5GM1A

Crystal structure of methyltransferase tled complexed with sah
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
281
structure length
281
Chain Sequence
QQQVTADEVGDWYDKFGEVYHLTLGESVHCGLWFPPDAPVPQDMELVTMSSQAQDRYTDYLIETLDPKAGQHLLDIGCGTGRTALKAARQRGIAVTGVAVSKEQIAAANRLAAGHGLTERLTFEVADAMRLPYEDESFDCAWAIESLCHMDRAKALGEAWRVLKPGGDLLVLESVVTEELTEPETALFETLYAANVPPRLGEFFDIVSGAGFHTLSLKDLSANLAMTMNVFALGVYSRRAEFTERFGAEFVDGLLAGLGSAQETLIRKTRFFMATLRKPAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords O-methylransferase
publication title Crystal structure and enantioselectivity of terpene cyclization in SAM-dependent methyltransferase TleD
pubmed doi rcsb
source organism Streptomyces blastmyceticus
molecule tags Transferase
total genus 95
structure length 281
sequence length 281
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R
ec nomenclature
pdb deposition date 2016-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08241 Methyltransf_11 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5gm1A01
1KP9A 4PYIA 3UBTA 4BP1A 3SSMA 3DTNA 4A6DA 3CCFA 2V7EA 1YZ3A 2Z6AA 4XUEA 2AOUA 3ER8A 2Z6UA 4RVDA 1Y8CA 2YXLA 1VP9A 3KQTA 3CJRA 3LKZA 3NJRA 2VS1A 1U2ZA 2PGXA 3OPNA 2AZTA 4V0RA 5EKUA 2YQZA 5C9ZA 4DCMA 1BC5A 4DKJA 2BM9A 3V97A 1JG1A 2ONYA 5CM2Z 3R24A 1L3CA 1ZQ9A 2PXCA 3UJBA 1QAOA 3DR5A 3UFBA 2O0LA 1SKMA 1WG8A 3KQWA 5G02A 2YXDA 3L8DA 3NW9A 3O31A 3OZRA 4POOA 3G8BA 3KQVA 4QDJA 2Y1XA 3A7EA 1N2XA 1XCJA 3KPWA 1P1CA 2UZ4A 3KPUA 2BR3A 2UYOA 5F2NA 3MQ2A 2JJQA 3LDFA 3NVKI 5HIMA 1I1NA 4X60A 5EIWA 4C04A 2YTZA 1RJGA 4E2XA 2NP6A 3BGIA 3Q7EA 3GRUA 5FULA 5FQNA 5M5BA 2B25A 4WVLA 2EJTA 2QRVB 3R3HA 1RI1A 3R6TA 2XYRA 1NKVA 3KQMA 4AZTA 4NECA 4AZVA 2P35A 2UYQA 1VQ1A 4PGHA 1G6Q1 1IM8A 3ELDA 4EMSA 2E5WA 3ELYA 4RTQA 2P41A 4BY9E 2PJDA 5GINE 1JG2A 4RX1A 4C06A 3MERA 4ER3A 4F85A 4AUKA 5BXYA 1ZHFA 2A14A 3M6WA 3FUUA 1QAMA 1QYRA 4M36A 2AN5A 4GC5A 4GOND 4M7RA 2EX4A 2F8LA 3BGDA 3FUXA 5DX0A 2V74B 4YUVA 3V8VA 2H1RA 2PSSA 1Q0TA 2IH2A 1TW3A 3B7PA 1PRYA 2KW5A 1PJZA 3EGIA 3IEIA 4MWZA 1JTFA 2H00A 2IGTA 3O4FA 4BP3A 3OCJA 2NXJA 2CL5A 2EJUA 4LWOA 3LDUA 3CJQA 3DUWA 2JHAA 2ONZA 3GJYA 4OA8A 4XCXA 3SVZA 4P7KA 4V0QA 2GB4A 3Q87B 3C6KA 1NW5A 3EVGA 5B1SA 3TM4A 3C3PA 3P71T 3OU6A 4MIKA 3HCDA 4FT2A 3UJ9A 4ATNA 4E32A 5F2KA 2HTEA 4M37A 2OKCA 4FR0A 1X1AA 3A7DA 2B3TA 3AXSA 5IH3A 4PCAA 1RI3A 1N7JA 5FQOA 3G2OA 3LCCA 5DRYA 1X1BA 5LQJA 2R6ZA 5EG5A 4GQBA 1YFLA 1ORHA 5DXAA 4K6MA 4EVIA 2BR5A 2AS0A 2I62A 1N7IA 1M6YA 3EMDA 5GM2A 2IDKA 5C1IA 4FZVA 3ERCA 3G89A 5E9WA 3BGVA 1VLMA 4YMGA 2VDUE 3F4KA 3LHDA 4FP9A 1SG9A 5BW4A 3S68A 4RVGA 3PLAE 1YFJA 3WSTA 3C3YA 4R6XA 1D2CA 4RTLA 3LBYA 2PY6A 4HTFB 1G38A 3M6UA 3HA7A 5DXJA 3I5UA 2PX4A 3SMQA 1EJ0A 2ZBRA 3UJAA 2IH4A 2ZFUA 4E2WA 3TKAA 3EGVA 3K0BA 3KKZA 3KQYA 5FA8A 5HIKA 3PB3A 3HEMA 1I9GA 2O05A 4DCGA 3OFJA 5CD1A 1X1DA 2IIPA 3E05A 5FUBA 4CKEA 3AWIA 4QVGA 3FZGA 5EC8A 2GS9A 3O7WA 5DRTA 5EZQA 2PT6A 4FSDA 3HVIA 5DM4A 4QVKA 5DM1A 1QAQA 4EKGA 5E1BA 4IKPA 3UJ6A 3BWYA 4GUAA 2PX5A 3GGDA 3TRKA 2HR1A 4BLUA 4RVFA 3SSNA 4P58A 3GNLA 1P1BA 3B5IA 3HCAA 3NDJA 2O57A 3PX2A 1FP2A 3HCFA 4YV0A 1M6EX 3HVJA 1KXZA 1YF3A 3HCEA 1Z3CA 3FUTA 3KQSA 5D1NA 4IV8A 2AVNA 5EGSA 5KYGA 4GOLD 5CVVA 1SQGA 1JQ3A 2Y1WA 2YX1A 4MTLA 3KHKA 1DCTA 5FCDA 5FWAA 1F3LA 1VE3A 2ESRA 5K0NA 5C0OE 3B3GA 3RIEA 1UIRA 4QTTB 3TR6A 3DXXA 2ADMA 3DMFA 1VL5A 2WA1A 4E2YA 1F38A 2P3LA 3OU2A 1P91A 2JH8A 1RI4A 2PV0A 3CBGA 3E7PA 5E1MA 4DQ0A 3E23A 3GIWA 3DLIA 3HP7A 3M6XA 2OXTA 4A6EA 3P2IA 4OBXA 2PKWA 5CCBA 3A27A 3IV6A 4EQZA 2BM8A 4MQ4A 4ER6A 3MTEA 3P9CA 2OZVA 5CVDA 1KPGA 3CJTA 3FPFA 5MHTA 2PVCA 4WXHA 3HCBA 5GIOE 1SVUA 2AOUB 4XUCA 4CWAA 3EVFA 4C08A 1YUBA 2EG5A 5DTRA 4RTMA 1ZKDA 5DTMA 1XDSA 3ME5A 1SQFA 2IPXA 1NW3A 3KR2A 3R0QA 2QYOA 5GIPE 5LQUA 2OO3A 2ERCA 2ZZKA 1IXKA 2CKDA 3TPZA 4OX9Y 3DXYA 3GRVA 1L9KA 3DLCA 5CIYA 4PINA 1L1EA 3VYWA 3EVZA 4ER5A 1FBNA 3MAGA 4YV2A 3HVHA 1T43A 1MJFA 1WZNA 3LGAA 1X1CA 3E8SA 4L7VA 4C07A 4CKCA 4FGZA 4RTJA 3PX3A 3FTFA 4O29A 5P8WA 1O9HA 2FHPA 5HFJA 3G88A 3G2PA 1L3BA 1RJFA 2YXEA 4CTJA 4FSXA 3LDGA 3M6VA 1WXXA 1NBHA 1XDZA 5K0JA 3NWEA 2PT9A 4YUWA 3PT9A 4PYLA 3UJDA 5HZMA 3OZSA 3HVKA 5CUQA 2G71A 2HV9A 3A26A 2OYRA 4C03A 3CKKA 4RWZA 2XVMA 2FRXA 3NTVA 4HC4A 2AN3A 1WXWA 2OBFA 3T7RA 1TPYA 1UFKA 2P3QA 4LWPA 3A4TA 3REOA 1NW7A 3CC8A 3DXZA 3FRHA 5DM0A 1RI2A 2NXNA 2ZIGA 4LG1A 3KPJA 5HIJA 9MHTA 3R9XB 3EMBA 5LQAA 3PS9A 2I6GA 3M33A 4ZTBA 4GBED 2XVAA 3C0KA 5FHQA 2G1PA 1OR8A 3LKDA 1VP3A 3IYLW 3G2MA 3NVMB 4DA4A 2CWWA 8MHTA 2WA2A 5H02A 3CGGA 4X41A 5ICEA 1FPQA 1EJ6A 3KPVA 4DF3A 4KDRA 5E9JA 5EEHA 1KPHA 4YMHA 3PVCA 3EVAA 1L3IA 3BXOA 3T0IA 5HIIA 3B3FA 2ZTHA 3BKXA 4RTOA 1MHTA 3MHTA 5LQRA 5FTWA 4RTRA 4QQKA 5DWQA 1DL5A 2AOWA 3HA5A 3UJCA 1NV9A 3PFGA 4M38A 1R8YA 4CXMA 2ZWVA 2OPBA 5KQRA 2YVLA 1JR4A 4PYNA 3OFKA 1YB2A 3B3JA 2I7CA 2YR0A 1H1DA 4KIFA 4Z2YA 3LBFA 4KWCA 3EPPA 2DPMA 5FADA 5T67A 2OY0A 1SUSA 1UWVA 2FK8A 1I4WA 3FTCA 2N47A 3P8ZA 2GA9A 2PXXA 3FYCA 5DT2A 3QOXA 4FS8A 1JTEA 3TMAA 4F84A 3IHTA 2DULA 1KYZA 1O54A 2WK1A 3AJDA 1JG3A 2ZBQA 1HMYA 1BHJA 3EVDA 3THRA 4DMGA 5LQCA 1JQDA 3P9NA 3G8AA 3I53A 4R6WA 2AOXA 2JHCA 3MGGA 2P40A 1RJDA 4PWYA 3JWGA 1ZGJA 2BR4A 4R8SA 5EMKA 3VSEA 3PFHA 5ICGA 2PX2A 3GO4A 4UOEA 3VC1A 4GOMD 2ZLBA 1QZZA 3BT7A 5EMLA 3G5LA 1Q0SA 4KRGA 3BWCA 2NYUA 4GOOD 2O07A 2AVDA 1INLA 2QE6A 2FCAA 4P7FA 3TQSA 4RSRA 5EIFA 3FUVA 4BLVA 3FYDA 2PX8A 3EVEA 1DUSA 4PYKA 3LSTA 3TFWA 3OE5A 5LR6A 2IBSA 3OZTA 4R05A 2NXCA 3HTXA 2QM3A 2PWYA 4OQDA 2JHPA 3RW9A 2AOTB 4R8RA 5E1DA 5EMMA 1SUIA 3KR0A 1KHHA 5K8VA 1R00A 3P97A 2AN4A 1P39A 2CMGA 4PIPA 4RV9A 5DSXA 3AXTA 1JSZA 3LPMA 5EOVA 3ID6C 2IP2A 3HCCA 4KW7A 2EFJA 1EQAA 3I64A 3ORHA 5EVJA 5FA5A 5DX1A 1ORIA 2P8JA 2P1DA 3FUWA 3HA3A 4X1OA 5K09A 4RTPA 1BKYA 1G8SA 2PBFA 4HGYA 4HSGA 1EAMA 3MTIA 2XBMA 3P9IA 3TKYA 5K01A 3TLJA 3FPJA 3EEYA 3G2QA 5FWDA 4OA5A 5D1HA 5CVJA 5FHRA 3HNRA 2IH5A 1M0EA 1AQIA 3BWBA 2FPOA 5E1OA 2C7OA 3T7SA 3GWZA 1VIDA 3BUSA 3VC2A 3UZUA 2ZULA 3THSA 5CCXA 3JWJA 3DOUA 3KU1A 3RODA 2GH1A 2C7QA 3DP7A 1EIZA 3AY0A 3GRZA 2JG3A 5E2BA 2IBTA 3DH0A 2CMHA 1XXLA 2G72A 4H0NA 5IKMA 5JR3A 1G55A 4RYLA 1O9GA 1KPIA 5K0FA 1R74A 1RJEA 1R8XA 4PYQA 4C05A 3NWBA 5EHGA 1AV6A 1D2HA 1ZGAA 2FK7A 5DTQA 2NP7A 2C7PA 10MHA 5DX8A 3MB5A 3LCUA 4E30A 3U81A 5EKXA 3SSOA 2YUIA 1AQJA 3NMUF 3BKWA 1YZHA 4KVZA 3QOWA 3EGEA 5E8RA 2QRVA 3SR4A 4QPPA 4MHTA 3GCZA 2ZVJA 2P3OA 5EEGA 3FRIA 3G7UA 5F2OA 3M4XA 4LECA 4BLWA 2AR0A 3MCZA 2XYQA 3PTAA 1JQEA 5DSTA 2B9EA 5DPMA 5JUWA 4AZWA 4AX8A 3BWMA 4HRAA 4PYOA 4JXJA 2VP3A 3CVOA 3LECA 3KQPA 5LQNA 3GDHA 3X0DA 4PGGA 5ICFA 5T64A 4YUZA 2GPYA 2K4MA 4PIMA 4B17A 5GP1A 4PYJA 5HOQA 5DM2A 4EKIA 2B78A 5K05A 2AOVA 3UJ8A 3P9KA 2VZ9A 3EEOA 3QV2A 5E9QA 3EVCA 1VBFA 1XTPA 4QTUB 4YV1A 4E2ZA 1R6AA 2ZIEA 5ERGB 5EPEA 5K03A 3LCVB 3TOSA 2XYVA 3FTEA 1KIAA 5K0LA 4RVHA 2R3SA 2G8NA 5LSAA 3I58A 3KQQA 1KYWA 1FJXA 1NBIA 4YUXA 3H2BA 1X19A 3EVBA 1V39A 1KR5A 4KDCA 3SGLA 2IFTA 1JSXA 2NNWB 4OQEA 4E33A 5LQKA 5EMJA 4IWNA 4P7GA 4CTKA 2ZSUA 5HEKA 2VDVE 4HH4A 1XJ5A 2H11A 1BOOA 4G56A 4U7TB 5CVEA 3GU3A 3UJ7A 3KQOA 5GM1A 4YUYA 5K0BA 3LL7A 3KR1A 2Z6QA 2BZGA 4P7JA 3TM5A 5U4XA 3MCTA 3SX0A 1NV8A 1XDUA 2P7HA 4IV0A 1G8AA 3DMGA 1B42A 5EZSA 3DULA 2BH2A 2GAFA 4F86A 5K0CA 1VPTA 4HTFA 3B89A 2PLWA 3DMHA 5T6BA 4RTSA 4KIGA 3D2LA 1NE2A 3ELUA 2ZW9A 1R18A 3FPGA 3FTDA 2UYHA 3GXOA 4GF5A 1TW2A 4ER0A 4RTKA 5HILA 1NW6A 5BP7A 3JWHA 4PNEA 1WY7A 4QDKA 3SXJA 3M70A 3GRRA 1IY9A 4OBWA 2ORED 4HGZA 4Y2HA 4Y30A 5E2AA 5E8JA 5EQJB 2NXEA 4DM3A 2FYTA 3KPYA 5KVAA 1XVAA 3ANXA 3C6MA 3FPEA 4HG2A 3BZBA 2LD4A 4GEKA 4QQNA 5CVUA 2P7IA 2PXAA 4E70A 1D2GA 4AZSA 5K0GA 3OU7A 2JH9A 4U7PB 4DZRA 5KS2A 4RTNA 1ZG3A 5GWXA 2OB2A 1NW8A 2UYCA 2ZBPA 2ZWAA 7MHTA 4PONA 5KQSA 1RI5A 2Q41A 3KR9A 1AF7A 1WS6A 4ER7A 3HM2A 3GRYA 4GC9A 2IDJA 3P2EA 4X63A 4CKBA 1FP1D 1XCLA 2AOTA 2HWKA 3FPHA 2O06A 3P2KA 2C7RA 4PCLA 1NT2A 3UA4A 3I9FA 2ZZMA 4C4AA 2VDWA 5K0EA 2G70A 2B2CA 3ELWA 4E31A 3LX6A 2HNKA 3NDIA 4QPNA 2ZCJA 2GLUA 3G5TA 4FT4A 4PYMA 5BW5A 3K6RA 3UA3A 2ZIFA 2PWPA 2HMYB 2ZZNA 2I9KA 1G60A 3A25A 5ICCA 3UWPA 1HNNA 1EG2A 4ISCA 2QY6A 5DLYA 3SM3A 1JG4A 5GOZA 3JWIA 4X61A 3T7TA 4EK9A 3ER9A 2OB1A 4XUDA 5EHIA 3OE4A 1QANA
chains in the Genus database with same CATH superfamily
3H1PA 3OT1B 4MI1A 3O4IA 2LKDA 2X7JA 1MTZA 4P4NA 1NYQA 3CZ5A 1Y8CA 3F7MA 5FA6A 3JQEA 1U6KA 1VP9A 3KQTA 1MO5A 1MJGA 1YKSA 3OTQA 3PBKA 1C7QA 1M83A 4DA0A 1MO4A 1QP0A 2HA7A 2JI6A 2R48A 4RSMA 5KNCD 3E9CA 5E6UA 1GT91 4HZIA 3L0YA 4U0KA 1DG1G 5COBA 4S05A 1UK8A 3NAQA 1QP7A 3O9MA 3IJ5A 2FVXA 2ZB7A 4HZUB 3QF4A 3R3JA 2O0LA 3DFFA 1P7WA 3FD8A 4FGSA 1H0RA 4PE5B 3HM9A 5AOVA 5FJIA 1YVRA 4DR4B 1RCTE 3F7OA 3RHSA 5ALEA 2QR5A 3GGSA 1C1DA 3DNPA 4YLEA 2JBHA 2JLRA 1U7OA 2TMKA 4FYYA 3UHJA 5AW5A 1M2VB 3VC7A 4E11A 4MXDA 1LPAB 5KYUB 3AONB 4LRUA 1FX0A 5JATA 2P3SA 3OURA 1DNPA 3RK1A 3RK4A 1K0FA 2CF6A 4Z86A 3V32A 7ABPA 2I29A 4MS1B 2VHEA 2NP6A 2RHWA 4AZ0B 2VTDA 3EJWA 1XEWY 4UVDA 4GAEA 1QHHB 2Q3BA 4TMKA 4WVLA 3WLLA 1W94A 4LZAA 4ZC1A 5KTOA 1ZNYA 5BY2A 1EDOA 5D51S 4YX9A 3F6YA 2Y9PB 1L5HB 2IPNA 3H3FA 3G0OA 4CMAA 4ZMBA 1VQ1A 2HCFA 3EC7A 3VR4A 2PGOA 6ADHA 4EMSA 3WYCA 2ID9A 3CRRA 4LMAA 3J81k 2QM8A 2AK2A 3UMYA 1KRWA 3E5NA 4EUEA 2JGFA 2NQ8A 3OJXA 1R6DA 4I5GA 4R8MA 1X94A 2RGNC 4OY3A 2BBTA 3ASVA 4A0RA 4MRSA 1RSZA 2W6PA 4WCVA 1IBSA 2V98A 5A5EA 3WLNA 2OVFA 3HBNA 3ZTTA 3R9IA 3TDMA 3K6KA 1P81A 1EVQA 1N6KA 1JU4A 1SUBA 2KW5A 3JQ8A 1XZPA 2GZ1A 4UNPA 4H17A 3LZCA 2H1OA 1QONA 4G3XA 2IYXA 1TUEA 4MX8A 1ZJZA 2RH8A 4QHSA 3SVZA 5C3UA 3WHPA 2XE6A 3CLRC 1ZD1A 1H2XA 4R9NA 4BV3A 5KNDA 1UJMA 1PWZA 1RAEA 5ALRA 3GFOA 1XTUA 2L42A 2ODTX 3HMKA 5BV1A 5BN3A 2HTEA 2QAGA 4INJA 4URWR 2I2AA 3V3TA 1BJRE 3OESA 1PFGA 1PDWA 3IBSA 3DQPA 2B3TA 1ECLA 4ZVOA 4DLKA 3OPQA 3TTWA 1RI3A 2FSUA 1N5OX 5LA6A 1NOIA 5IU6A 2VEOA 5CNMA 4YBZA 3ZQ4A 1YFLA 3MMPA 4BMZA 1EFDN 1E1CA 2DUUA 5IJ0A 2FW0A 4UPEA 1M6YA 3QEMB 3W2TA 3BHJA 2DT5A 5FLEX 4BZWA 2YHIA 3TTYA 1ZMOA 1UH5A 2V9CA 4LX8A 1L9XA 1T4MA 4HQNA 4BAUA 2LRHA 3OEWA 2IWRA 2EHJA 2IYNA 4CIWA 2UUPA 3BD8A 2HDHA 4MMZB 4R6XA 3ZHTA 3KQNA 2X4LA 2VSXA 1Z4QA 4I4CA 5CDYA 2E82A 2WKPA 1M6NA 1RYBA 3LP5A 4Z0TA 4MV6A 4RE6A 3SOPA 1GRRA 2DKFA 5HWSA 1V6CA 4AYXA 1PFVA 2NUBA 3E5HA 1NXSA 4RZ3A 1GRNA 1P1JA 4U6SA 2L0XA 4X1YB 2WYIA 1M9NA 2P6UA 4MVYA 2R8BA 3VH3A 3TW0A 1BMDA 1CG6A 1F2UB 2R7MA 3ONEA 4MVJD 3RPEA 5AI0A 4L8FA 4CQJA 4E4TA 4G23A 5IFLA 1L5LA 5F5LA 4DIOA 2XMQA 1IRIA 1U1EA 2ZRQA 1DIGA 3AETB 3K31A 5E1BA 2PUTA 2F4VB 3ISJA 1G1MA 3EWSA 4IKPA 4TT3D 4XDYA 4R5MA 1S4MA 2A9VA 3GGDA 3PFWO 4J1SA 2WY2D 3TRKA 3AHFA 2PJUA 2ZK7A 3B8HA 5A9SB 2OEPA 2X3YA 3JAKA 3GAZA 4RZ2A 2ZJ3A 1TQ8A 2IEYA 1TE2A 4GL2A 3GN2A 4ERXA 2IYUA 1JPVA 4AKIA 3AHHA 3TRFA 5A4FS 1IVSA 5EFZA 4Y1FA 2HU5A 3IMEA 3EIOA 3RV4A 4Q7KA 3S8YA 3INRA 3AUKA 2WV9A 3N0TA 4X90A 1R4MB 4EFNA 2ODBA 4YP6A 2YRXA 2CUNA 3NBUA 2F1RA 2GR9A 2ZYRA 4O2RA 3AM3A 2JHGA 1R0RE 3KEGA 5C0OE 4YYEA 4B4VA 4KFCA 5IAKA 2QUJA 1QRUA 3UICA 3IOCA 2O2SA 3ZR4B 3UMBA 3TLGB 2JH8A 5I9BA 1TC2A 2QRKA 3ESYA 2YJTD 4MW1A 1QFZA 1YCHA 1RKVA 3E0QA 2EEZA 1WBDA 2AZXA 5TRTA 2A0YA 4XD2A 4QIHA 5EIBC 4DEVA 4EZBA 2H7XA 5BOSA 1BOFA 3TLBA 1F7UA 4TTIA 1Z6GA 4FINA 1ZKDA 1HURA 2PO7A 1E9VA 4MA0A 2XT6A 5DTMA 4L2IB 5F7JA 4EF4A 2DE0X 4EMBA 3K6JA 3R44A 3VVMA 5JC8A 4M9UA 3T1QA 2PZFA 5ALLA 5EL0A 1DTWB 3P26A 1UKVY 5EHQA 1GL9B 3RJ9A 4CLDA 3VA7A 1QF9A 1T1GA 1PV4A 1F06A 1WXGA 4NP6A 2IITA 1PWHA 3LQFA 3ULKA 4EOGA 4RKFA 3IJRA 4HTAA 1SOMA 4TTQA 3WKAA 1N2JA 4ALJA 3EEQA 4C07A 1I6LA 2EYUA 1FUKA 1AGRA 3HB0A 1ZWLA 4NZ9A 4FCTA 1E2MA 1J22A 2BFCB 3G2PA 3G88A 2QNRA 3M1IA 1N5RA 4UVHA 5AHKA 5A02A 1UBJS 1VA5A 4ID3A 1NBHA 4YCMA 4OQPA 3RABA 4YUWA 4TRRA 4DNQA 3VTZA 2FG7C 4MWTA 5CUQA 4TKUB 4HYYA 2PR7A 4XTRA 2AIRA 1BDJA 1EDZA 2I1LA 4HNVA 1U1CA 4L0DA 1NBME 1ZVJA 4W1PA 1U8XX 1O95D 3ZCXA 4HNUA 1F4LA 4HC4A 2JJ2A 4WBNA 3T7RA 1NUPA 4KO4S 2XT9A 3REOA 5LP6F 4KXFB 2F17A 3DXZA 5D3MB 2QUHA 3WGGA 4HLQB 5DYYA 2M2IA 3EOZA 3GGJA 5SZJA 2JLZA 2O7RA 2XH8A 1NI5A 5FNVA 1SBZA 4IZIA 4XYEA 4ALIA 1Q0QA 2CL7X 1EDDA 1FJGB 3STWA 5DVZA 1SHTX 4MQMA 3G2MA 3VV3A 1CEQA 5FBQB 1YK0A 3V80A 1TB4A 1THZA 2WSBA 5E9JA 2WR8A 5ELXA 1DRUA 1R88A 2NAFA 2EXXA 3Q3JB 4F6RB 2ZTHA 3BKXA 3LHIA 1PFUA 3DAFA 4C6HA 3MOSA 4CODB 4QJ5A 4RK6A 1OYYA 3ZIDA 1QSGA 1MV8A 4WBXC 1BMQA 3A2NA 4GMKA 3PCTA 1ENYA 2YVLA 1LRJA 1GPWB 3A4VA 4CKWA 2WWYA 1YB2A 2JD2A 2FXVA 2NPIA 3X1YA 1N34B 3FGPA 3AR5A 2MOKA 2TYSB 1B73A 3R23A 2W6JD 4RADA 3WLTA 4B3DA 1BO6A 3RDPA 4YXWD 3W5UA 5DBOA 4K6HA 3UT6A 4AJHA 4ZHQF 4MUKA 2C8LA 2OC4A 4XE5A 2VXYA 1ADYA 1XMVA 3FYCA 2AF3C 4W82A 4HH3C 1VKHA 3EGXB 1REQA 3A58B 1I6MA 3MWJA 4XFJA 5E6RB 1TD1A 1E3QA 1O54A 2VDKB 1NZJA 3L04A 4G0UA 4XTCS 3N8NA 3LPCA 1JQDA 2FEAA 3Q3EA 1PK9A 4ZDJA 4TYMA 3FNFA 2HB6A 2CSUA 2XGMA 1UKEA 1CZOA 1RRPA 1XHEA 2QL5A 4M55A 4UOQA 5EMKA 4FZRA 4N5DA 1PZMA 4D3FA 5CFZA 1D9ZA 5AW0A 3BT7A 4EVSA 3FOZA 1XZNA 2IPLA 1Y1PA 3LY9A 1OXUA 1EFVB 1INLA 2AVDA 2J9RA 1QDEA 2OHFA 2P0AA 2WU4A 3GFRA 4RA9B 1Q0PA 4YHBA 5ENDA 4DYHA 3IOBA 1JQKA 3A6FA 1M0SA 3C15C 2GCOA 5KHLB 1LBQA 2BONA 2P65A 2VA9A 4NXMB 4N9WA 1Z8HA 2W9XA 1Y1SA 5I9LA 3G6KA 3KT8A 3PDWA 4IP0A 4HWGA 3A1FA 1JEAA 4ZQHA 4DDTA 2OT3B 1KHHA 4POAA 2CMGA 3GAMA 3QKWA 3K2IA 4WLOA 1GL7A 2XF8A 2PTHA 3ENKA 3PXEA 1RPNA 1OSNA 3GX1A 1DT5A 1BKYA 1JT9A 1VE6A 4HSGA 4ND7A 5T6MA 1LJUA 4QFBA 3HU2A 3RYCA 3ZWWA 2ZB3A 3GBSA 4WY5A 1FZTA 4BNTA 5BWNA 4LF7B 5CVJA 1ZD8A 3JQQA 2A35A 4BNHA 1QGUA 3EEFA 3D6TB 4Q1CA 3AVVA 3I09A 4ZHQB 1VIDA 2PL9A 5KNCH 1GZ4A 3C2QA 5C5EA 5EJIA 3DT8A 2GPTA 3THSA 1NP7A 1VG1A 4OGWA 3AUXA 2MINA 2JCBA 3Q0TA 4RMGA 3DCJA 3HVUA 3ONVA 4JEIA 1HG1A 2GJ4A 2VDQB 3DUFA 3F4LA 1QGYA 5ENZA 3RYFA 3U62A 1IM2A 4M1SA 3OJLA 5CAEB 1OASA 5DTQA 2AUMA 1Y6FA 2QTVA 1P7ZA 3KUCA 1Q2UA 4K9DA 1U28C 1XVUA 2G6BA 1G6KA 1T5LA 1TJPB 1U98A 2B4AA 1ML3A 3FCSB 3PDJA 5C4GB 4DSUA 4PC3A 1LRKA 2QTMA 1U3GA 5IN5A 4RHYA 2H2DA 1Z17A 5GVSA 1C3LA 2KBFA 1PSZA 3PUKA 5E8RA 3ZDAA 4NV0A 2P62A 4ISBA 4K9MA 3QG5A 4MAAA 3TK1A 2IU6A 3WYBA 3ZZ0A 5HKKD 4LF5B 1USVA 3BGWA 1Y8RB 2VJDA 4LZLA 2WV7A 3GIDA 3M6IA 2JGEA 2V6MA 1WZIA 2FH5B 2ZI5A 1GQ2A 2ORIA 4YT4A 2XA1A 4Q9HA 3JD3A 4CDMA 4JV5B 2RGGA 1QR2A 4IGEA 3S27A 1J8VA 5KWJA 1E1LA 4KUEA 4W99A 4GR9A 4B17A 4PYJA 1KJJA 5EZ5A 4C9BA 1XPRA 3LC0A 3T5BA 1DIHA 1DFGA 2VWHA 3IO3A 4FYPA 4GPIB 3W5DA 4UAVA 1IPEA 2SCUB 4QM7A 1N9GA 3P9KA 4KMOA 4YT5A 4RQUA 5AUPB 3NP7A 5B1DA 2AR7A 2UZ0A 2CDRA 5KINB 3T95A 2D62A 3HZRA 3AKYA 4A26A 4EABA 2G9VA 4GLOA 3ZJYA 2KB0A 5LOVA 1QC5B 2L18A 4JJ7A 3UOWA 1IY0A 1RIFA 1KYWA 3ZLUA 5FJJA 3OQHA 1Z6QA 2VTBB 3LD9A 4RFVA 1V1MA 4LZJA 1KAEA 3U3ZA 4KE9A 5HEKA 3CKMA 2JLWA 4JXKA 3B9RA 3U3XA 2FEWB 4P3YA 3U7QB 3F3YA 2WHQA 2QL9A 1SB9A 2IHJA 5B7QA 1E1QA 2HJSA 4Y98A 1P3Y1 3H9GA 3I45A 4R1NA 3X1KA 3H9QA 1UPCA 4X20A 1XA0A 2D3TA 4XD7A 5EIBD 3FKQA 3PDIB 1GR1A 4LY9A 2WJHA 3E3OA 3LY8A 5JARA 3E5MA 1RLMA 4O1IA 3L1HA 3WC4A 3E9MA 1RWPA 3F8WA 2LIVA 4ZKDA 3C4QA 1T9ZA 3G49A 3H8JA 3PR1A 2YINC 5EE5B 3L8YA 5DBHX 1O77A 2FI1A 5ANRB 3R1IA 2HFJA 1YJAA 3IS3A 3HWRA 1PL8A 1QP4A 1NUQA 3KTFA 4D9JA 4WFQA 1H1TA 4HGZA 2AFVA 2FMUA 2H4YA 3F9RA 4MVJH 5EESA 3ZS8A 3KOYA 3QWFA 3ETLA 1OXSC 2FFBA 2JFOA 2QRMA 3LK7A 1XVAA 5AVYA 2DLNA 3BZBA 1SWWA 3TSZA 4HLDA 2X23A 5F64A 5D6NA 1GZ7A 5B5SA 1V47A 4QHTA 1KVQA 2DBRA 2VUHB 1UKZA 4KZPA 5FR1A 4DDKA 1LTHR 2ISSD 2ZSHA 1T8PA 4M6WB 3VO9A 5JJIA 2QYHA 3LH5A 5DHSA 1CZUA 1CR4A 1A5SB 1CR2A 4IM7A 2V5UA 4FC7A 4AY6A 5I8WA 4I5IA 3QFHA 3O8CA 1G66A 3EWNA 2Q9UA 1FP1D 2QX6A 1UXKA 2F3SA 4ZZ0A 2I99A 2F59A 3KOWA 3LZ6A 1QHSA 1KAGA 4Q4AB 2ZP1A 3DWEX 5B4VA 5FRDA 1Q1QA 2FOXA 2GJKA 3SK0A 1IFXA 5EP2A 4ZU1X 3AB8A 4Z9YA 2DFDA 5ISMA 3TVTA 1Q1NA 4EUNA 2G7ZA 4MHSA 1KTIA 1TM2A 1Y7TA 1UK7A 4B85A 1Z5UA 1LK7A 2EQ5A 3INTA 2FWRA 2GM3A 3GYBA 1YB6A 2X6QA 5K2MA 2E48A 4ND8A 1L7XA 2ZUUA 3PJGA 4KR9A 2A6PA 1ESCA 3KKOA 2RKWA 3FFAA 2IXDA 2F4NA 1Y80A 4ZEMA 2IY9A 4A23A 1JJ7A 4LK3A 1KQFA 1ZOOA 4ZAZA 2O1XA 2NYVA 4OXIA 2VAXA 2IV2X 3WB9A 3DO6A 3OQNA 1R9NA 2D54A 2Y66A 3L7BA 2XSZD 5FKJA 5B1IA 2BSXA 4HH0A 2Q7DA 3H16A 3DLHA 3FCEA 1C3JA 5F1YA 5JWOA 1SKMA 4CT4B 3KQWA 2J46A 5ELLA 3NW9A 3L02A 2EZ8A 1DAIA 4XIIA 1KBQA 4K6KA 1QRDA 2V7TA 3Q12A 5ARCA 2RHRA 4C30A 3RB8A 1B1AA 1CR6A 1P1CA 5AI9A 1SM4A 3NVKI 5DYGA 1ZY2A 2XAAA 2REXB 1A7KA 2IDZA 4Y1RA 1T9DA 3RTEA 4UXHA 3LE8A 5IM4F 1B8NA 1VCMA 5JCJA 4F1JA 2GAAA 4NQZA 1GR0A 1KMIY 3L18A 5JAMA 4YPOA 5J2UF 1D1TA 3Q7EA 4NBNA 2CBGA 5FBRB 2ZSFA 4ANFA 1RXCA 4BIIA 1UPAA 2YN0A 3BCUA 5K3FA 4TRJA 2D7JA 4FEGA 1NKVA 3DBRB 5KSOA 2FZWA 3OEYA 2O1WA 4UNIA 2ZIAA 2QG9A 2W2PA 2P41A 4R68A 2I22A 3RJMA 1PBNA 1ZXXA 4JLBA 4N47A 5JIBA 1PQWA 2O3QA 4KQ2A 4ENUA 4JLDA 3THXA 1FC0A 2Y2VA 5H68A 3DDHA 2ADFA 4M36A 3HABA 2FSPA 1UM8A 3A6JA 3G02A 2WKWA 3IESA 4HATA 4JQCA 3WP0A 3V7NA 2IYEA 4L4RA 3V42A 4RA6B 2WWVD 2H1RA 3T9CA 3ZDYB 5F7XA 2UKDA 5EKTA 3P0JA 3GBPA 1CUGA 3AF0A 2M6SA 5CT4A 4BP3A 5BSFA 2CNDA 2A9FA 2YC4C 4E6PA 4EG6A 2HV8A 3CJQA 3WWDA 5HQTA 4MUEA 1K4YA 3HL4A 2C88A 4JUBA 4KNVA 4OA8A 1TA0A 3L0SA 4EZEA 1ZM9A 2GB4A 3Q87B 2JNWA 1E94E 2O2HA 3NG1A 4PLZA 1UBSB 4MIKA 4AWXA 1W6UA 1Z25A 4OM7A 5IX8A 1PWEA 2WB4A 2R8XA 1EX9A 2DECA 3L4BA 5KQGA 5JCOA 5LLSA 1A7JA 3BREA 4UHEA 3UIEA 3V4PB 3BFVA 3USCS 1VZ3A 2GOYA 4DSAA 3G2LA 2HSDA 3N2LA 5DRYA 1ETUA 5TSDA 4Q7JB 1XEXB 3O0TA 1KI2A 2OCDA 2WSMA 1FS4A 1ZWKA 3FOAA 4XA8A 2MIIA 5CA1F 4GKBA 2JBAA 5HUJA 5J2UB 4M9SA 1O87A 7AT1A 1BE6A 4IFBA 4IF4A 4S0XA 4LQLA 4K88A 4ZXFA 3GFFA 1KZYC 3FLAA 4QE3A 5JFOA 1XMOB 3ZWVA 1P0FA 1ZMXA 3I76A 3ONDA 3W5SA 1D2CA 1CUAA 1J0EA 1FB5A 3C6ZA 4EY6A 1FYEA 2BFEA 2AG5A 4V1CB 1YS9A 1EGAA 3AFOA 3D7LA 3DEYX 3EW7A 4QPDA 4WK6A 4AAYA 1JHMA 4W5OA 2CLMB 2D0DA 1JHPA 1OH6A 1O1YA 5E6SB 2A0KA 1OMOA 4ARUA 2GWHA 4XGIA 1RJ9B 2P9QA 3D6UA 3A6EA 1QIHA 3VR6D 1Y6GA 2VYVA 3PR3A 2PE5A 3C45A 1JXMA 3SF8A 1ULSA 3L77A 3KYDA 2CLIB 3F90A 3PENA 4H3VA 5DW3A 3ZCVA 4AUMA 1JZQA 3UHPA 2CNWA 3PIDA 3VFDA 3MMNA 2CL0X 2CLDX 2PX5A 3AIKA 3BE6A 4G5HA 1BAPA 2XE4A 4GUAA 3V2GA 3DEJA 3K2EA 4G0QA 4CMBA 5B12A 1V5IA 3HY6A 1QTNA 1GQRA 1L5WA 3HVJA 3QTBA 2VYFA 3ST7A 3VBEA 5LYJF 1X7YA 4R3WA 3N7TA 4EENA 5EERA 4LJYA 3RK0A 3GLSA 1G7TA 1EVLA 1L7NA 1WSWA 4A92A 4TKVB 5CVVA 4CQNA 2UV8A 2WVHA 2P27A 3C6YA 3LO5A 4KH1A 1O4VA 3IBGA 4R1PA 3ZK7A 3QVMA 1COWD 4E2FA 1R0ZA 3RIEA 4XW2A 5CA1B 5K8IA 4YN3A 2Q6IA 4JFRA 3N2KA 1PEDA 2GF0A 1F38A 2P77A 3D5TA 1ZS9A 2MSWA 3NM4A 3COYA 2I2BA 3O4GA 2PV0A 1XXHA 3CBGA 5IVIA 4CT5A 3HP4A 1GZVA 5FPTA 4J7XA 4YCSA 1Y7HA 4W1SA 3RVMA 3THOA 1AMNA 1P18A 3SM9A 2HU2A 3SQDA 4ER6A 4X1KA 3E9YA 1M8KA 5DLEA 1VMAA 1Y4ZA 3NUGA 4KGVA 3QFCA 5MHTA 3IAFA 1OC2A 2DP4E 2XMGA 4EBFA 5BR1A 1YAJA 1GT6A 2WIBA 2ZWOA 3MB8A 3ZI4A 2WM2A 1XDSA 2A94A 2EF0A 3OOJA 5LVAA 2HTFA 5J1TB 1SZCA 3G5AA 4R1SA 4QEDA 1BCRB 3DXYA 2HXYA 5AICA 2RSLA 3S8EA 1CF2O 3SZLA 4BMYA 3ZWNA 1MBZA 1E6MA 2JFUA 4NPCA 4GPEA 4DNFA 2PUBA 1CJSA 2HZBA 1UZNA 2CJXA 1ZBDA 2FN3A 3PQ2A 3R20A 4O2LA 4WMLA 3TUJC 1MLDA 1JWBB 2OV4A 1KMCA 4O4HA 4S1PA 3VHQA 4Q82A 2A59A 1WETA 5CYFA 2F3TA 2JW5A 4Q3DA 4YASA 4F6RA 5LYJB 1HQYE 3WL7A 1L7BA 2EDCA 4RD3A 2ZJ5A 5LDHA 3I2JA 3WLAA 4KR6A 1XZHA 5HQJA 3RLFA 3D3QA 3GMDA 2GHIA 2LKCA 2VJMB 4RHTA 1XMPA 6GPBA 2CXHA 4QBGB 1YOVA 5FOXA 2QUIA 2HV9A 2AG0A 3A1EA 4Q3OA 1RQ2A 4ZEOA 3ANNA 5L3QA 1HXHA 1L1RA 1AURA 1DKOA 3G23A 4UM9B 4FX5A 3UMFA 1WCIA 1TECE 3H05A 5JD5A 4QJ3A 3HBMA 2ADOA 2ATVA 3OIVA 5ES3A 1CY7A 4ZQBA 1PZHA 5HJEA 6REQA 1IN8A 1RHMA 2FN7A 3IUPA 5BSUA 4PHGA 3RCBA 3DPUA 1M5RA 4B7XA 1UM9A 4L5JA 1LC0A 1XPJA 1PZXA 2AR9A 4KIUA 3TXAA 4B3TB 1B0UA 1XDGA 3RGGA 2OHOA 1CR1A 1G63A 4MJLA 2GZHA 2O2GA 3RVOA 1KKMA 1MB0A 2XKJE 2WA2A 2X8WA 4X41A 1NF3A 3KPVA 4OQXA 1T0IA 5T4BA 1XKXA 2YW9A 3F49S 3LT0A 4MNTA 4O4JF 1OH7A 1T6XA 4JHLA 4AW9A 1V8OA 2BUCA 4D9FA 1N75A 2KBEA 1QJ4A 5AMXA 5FPSA 5BSKA 4RGVA 1KAHA 3BMOB 2J45A 3FX2A 5IG2A 2WEKA 5CDFE 1N77A 3SR3A 2X14A 3BB1A 3GFBA 5KPJA 5BT8A 2YWJA 3FHJA 4Q3CA 3OFKA 3SYRA 3KHUA 2DFNA 2W6CX 2GMWA 3C98A 3L7NA 4KACA 3T1OA 4DUGD 4EW6A 2GM9A 4F3RA 3LKBA 3LBFA 2E9SA 2K7ZA 2OWEA 3HKCA 4UMFA 1IMJA 2EW2A 3VZSA 3EDQA 1DMRA 1VHQA 1WVIA 3HB9A 3QFFA 2Q1YA 3QPUA 5LD2C 5AXDA 1NVUQ 3MG9A 2WWIA 1PBTA 2QN2A 3JZAA 3LCMA 2V58A 3O6VA 1FFAA 5DT2A 4A91A 5B64A 1XROA 1Y5LA 1GA1A 4ZAWA 3AKZA 2MMCA 5JJ5A 2UZ1A 1RWBA 3SDBA 3THRA 1OGIA 4XM0A 5DYTA 4IIDA 3CZMA 4HB4A 4KXQA 5ED0A 3LQYA 3NNNA 3T3MB 4QDTA 3UF0A 2V4MA 4OTZA 3UG6A 3H5WA 2RC6A 4DQVA 5ILOA 2ST1A 5ITWA 3B9BA 4OLFA 5ICGA 3GEEA 3GO4A 3TTTA 1FW6A 3LPDA 4GOMD 4AKEA 5HHTA 3ABIA 1NR7A 4XGQA 1FDRA 3K73O 3QEKA 1N33B 3O4VA 4EAQA 1ZVKA 4NHOA 4JASB 1AIPA 1FTSA 3OCYA 4Y7CA 2BHRA 4JI7B 2E37A 1I4EB 1Q7CA 1RWXA 3BPSA 3EIWA 4IQ0A 4KO3S 1Z2OX 3D4NA 4ZQGA 3LSTA 4C7BA 5LR6A 1QB8A 3SQXA 4U9IS 2NXCA 3QW4B 4YUAA 4O4JB 1AC5A 5FUVA 1Y8ZA 2JHPA 5A04A 1LPPA 3ZHRA 4LSZA 3SC4A 5K8VA 3OFNA 1LDEA 2GEUA 2VPIA 2VDWB 3BJIC 4NOJA 4K26A 3WIDA 4AX4A 3P32A 4WFIA 1EQAA 3ZD6A 1KEWA 3KDPA 3HA3A 4QU0A 1S2NA 4IVNA 2O2IA 3C5CA 1KYTA 4QYIB 4DMKA 2WIKA 1HYBA 3DB2A 5K01A 4OX9B 1I7DA 5B2FA 2QR3A 1EXWA 3D8TA 3WL4A 4YO7A 4WZAE 1JLRA 1MTOA 4I5FA 4OQFA 2FEPA 4BMDA 3TWOA 2OGWA 2V0CA 1H5UA 1RC0A 1EIZA 5ALIA 3TE7A 2Z6AA 3D6NB 1SN7A 1TA4A 1KFJB 3UB2A 2GCEA 1E2IA 4XH9B 5L3VA 4EA7A 3AZOA 3NIFB 2HREA 3UOGA 1AV6A 3U39A 4RMJA 2JIZA 2EBUA 4JGIA 3PXUA 2I3DA 3RS0A 1MJNA 3PDCA 4ZU3A 5H9WA 4OBEA 3DLAA 3HYCA 1SHUX 2E5FA 4DQKA 2WJYA 5ARBA 2FQQA 4ENPA 3F5QA 3NBMA 5AJXA 1UBGA 2WW8A 1KE2A 4BUZA 2QB5A 1YZLA 2DRIA 3RSOA 4G5FA 1YB4A 5CIWA 3LLVA 1DEKA 1UCFA 2WF5A 3L0OA 2J5KA 2O4UX 2O4CA 5JYEA 4AJNA 3BCHA 3L7OA 1JR3D 4ZVSA 4GGOA 2W6NA 1JR2A 3BWMA 4EY8A 2WUEA 4ND3A 3VDXA 5K3OA 2NPOA 1UPBA 2NUTB 3A70A 4IEIA 3C8ZA 3DMNA 5HBGA 5BN5B 4FLFA 3DM5A 5FXMA 3PD7A 3ICVA 4HBGA 5SZKB 3DMDA 3ZWDA 1OFUA 1FYWA 3N2NA 4KFSA 2B78A 2Q9CA 5ALDA 3ZLTA 3JQRA 4ZHSA 2CHFA 4DC9A 5DN6D 1QHEA 1Z6YA 2H4HA 4CUKA 5KC9A 3FIJA 1E2HA 1VBFA 4QAJA 4YJGA 4EFDA 3GRAA 4CV3A 1W36C 1K63A 4G2NA 1P7VA 4ESOA 3U13A 3GEBA 4GLBA 1V48A 1NJ2A 1W25A 4FOPA 3IEPA 3MT9A 4H7PA 4O2BB 4RZXA 4TMTA 5BMOA 5JDCA 3Q8LA 1QIJA 3R4VA 4CCYA 3Q8KA 2Q2NA 2GF2A 2BP7A 3O9VA 4IVRA 3UJPA 2BGMA 2Q07A 3H2BA 4EAAA 2OCGA 2VDRB 1UEJA 5CB8A 5K6AA 5DYNA 3Q7QA 1I8TA 4D25A 3DBVO 3LBNA 1HH4A 5HP4A 3I6IA 2GEBA 2ZSUA 2FG6C 2HBQA 4Z8YA 5IMBA 4BBPA 1ZLYA 1PJ3A 1AQYA 1HSOA 3GCDA 1BX1A 1DOAA 3GYGA 2QVZX 4GRIA 1NXPA 1U0EA 1XTIA 2H52A 3MCWA 3OLZA 4YUYA 3DG9A 4XQGA 4GNRA 2BZGA 2Q5CA 1DQNA 1IXYA 5CHYA 2O0KA 4ZYUA 1JXQA 2XDQB 3NYIA 4RKRA 4V2UA 4X8HA 2A1UB 4LJ9A 3DMGA 3IHKA 1G0OA 3FW1A 3NHFA 2BGNA 4L5YA 3EXHA 1NF2A 3UW3A 1Z28A 4M98A 2OFFA 2PZJA 3BRCA 1M54A 1I10A 2Q5OA 4OM8A 5GZ1A 4Y2UA 4HQ6A 5HTOA 1I0IA 3A1NA 4J3NA 4Q01A 5TVKA 4CKYA 5BV8A 5CBPB 3RRBA 4NU6A 3VAYA 1BIFA 1PL6A 4UBLA 2HF2A 4TS1A 4ZVLA 4FYMA 4MZXA 2QBYB 3OD5A 4MCAA 4DOMA 1N6LA 3V7UA 2O8FB 5J1SB 3VR6H 2H1SA 1BDBA 1OAKA 4HPXB 1SKQA 3PXBA 2JFYA 4LBYA 2G5GX 2G04A 3FI0A 4ZA2A 4Y7DA 4BNVA 3FOEC 2P7IA 3WTBA 1K8QA 4UJ5A 4MPPA 1X3SA 3HO8A 4OOEA 1MW8X 2GM5A 5KS2A 2LTAA 5JT1A 2O7SA 4KUGA 4LFAB 4RM3A 2I4IA 3WKCA 4Z9FA 2WAXA 3WYFA 1I6WA 4YT2A 2QAJA 2FMXA 3ANTA 3OT5A 2B1JA 1WW8A 2QAGC 4M2LA 3V6MA 2MSKA 3WLEA 2G5PA 5JRDS 4X8OA 2ZDGA 4C01A 3TQRA 3P2EA 1F0NA 3P2KA 4ETWA 1UMKA 4TQUS 2ZYVX 1G6HA 1RBMA 2ZRPA 4BO0A 3U80A 1T9AA 1WUTA 1FRQA 2VBFA 1L7MA 1CUIA 2NO6A 1SURA 1A9ZA 1K06A 1R0CA 2DFKB 4PYMA 1EUYA 1ELOA 1V7ZA 2P6PA 1SHLA 3FB4A 1W75A 3I12A 3OP1A 4UD6A 1EE9A 1GNRA 2FWPA 2XHEA 4UDNA 3MUEA 4R2HA 4WW0A 4XR4A 4NBRA 5DLYA 4DCJA 5HM6A 1NSTA 1Z6XA 4CM8B 3D02A 3DE0X 3UB3A 3CF4A 2FWNA 3F67A 3OM0A 4ZJUA 4PYIA 4X66B 1C0KA 2BCJQ 1UWKA 3E1GA 1A4UA 3L7CA 2V7EA 4Q9NA 3UGQA 4C2BA 5EJFA 3KEMA 4EJFA 4YLYA 2MDTA 1BWQA 1BHQ1 2DQ4A 5T8KC 2RK6A 3SX4A 3CE9A 1P2VA 4D92A 4YEDA 2AZTA 4C6TA 1H4SA 5A05A 4XX1A 1HM5A 4ZRDA 4CV2A 1SPXA 2GN9A 1H2YA 3LYLA 1PFKA 3QUQA 1LY1A 4RNDB 2Z2KA 4OATA 2GBFA 1SJ9A 2IS1A 1QRSA 2PUHA 3EZLA 3L0DA 4BU0A 4I9UA 5HW0A 2GPWA 3BXZA 4BE9A 4POOA 4WKNA 4MROA 1NY5A 2Y1XA 4DHWA 5HFNA 1IK6A 2JS7A 3U44B 1I80A 4HMPA 2YDXA 5ALKA 3WRYA 3OTOB 3W5JA 5AJVB 5DWDA 2QUAA 4W8OA 3HDGA 4FBGA 4DLLA 1MEOA 1VLZA 2VJLA 1NZDA 2OR3A 4Q9LA 2HNAA 3PC4A 2YYYA 5G1OA 4RABA 3ZGVA 1CQWA 4C1NA 4JXZA 1RMQA 1NXOA 5KU7A 1NDQA 2FGJA 5IVPA 1JIJA 1XQ6A 5KIAA 1Y8QB 3OZCA 1DX4A 4C0BA 3HDHA 1SOWA 1V11A 1YR9A 2PIAA 4OJNA 5AM3A 2KM1A 3RS9A 1J70A 1ZOLA 1VHDA 2XV1A 4XWOA 3N3AC 5IP5A 5JSKA 3HQ4O 3ELYA 4JJFA 1IZ8A 3FWHA 3VZDA 1XZFA 2VPYA 1JG2A 3ONFA 2G17A 4PCUA 1CUUA 2IZ5A 3NRJA 1WLSA 2A14A 3O21A 3OBIA 4DPMA 4ARAA 1P6QA 1N8KA 2XJ4A 3LT5A 1B23P 1KO4A 2AN5A 2PLNA 2VHUA 3JQDA 1M1YA 2V9PA 3ZV3A 1WXHA 3CPHA 3K6SB 3V8VA 1I3NA 2BEWA 3RNLA 3BORA 1HEYA 1NQAO 2E4XA 3EDRA 3HE3A 3LW8A 4QOIA 2Y71A 1JXOA 4P5EA 5G3YA 2JLBA 2J3LA 1NN5A 2RH9B 3GJYA 4IRXA 3FNGA 2GD2A 4NCKA 4CBVA 2WAOA 3H1EA 3AEZA 3AESA 3O2QB 1MRZA 4FNOA 4XYMA 3RVDA 2KYRA 3IDSA 2XTMA 2HDWA 4D42A 5T4HA 2YASA 1NONA 1S8NA 5LU9A 5I7VA 1DT3A 1T3GA 2P2NA 4LDZA 1G8GA 1QQBA 4P7BA 1QMGA 2WWFA 4GLJA 4EJSA 1J0CA 1ZVQA 4S2UA 2RI1A 4KAJA 1S02A 2GDJA 4M9XA 2VK1A 4BATA 2X0NA 4UJ3A 1O6BA 2FFRA 4JI3B 1I2MA 2PWBA 4RH1A 1F6WA 4CLRA 3TLMA 1K8YB 2PYZA 3G8CA 5CEJA 4KAXA 5TDHA 1ORHA 5GMOA 3DLTA 1J33A 4JBLA 1JHAA 1QWSA 3KJZA 4EELA 1ZPDA 5CLHA 4AG5A 2B1GA 3TSAA 4DMHA 3COSA 1IWOA 4IDDA 2AI3A 4C7JA 4TTAA 1Z5ZA 3LHDA 4WI1A 4EPXA 1Z08A 2YFHA 1SIUA 1L4MA 1SC1A 1RP1A 2EL7A 3UXEA 3ZK9A 3PC2A 3QLEA 4ZREA 1JLMA 2OD9A 3WLMA 4AG3A 4AUEA 4MVJE 2RONA 1ECPA 3V9PA 4DA8A 1TT5B 2Z8ZA 1EJ0A 1MD9A 4F8JA 3PF8A 3QW2A 3T5PA 5K3DA 1DWPA 1BFUA 1GIAA 2I2FA 1QHNA 2ATCA 2I8AA 2XOKD 3PFNA 4NNOA 3C3EA 3ZHVA 2JVJA 3OCWA 4Q3LA 1FCJA 2J4CA 3FSGA 3HN7A 5IN4A 4G0VA 1K4MA 3FGOA 4CIBA 5EC8A 1XTJA 2OYCA 4YJHA 2FZKA 4QBIA 4A2WA 5DM4A 1T1SA 1MKYA 2FDXA 4HGPA 2QX4A 4IIBA 1NX6A 2DQKA 1FA9A 4R51A 5DM1A 3OQMA 2IW1A 3OF3A 3UJ6A 2JA1A 2HQSA 4DXAA 4BTLA 2OXCA 2VLBA 3KYBA 5ALJA 3U4MA 1H4TA 2HK9A 1MQSA 3K0FA 6PFKA 1NQUA 1OVMA 3WL6A 3ZE9A 4Y1EA 5HGXA 5TPWB 4B81A 5FBLB 4Q3EA 3TSWA 2JJYA 1UFVA 2AQ8A 2BCEA 2CLOB 2W7TA 3TH5A 3VPCA 3O1LA 1I2DA 1GG5A 1C4XA 3HP1A 1CULC 4Z4FA 1JQ3A 2O8FA 1ZOPA 2XGGA 2YX1A 1ML4A 1TFUA 1TVEA 2DFPA 2OGSA 5EYPA 3TZEA 4IXNA 5FCDA 1GQFA 3N2GA 1XD9A 4LZNA 4JYAB 1F14A 1DC4A 3RIMA 3ZJVA 1SC4A 2CUZA 3OE1A 1FMLA 3QLUC 4RKEA 1BW9B 3GCGA 3PEFA 2OCIA 3GRCA 4MB0A 2BFFA 5F76A 4DWVA 2XUOA 2Z4TA 1MIOB 1CUVA 2IRWA 2ZT8A 1PT6A 3IMCA 1R0LA 2ZUCA 5CA0A 1JG6A 1WIWA 3EOBI 1XVIA 3H84A 4XVUA 2QU8A 2XNDD 5HTKA 3RBXA 2VRCA 1IAVA 3W2EA 2RE8A 4MWBA 3WMEA 8ABPA 3FNHA 2IY8A 4J3JA 2XUGA 3TCKA 3KTAA 1SVUA 1M2WA 3E9QA 4GWKA 5AJHA 1DBSA 2QLFA 2E49A 2XB6A 4JA0A 2A1TR 1BS1A 2B7LA 1M73E 3ET5A 3FMFA 4V0MA 4EPTA 4AKHA 4CL2A 2BTQA 1PYDA 5BMVF 1B2RA 5CHEA 1PR3A 5DKFA 1NF8A 2DAPA 2H63A 2J9XB 2DWUA 2AX3A 2WZBA 3I92A 3ND6A 4YI3A 1FBNA 3T52A 3TD9A 3TDKA 1QH9A 3R76A 1YJCA 1E96A 2W98A 3C6BA 3LPAA 3WO1A 3U3OA 1U0HC 4IIGA 5BRNA 5P8WA 3TTSA 1J5EB 2JL1A 1FE8A 1RJFA 3CWZA 3L7KA 1AQ6A 3LDGA 1WDLA 3CISA 4G25A 2WT9A 5EJ6A 3U19A 1I4TD 3Q9UA 5K0JA 1H6DA 5HRUA 4Z4GA 2EFCB 2O8CA 2C2XA 4KXUA 3CTPA 4S35A 3KVYA 4B0OA 5SZHB 1D04A 5JH7A 4BZPA 4HRXA 3EWIA 5A6SB 5C8YA 2EOAA 3F0TA 3L7AA 3CKKA 1WW2A 4EW3A 4EMTA 4JUCA 4LWPA 4DY6A 1HDZA 5JNVA 2JANA 4CM7A 3ZV6A 3ZLJA 2Z3WA 1LVGA 3U5ZB 1JA9A 4LI0A 3WK9A 3P2JA 2PJRA 3V6LA 4DGQA 4JC8A 4MCIA 4NV3A 4D6XA 1NJ1A 5JVDA 5IK2D 3I9LA 4PM4A 4XDGA 4HB2A 1EFPA 2ARKA 3VAZA 2Q4RA 1QE3A 2R96A 4BFVA 4DA4A 2UUAB 2YWRA 1UJCA 2GT1A 2CMFA 3C3JA 4FBMA 2PGLA 3LC1O 4HDNA 3B6EA 3HB1A 4HDKB 4L4ZA 4PSKA 2HHJA 3C6XA 4R2JA 2P4QA 3E48A 5BMVB 2WHXA 3UUFA 1KI9A 2I78A 3S40A 4D0NA 1N6IA 2R6CA 4B82A 2I3GA 3QM1A 4M8IA 3DBLA 3CRQA 2NXWA 3GEGA 3LLUA 1ZA2A 3QKUA 1U4NA 3G5MA 4L7QA 1H1DA 1VIYA 4W1QA 3D6VA 1MC8A 5TQJA 4N7BA 2PL1A 4EHHA 7REQB 6NULA 1RE0A 2XEXA 2ZAYA 3QBVA 3ES9A 4FFOA 5C46F 1NFFA 4XIJA 4JLAA 4RFSA 3ZVRA 3KVVA 1FIUA 1CTQA 2IOYA 2QTRA 4E7PA 1OHHD 4M1KA 3AJDA 2JIPA 1G2PA 3NM6B 4A82A 2XYPA 1YBHA 4B09A 3HBFA 2AOXA 2NO1A 1VDMA 1XEFA 3A6KA 4RBNA 5ALXA 3WQRA 1KY4A 5B3JA 1XELA 2V7QD 1BDIA 1XZEA 2YYAA 2ZLBA 1U8YA 3Q98A 1Z47A 1N6HA 4JLSA 4W7SA 2G0NA 2I2CA 5CW1A 5EZYF 1Q12A 1WCXA 5H5JA 5KQPA 3UNXA 3A3OA 1ZMRA 2FCAA 3D0QA 1UDRA 3RTBA 3C74A 3L9XA 3N39C 3SXUA 5A5DA 1NATA 1VKNA 1VMEA 3QWHA 4E51A 1DKUA 1ONBA 4DM4A 5L3ZA 2IS6A 4LCBA 3TNFA 3ZCQA 1HTTA 4GE0A 1E5LA 3E5RA 4Z6KA 1KAMA 3A4IA 1NAHA 5EMMA 3AC0A 1PZFA 4QUIA 2YH2A 4UCQA 3LX8A 3CY6A 1VJRA 3DEAA 3KR0A 1A82A 3PPIA 3P97A 3HV0A 4MV0A 4OIFA 4RV9A 5EXDA 1SXQA 3IAUA 1WU8A 4XYGA 3HNOA 3PI6A 1I51A 5A1TA 4BASA 2P8JA 4JNCA 1G8SA 3IPXA 3SIRA 4C20A 1TNDA 1WHTB 2F1KA 3D9QX 3N58A 3R5SA 2ZOSA 3GUZA 2F9MA 5FWDA 3BDVA 1Z0SA 2DJ5A 5LYYA 3SXPA 1JS1X 5I4BA 1V41E 2BRUA 1LRLA 2R6GA 1HX7A 1OVGA 2REQB 2Q5JA 4GBMA 4IQFA 3G0CA 4XX0B 1Z0AA 5FO0A 3QVWA 5CCXA 1ODIA 1XD2B 4URUR 2YWGA 2E18A 3CG0A 3AY0A 5J59A 4FM9A 1FQKA 2C4UA 4RV4A 1YL5A 5KTNA 4IF6A 2WTUA 1R8XA 4H1VA 4TWBA 3A2KA 2XF2A 3AOGA 3GT7A 5JANA 1A7AA 1CEEA 5FBHA 1GNPA 3GNTA 3NYWA 2RBEA 3MS2A 4K9LA 4JP3A 5BSVA 1U7DA 2NZ8A 5JEEA 4E30A 5EZYB 1OFTA 3SHTA 1P9RA 1CY2A 2HMSA 2HWXA 4IO0A 5ALYA 4PAGA 4CLOB 4YRBA 3WL5A 3QOWA 4F5EA 3HYLA 2W6ID 3JQAD 4G5XA 3TW8B 4MHTA 1EFUA 4BLWA 4BXOA 3GOQA 3M4XA 1F0PA 1YO6A 2GD6A 1OCEA 3FHOA 4TXMA 1CUZA 2GPAA 4CCWA 1JQEA 2FVYA 5BWCA 1C7JA 4TQGA 3BF8A 4ERNA 3MQFA 1OXXK 2G0TA 3GNQA 5T41A 2WJPA 1E3WA 3STTA 5BV2P 4L0MA 1WDWB 5AW9A 4LIPD 3AEKB 3PLRA 3RVSA 3NBXX 1V25A 2FDCA 2A4MA 4K3UA 3C1AA 4OP1A 4P2GA 1TF5A 3ZIAD 4W8HA 5DM2A 2PMCA 2B82A 1KZHA 2P11A 3FVQA 4LY6A 1NLYA 4JT8A 3U4IA 4W5JA 4UHJA 4LJ5A 1IC6A 4ETNA 5DHFA 1HLGA 4MIEA 1DIBA 2MSNA 3M2TA 1GDDA 4KQ6A 4E2ZA 4YAJA 5K03A 2CLHB 3AFNA 3QMWA 4JI6B 3K0SA 2ZT5A 1UAGA 2ZS9A 3ZBQA 5CDHA 1PS0A 2ZEJA 2X2FA 3GPLA 4OJQA 3B6JA 2HF7A 1TRKA 2PSFA 1X38A 1PCXA 1OYWA 4IWNA 3L1IA 3E4DA 4P7GA 2ZUTA 4A15A 1EK5A 1HZZA 1DKQA 5KJEA 3GAFA 5FDFA 1W52X 1ZIYA 5K0BA 1AKEA 2X8JB 4FJ1A 4G0WA 4ZTUB 2EGGA 1XNRB 3I0NA 4UD2A 4BRSA 4IV0A 3LHKA 1J2UA 3T5GA 4H60A 3F2IA 4F6LA 5EXSA 1JSCA 3RI3A 1AQLA 1Q21A 3MWDB 3TQFA 3O1HB 3W3AD 4E4YA 1CPYA 5JPCA 2G0AA 2OO5A 3KT6A 1QHGA 4RTSA 4PPNA 5A62A 3QEBZ 3AM5A 2JLUA 2RAUA 2P0EA 1L4HA 3IUJA 3CE6A 4F72A 5F4ZA 1IXSB 4LNHA 5FX2A 4RTKA 1DE0A 1Z2CA 2OHXA 3ROPA 5BP7A 3PKJA 1NUSA 3R5TA 4CGZA 4PCVA 1IY9A 1P29A 2FQYA 3MD9A 3OPYB 1GTSA 3E9ZA 5E8JA 3RADC 3E18A 4C7VA 3C3BA 4RK7A 1XE3A 3KPYA 4WJZA 2CGEA 4TZKA 2NZYA 2DLCX 1RWMA 1U0GA 4EFLA 2EHDA 2M9MA 2FDRA 4KQGA 4MGZR 1XTSA 4V1CI 1H5QA 1NJ8A 3V4LA 4AZSA 2EZ9A 5LXTF 3TFQA 1WQ3A 5BSWA 5J43A 4DJDC 2NU9A 4GM0A 4X7RA 1MEJA 1ZG3A 2QZ9A 1NVDA 1V9CA 2LNDA 3PK0A 4LDPA 4PLPA 4S1VA 1ZK0A 4WASA 4OD0A 1Z7YA 3IILA 4Y6LA 1DWUA 1IB0A 4D99A 4RK5A 1RS0A 4PS0A 1GTRA 4XAQA 3ZE2B 1CQZA 1EZ4A 5F73A 3R09A 1TX4B 3CM0A 3W9UA 2NIPA 4G5QA 3BTUA 3DFZA 3I9FA 1S3IA 4NDZA 4DANA 2HNKA 1W0KA 3GP5A 5KJFA 3IUQA 1B7GO 3E7XA 1FJ2A 3U09A 1U6IA 3UA3A 3SKYA 1Z12A 2JZOA 1FNBA 1T15A 1KSGA 3WNVA 3IR7A 3CH5A 5LNK1 3KEQA 1TFRA 4GPTA 4CIYA 1JDBB 2N3ZA 4KQIA 4KXNA 4QWWA 4WNAB 1GNTA 1SCBA 1J1IA 4RM2A 4JBNA 3CRZA 3UBTA 4DR7B 2DWPA 2ICAA 3PQEA 4QEKA 3OJFA 3V8MA 3DFMA 4G4GA 1E9RA 2QX7A 1E8MA 1OI2A 1W44A 2FW7A 3GUCA 3NJRA 3CWCA 3W6NA 5F21A 4V0RA 3MJVA 4Z1MD 3MWYW 2H4WA 3EARA 1RXVA 1BC5A 4KYIB 4QOHA 2CCKA 1PD0A 5HE9A 4P81A 4ITUA 1THMA 1V6SA 3OMLA 2VWGA 4NE2A 2WM9B 4WXEA 3DF9A 1MU0A 3DTVA 4LV8B 4TX1A 1XFDA 4UVEA 1XAJA 3F2VA 4TTRA 5LXTB 1XCBA 3TLAA 2P2DA 4JR0A 1JLLB 4LISA 4G86A 3I62A 3KB2A 2G9NA 4Z5XA 3Q7SA 4BKMA 3WL8A 2VIIA 3MM4A 4Y2RA 4AU1A 5M34A 5EAIA 2FN9A 2JFHA 3DV0A 1R9GA 1OY1A 2GZRA 2JA2A 2ZROA 3BGIA 3KXPA 3WSVA 4ZO6A 1Y9EA 2Q45A 2AZ4A 5HCIA 4B44A 4CG0A 2GX6A 2O3TA 2A0FA 1D07A 3HG7A 1W4BA 4NECA 2IXBA 3GEMA 1HMPA 3B6KA 1QQTA 3GK3A 5I7WA 1SXJC 4ZVTA 3USES 1YZVA 3KYCB 1BMFA 1K6IA 4TZTA 4NENB 4NL4H 3UGTA 4BFUA 3VI4B 3OTHA 4Z4CA 5G41A 4Q9IA 3BXFA 3FUUA 3WGHA 1YNOA 1SCQA 4H7JA 1W4ZA 3OLYA 3ZHYA 2HRBA 4IINA 4GW3A 2F8TA 3ESZA 2OCYC 4Q3NA 3ZZ1A 1JHRA 3U0BA 3L0CA 5DX0A 3HJHA 1UQTA 3JU3A 1XCGB 4ZN6A 1LSJA 3BULA 5G1NA 1E0JA 2QE7D 3Q2KA 1TZJA 3MELA 3QBTA 3SOZA 4KFTA 3DAHA 3VKVA 1P17A 2DPLA 3BFKA 2F43B 4DIEA 2X7HA 1NN3A 5AKEA 2BMFA 5IUJC 2BFOA 1CUSA 2QKYA 2QXUA 5K0TA 1YB1A 2BHSA 1B1CA 4KSYA 1UJNA 5J23A 3OO0A 4QECA 3EQ9A 3MJTA 3JD1A 4JP8A 5BVGB 2OKCA 2VJQA 3P4UA 1KEKA 1J21A 1KVRA 3V8PA 2WFLA 1XZQA 3ZWXA 1WPGA 4H7KA 1T24A 4MDFA 1I30A 3I9JA 1J9EA 2HMTA 4H1UA 1H0HA 3C24A 4IOKA 1BVYF 2G63A 4CLHA 5IF9A 1YA8A 1P72A 2J7PD 1OBVA 5DK4A 4E5YA 5E9WA 3FOBA 2IUFA 2DERA 2C95A 2VG8A 1WTAA 3PZRA 1OPXA 1W581 5BW4A 1AQNA 1FW8A 3AP2A 4KXVA 3WSTA 3FA2A 3B2QA 1W4AA 3RUAA 4LE2A 3OLVA 4PC2A 4ZO4A 5IZ4A 1QHYA 1ZCAA 3HA7A 3MFYA 4WY2A 4FHEA 1PGQA 2QDKA 4N8EA 2XQIA 1ACLA 1AKTA 1NFRA 2CXXA 3AR9A 1HRDA 1BN7A 2ET6A 1TA9A 3X3HA 5FA8A 5HIKA 3QA3E 2GJSA 3PNQA 4G5YA 1E8DA 5EZ6B 3GJ8A 4I1SA 2RGAA 3MRTA 4UULA 3BMQA 3IQXA 3WKBA 2P68A 4YROA 4AKTA 1F8FA 2CVPA 1UPXA 2OBMA 2RGBA 2XQVA 4X85A 4AECA 3S1LA 1U8AA 1PSDA 1YJ8A 5KYXA 4I3HA 2VDJA 3NB0A 4BNZA 4BNFA 1J6UA 4IWXA 4LXHA 1QV9A 3CN9A 4K5QA 5EWLB 3DFUA 5DNCA 4FKBA 4B84A 1EESA 3HCEA 1BXGB 3GH3A 5CLGA 2NU8A 3FUTA 4H0FA 4RF5A 4WK0B 4F92B 3QPWA 3I3SR 3CR7A 2Q27A 1G5TA 2IZOA 1N2HA 2JPDA 3PGA1 1MAAA 4GI7A 1PR4A 4YBRA 5AK3A 2JLXA 3PE4A 2CL6X 2Y1WA 1AHIA 2RHLA 3D3NA 1FYDA 1Z2DA 2XCSB 3AL2A 4MTLA 2PRYA 2ASEA 3NUQA 3DZFA 3FDZA 4P34A 3DE2X 2B99A 2YJNA 1JDNA 4AMBA 1L7OA 5E3HA 1TK9A 2C5FA 2XVZA 4N5HX 2B4YA 3D8UA 4Q4DA 3F1KA 4YAWA 1KJWA 1DARA 4L57A 1ADCA 4PF1A 2D4HA 2R7LA 3B1WA 4QLOA 5T4EA 4BJ6A 1I1HA 3RC8A 1W88B 3IP1A 4DQ0A 1OYOA 3HP7A 2FWAA 3LHSA 4P4SB 1P74A 1X7GA 1C8VB 4LXIA 4IJQA 1MABB 2NQTA 2W6OA 3MTEA 2DHDA 4BEVA 4DCCA 3WAGA 4TZ0A 3NIGB 1GZSA 5GIOE 3NMUF 3PQ8A 4HZUA 1ENZA 4TUYA 3ORRA 1A5TA 1PS9A 1QO0D 1SRRA 4MEBA 2NVUA 1QBKC 3PTZA 3R6LA 1SQFA 3ASUA 4PYRA 2AWNA 1T2NA 4UUQA 4ACAA 5IULC 2XZDA 4L3WA 3LY5A 1IXKA 2ZYWX 2WU8A 1W36B 2AFHE 1IOLA 1UXOA 4DV3B 3CNNA 3IBCA 4O4LB 2C84A 3OOWA 1ETHA 1M2VA 1J56A 1C2TA 1QCDA 2G67A 2NSYA 5KYUA 3ECAA 4EB3A 4LJ7A 1GAEO 1WD7A 4UBKA 2EP5A 2YOHA 2YQ5A 4MS1A 4Q9DA 3KXIA 4AZ0A 1VL6A 1RXEA 3PXCX 4BUJA 5CFNA 1D09A 1KJYA 2CLFB 1NVGA 5HFJA 6LDHA 3IXMA 5LA6F 2FEMA 3HSKA 2BEUB 1FX0B 5AK6A 1L5HA 2GJ8A 3ODGA 1SBIA 2HGZA 3ESXA 5EE1A 4F6CA 2BCGY 1XO1A 1MG0A 2WDPA 2BMVA 4PYLA 3B5EA 4RIIA 3JV7A 5FBZA 1ZVMA 4FNAA 2WB2A 1VPLA 4LRSB 5AJUA 3D8HA 1HNZB 4ES6A 2E87A 2P5TB 4GRAA 3WDKA 3ETJA 4DBLC 4GKKB 2XE8A 1DQSA 3EIEA 4IUCS 4NX2A 4G8JA 2WJVA 1GPKA 4U00A 5CG2A 1RABA 3RJTA 3UG7A 3W1EA 3RVKA 5GTDA 3ZE0B 3H6KA 4RETA 5F5NA 4C7MA 4QU8A 3JAWB 1DJQA 2I6UA 3AR7A 4E46A 5IXSA 3LOPA 1S2GA 3T7EA 5KWEA 2H4ZA 1B26A 1FPMA 3MT8A 4ZAXA 4A2PA 3C0KA 1HNWB 5HFAA 5JYDA 4OBBA 1Z5PA 2PZGA 4FBLA 4UUMA 1Q0LA 1AB5A 1DLIA 1ZL0A 3JQ8B 3WO0A 2EDAA 1L8LA 3EQ8A 3PHGA 4DF3A 2ZYUX 2G8LA 3GGGA 3GJ6A 2Q7OE 3T0IA 4X95A 1C9YA 1V4VA 3TZHA 1RBYA 4ZOLB 2GAIA 5TIIA 4G8DA 3VC3A 4IJUA 1DL5A 2QJRA 3UHFA 3HJFA 1C3VA 3ACCA 3NBYC 4CM9A 3D4OA 3W3AH 4L5CA 3PVZA 4L72A 4GUDA 3RWOA 2PQ2A 1W85B 2OGZA 3ITKA 4WKOA 3N8GA 1VSQA 3AJRA 2QAGB 3P0RA 5BN3B 1T9KA 2HJWA 1IBLB 3WGLA 2FR0A 3N59A 3IHLA 1QB7A 5CTAA 5G0UA 1TC1A 2WIGA 4QT0A 4RC9A 1SVIA 2CDAA 2DVMA 2H3EA 4M88A 1P5ZB 2P79A 2QQFA 4OP2A 4U2CA 4YWJA 4BBJA 3KSBC 5T67A 2DPGA 3DZIA 1SUSA 1B0AA 2G4VA 4W9NC 3ADPA 5HF8A 3RAFC 1E1CB 4LJKA 5E7QA 4JCOA 1JTEA 3AOEA 3NPAA 2VJPA 4UQLA 1O89A 4ZODA 1QYIA 2YHIB 2ZBQA 3LYUA 4Y9SA 4ZT5A 1MOSA 1XDDA 3F4BA 3TRHA 1DAFA 2MR6A 4FLMA 4H7IA 1QOPB 4KR7A 3HBLA 1RJDA 3QE9Y 3AI7A 2PMWB 1Z0DA 2ZWPA 1BRMA 5DASA 1OBOA 5K6AC 2IZ7A 4EB0A 3B82A 1BH2A 1XZLA 2ZKLA 2ZTSA 3QQ5A 5DGIA 3ED1A 5JS6A 1X2EA 3HDQA 3ZZUA 2WD8A 1PN3A 3NM5A 2G7MC 2YOGA 2HUPA 5KSZA 4M1QA 1NDHA 3W2FA 1DO8A 2ZTVA 1IB6A 3TX6A 1PW5A 1ZSYA 2ZQ5A 2GGSA 1PE0A 2ORWA 4XKJA 5DGXA 5FL3A 1CNMA 3HN6A 2UYGA 1G20E 4YIHA 1W7AA 4E22A 2GEJA 1SNYA 3R6DA 4NCNA 5DSXA 1JH9A 2NUPA 1JSZA 3JAKB 5IEJA 2VPTA 3MTQA 3HCCA 4HEJA 4NCJA 4WIAA 2O19A 5K09A 1JFFB 4RTPA 3C3CA 4RHFA 4HGYA 5B7GA 3W5CA 4HQ0A 1MC4A 1NPYA 2QJOA 1E2DA 4HUQB 2PH1A 2J87A 1NOJA 3ROZA 3BA6A 2AH5A 3MMXA 5TMPA 3BIOA 3EEYA 3QKIA 3TLGA 4OA5A 5JO0A 5FIUA 2IUYA 1RZRD 2W2VA 5FI1B 1L7EA 3AUUA 1RXWA 2PRKA 2C7OA 5U1PA 1MRNA 1KVTA 3IVGA 1OXVA 2N42A 4FYVA 4B40A 5JJLA 5C5CA 3R0ZA 4WBNF 1T4GA 2QTNA 5HJ2A 2Z1NA 3MAAC 4XB1A 3HJGA 2QU7A 4EO9A 5JR3A 4CQMD 4BV2A 1P2DA 5CMLA 5CLIA 2O8NA 4L2IA 4M60A 4OAOA 4LGVA 3OH8A 2MYTA 3Q1LA 3VTKA 1PT8A 4BBAA 1CF9A 5HF5A 5BOSB 1T26A 3EEBA 5IC5A 2E89A 3W8RA 2YUIA 4MV7A 2AKEA 1A77A 3DS8A 3GLKA 3AFMA 4PR0A 2POCA 4DBVO 2ZRCA 4ASUD 2Z98A 3DOCA 1KZ4A 3W9BA 4PNHA 5JBIA 1Z6PA 2UXDB 1U0OC 1EX6A 3G1TA 1NI3A 2DBVO 2ID7A 3QU2A 4JKOA 5FI0B 5DSTA 5DHUA 3MN1A 1KZ9A 2UVPB 4EJ2A 3K9HA 5KNBA 4C88A 2ECKA 5K6RA 4D3ZA 5DF1A 4JXJA 3PNYA 2C0QA 1HK7A 5AVOA 4QYTA 3LRXA 2MMGA 3T1YB 2A3NA 2QJFA 1WXIA 4QXMA 4D9CA 4M87A 3FAZA 2Q3LA 3VR0A 3DZCA 5JSUA 3UMJA 2WAMA 4CEJA 4NARA 3KLPX 1O9BA 2RD2A 4NYIQ 2JIRA 5HZHA 1Y9AA 2JJMA 3VPBA 4JLKA 2O0MA 4IMIB 4NFHA 2F1JA 2C5BA 3ILHA 2XNJA 5D3MA 2HRQA 4KOAA 4TLLB 5MGBA 4J3FA 4V0KA 3RF7A 3FCYA 5LC1A 3WVNA 1B8OA 1U2PA 4EHKA 1C3EA 2NV6A 1FU4A 2Y9MB 4X64B 2IXFA 4C0WA 4WBNB 4C5AA 2ZTLA 3NUZA 5KTYA 4JH0A 4N3CA 2WMYA 1JSXA 2XUIA 1SU4A 1LI5A 2V7VA 4UHHA 4RDXA 4JC5A 2WJZB 1CRQA 3AUFA 4XLZA 3WRYC 3G9UA 4F4JA 2C3OA 3JZMA 4NYIR 5FAKA 1V7QA 2HGSA 2MSDB 2Z83A 3EFOA 1ZGCA 3PSAA 3G2IA 5DI3A 4L6AA 4G01B 4ME6A 3II6X 1AGXA 1IEVA 1I4OA 3HI6A 4ENRA 4GSKA 3TM5A 3UGKA 1R5BA 5BQ5A 1T5HX 2CHQA 1NV8A 1SBQA 1GCAA 2WWXA 3Q7RA 4UDYX 4EVQA 5JASA 1MA0A 3SLRA 1H9BA 2R9VA 3WNZA 4JVSB 3I83A 3T34A 3TZLA 3UY4A 1SB8A 1TJ4A 3L1UA 4H2DA 4KIGA 5ECWA 5J40A 1E5XA 1TMYA 4ZDIA 5B6PA 5HM8A 4WZBE 5D01A 2RHDA 2Q6TA 3G1WA 3GXOA 4RK1A 2NTEA 3EGXA 3H19A 5E6RA 2C4VA 1NW6A 3BGOS 4UDXX 3OZBA 4D8YA 1V1JA 2PWZA 5IC6A 2V4ZA 1G4UR 3P5BA 5TLSA 1CZLA 4BMOB 1VMDA 3H4MA 3R5KA 5KCZA 4D8TA 1PKXA 4R2WA 2R47A 1BYUA 1X92A 5TMBA 4CLXA 3TR0A 5KVAA 1AXGA 4QQNA 4MW7A 5JRJA 1REQB 4KLRA 4HUJA 3GLFE 1ZD4A 3PCXA 3EAGA 4FIZA 4J91A 2VT2A 4JOCA 5I7HA 1DRVA 1JAYA 1ZHHA 2C94A 1EFRD 4U7PB 5EP1A 2HLPA 2Y1LA 3GRKA 4WNYA 2QRPA 2AXEA 2VWQA 3H4VA 1Z73A 2WZDA 4WVFA 1NY6A 2XT0A 2OAEA 5BRAA 4WINA 5DI9A 2H6EA 2AW3A 3KSZO 2CVOA 2PQ6A 3MGCA 3BD9A 4BNJA 1AF7A 2BUAA 4JK3A 1A96A 3FPLA 3E22A 4LRXA 1SXHA 1V4NA 4I1UA 4OKNA 3A4YA 4D1YA 4AO8A 1QKKA 4P3OA 2QLBA 3GLHE 1COZA 1N1EA 1DJOA 2O7VA 1A27A 3H1AA 4G85A 1FUUA 4Q4JB 3IVAA 4LX0A 3SJCA 3TR5A 5AKZA 4M49A 4Z3KA 3R75A 2CLEB 5KDOA 4IEFB 1DQPA 1APBA 4AQYB 1XCOA 2GN8A 4IHKA 4HXFB 4NULA 3R7DA 4BPRA 3ZCPA 1HNNA 2PT5A 1T9GS 2YWEA 2ZREA 3FMOB 1FOEB 4ISCA 1ULZA 2ORVA 4ZVPA 4EGAA 5GOZA 1Y5RA 3JWIA 4ZOAA 4EK9A 1JSLA 1GV1A 5C37A 5MGNA 3T99A 3DL2A 4QULA 4ALKA 1KP9A 4HSEA 5LNK6 1KYYA 4DR1B 4ZOBA 3V8NA 3IPCA 4QRIA 4WLUA 5CRIA 4BVFA 5IC4A 1WL8A 2EQAA 1ESDA 3NHZA 4G1EB 3T3HA 2AOUA 3ZWOA 3PVSA 4YRCA 3BE8A 4EG1A 2YXLA 4MS4B 2C4MA 3LKZA 3KRTA 4MUIA 2ZRAA 3R9WA 3K8ZA 3IVCA 3AKDA 1L5VA 3O95A 4I8DA 3S2EA 4CCSA 4QAQA 1FNSA 1Q1BA 2BM9A 2N46A 5C2JB 3L8CA 1S89A 4XQ9A 1FNMA 1YI0A 1J8QA 2CNOA 1D4FA 3NALA 2PSJA 3MCUA 4HLNA 3CUWA 3UJBA 3DR5A 3VOBA 3VU3A 5LOVF 1GQYA 5A7HA 1O0BA 1RQPA 4G5OA 1CUEA 2GLXA 2MINB 3HXQA 3A7EA 3RYFB 1JAHA 3J81A 3OI7A 2BR3A 3R7SA 4WCFA 1S7GA 4U0JA 2X0IA 2O5CA 3Q5GA 3T41A 1KHTA 2EERA 2NSJA 2PAAA 3CLHA 4QATA 1PI3A 3BC1A 4NAHA 3MCVA 1C4KA 1Y8RA 2Y68A 3M9WA 5KAMA 4RMHA 3CQ9A 1M2OB 1M0TA 2J3KA 1E7YA 1IUOA 2IPMA 2VHTA 4M1YA 4YCBA 4GHWA 3MD0A 1AMUA 1YS4A 3KQMA 5IJXA 3D7MA 3A1UA 4INOA 1TCAA 3FVVA 3M1YA 1E77A 3O47A 2ZB4A 1OIXA 4L07A 1ZH4A 4RTQA 3CLKA 1TYZA 2A5FA 2D8AA 3TQOA 1T0HB 4M1OA 4RX1A 4ER3A 1RFGE 2DUJA 2ZJ4A 3BCSA 4J1TA 1ZHFA 3WE7A 1PR5A 4PGAA 3GEPA 2MYNA 4QOJA 4Y2SA 3V7WA 4IMJB 2PS3A 1YDEA 4AO6A 3L3BA 4QGBA 2CK3A 2WHYA 5LMZA 4P0QB 1JLKA 3QU9A 1XQ9A 4PG4A 2BEJA 1N8TA 2RAPA 3E2MA 4NS4A 3V8QA 4V02A 3TN7A 4BX9A 1TW3A 4B6PA 1QC5A 1I13A 1N9GB 2Z4SA 3RIYA 1NMZA 3BD6A 1TIKA 2O20A 4FMCF 2AA3A 1CUXA 1Z39A 1EX1A 2AZDA 2C9OA 2PVSA 4NBKA 3RFUA 5F7OA 1GADO 1R8QA 4M21A 3C6KA 4E08A 5AFSA 1Z8NA 3BTOA 3L41A 4PSCA 5JYCA 4UBJA 4PWZA 4YP9A 4FT2A 1T5TA 3LSYA 3UJ9A 2BFWA 3UANA 3VSBA 1KAOA 2BLLA 3HVRA 1QVVA 2BLNA 3M6FA 4RF4A 4PHCA 3Q88A 2R8PA 3PC7A 3PNKA 3G2NA 2BFMA 2AMJA 2W37A 2IGBA 1V1MB 5FQOA 4V3CA 3RUHA 3VKUA 4AK9A 4EKEA 3T7CA 3ZK8A 3PDIA 3GQVA 3ZXSA 2OV1A 4M9ZA 4MR9A 5DXAA 3R3ZA 1DP4A 1TTQB 2EBFX 1OQAA 2Y8EA 4Y0VA 4FFDA 4OB7A 1G7RA 4X20B 3S29A 3GG9A 4AYWA 4BVBA 3OEEA 4BCBA 4FGUA 3E82A 3S68A 3V1KA 4GP9A 2CW5A 3LBYA 4R83A 4B3JA 3M81A 4R40A 3TBHA 2VSYA 4A73A 2ZJ7A 3FSEA 3MC1A 4M54A 1H94A 3W9YA 5B7NA 1NBWB 2WJGA 3T38A 5B1YA 2CNNA 4LZOA 4CCAA 5DLDA 3IEUA 4DV4B 3WHKA 3N8DA 2OILA 4AN1A 3L0ZA 4PZZA 1B2LA 3HFRA 3MJ4A 4EHBA 3TQIA 3KKQA 5ED4A 4DCGA 4KUHA 1SVOA 3GJ3A 5EIEA 1O6GA 2XD4A 1RAFA 2V8BA 4OXYA 1NJFA 1IHPA 1SIOA 2R8OA 5KYNA 1L4YA 4YRMA 4FMCB 4NFYA 3K1TA 4IZHA 5FOUA 3INGA 1OWPA 4NV1A 3NDJA 1P1BA 1XL1A 4J49A 1ZESA 3GRPA 3ACBA 4CQLA 1LPOA 2QQEA 3DXFA 5BT9A 1ZOSA 4Q4AA 3GDFA 1L4UA 2JI8A 4PTLA 5D1NA 3G17A 4UHBA 1GUZA 1V5WA 2QN9A 3PHBE 5EGSA 3FDFA 5IAAA 5DTEA 3U4HA 3CNOA 3FHLA 5J58A 3MJSA 2PNJA 2P6MA 2W2KB 3SIPA 3SPXA 4C21A 2OHHA 5CK5A 5IJWA 2HNBA 4HY3A 4QBHA 3KFVA 1DCTA 1NHGA 3D4BA 3L1VA 3WK4A 1E0DA 3FDJA 4Q6WA 2L19A 4PAQA 5FL7D 1U90A 1WVGA 1BFKA 2X5JO 2X41A 4ARSA 3H0KA 4GVPA 3E70C 2OSVA 4JBGA 4PZYA 4R8KA 1L7DA 2RHBA 3DHNA 4EECA 1YQXA 3T4PA 3DZJA 2ODPA 1Z7GA 1OAAA 2PKWA 4P86A 3NIWA 5CCBA 1PZGA 2AEEA 3VNVA 5F3RA 2BKEA 2EYQA 4M8NE 4U7HA 5CVDA 5CB4A 1R50A 1C41A 2IYFA 3CJTA 4YDHB 3ZLBA 3FKSD 1LGYA 1HF3A 2VKTA 3VHRA 4BO4A 1DADA 3B1XA 1CQIB 2VXBA 2H5EA 1LI7A 4FB4A 3WLKX 3WR5A 3UMSA 2H7CA 4DJJA 4DLAA 1KIMA 3TW4A 5AH0A 5KYYB 1KFCB 4LJ8A 1DG9A