structural insights into the interaction of p97 n-terminal domain and shp motif in derlin-1 rhomboid pseudoprotease
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
170
structure length
170
Chain Sequence
PNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLKGKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEGEPIKRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transitional endoplasmic reticulum ATPase
publication title Structural insights into the interaction of human p97 N-terminal domain and SHP motif in Derlin-1 rhomboid pseudoprotease.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/transport protein
total genus 48
structure length 170
sequence length 170
chains with identical sequence C, E, G
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 2016-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02359 CDC48_N Cell division protein 48 (CDC48), N-terminal domain
A PF02933 CDC48_2 Cell division protein 48 (CDC48), domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 5glfA01
3.10.330.10 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 5glfA02
1E18A 5GLFA 3HKZA 1UHEA 1QDNA 1Y5IA 3IR7A 1Q16A 5DYGA 4AYBA 2JIOA 1CZ5A 1TWCA 2NYAA 1WCMA 1QCSA 1Y1VA 4GA5A 5DYIA 2JA5A 3IR5A 1TMOA 2YU9A 2JA7A 1OGYA 2EEOB 1S3SA 2R7ZA 2VPYA 3FKIA 1R9TA 5T5ID 1KQFA 3H0GA 3TIWA 4D7ZB 2VUMA 3GTMA 3IR6A 2JV2A 4AZDA 1IW7D 1G8JA 2PJHB 1Y4ZA 1DMSA 1TWHA 2E2IA 1H0HA 3HU2A 2E7ZA 3GTOA 2V3VA 5FTKA 3QQ8A 3HU1A 3GTPA 2JIQA 2NVYA 1YLEA 2JIMA 2WB1A 3QC8A 1PQFA 2JA6A 4AONB 1E60A 4KDIA 1PYUB 5FTNA 4AOKB 5FTLA 2E2HA 2R92A 3OUGA 2DMRA 3GTQA 1E5VA 3TM7B 1SIWA 5FTJA 4DMRA 1E61A 4KLNA 5EPPA 5C18A 1I50A 3PLXB 4AAYA 2C45A 4KODA 1PQHA 1TWFA 2V45A 2NAPA 1WLFA 2VPXA 4CS0A 1I3QA 3DMRA 3GTLA 1EU1A 2YUJA 1PT0A 1G8KA 1DMRA 4CRZA 3CQZA 5FTMA 3GTKA 1PYQA 1ZC1A 4RV0A 2NVXA 2VPZA 2PMZA 2IV2X 2B63A 4KO8A 2JIPA 1PT1A 1R27A 1Y1WA 1PPYA 4GA6A 1CR5A 2WAQA 3QWZA 4CRYG 1KQGA 2KI8A 4QIWA 1UHDA 5B6CA 1TWAA 1SFOA 1PQEA 3GTJA 3QQ7A 4C2MA 1K83A 1TWGA 3O5AA 2R93A 3HU3A 5T5MD 3ML1A 1H5NA 2VPWA 2JIRA 1FDOA 4KDLA 1R7RA 3CF2A 2Y0SA 3GTGA 1AA6A 1AW8B 5C1BA 1VC3B 1CZ4A 1FDIA 1E32A
chains in the Genus database with same CATH superfamily
1E18A 5GLYA 2Q19X 5GLFA 4AVRA 3HKZA 3X2KA 1L8FA 1UHEA 3X2IA 1BW4A 1QDNA 1Y5IA 3X2PA 3IR7A 1Q16A 5DYGA 4AYBA 2JIOA 1BW3A 2GFAA 1CZ5A 1TWCA 5CD1A 2PWYA 3X2NA 2NYAA 2PICA 3D30A 1WCMA 1I9GA 2A69D 3M3GA 1QCSA 1Y1VA 2GAEA 4JJOA 4GA5A 5DYIA 2JA5A 3IR5A 1TMOA 4ZM7A 2YU9A 2JA7A 3ZGZA 1OGYA 3CZBA 2EEOB 1S3SA 2R7ZA 2VPYA 3FKIA 1R9TA 4JCWA 3MB5A 1OA7A 5T5ID 1KQFA 3H0GA 3TIWA 4D7ZB 2O5JD 2VUMA 2QQSA 5CCBA 3GTMA 3IR6A 2JV2A 4AZDA 1IW7D 1O54A 2PNWA 1G8JA 2PJHB 1Y4ZA 1DMSA 1TWHA 3ENGA 2E2IA 5CCXA 1H0HA 5H4UA 3HU2A 2Q1CX 2G6GA 5GLXA 3X2HA 1YNJD 2E7ZA 3GTOA 2PI8A 2V3VA 5FTKA 3QQ8A 3LGAA 3HU1A 3SUJA 2JIQA 3GTPA 2MM2A 2NVYA 1YLEA 4L48A 3X2OA 2JIMA 2WB1A 2CW0D 3QC8A 3LHDA 2XDPA 2MM0A 1PQFA 4FG4A 2JA6A 4AONB 1E60A 2ENGA 4NOHA 3SUKA 2A6HD 2Q1AX 4KDIA 5EQJB 1PYUB 5FTNA 4AOKB 5FTLA 3ZJVA 4AS1A 2E2HA 2AE0X 5GM9A 3BQBA 2R92A 3OUGA 3FPUA 2DMRA 3ZJTA 5ERGB 4JP7A 4AQ7A 3GTQA 1E5VA 4FFTA 3TM7B 1SIWA 5FTJA 4DMRA 1E61A 4KLNA 2A68D 4FIBA 5EPPA 2B25A 5C18A 1I50A 3PLXB 4AAYA 2C45A 2Q1DX 2HCZX 1OA9A 1PQHA 1TWFA 2KQAA 2NAPA 1WLFA 2V45A 2VPXA 4KODA 2BH0A 4CS0A 1I3QA 2KY9A 3DMRA 2LW6A 3GTLA 1EU1A 2YUJA 4UC4A 1PT0A 1G8KA 1DMRA 4CRZA 3CQZA 5D6WA 5FTMA 2BE5D 3X2MA 3GTKA 1PYQA 1ZC1A 4RV0A 3FPRA 2NVXA 2QQRA 3X2GA 4ARCA 2VPZA 4FG2A 2PMZA 1WC2A 4FERA 1SMYD 2IV2X 2YVLA 2B63A 4ARIA 1ZYRD 2JIPA 1PT1A 4KO8A 1R27A 1Y1WA 3X2LA 1PPYA 4GA6A 3ZJUA 1HD5A 1CR5A 2WAQA 3QWZA 4CRYG 1KQGA 4JS7A 3X2JA 2KI8A 4QIWA 1UHDA 2Q18X 5B6CA 1TWAA 1SFOA 2A6ED 3FPTA 1PQEA 4JP6A 3GTJA 3QQ7A 4C2MA 1YNND 1K83A 1TWGA 3O5AA 4ENGA 3HU3A 2R93A 5T5MD 2GF7A 5D6XA 3ML1A 1H5NA 2G5DA 3SULA 2VPWA 1N10A 1FDOA 2JIRA 4KDLA 1R7RA 3CF2A 5D6YA 3SUMA 2Y0SA 3GTGA 1AA6A 1AW8B 5C1BA 4CQNA 1VC3B 1CZ4A 1FDIA 1E32A 2PJJA
chains in the Genus database with same CATH topology
1E18A 2Q19X 5GLFA 3HKZA 1UHEA 1QDNA 1Y5IA 3IR7A 1Q16A 5DYGA 4AYBA 2JIOA 2GFAA 1CZ5A 1TWCA 5CD1A 2PWYA 2NYAA 2PICA 1WCMA 1I9GA 2A69D 1QCSA 1Y1VA 2GAEA 4GA5A 5DYIA 2JA5A 3IR5A 1TMOA 2YU9A 2JA7A 3ZGZA 1OGYA 3CZBA 2EEOB 1S3SA 2R7ZA 2VPYA 3FKIA 1R9TA 3MB5A 5T5ID 1KQFA 3H0GA 3TIWA 4D7ZB 2O5JD 2VUMA 2QQSA 5CCBA 3GTMA 3IR6A 2JV2A 4AZDA 1IW7D 1O54A 2PNWA 1G8JA 2PJHB 1Y4ZA 1DMSA 1TWHA 2E2IA 5CCXA 1H0HA 3HU2A 2Q1CX 2G6GA 1YNJD 2E7ZA 3GTOA 2PI8A 2V3VA 5FTKA 3QQ8A 3HU1A 3GTPA 2JIQA 2MM2A 2NVYA 1YLEA 2JIMA 2WB1A 2CW0D 3QC8A 3LHDA 2XDPA 2MM0A 1PQFA 2JA6A 4AONB 1E60A 4NOHA 2Q1AX 2A6HD 4KDIA 5EQJB 1PYUB 5FTNA 4AOKB 5FTLA 3ZJVA 4AS1A 2E2HA 2AE0X 3FPUA 3BQBA 2R92A 3OUGA 3ZJTA 2DMRA 5ERGB 4AQ7A 3GTQA 1E5VA 3TM7B 1SIWA 5FTJA 4DMRA 1E61A 4KLNA 2A68D 4FIBA 5EPPA 2B25A 5C18A 1I50A 3PLXB 4AAYA 2C45A 2Q1DX 4KODA 1PQHA 1TWFA 2V45A 3LGAA 2NAPA 1WLFA 2VPXA 4CS0A 1I3QA 2LW6A 2KY9A 3DMRA 3GTLA 1EU1A 2YUJA 4UC4A 1PT0A 1G8KA 1DMRA 4CRZA 3CQZA 5D6WA 5FTMA 2BE5D 3GTKA 3FPRA 1PYQA 1ZC1A 4RV0A 2NVXA 2QQRA 4ARCA 2VPZA 2PMZA 1SMYD 2IV2X 2YVLA 2B63A 4ARIA 1ZYRD 2JIPA 1PT1A 4KO8A 1R27A 1Y1WA 1PPYA 4GA6A 3ZJUA 1CR5A 2WAQA 3QWZA 4CRYG 1KQGA 2Q18X 2KI8A 4QIWA 1UHDA 5B6CA 1TWAA 1SFOA 2A6ED 3FPTA 1PQEA 3GTJA 3QQ7A 4C2MA 1YNND 1K83A 1TWGA 3O5AA 2R93A 3HU3A 2GF7A 5T5MD 5D6XA 3ML1A 1H5NA 2G5DA 2VPWA 2JIRA 1FDOA 4KDLA 1R7RA 3CF2A 5D6YA 2Y0SA 3GTGA 1AA6A 1AW8B 5C1BA 4CQNA 1VC3B 1CZ4A 1FDIA 1E32A 2PJJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E18 A;  5GLF A;  3HKZ A;  1UHE A;  1QDN A;  1Y5I A;  3IR7 A;  1Q16 A;  5DYG A;  4AYB A;  2JIO A;  1CZ5 A;  1TWC A;  2NYA A;  1WCM A;  1QCS A;  1Y1V A;  4GA5 A;  5DYI A;  2JA5 A;  3IR5 A;  1TMO A;  2YU9 A;  2JA7 A;  1OGY A;  2EEO B;  1S3S A;  2R7Z A;  2VPY A;  3FKI A;  1R9T A;  5T5I D;  1KQF A;  3H0G A;  3TIW A;  4D7Z B;  2VUM A;  3GTM A;  3IR6 A;  2JV2 A;  4AZD A;  1IW7 D;  1G8J A;  2PJH B;  1Y4Z A;  1DMS A;  1TWH A;  2E2I A;  1H0H A;  3HU2 A;  2E7Z A;  3GTO A;  2V3V A;  5FTK A;  3QQ8 A;  3HU1 A;  3GTP A;  2JIQ A;  2NVY A;  1YLE A;  2JIM A;  2WB1 A;  3QC8 A;  1PQF A;  2JA6 A;  4AON B;  1E60 A;  4KDI A;  1PYU B;  5FTN A;  4AOK B;  5FTL A;  2E2H A;  2R92 A;  3OUG A;  2DMR A;  3GTQ A;  1E5V A;  3TM7 B;  1SIW A;  5FTJ A;  4DMR A;  1E61 A;  4KLN A;  5EPP A;  5C18 A;  1I50 A;  3PLX B;  4AAY A;  2C45 A;  4KOD A;  1PQH A;  1TWF A;  2V45 A;  2NAP A;  1WLF A;  2VPX A;  4CS0 A;  1I3Q A;  3DMR A;  3GTL A;  1EU1 A;  2YUJ A;  1PT0 A;  1G8K A;  1DMR A;  4CRZ A;  3CQZ A;  5FTM A;  3GTK A;  1PYQ A;  1ZC1 A;  4RV0 A;  2NVX A;  2VPZ A;  2PMZ A;  2IV2 X;  2B63 A;  4KO8 A;  2JIP A;  1PT1 A;  1R27 A;  1Y1W A;  1PPY A;  4GA6 A;  1CR5 A;  2WAQ A;  3QWZ A;  4CRY G;  1KQG A;  2KI8 A;  4QIW A;  1UHD A;  5B6C A;  1TWA A;  1SFO A;  1PQE A;  3GTJ A;  3QQ7 A;  4C2M A;  1K83 A;  1TWG A;  3O5A A;  2R93 A;  3HU3 A;  5T5M D;  3ML1 A;  1H5N A;  2VPW A;  2JIR A;  1FDO A;  4KDL A;  1R7R A;  3CF2 A;  2Y0S A;  3GTG A;  1AA6 A;  1AW8 B;  5C1B A;  1VC3 B;  1CZ4 A;  1FDI A;  1E32 A; 
#chains in the Genus database with same CATH topology
 1E18 A;  5GLY A;  2Q19 X;  5GLF A;  4AVR A;  3HKZ A;  3X2K A;  1L8F A;  1UHE A;  3X2I A;  1BW4 A;  1QDN A;  1Y5I A;  3X2P A;  3IR7 A;  1Q16 A;  5DYG A;  4AYB A;  2JIO A;  1BW3 A;  2GFA A;  1CZ5 A;  1TWC A;  5CD1 A;  2PWY A;  3X2N A;  2NYA A;  2PIC A;  3D30 A;  1WCM A;  1I9G A;  2A69 D;  3M3G A;  1QCS A;  1Y1V A;  2GAE A;  4JJO A;  4GA5 A;  5DYI A;  2JA5 A;  3IR5 A;  1TMO A;  4ZM7 A;  2YU9 A;  2JA7 A;  3ZGZ A;  1OGY A;  3CZB A;  2EEO B;  1S3S A;  2R7Z A;  2VPY A;  3FKI A;  1R9T A;  4JCW A;  3MB5 A;  1OA7 A;  5T5I D;  1KQF A;  3H0G A;  3TIW A;  4D7Z B;  2O5J D;  2VUM A;  2QQS A;  5CCB A;  3GTM A;  3IR6 A;  2JV2 A;  4AZD A;  1IW7 D;  1O54 A;  2PNW A;  1G8J A;  2PJH B;  1Y4Z A;  1DMS A;  1TWH A;  3ENG A;  2E2I A;  5CCX A;  1H0H A;  5H4U A;  3HU2 A;  2Q1C X;  2G6G A;  5GLX A;  3X2H A;  1YNJ D;  2E7Z A;  3GTO A;  2PI8 A;  2V3V A;  5FTK A;  3QQ8 A;  3LGA A;  3HU1 A;  3SUJ A;  2JIQ A;  3GTP A;  2MM2 A;  2NVY A;  1YLE A;  4L48 A;  3X2O A;  2JIM A;  2WB1 A;  2CW0 D;  3QC8 A;  3LHD A;  2XDP A;  2MM0 A;  1PQF A;  4FG4 A;  2JA6 A;  4AON B;  1E60 A;  2ENG A;  4NOH A;  3SUK A;  2A6H D;  2Q1A X;  4KDI A;  5EQJ B;  1PYU B;  5FTN A;  4AOK B;  5FTL A;  3ZJV A;  4AS1 A;  2E2H A;  2AE0 X;  5GM9 A;  3BQB A;  2R92 A;  3OUG A;  3FPU A;  2DMR A;  3ZJT A;  5ERG B;  4JP7 A;  4AQ7 A;  3GTQ A;  1E5V A;  4FFT A;  3TM7 B;  1SIW A;  5FTJ A;  4DMR A;  1E61 A;  4KLN A;  2A68 D;  4FIB A;  5EPP A;  2B25 A;  5C18 A;  1I50 A;  3PLX B;  4AAY A;  2C45 A;  2Q1D X;  2HCZ X;  1OA9 A;  1PQH A;  1TWF A;  2KQA A;  2NAP A;  1WLF A;  2V45 A;  2VPX A;  4KOD A;  2BH0 A;  4CS0 A;  1I3Q A;  2KY9 A;  3DMR A;  2LW6 A;  3GTL A;  1EU1 A;  2YUJ A;  4UC4 A;  1PT0 A;  1G8K A;  1DMR A;  4CRZ A;  3CQZ A;  5D6W A;  5FTM A;  2BE5 D;  3X2M A;  3GTK A;  1PYQ A;  1ZC1 A;  4RV0 A;  3FPR A;  2NVX A;  2QQR A;  3X2G A;  4ARC A;  2VPZ A;  4FG2 A;  2PMZ A;  1WC2 A;  4FER A;  1SMY D;  2IV2 X;  2YVL A;  2B63 A;  4ARI A;  1ZYR D;  2JIP A;  1PT1 A;  4KO8 A;  1R27 A;  1Y1W A;  3X2L A;  1PPY A;  4GA6 A;  3ZJU A;  1HD5 A;  1CR5 A;  2WAQ A;  3QWZ A;  4CRY G;  1KQG A;  4JS7 A;  3X2J A;  2KI8 A;  4QIW A;  1UHD A;  2Q18 X;  5B6C A;  1TWA A;  1SFO A;  2A6E D;  3FPT A;  1PQE A;  4JP6 A;  3GTJ A;  3QQ7 A;  4C2M A;  1YNN D;  1K83 A;  1TWG A;  3O5A A;  4ENG A;  3HU3 A;  2R93 A;  5T5M D;  2GF7 A;  5D6X A;  3ML1 A;  1H5N A;  2G5D A;  3SUL A;  2VPW A;  1N10 A;  1FDO A;  2JIR A;  4KDL A;  1R7R A;  3CF2 A;  5D6Y A;  3SUM A;  2Y0S A;  3GTG A;  1AA6 A;  1AW8 B;  5C1B A;  4CQN A;  1VC3 B;  1CZ4 A;  1FDI A;  1E32 A;  2PJJ A; 
#chains in the Genus database with same CATH homology
 1E18 A;  2Q19 X;  5GLF A;  3HKZ A;  1UHE A;  1QDN A;  1Y5I A;  3IR7 A;  1Q16 A;  5DYG A;  4AYB A;  2JIO A;  2GFA A;  1CZ5 A;  1TWC A;  5CD1 A;  2PWY A;  2NYA A;  2PIC A;  1WCM A;  1I9G A;  2A69 D;  1QCS A;  1Y1V A;  2GAE A;  4GA5 A;  5DYI A;  2JA5 A;  3IR5 A;  1TMO A;  2YU9 A;  2JA7 A;  3ZGZ A;  1OGY A;  3CZB A;  2EEO B;  1S3S A;  2R7Z A;  2VPY A;  3FKI A;  1R9T A;  3MB5 A;  5T5I D;  1KQF A;  3H0G A;  3TIW A;  4D7Z B;  2O5J D;  2VUM A;  2QQS A;  5CCB A;  3GTM A;  3IR6 A;  2JV2 A;  4AZD A;  1IW7 D;  1O54 A;  2PNW A;  1G8J A;  2PJH B;  1Y4Z A;  1DMS A;  1TWH A;  2E2I A;  5CCX A;  1H0H A;  3HU2 A;  2Q1C X;  2G6G A;  1YNJ D;  2E7Z A;  3GTO A;  2PI8 A;  2V3V A;  5FTK A;  3QQ8 A;  3HU1 A;  3GTP A;  2JIQ A;  2MM2 A;  2NVY A;  1YLE A;  2JIM A;  2WB1 A;  2CW0 D;  3QC8 A;  3LHD A;  2XDP A;  2MM0 A;  1PQF A;  2JA6 A;  4AON B;  1E60 A;  4NOH A;  2Q1A X;  2A6H D;  4KDI A;  5EQJ B;  1PYU B;  5FTN A;  4AOK B;  5FTL A;  3ZJV A;  4AS1 A;  2E2H A;  2AE0 X;  3FPU A;  3BQB A;  2R92 A;  3OUG A;  3ZJT A;  2DMR A;  5ERG B;  4AQ7 A;  3GTQ A;  1E5V A;  3TM7 B;  1SIW A;  5FTJ A;  4DMR A;  1E61 A;  4KLN A;  2A68 D;  4FIB A;  5EPP A;  2B25 A;  5C18 A;  1I50 A;  3PLX B;  4AAY A;  2C45 A;  2Q1D X;  4KOD A;  1PQH A;  1TWF A;  2V45 A;  3LGA A;  2NAP A;  1WLF A;  2VPX A;  4CS0 A;  1I3Q A;  2LW6 A;  2KY9 A;  3DMR A;  3GTL A;  1EU1 A;  2YUJ A;  4UC4 A;  1PT0 A;  1G8K A;  1DMR A;  4CRZ A;  3CQZ A;  5D6W A;  5FTM A;  2BE5 D;  3GTK A;  3FPR A;  1PYQ A;  1ZC1 A;  4RV0 A;  2NVX A;  2QQR A;  4ARC A;  2VPZ A;  2PMZ A;  1SMY D;  2IV2 X;  2YVL A;  2B63 A;  4ARI A;  1ZYR D;  2JIP A;  1PT1 A;  4KO8 A;  1R27 A;  1Y1W A;  1PPY A;  4GA6 A;  3ZJU A;  1CR5 A;  2WAQ A;  3QWZ A;  4CRY G;  1KQG A;  2Q18 X;  2KI8 A;  4QIW A;  1UHD A;  5B6C A;  1TWA A;  1SFO A;  2A6E D;  3FPT A;  1PQE A;  3GTJ A;  3QQ7 A;  4C2M A;  1YNN D;  1K83 A;  1TWG A;  3O5A A;  2R93 A;  3HU3 A;  2GF7 A;  5T5M D;  5D6X A;  3ML1 A;  1H5N A;  2G5D A;  2VPW A;  2JIR A;  1FDO A;  4KDL A;  1R7R A;  3CF2 A;  5D6Y A;  2Y0S A;  3GTG A;  1AA6 A;  1AW8 B;  5C1B A;  4CQN A;  1VC3 B;  1CZ4 A;  1FDI A;  1E32 A;  2PJJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...