5GM1A

Crystal structure of methyltransferase tled complexed with sah
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
281
structure length
281
Chain Sequence
QQQVTADEVGDWYDKFGEVYHLTLGESVHCGLWFPPDAPVPQDMELVTMSSQAQDRYTDYLIETLDPKAGQHLLDIGCGTGRTALKAARQRGIAVTGVAVSKEQIAAANRLAAGHGLTERLTFEVADAMRLPYEDESFDCAWAIESLCHMDRAKALGEAWRVLKPGGDLLVLESVVTEELTEPETALFETLYAANVPPRLGEFFDIVSGAGFHTLSLKDLSANLAMTMNVFALGVYSRRAEFTERFGAEFVDGLLAGLGSAQETLIRKTRFFMATLRKPAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords O-methylransferase
publication title Crystal structure and enantioselectivity of terpene cyclization in SAM-dependent methyltransferase TleD
pubmed doi rcsb
source organism Streptomyces blastmyceticus
molecule tags Transferase
total genus 95
structure length 281
sequence length 281
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R
ec nomenclature
pdb deposition date 2016-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08241 Methyltransf_11 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5gm1A01
1M6YA 3T7TA 3CJTA 4L7VA 3FPEA 1I1NA 3PX3A 1KPHA 1EAMA 5K05A 1JG4A 2CMHA 3LSTA 3UJ8A 3LCCA 1Q0TA 2G72A 2R6ZA 3M6UA 1OR8A 3M6VA 4PYKA 2BR3A 4KDRA 1ZGAA 5DM4A 2E5WA 4A6EA 5DXAA 2ONZA 1ZGJA 3DP7A 3LL7A 4P58A 3RW9A 4HRAA 4YUZA 3LHDA 3DXYA 2V74B 1JG2A 3EVEA 2HWKA 2P3QA 5P8WA 1ZKDA 4CKEA 2B3TA 3MHTA 4KDCA 1NE2A 3O4FA 2PVCA 2YXEA 3A27A 5FA5A 2BM8A 4AUKA 2AOUB 4M37A 3TLJA 4FS8A 3KQTA 1H1DA 5JR3A 3T0IA 3X0DA 1T43A 2GA9A 4ATNA 1RJEA 3E7PA 3SSNA 2Y1XA 8MHTA 2NXJA 3EVZA 4LWPA 4DCMA 3GJYA 5EVJA 5DTRA 3MCTA 3EEYA 5DWQA 3UJBA 3P2IA 4HGYA 4BY9E 1RJFA 1KP9A 3CGGA 1WS6A 3CVOA 3G88A 5DTMA 3MQ2A 4E2XA 5K09A 3ER8A 3LDFA 3CJQA 3ELDA 4PIPA 2LD4A 3C3PA 1XDZA 3C6MA 2YX1A 2P1DA 2AOWA 1KPGA 1KHHA 3HVJA 3ORHA 5GM1A 4BLVA 2NXEA 1EG2A 1RI5A 2ZWAA 4LG1A 1F38A 2IH4A 5BW5A 5D1HA 5EKXA 1IY9A 2OY0A 4DM3A 2PXAA 3THRA 3QOXA 1G8AA 1L3BA 3BGVA 2I62A 1N7IA 2YQZA 3OZTA 4OBXA 4RTRA 1WG8A 3CKKA 3HNRA 2HV9A 4QVKA 3SVZA 3SGLA 3BWBA 4EK9A 3ELYA 2PBFA 5F2NA 1Z3CA 3B3JA 3FPGA 1R00A 1F3LA 2PWPA 4ER3A 2A14A 4B17A 1U2ZA 2XYQA 3OE4A 3FPJA 2ERCA 4PINA 4NECA 3P9IA 1O9GA 1QAQA 3EGVA 1VE3A 1RI4A 4YUVA 4R6WA 3EMBA 5G02A 3UJ7A 2O57A 4OQDA 3KU1A 2OBFA 2QYOA 3GRYA 4FT2A 4R6XA 2V7EA 5FA8A 3VC2A 4YV0A 3B7PA 1L3CA 2AR0A 4FT4A 1L1EA 1L3IA 2FRXA 1EQAA 3R0QA 2PX8A 5EZSA 5FULA 1BHJA 1I9GA 3T7SA 3OPNA 5E8RA 4RTQA 1RI3A 3BXOA 5KS2A 3FPFA 1WXWA 4P7FA 5E9WA 3AXSA 5E2AA 4C07A 5ICCA 2ZCJA 4YUXA 9MHTA 3QV2A 1JQDA 3CJRA 1HNNA 2ZVJA 3OE5A 1VIDA 4GEKA 2P35A 4Y2HA 3UFBA 3G89A 3LDGA 1G60A 2QE6A 3IHTA 3UZUA 4PYJA 1JR4A 1R8XA 3LKZA 3V8VA 3B89A 3DOUA 4PCAA 3KQPA 5FCDA 5HIMA 1WZNA 2QM3A 3G5TA 1G55A 4HGZA 3LBYA 5ICFA 2NYUA 3TMAA 3EGIA 4HSGA 2Z6UA 2UYOA 2ZSUA 3AY0A 4QPPA 2H1RA 2YXLA 5EKUA 4OBWA 5EPEA 3TRKA 5IKMA 5EEGA 4E2WA 1L9KA 3I9FA 3KPYA 4E2YA 4GBED 2HTEA 2WA1A 4O29A 3FTFA 2EJUA 4X1OA 3EGEA 5DRTA 4FGZA 4QDKA 3TM5A 4PGGA 5DXJA 1WXXA 3R6TA 3B5IA 5KVAA 4KVZA 1NW5A 1ORIA 3UA3A 5T67A 4E33A 1XCJA 3KPVA 5LR6A 1SKMA 4IKPA 5EG5A 4MIKA 5EQJB 3DMGA 2IP2A 3MTEA 2Z6AA 4PIMA 2ZBRA 2ZLBA 5LQKA 3DLIA 2IIPA 2O0LA 3O31A 5EMJA 4P7JA 3K6RA 3TQSA 5JUWA 3EVBA 3H2BA 4ER7A 5GM2A 2GS9A 5K0FA 2ZZMA 3P8ZA 1SQGA 3L8DA 4XCXA 3TPZA 3CBGA 3UJAA 1YFLA 5M5BA 4EQZA 1BC5A 3M4XA 3M6XA 2ADMA 2O05A 5C0OE 5GIPE 5EZQA 2PXXA 3PTAA 2PWYA 1QAOA 1XDSA 3M33A 4QQKA 5D1NA 5FQOA 3HTXA 3FYCA 3GU3A 4F85A 4PYLA 1XCLA 1NW7A 3ER9A 2H00A 3P2EA 4AX8A 4RV9A 4QDJA 3G2OA 5DM0A 1EJ0A 5DLYA 5EMMA 5E8JA 1NV9A 5FHQA 2UZ4A 1DL5A 2PY6A 1FBNA 1D2CA 5EEHA 3PS9A 5HIJA 4C4AA 2CL5A 1FJXA 5LQRA 4V0QA 4RVFA 1NW8A 3GXOA 2FPOA 2QRVB 3GCZA 4GQBA 4HH4A 5DX0A 4KIFA 2DPMA 2QRVA 3AWIA 1BOOA 4GC5A 5EC8A 4PNEA 2P3OA 2FCAA 3OZSA 2FK7A 2CMGA 2HNKA 3Q7EA 5FUBA 3GRRA 1VPTA 2VDVE 2B78A 4RYLA 2JHAA 3HVHA 5CVVA 3LCVB 5DRYA 4ER5A 3TR6A 3A7DA 4YV1A 3LDUA 4P7KA 1VL5A 3SM3A 5DPMA 4RVGA 4CKCA 4EKGA 2AVDA 3DMHA 2C7PA 2IPXA 2NP7A 3DXZA 4Y30A 1YZHA 4PGHA 4POOA 1X1BA 5GINE 3WSTA 3P9KA 3R9XB 2XVAA 1R18A 3QOWA 4MHTA 5F2KA 4X63A 4ER6A 5ERGB 3B3GA 3SXJA 4P7GA 2P8JA 2P7HA 4PYOA 1ZG3A 3R24A 5DM1A 2G1PA 2AS0A 3BGIA 3R3HA 1FPQA 3DMFA 1JTEA 5DTQA 4GOMD 4R8RA 5T6BA 4CTJA 5F2OA 4C06A 3FUXA 3C0KA 1NBIA 2AVNA 3DULA 3PB3A 3PFHA 4C05A 5K0CA 2I9KA 4RTPA 1JSXA 2BR4A 3HCBA 4WVLA 1UFKA 2YVLA 1NV8A 1JG1A 4X61A 2IBTA 4OA5A 3HCAA 4FSDA 5EHGA 4YMGA 4EVIA 2FK8A 3EVGA 3KKZA 3CC8A 5ICGA 2Y1WA 3SMQA 1YF3A 1X1CA 1SG9A 1ORHA 3BWCA 1P1CA 1R6AA 3IYLW 3M70A 3P9CA 4FSXA 3SR4A 2ZIEA 5CM2Z 1P39A 1G6Q1 3GWZA 3TOSA 2IBSA 2ZULA 5H02A 1PRYA 4GOLD 3A4TA 2CWWA 2BM9A 3HM2A 3MAGA 1O9HA 2P3LA 2YUIA 3HA3A 1D2GA 4XUCA 3THSA 2JH9A 1R8YA 4RSRA 2ZW9A 4RVDA 5CVJA 3SSOA 1X1AA 4A6DA 2AOXA 4CWAA 2PV0A 2OXTA 3UJ6A 1RJDA 2OO3A 1YB2A 2FHPA 5FWDA 1D2HA 1HMYA 3ANXA 2JHPA 4KW7A 3KR9A 3NJRA 5EIWA 2AOVA 3NW9A 2F8LA 3FYDA 4F84A 3VSEA 5CVEA 1QAMA 2OPBA 3F4KA 1M0EA 3MB5A 3KPWA 3KQWA 5MHTA 2VP3A 4IV8A 4JXJA 5CVDA 1ZQ9A 5CCBA 2PX5A 5EHIA 3TM4A 4IV0A 4M36A 4C08A 3G2QA 1QZZA 5K0JA 3K0BA 3U81A 2C7RA 2ZZNA 3KR0A 5K01A 3KQVA 5C1IA 5C9ZA 2HMYB 3KR1A 5ICEA 4QTUB 2O06A 1KXZA 2CKDA 3PT9A 4KWCA 3REOA 4FP9A 2ESRA 5K0LA 5FTWA 2XVMA 3O7WA 5EIFA 4C03A 2JG3A 2YTZA 4EMSA 5GIOE 4PONA 1XJ5A 5GP1A 1ZHFA 3ELWA 3OFKA 5E9JA 5HIIA 3BZBA 1G8SA 4BLWA 1YUBA 3EVDA 5LSAA 1IM8A 2IGTA 3A7EA 3G7UA 4RTSA 2UYCA 3FRHA 2C7QA 3LGAA 4LECA 5DT2A 4F86A 5LQCA 4X41A 3BKXA 5HIKA 4GF5A 2ZIFA 3KR2A 1FP2A 4E30A 1TW2A 1AV6A 3D2LA 2JHCA 5K0BA 4R8SA 2PJDA 3HA5A 3NDJA 5DX1A 2I7CA 4PYMA 3BT7A 1X1DA 2ZWVA 4DKJA 3G2PA 4DQ0A 1Y8CA 3P97A 2AOTB 1NBHA 1BKYA 3P9NA 1JTFA 2AOTA 2PX2A 5KQRA 5DSXA 3P2KA 3UBTA 2VZ9A 4RTLA 2K4MA 1VP9A 3AJDA 4PCLA 1AQJA 2AN3A 2OZVA 4RWZA 2N47A 3T7RA 2OYRA 4YUYA 2PSSA 1IXKA 4QQNA 1QANA 3BWMA 4XUDA 1UWVA 2ZIGA 4HTFB 4DCGA 4ISCA 2P7IA 3LECA 1VBFA 3IEIA 4HTFA 2JJQA 3OCJA 4DA4A 4PYNA 3FUTA 1MJFA 3FTEA 4RVHA 1RI1A 5BXYA 3S68A 4ZTBA 2OB1A 3DH0A 5K0GA 3NWEA 5EMLA 4MWZA 1V39A 4WXHA 5E1DA 2GLUA 3NWBA 1M6EX 4GOOD 2ZTHA 2GB4A 3ELUA 3I58A 3JWGA 1SUSA 5FADA 1SVUA 4E31A 1SQFA 4U7TB 4DZRA 1FP1D 3LKDA 1I4WA 3KQQA 3IV6A 4KRGA 5DM2A 4DMGA 4U7PB 2BR5A 5KQSA 4RTKA 4RTOA 2ZZKA 3TFWA 3ERCA 5DX8A 3ME5A 2AN5A 2PX4A 5E1MA 4DF3A 3GGDA 3HEMA 5E9QA 2B25A 3EPPA 4OX9Y 5GWXA 4RX1A 4QVGA 1P91A 3FRIA 2VDUE 5CVUA 1VLMA 2GPYA 2IFTA 2OKCA 3FUWA 3G8BA 3HA7A 1AF7A 4PWYA 2NNWB 3BGDA 4C04A 2AOUA 1Q0SA 5FHRA 3C6KA 3DR5A 5GOZA 2XBMA 1YFJA 4PYQA 2B2CA 4QTTB 2ZBQA 3A26A 1DCTA 1XXLA 2FYTA 2WA2A 5EOVA 4IWNA 1X19A 2P41A 4OA8A 1P1BA 3HCEA 3EMDA 1XDUA 2Q41A 3HP7A 3NVMB 3V97A 3OZRA 2BH2A 5FWAA 3UJDA 1YZ3A 3GRZA 5HILA 1KYZA 1NKVA 3NDIA 5E2BA 3LPMA 2JH8A 3Q87B 3PVCA 1RJGA 5LQUA 1DUSA 4AZVA 3M6WA 3UA4A 3LBFA 2AZTA 1WY7A 3ID6C 3TKYA 4EKIA 3KHKA 2G71A 2P40A 3KQOA 5E1BA 2AN4A 4AZTA 1JSZA 4XUEA 3AXTA 5LQAA 3LX6A 2H11A 4RTMA 3MERA 3TKAA 2ZFUA 1N2XA 2G70A 3E23A 3PLAE 1NT2A 4PYIA 1KPIA 1KR5A 1MHTA 3GRVA 3JWIA 5BP7A 1UIRA 3BKWA 1KIAA 4HG2A 4LWOA 5E1OA 4YUWA 1AQIA 3JWHA 3EVCA 1XVAA 2PXCA 3E05A 4E32A 5CD1A 2G8NA 2PKWA 3HVKA 4AZSA 1JQ3A 4H0NA 1R74A 2WK1A 4GUAA 2NXCA 3KPJA 3NMUF 3E8SA 1JQEA 1VP3A 4FR0A 3OU7A 5B1SA 5HOQA 3SSMA 4M38A 1RI2A 5T64A 3FZGA 2B9EA 2R3SA 4KIGA 5DSTA 3GDHA 3HCFA 1EJ6A 3FUVA 3GNLA 3JWJA 4AZWA 2Z6QA 4Z2YA 2EFJA 3BWYA 4QPNA 2IDKA 4BP3A 5HEKA 1PJZA 2GH1A 3FUUA 4R05A 2VDWA 1N7JA 1B42A 4OQEA 2NXNA 5K8VA 3CCFA 3PFGA 4BLUA 2EX4A 3EVFA 3GRUA 2KW5A 3VC1A 2IDJA 5EMKA 3NVKI 2PLWA 4M7RA 2QY6A 3HCCA 5HZMA 3MTIA 4MTLA 4GOND 5FQNA 3G8AA 3I5UA 2O07A 4K6MA 4BP1A 4G56A 3B3FA 4E2ZA 4MQ4A 1NW3A 2UYHA 3A25A 4X60A 2GAFA 5HFJA 3HCDA 2C7OA 2HR1A 5K03A 2PT9A 3P71T 3C3YA 3GIWA 3BUSA 3DUWA 3OU6A 3SX0A 3UWPA 1INLA 2XYVA 3MGGA 4UOEA 1SUIA 3VYWA 4E70A 2UYQA 4V0RA 3FTDA 10MHA 3KQYA 2IH2A 2ORED 3DLCA 2NP6A 4YMHA 3EEOA 2PT6A 2BZGA 1JG3A 2PGXA 3GO4A 2YXDA 3RODA 3LCUA 3UJ9A 5K0EA 2ZBPA 2I6GA 2IH5A 5IH3A 3DTNA 3NTVA 3G2MA 3G5LA 5CUQA 4HC4A 2YR0A 3I64A 3OU2A 2ONYA 3OFJA 5U4XA 3PX2A 5CIYA 1VQ1A 1EIZA 7MHTA 3I53A 4ER0A 4CXMA 2EJTA 5LQJA 1G38A 5BW4A 5EGSA 2OB2A 4FZVA 1XTPA 5K0NA 3KQSA 3FTCA 2VS1A 1QYRA 1O54A 3KQMA 3FPHA 2XYRA 3MCZA 1TW3A 3DXXA 3RIEA 4YV2A 1TPYA 4RTNA 3HVIA 4CTKA 2DULA 1NW6A 5KYGA 5CCXA 3EVAA 4GC9A 3KPUA 4RTJA 4CKBA 1KYWA 5LQNA 2EG5A 3UJCA
chains in the Genus database with same CATH superfamily
3KM0A 4LXTA 4DHWA 2GBLA 1XP8A 1ZMXA 4C6RA 3PX3A 3SE7A 4EG4A 4K2HA 4R40A 1PLJA 4F2GA 2CMHA 3AYXB 5DM70 1II8A 4JT9A 5FOWA 2G82A 1BMFD 2LTAA 3ZNNA 4EYEA 2ACWA 3FCEA 3KJFA 4XRRA 3T1HB 3QOYA 3TINA 1GR0A 1VMIA 5KYYB 3BXZA 5GJCA 5A71A 2FJ0A 4P2BA 5JR3A 4B6OA 4H6XA 4YDSA 5EIBC 1L4FA 1ZFNA 1JEYB 2A9FA 2ADFA 1SCDA 3E7FA 3ETEA 3GELA 3G2KA 3TZKA 1SRQA 3TTYA 5CITA 5LZ9A 3U17A 1U9IC 4LYJA 2VHCA 5CT6A 4QJ3A 2AFHB 2G0AA 4JI1B 3CPHA 2PPLA 4MWSA 2A94A 1GSHA 5B2ZA 1CK4A 2J5QA 3GMDA 1RJFA 2AC4A 2WHXA 4NBSA 1YBFA 4HQ6A 4ZO7A 3RAEC 1X1EA 2C2WA 3MTDA 2P6RA 1BS1A 2AHRA 1R15A 2IEDA 2COEA 5LCXA 4F9EA 2KX7A 3ABOB 4NMWA 1LWNA 4NAUA 4PC7A 4F38A 1B8VA 4CGYA 4BJHB 1XNJA 3DW3X 1F38A 1OUMA 2IH4A 3HY6A 2WG2A 1KO7A 4CEIB 1YB1A 1AC5A 4JLKA 4O4IF 5EP4A 5IFKA 5IX8A 2PXAA 2B61A 2C07A 2FMIA 2O4CA 5I7SA 3BRWA 2OZLA 2HSEA 2Z3VA 2EKLA 1GNSA 4KAXA 1SG0A 1GVNB 1HQDA 3WK8A 1I0ZA 2D7CA 1QM5A 2G7ZA 4S1PA 1T3HA 3S40A 3WTCA 4TYWA 1E1RA 1UT6A 3QLJA 4RGQA 1U3GA 1USWA 4JI0B 3RS4A 1JFSA 3V1TC 5FUXA 3Q8KA 3QW4B 1RIFA 2H52A 1BFDA 2GCOA 2J3KA 1ZVVA 1CNEA 4N8DA 4R6WA 4XWWA 2J9FB 4XWTA 3R8CA 1Q2XA 3L49A 3FNIA 5FRDA 5JAOA 4AX4A 3GRYA 1DAEA 4HTAA 2ZM5A 2Q4OA 2IKSA 3A1SA 4MRMA 4P5EA 4CLHA 1Z45A 2DHQA 4OXNA 3RC1A 2VP4A 2IZ5A 3JQ7B 3LOUA 1BHJA 2WYUA 3SQOA 4RAOA 1PTJA 1A95A 1UC4B 3LC7O 4Q1AA 4MPDA 1N2SA 4JJKA 1P1HA 2BDTA 4I3GA 4GI2A 4C01A 1I5OA 1LNQA 2AMFA 2VEDA 3WRYC 2FWBA 1ZZGA 1U7XA 3PQ4A 1IHOA 3IQEA 3P9ZA 1E2PA 3G2JA 2N3ZA 2E4VA 2P35A 2V7UA 2AF4C 3ZLBA 5E9AA 5DHUA 2CY0A 1A5BB 1TIKA 2QE6A 2NZ8A 4GR9A 4C5AA 3VR5A 5AI4A 1TRHA 5I9MA 1ZGHA 1R5OA 4JIMA 3T3DA 2VTBA 4QRHA 1KMHA 3TMAA 4D9FA 3KUXA 1WKBA 3QFCA 2YIMA 3RU7A 2JKVA 2ZYIA 3TCKA 3WXMA 2QZJA 4J0IA 3ZZUA 5HQ3B 5KVSA 1OFUA 2MMGA 4MQ5A 4MV0A 4DY4A 4FB5A 2I1WA 2VF5X 3K5IA 2R4UA 4CEHA 2FWRA 1L9KA 1ADCA 2QK4A 2H8KA 1UBNA 3I9FA 3P7MA 3QU5A 1NOKA 3TW0A 3VJKA 1QVVA 3H6GA 3EGEA 1EE2A 3STHA 4QDKA 3N76A 2Q3DA 3HH8A 1M2VA 1YAHA 3KXLA 1NC1A 4JELA 3X2SA 2O6HA 1E2GA 5KU1A 5LR6A 1CX9B 3FYUA 3KOUA 4Q6BA 4R51A 4XEUA 1HDZA 4LE0A 4CLXA 2F6RA 2G1AA 2REQB 3KYIB 3WKCA 4LVNA 3KVNA 4KE6A 4PCUA 3F2VA 4X3OA 5I4CA 3DLIA 1PQWA 3U19A 4I66A 3H13A 2GM9A 4REOA 4H59A 3BHNA 4Y2GA 1MR3F 4IGAA 4RKYA 3NHYA 1YUNA 2XRFA 1IRIA 1XLVA 2LZ0A 1IBRA 4XCXA 3A05A 2R8BA 3UJAA 3JYOA 3I04M 4BVLA 1J2TA 3OJXA 3SIRA 1RAHA 1Z2NX 5A6SB 1Z12A 3D8BA 4CUKA 1OH5A 3OI7A 4N5DA 5I9LA 5THKA 4E1BA 1S3SA 2Q5JA 2JHFA 4N7JA 4R2KA 2D00A 3UMFA 2VL7A 4F85A 1NUPA 2Q7XA 3GFRA 3G1TA 1BWQA 2HCBA 5LJLA 4GKJB 1T2NA 3OTGA 5H7XA 4BU0A 3DVQX 2GPNA 3ES9A 3S2GA 1K97A 2J3EA 4KZPA 1WHSB 5DM0A 1MEOA 3AEZA 4YMTA 3DE3X 3DBHA 4U1RA 1PHRA 4D2IA 2AA3A 1RFGE 4HFNA 4LHSA 4WL0A 2SECE 5C5CA 2D5IA 5KHLB 3OURA 4G5QA 5EJ8A 1U94A 2ISCA 1A9XA 2AKEA 1E3QA 2QD1A 4O4JF 4R2MA 5I9BA 1UC8A 1YIAA 3X1JA 4NFLA 3TLGA 1CY8A 4CKWB 4QNRA 1ZRHA 3ZGVA 3EIEA 4MCIA 2V58A 1UJ5A 1ZI6A 2WFLA 4Z4QA 3MRXA 3ZNOA 4DNPA 1XZIA 2AQ8A 3H6KA 1YZUA 1ZDMA 3TZCA 3DZGA 3LCVB 1QU2A 3DONA 3T38A 2GD2A 4MW7A 4C4YA 2QSJA 5F9FA 1E2BA 1X7GA 3IDOA 4F2PA 5KVVA 4LSGA 4LYGA 2HU7A 1V71A 5F4ZA 3ZDYB 2PYDA 4Q9JA 3BOSA 3V4PB 1ZMTA 3WSTA 1TFRA 4HQ0A 1OLXA 2H9YA 4JP3A 4OJKA 2XT0A 4ZAYA 1R18A 5TQ2A 3WFJA 4ER6A 4LRQA 3TDKA 4BO5A 1TOAA 2F3TA 3P0EA 3M5WA 3JQDA 4E2YA 4WCVA 3T54A 2ZJ2A 4LXQA 3VV2A 4DLLA 1IY0A 2PWAA 5EIBD 2QRNA 3JX9A 3LK7A 4UCQA 4ZCQA 1FFBA 1UR5A 3FUXA 2I55A 3NTQA 4K81B 4KQFA 2CJYA 1U28C 4UBJA 4CM1A 2YMMA 3T5GA 6PFKA 5HKOA 3U4HA 3HHEA 3VOSA 1EK2A 2WILA 4EHLA 5JBQA 4HVTA 1JG1A 4Z49A 2AG6A 1HY3A 4YCDA 2DXIA 4YP5A 1X7XA 2GTIA 2X9QA 2F90A 5F51A 3VYTB 3NEYA 5BR1A 1KETA 1TYZA 1DBIA 3F1KA 1FRNA 1KI4A 5EPOA 5AICA 2BGIA 4QDUA 3PU6A 2FMHA 4FI3F 4ZHSA 4CQMB 3GFBA 2ZULA 1EFAA 4L8FA 5CIQA 3I09A 1WM1A 3VH3A 2M1ZA 1YO6A 2QZPA 3CZQA 1Z5WA 2J87A 2RKOA 2XDYA 2VJBA 2GJSA 1KP3A 4N3BA 4CMJA 3A1WA 2P79A 1P5FA 2C2MA 2HNAA 2OBXA 1VCHA 3PRYA 1QGDA 4KMMA 5U4QA 3WV4A 1KAHA 4X7BA 3HXMA 4R54A 4TL9A 1S96A 2RONA 3W1VA 3ZE0B 4B33A 5K8UA 3AHIA 4UEOA 2CSUA 2NO0A 2HLNA 4JDPA 1JYEA 4ZU3A 1GA4A 1ZQ9A 2JFGA 3IQWA 2V7XA 3P27A 1GLGA 2Y6VA 4HYYA 1ZH4A 1BCRB 2EZTA 3IUMA 3HZHA 3WDLA 3ZGOA 3ZQ4A 1PN3A 4FEEA 4LZJA 4C7OA 2BBWA 2JJMA 3DMTC 3K0AA 1PYGA 1SBHA 2JLYA 4RM2A 4M76B 5KNDD 5C9ZA 2F2TA 2OCGA 3FPBA 3OAAA 4QBGB 2ODQA 1JQLB 4FFMA 4GI5A 1CZNA 2Q5OA 2GN0A 4C30A 4FE3A 4A1OA 1PZFA 4KK4A 1QK3A 2F9FA 1R0BA 4OHZA 4KJZA 3LVBA 3MWFA 5FTWA 4BFZA 3DBLB 1N0WA 1B0UA 3ANMA 5EIFA 2YTZA 5IAGA 3ZQUA 5IT0A 2QD2A 4RD6A 2BMVA 1OKKD 2V5AA 3ELWA 1OZHA 4BNJA 4JP2A 4W1QA 4A9AA 1YL5A 1PWHA 1PZGA 3G7UA 3SC3A 2I5PO 4YP9A 3L4JA 3OE7A 2Q46A 1T8YA 4MVJI 3BSFA 2E0IA 4ND4A 4GF5A 3BWXA 1L7QA 4H1UA 2N1MA 2O3TA 4B2IA 1QVAA 3UHPA 1IE3A 3OJCA 3QBEA 1T34A 1W46A 3QFRA 2PJDA 5C8YB 4QIHA 4LSZA 4WZAE 1SR8A 3TRFA 4JEUA 3ZDFA 4QGFA 1P31A 4WOCA 4ZMRA 2IYUA 3KXIA 3CXUA 4MPJA 1RS0A 3TL2A 1ULTA 1LW6E 1TO6A 2TMDA 4BVAA 5KSZA 1FFXA 1FFYA 1TM3E 4MI6A 1N1MA 1ZD9A 3UATA 1E69A 2O3JA 2ZB7A 4HX9A 3JTMA 4JYPA 3H1BA 5JNLA 1WETA 1XTRA 4KH0A 3T7RA 4JUIA 3SP1A 2C99A 3SJAA 4HB2A 4XUDA 3FHOA 4H7IA 3ETNA 1TM2A 2QJRA 4NATA 4TVSA 2R1UA 3RVQA 4JYAB 4M0EA 2WU8A 1N8NA 1P45A 3B3AA 3CZRA 1V6SA 4PAWA 5EIXA 1Z37A 2F43B 4OI4A 3DH0A 5JZVA 3B1VA 4MRVA 4NCNA 4E7OA 1FTQA 4D25A 1MKYA 1CZRA 3I61A 1PO7A 2YZKA 4G8JA 4D9NA 1GUBA 3L01A 4DG8A 3TJRA 2GZRA 4IXTA 1R4MA 4E31A 1SQFA 5D6OA 3M3HA 2HQ1A 3FLMA 4QOEA 5ALJA 1XDBA 1STOA 1ZD5A 4WESA 4C1NA 4B45A 4DMGA 5HSGA 4KQ9A 3SKYA 1NGSA 2RCNA 3KZMA 2CWDA 4XRGA 3SQXA 1RQ7A 2Y1DA 4G0ZA 4EI8A 5IXYA 5JQGB 2V7GA 2DBZA 4JL8A 3CT6A 4JYCA 2M6LA 4LX8A 3QF7A 2JASA 1H2XA 1SM4A 1RTTA 3AUXA 2CHEA 4FIZA 3VSAA 4R9UC 5F3DA 1AH2A 2VR1A 3DAOA 2P6UA 4O4IB 5JSFA 3B70A 4A36A 2R8YA 3PK0A 3WB2A 2ET6A 2FQYA 1Z16A 1Z6GA 1D07A 5F3RA 1TUEA 1UJ4A 2HHJA 3PC3A 2QAGA 3WHLA 1LSJA 1QH8B 1VHWA 4WXYB 3CLRD 5I6DA 2HGZA 2X8JB 1E79D 1SCJA 2R0QC 4M1OA 4AIRA 1A9TA 1NYRA 4JDUA 3H5RA 1CE8A 4HDQB 4AS2A 5EHZA 2HTFA 2J46A 5L40A 1E9SA 1V1MB 4G5XA 4CLEA 3LPMA 4RD4A 2PO5A 2PGDA 1XWIA 1DUSA 1YUMA 1JMVA 3EUEA 3GR6A 3TWOA 1DNPA 3UA4A 4GYYA 2QJWA 4H60A 3GLHA 5C35A 1QQ7A 4BV8A 1R0CA 3CN7A 4NHOA 1E59A 3AINA 2ODTX 1ZOPA 1CSEE 1YGPA 3MERA 3DDHA 4ZT3A 5C8XA 4RTMA 2EQAA 3G5UA 1QTRA 2IQ5A 2RK3A 2VIIA 4PYIA 1Y4AE 1JE1A 5J5VA 1WB6A 1BVYF 3TRJA 3DVLA 3KKQA 4HG2A 1N2EA 3VZDA 4MR7A 5E1OA 4C4TA 1N6HA 2ALJA 1G5FA 2C31A 2D0OB 2VDKB 4M0MA 4ZWNA 3RSLA 3STYA 2AR7A 2ZQ5A 3E05A 3L5OA 4E32A 3GT0A 1LDGA 3I5AA 2H9IA 3NX4A 4YJ3A 4S2EA 2XUFA 4GOKA 1VI5A 5KO2A 1QHGA 4G5GA 3H5OA 2I54A 3QE2A 4HBGA 3ASZA 3F9IA 4PZ9A 3H2ZA 1NG9A 5JYBA 3JD3A 5JD5A 4WN9A 3UMGA 2JAOA 5JNVA 3QPWA 1Z13A 2NTJA 1UBKS 2OK7A 3C3AA 3GARA 5JCOC 4LHWA 3K71B 2AG1A 5BORA 3M49A 2E89A 4WHMA 1CRLA 1N2CA 1GY8A 3AOGA 4RENA 2R5FA 4W9MC 1R6BX 3GFQA 4OQEA 3DF9A 4O2AA 3CB2A 4MV1A 4ZKEA 2KW5A 3F3SA 4DABA 3LO5A 3C6XA 4CCSA 1U9JA 3DE5X 3HCCA 2A3NA 1R12A 3U7HB 4S12A 2G08A 1I1QB 1Z36A 4CL2A 2OV8A 2NSLA 3IEMA 3DCJA 1PW5A 1Y3BE 2AJCA 3L0OA 4G56A 4ZVRA 3UT0A 2H2FA 3GJSA 2DEUA 3DM5A 5HFJA 2CL0X 3RVNA 3KQHA 2PSDA 1XGKA 3DQZA 3VOAA 3ILSA 4ACBA 2WWYA 2HR1A 4KV9A 4TMVA 4BGUA 2B4AA 2J5XA 1DCKA 4XIYA 2C82A 4AYXA 3AY3A 5IBPA 4E70A 3S81A 1K8YB 2FV8A 5ITZB 1XZQA 2DSNA 5IJ9B 1DRKA 1EB9A 1NF2A 3OWOA 1DAOA 4KN9S 4EPWA 2DMRA 1QTQA 3L7KA 3VZPA 3QWFA 1SVKA 4Y0NA 2DPXA 4FWIB 3PQ3A 2CE2X 3H19A 4QPZA 1C9YA 3QK7A 3FDZB 3G2MA 1XG5A 2IPMA 3WKEA 5B3KA 3COSA 4ZT2A 4IQGA 3OU2A 1M2WA 5JYDA 3OLQA 2N75A 4JB2A 4J2TA 1DQPA 2BKVA 3EGDB 5AKXA 5CA1F 2GD1O 2OP0A 4B83A 2Q5IA 1VRCA 1WMDA 5H70A 3TVYA 4F0JA 5HRUA 3IXLA 4YAIA 5EGSA 3SZOA 2I22A 3PXUA 1N9GB 1E3WA 4MO2A 3U6BA 4O4JB 3O47A 4IZHA 3MOIA 3EBLA 5JXIA 2XRYA 4MKZA 4EAQA 1HDRA 1CUCA 2JFWA 5E95A 1NQXA 2D1YA 4F11A 5KB3A 3V42A 3NDRA 3CHYA 5EE9A 7REQB 2EG5A 3Q5GA 1OH7A 1YC2A 2C2BA 3G9TA 3WLFA 1SY7A 4JWKA 1NE7A 3GFVA 3O84A 3J81k 1R4NB 3GAFA 4KQCA 4TTPA 3S4YA 3OECA 4MYHA 4KDRA 3AJRA 4GRIA 1Q0RA 4BNIA 3LL7A 4XASA 5LBUA 1MV5A 3NOQA 3ITEA 3GROA 4Q4DA 4HY3A 4I2NA 1E2DA 3NGLA 4ND5A 4PFJA 1CQPA 3ZE6A 4EKYA 5IRCD 3AVTA 2GAAA 2YXEA 5KYYA 3A3KA 2FQXA 4A2WA 1W4RA 2JD1A 3ROZA 2JIOA 1JR2A 3RRXA 2Z4TA 4KV7A 2OQVA 1FMFA 2Q62A 1NQTA 3IT0A 3NYWA 3ZGYA 3JR3A 5JPDA 2CDCA 1YMQA 2BKAA 2FTKE 2AFHA 3VR2A 1ZLYA 1A9QA 1HYGA 1PKXA 1JFVA 3LUHA 1DKPA 3MLAA 5FOVA 4DREA 2JPDA 5BV7A 1OHHA 2W8BB 4MI9A 5ITWA 1R0SA 2F1IA 3ER8A 4ZEVA 1IXRC 2DH6A 1LLDA 4HXGA 4DWOA 2VJYA 2XV1A 4BTEA 3R76A 4Z7NB 1T5LA 4A82A 2F1JA 5FUWA 1OV6A 1EBFA 2D1RA 2A0XA 1GPWB 3WK9A 3IMEA 3AI7A 1UOPA 3ZCUA 1ETHA 5CEEA 4WNCA 4EFDA 2AH5A 3KOZA 1JIQA 1E0AA 4G25A 3L6BA 4QVKA 2JJ1D 3OPXA 3IR5A 4Z99A 5I5GA 3GBSA 1BA3A 1K8QA 2YZ2A 1U2DA 4BBPA 5AM1A 1ZK2A 2V54A 1KDYA 3I8OA 3UQYS 3QELB 1AUQA 4C4XA 1MW9X 2CL7X 3TW8B 3PFWO 4C0KA 4O8CA 1BOFA 2IQIA 2Q50A 2X15A 2PLFA 1P5RA 3CURA 4DLPA 1CLUA 1GZ7A 2FSIA 4OQDA 3FBTA 4BO8A 3OEWA 4EFNA 1W4ZA 2Z5VA 3R74A 3P2JA 4ZT4A 1C0PA 3EJ6A 1Q3HA 1C5KA 1NY6A 5H4HA 3WGNA 4Q03A 1NIJA 2BONA 1WTAA 3REQB 4OQMA 5A06A 2XTNA 4YQFA 3CWZA 1IM5A 4IIJF 5F76A 3BJRA 3JQ7A 4QELA 2IYEA 3TXXA 1DRUA 2ZU0C 5KWSA 4CM5A 3FPFA 3OO1A 1YIOA 5F52A 1OI3A 4MVJP 4OGFA 3WZMA 1AQNA 2JI9A 1HNNA 1P0IA 3HN6A 3FI0A 4C0SA 2LPMA 1B00A 4EPYA 2ID9A 3IIJA 2O54A 4MNTA 3GFFA 1VZ2A 4RIEA 1VA5A 2ZPTX 2GK3A 2Q8QA 3P26A 2EZ8A 2XE4A 1FUYB 1L7NA 1LK5A 2IZ0A 2Z56A 4PCAA 5JWRA 2ZWPA 3LXRA 1TZJA 4R16A 5DN6D 4UPVA 1G55A 1UEJA 1S0UA 2YZMA 4MVCA 2C2GA 1B3BA 1XTQA 2H7YA 2NYUA 4KQKA 4DLWA 3AY6A 3RIHA 1M5UA 3KVOA 3CLUC 2LDXA 4U7WA 2H1RA 3UK6A 4C7VA 4Y2QA 4BX8A 1V16B 4DWWA 5KJ6A 2OXCA 5EEGA 3OIUA 1E62A 3GGGA 5SYNA 3EF0A 3KL4A 4PSAA 3AJ8A 2VT6A 4M54A 4CUZA 3SLKA 3C4VA 5CX1B 1V37A 3DO6A 3TM5A 4O2BF 4F7WA 2W2XA 5BMVF 4OMUA 2H2DA 4R2IA 1OA0A 1EHYA 3UA3A 2P8SA 4JYZA 2HIAA 4WOPA 3K9HA 2H1IA 2IUEA 1U2EA 1ZI8A 4X95A 5AK4A 2NO6A 1II9A 2VRBA 2XWPA 4NU8X 4UHJA 1K4YA 2FMXA 2GN4A 2QN6A 2XF8A 3F67A 4UULA 2ATIA 4MZXA 5T4EA 4EFLA 4ER7A 5J58A 1ZK4A 3JD2A 4XWKA 3U7FB 1S1CA 3SZMA 1NSYA 3QTTA 3A4MA 3TQQA 4W5NA 2P5UA 4F8YA 1SNYA 2O05A 2UVDA 3W3AA 5F1OA 5A6SA 2PXXA 1I13A 1NLUA 5LDGA 2GNAA 1L0BA 3DZCA 3NOVA 5F5LA 1YR8A 4URFA 4BV9A 1GZSA 3RI3A 2VF8A 3TAXA 4EY4A 2O8BA 2H00A 4DEXA 3P2EA 3HP4A 1MHPA 4ZOLA 1WHSA 3D6TB 2XGJA 2VSYA 1W1IA 3C7AA 2O8EB 4ARIA 1MRZA 2PY6A 4PZUA 4YPOA 2C3OA 4Y2PA 1T5DX 4A8HA 3HXQA 3Q88A 4PLPA 3BFPA 2VQ3A 4RVFA 1I3KA 5JJKA 1MC4A 1DHRA 2PKRA 1B3RA 4S1NA 4BZWA 1JR3D 2GEKA 1PYDA 1QIMA 1PU2A 3OZSA 5AM5A 4KR6A 1BXGB 2XUAA 4K6OA 4XIFA 5HKBA 5CPBA 3KOOA 3LY7A 3N6XA 1Y7TA 1M2OB 2MYTA 5KSOA 1G98A 4O4LF 1Y8ZA 2J0UB 1AN0A 2WMNB 4FCWA 3DD1A 2C83A 3S2EA 2FR8C 2AVDA 4B84A 3ADDA 3T0GA 2Y92A 5JAIA 1RAEA 2VDNB 2JFFA 3NANA 4EI2A 1AT1A 3NHUA 3F3MA 3MMZA 1GKIA 1WUKS 1YVEI 1XUOA 3K0EA 2AV6A 3QLVC 1OYVA 4PG4A 2X19A 4CKYA 5CBPB 2WIGA 3V9PA 2FMUA 5ILGA 4B3JA 5JD4A 2GBGA 2NTNA 3MJTA 5B57C 2ZQYA 1P4SA 2P77A 5KNBA 2M32A 4W9RA 5DK4A 1Z5OA 1NI3A 5T6BA 5L4SA 4NS4A 5HZGA 1IAQA 4KQGA 1G1MA 4RTPA 1MEEA 4DR4B 4KE8A 5SICE 5KJFA 1U1GA 4RKRA 3CW8X 4HYEA 4YHBA 3M34A 3W3ZB 1C80A 2BD0A 2EZ4A 4CW7A 2DAPA 3HGQA 4P5PA 4QATA 4XGRA 3TTTA 3I73A 3KKZA 3UBMA 3ZEIA 4JLMA 2XOEA 2PZMA 2ZTSA 2CBGA 1P1CA 3NBXX 5CW1A 2EVWX 4RHEA 4WZ6A 4AKSA 2IJGX 1GTJ1 3NU1A 1JBKA 4DG5A 3RU9A 2PUBA 4QUKA 4CQMA 5IHPA 4INOA 3BG5A 3EZYA 3PUJA 4O1IA 3WKAA 4IDCA 2BM9A 3MAGA 3UAWA 4A27A 2JBAB 3MJ4A 4UMDA 2ZW9A 1E9AA 3WTBA 2D4HA 3NHWA 1UK6A 1GA1A 3L3BA 1WJGA 3PQ8A 4M0LA 4WZBA 5EIOA 3RYHB 1W5TA 3R5KA 3MVEA 2I3DA 3EAQA 4OKIA 1C8VB 1EA7A 1M2GA 4RZQA 3FHTA 1B1CA 3SZRA 1O6CA 1COZA 4K6FA 3JYLA 1DZIA 1VYTA 4NZPA 5CCBA 1P74A 4Y18A 4UEWA 2XGSA 3RU3A 3NWJA 1BCRA 2OO5A 4Q00A 3ZU4A 3EGCA 1RM4A 1RHJA 1EDZA 4MPRA 4CCAA 1C4KA 5H9WA 3LTNC 1J39A 1JN0A 5C7YA 1ZBQA 4YAWA 3DOEA 3WXBA 5FWXB 1DKQA 1GNLA 1T6BY 1Z0KA 4AG6A 3K4HA 2V5UA 5AUNB 1ENYA 1HQKA 3X43A 3REOA 3VKHA 3ICVA 2YVUA 3W8NA 3OUTA 1UBTS 3QY9A 1W5SA 1XAJA 2GEDA 2RKBA 4ZPJA 4MSUA 3B2EA 4G23A 1QWSA 3TSWA 4JMLA 3A7EA 3L6RA 4L51A 2PSFA 3TZHA 3BJZA 1HT1E 2JAUA 3ZWYA 3TRDA 1WLYA 1CIVA 4HMPA 2PL1A 4DMMA 2HHAA 1NIPA 1SU7A 4LF5B 1K75A 4I3FA 2YWGA 3IVAA 3VPXA 3JZMA 2MINB 3DAYA 1YJ8A 1DQSA 4ENVA 1SU6A 2CFCA 5BN4B 3SXPA 3WG9A 2W2QA 2LIVA 3EYWA 1ONPA 3RRMA 2ZYDA 3G6WA 1W0KD 1ULUA 4FUTA 4II2A 2AOTB 4MVJE 5CB4F 1AKMA 3WLKX 1LY1A 3T5MA 4HH3C 4W9NC 3UBTA 2CXSA 2E2WA 2R00A 3HB5X 2K4MA 1SXQA 4FX5A 3ZDEA 1GD1O 4EO9A 3GLVA 4QKQA 5KJ1A 3COWA 1L4BA 3OOSA 2XEDA 421PA 1MZPA 3DDCA 1BG6A 4LZAA 1JEDA 2IY8A 6YASA 2BFDB 4UFPA 1UWVA 1TX4B 2PSJA 2X7HA 3DHNA 4HTFB 4LPSA 4D02A 5ICMA 4MB0A 3K4QA 2G07A 4OH1A 3SJUA 1Y5LA 1TUGA 4O0MA 3HUTA 4QLAA 1JJIA 1KGSA 4N7RA 2OR3A 4QREA 5L7WA 5D86A 2F43A 2WY2D 3VO1A 3COYA 3Q15C 5AVJA 1XZEA 4LHEA 1UH5A 2X58A 2EYQA 4IIYA 2GB4A 4MQUA 4FX2A 1EJ2A 5ESDA 3NT2A 4A23A 4Z5XA 2A78A 1YVUA 3LKDA 1BU8A 4YCNA 4D4MA 1WHTB 1YU9A 2VSOA 3DQQA 3C7KA 1JEQA 2A9VA 4S35A 4CDNA 4DDVA 4N3NA 1H65A 4CG2A 4W5QA 3ZVKA 1JAHA 3P96A 3DEAA 1NVVR 4CI0B 1DIHA 2J6IA 1D04A 2JIDA 2VUHB 4HNHA 2R1ZA 3MS7A 1S2NA 3EH1A 1U3WA 1LVGA 1M2HA 1VLJA 2JDIA 2QE7D 1T4MA 3FN4A 3BGDA 2PCJA 3ODPA 4TS3A 3T9DA 2XRZA 4F21A 1NXOA 1GGMA 2BTQB 2Y0DA 3DFIA 3FVQA 4RK4A 2BFEB 1H66A 1I2DA 4WA7A 4X93A 3GPBA 1YE8A 1XC7A 5AVRA 4Q9KA 3T0FA 2DQ4A 3E9YA 1OIVA 1QH8A 1YRAA 1XOIA 4HLUA 1JQAA 4YB8A 3TSCA 4F06A 4KPYA 3B52X 4EKEA 2C1XA 1C9MA 2DC1A 1O03A 1FQJA 2VWGA 5CT5A 5FWAA 3LUCA 4NFYA 1UBOS 4ZCIA 2JFXA 4J1NA 1U9CA 3UNXA 2PRIA 1V11B 4OJNA 2JGDB 4DPMA 5D3QA 4PBTA 4B3SB 3DVAB 1A7AA 5JCZA 1UBCA 4JX8A 4AZVA 3WBJA 2CUTA 5FL7A 2EBHX 1BD4A 1NXVA 1SJ9A 4CMHA 5KQRA 3T5CA 1RAAA 2XB8A 4MPPA 3VR1A 1YULA 3I0NA 4X9XA 4D9IA 3NYRA 2H11A 1UC9A 2A1TR 3Q85A 4G1UC 2OV2A 2JLWA 2HU2A 4IIJB 3VNBA 3M1IA 4RFVA 2VDQB 4Z0HO 3SQLA 2OL4A 3T34A 1J2UA 1T9HA 2H4YA 4V39A 3AEQB 1Z2AA 2JGJA 4YWJA 4R2WA 3G23A 2BMWA 4GBMA 5KYUA 3ZI4A 2PS1A 3O4RA 2BYTA 4IIFA 2Q6IA 4YFYA 1GITA 3D5TA 2PXCA 4MEAA 3ZN2A 2O2CA 2VCHA 2G8NA 1JQ3A 1RRPA 2H2AA 3FSEA 4GR5A 1RYDA 2SKDA 1XLWA 2ZSJA 2VPZA 5IAKA 3ZCPA 2G1KA 1AIPA 4BLTA 1T4BA 5FOSA 5HOQA 3QTLA 4BIMA 4PZ0A 2YVQA 3BA1A 4I5GA 3EWAA 4X8OA 4B4DA 2R3SA 2FPGA 2W37A 1BW9B 3OPYA 1SZJG 5H1YA 1W87A 3RT9A 3TH5A 3KJNA 4C7KA 1ZGCA 3SJCA 5JAPA 4PC3A 1DBSA 2HD4A 2WWHA 4DA0A 2HADA 1E2JA 1SCQA 3AP1A 4BMXA 3PHHA 1IRXA 1DMSA 1SHUX 2PQ6A 4JXKA 1QLHA 2GLTA 1UF9A 2PG3A 2R5NA 3DFZA 4O2BB 3WMRA 4B82A 3ZDAA 3KLNA 4A0FA 4FD2A 3EZ9A 4OAPA 3JV7A 3QX7A 4GOND 5FTJA 1A8PA 4BFTA 2ZXUA 2AW5A 3R7BA 2GPJA 3VO8A 1GNRA 3ORQA 4X60A 1E8DA 2B92A 1LNZA 1RKBA 4NJEA 2WB4A 3G9QA 3PKZA 5K03A 1B26A 1URPA 2PDAA 3NIFB 3KKKA 3SKVA 3L7AA 3SHWA 3MOSA 5IJ9A 3Q8MA 4MDHA 4AQ7A 5DSZA 4NH4A 1MB2A 3I05A 4XD7D 4HAYA 3SYRA 3LCUA 2OEPA 2VLIA 5FI5A 3EFOA 2WFMA 1FYDA 1SKMA 5A0TA 4LHXA 3DWEX 3I1JA 3CB4A 3SOPA 4CEJB 3E27A 1EIZA 5EXEA 2QP4A 1VMEA 4Z8XA 5GZ1A 4F9TA 2VHTA 5DBHX 3EXG2 2Z2JA 5K3DA 3EGDA 4P82A 5DBEX 1R4ZA 2ST1A 3ENVA 3TNDA 1ATIA 1XTPA 2IEIA 3NJ8A 3O83A 4MWOA 2FFQA 5LYJF 1SGWA 1N9GA 3DYBA 4N65A 3RNLA 2RBKA 4EX7A 4HFRA 1TYCA 2OFWA 1KKLA 4LTNA 1QRSA 1BXRB 2EP7A 5FIUA 2YUTA 1TC2A 3ZGNA 3ESXA 1EFUA 3CNEA 2QPOA 3PWSA 4OQYA 4F4FA 4BNMA 4GC9A 5KYGA 4AN1A 4O4LB 1HBJA 3S70A 2C0QA 1LRJA 1BMFA 1NLYA 4X0EA 4TZ0A 1V8FA 2D59A 1YA6A 4IWYA 4PG7A 3H5NA 1CEEA 1WXGA 5HWSA 1POWA 1U63A 5JC1A 1R4NA 5HUJA 3HUFA 3OIVA 4H35A 5DM4A 4U4AA 1U9ZA 3DVSX 4FYPA 5TVGA 3OQHA 4HUTA 5EIEA 4H6WA 2NZVG 3OIWA 5CTAA 2H5IA 4YONB 3RW9A 4CMGA 2QRHA 3DXYA 4J0DA 4DVJA 5B36A 4TX1A 3JQGB 1JHYA 4ZGWA 3TCXB 5DHPA 2ZVDA 2P2SA 1SZCA 3OVMA 4KO3S 5G1PA 1B8OA 1NM5C 1TT7A 2WTNA 2XCUA 4TLCA 1F14A 1M67A 3EEBA 1IZ0A 4JAVC 1N3BA 1H05A 1RJEA 2NU6B 1ZUNA 1Q7EA 3FXAA 2Y1XA 3IP3A 2YFYA 4G1EB 1LDBA 1IN1A 1P77A 2GJ8A 4RIFA 4B40A 3U44B 1QPGA 4DCMA 3ZHYA 3IRUA 3V2GA 1SEPA 1X2BA 3GRKA 3VAZA 1P9WA 2G9ZA 3PENA 3P9PA 4AZ3A 1GV1A 5DNEA 1YS2X 1TMYA 1MRNA 2RHMA 3RPEA 3RUIA 4QTYA 5J3JA 5BRNA 2ZI3A 3E53A 1ML4A 3MT8A 2OCXA 3GLFB 4LGCA 3LHKA 1KPGA 3ORHA 2GTHA 5TDHA 2OBYA 2R62A 3FNEA 3N2GB 3UAGA 5JBNA 5EKXA 4FK8A 3AM1A 4ILEA 4J6EA 3QOXA 3L43A 4OBXA 1UFVA 3SVZA 4D8TA 5KHAA 2QUBA 4IKOA 4JQYA 5G4KB 1PT8A 1Y37A 4HB0A 2XNSA 3OFND 1EINA 1G6HA 1SFRA 1YRQA 4Q9DA 3EBOA 4FIDA 2OECA 3V8EA 1AF4A 5DIFA 3GVCA 3TZLA 4ENRA 3E22A 3EMBA 5KNCH 2YOHA 4S0XA 4EMBA 4ENPA 3CPJB 3V4RA 3Q7QA 4PXAA 3ROPA 1T2DA 4M0PA 3DEFA 1I3LA 2HHCA 1T8UA 4RDIA 4Y9RA 1A27A 1UFOA 1SC3A 4O8ZA 2QDXA 3K4PA 3ZXUB 3ZX5A 1QTIA 2XRMA 1CPYA 4FHEA 1D03A 4OJQA 2V7VA 3L0CA 1FXUA 2OCKA 5FT9A 3VBEA 3FFAA 3BXOA 2NAFA 5SZJA 3QKRB 4M1TA 2VSNA 1G41A 3DE2X 5HRCA 4YECA 1KEVA 3R8FA 4JL6A 1NI4B 1QFXA 3CNQS 4FLFA 3ZUGA 2H1FA 4Y2HA 5ER9A 3RARA 1EK6A 4RANA 1ZIYA 2JA1A 4LJ7A 4R8LA 2P9CA 1GGHA 2VPPA 3F5SA 3QNUA 4XZ3A 5ARDA 4G86A 1GPAA 2YMPA 2VJQA 5CLGA 3BL8A 3QFSA 3WLHA 4E08A 3I8SA 5KZMB 1PSZA 3HWWA 3G1UA 4OGWA 1PLKA 2G4CA 2ZU6A 4K8OA 1KP2A 1PGNA 4XX0A 2QLTA 5L9AA 1SD1A 4QBHA 1ICEA 5CB4B 1L4HA 2E1RA 3WAKA 1O94D 3KDSE 3M4JA 1V16A 1QR6A 2DFPA 1G8KA 2QP9X 3OZVA 4K9DA 4M2LA 4QO8A 2IC5A 4RUKA 1KJZA 2RB4A 1XXHA 4LYEA 3O4VA 1ATZA 5DXJA 3B5IA 4BRZA 1I7PA 1NW5A 1ORIA 4E33A 2FPLA 1P17A 4KPGA 2BDEA 4JFAA 5JCPA 2C5HA 3IFSA 4G5HA 1CERA 2IYVA 3IP7A 4I2VA 2OV3A 4IJWA 3GJ6A 4GH5A 2UYGA 4GSKA 4B3BA 4X45A 3CN9A 1QIKA 3UWKA 1ZPDA 3HLKA 3ITKA 4YHHB 1KEZA 3CVYA 1CNFA 2AX3A 1RM0A 1Q1EA 3IO3A 2NZYA 3NDPA 1PGPA 5CW2A 1C29B 1WQ4A 2R68A 4MAMA 4ICIA 5M5BA 5BQFA 4LZWA 1WZEA 3U4IA 2Y76A 4MW4A 4OKNA 5C0OE 4CKBB 3PGLA 2Q9UA 2IUFA 5D1NA 1QO0A 3UW1A 4AT1A 2DX7A 4CBVA 1W30A 2EU8A 3CH4B 2GFHA 3O94A 1W5AA 3S5UA 5HQTA 2B36A 4ZYTA 4V0OA 1A5ZA 1TJPB 2ZSBA 1QUEA 3SMVA 1T25A 2VC2B 5JZSA 4QFBA 5EJ9A 2V9PA 5A7FA 2FSGA 1I2BA 3D3JA 5KYTA 1J21A 4GQBA 2TYSB 4ARCA 2Q3LA 4R1OA 1NTRA 4QDOA 2B9VA 5KC9A 3IIKA 3KKNA 3W2EA 5CURA 2P4QA 3ETLA 4QG3A 2P9EA 4HXYA 4BB5A 2BGLA 1J90A 4GRAA 3BWVA 4M3NA 4K1LA 3L4KA 3TR6A 1QKKA 4RVGA 3GYBA 3HKDA 4CKCA 3JQFC 1L8AA 1VGQA 4ENUA 2C7PA 2GFQA 2GGSA 2G4LA 2J08A 2VHYA 4JI8B 3UUGA 1RBMA 5EXTA 1N0IA 1TKCA 4ZI5A 2Y6UA 5ALIA 5IJZA 2J0QA 1GQSA 3D5QA 3CLHA 3KKOA 1X1TA 2CHUA 3SR3A 4A10A 4HVCA 3GYGA 3QF4B 3WZLA 2R11A 1CRZA 1Q91A 3EC1A 5IBRA 3INRA 3ONWA 1W4AA 4DMLA 1CY1A 1HDGO 1SVNA 1GEEA 3G0OA 4MITA 1A4RA 4IAOA 4UE6A 4BBZA 3PB3A 3OT4A 1ZSNA 1Y5RA 2AMLA 1RXIA 1YJAA 1DG1G 2TRSB 4AC9A 1VLQA 3NIBA 3UMRA 1U2RA 4QHYA 3WQBA 4BYMA 2DUNA 3QP9A 1DSSG 3BHMA 2H4WA 1X42A 1CUYA 4EVIA 3QVKA 1TT5A 2AX4A 4HN2A 2C29D 1LTKA 2C5SA 3P4YA 4UUAA 5HGJA 3PEUA 2PQ0A 4JLJA 4MUEA 3SFTA 2LXNA 2IHKA 1WXIA 1YKSA 5CT4A 5EHXA 2BSQA 2A35A 2VDPB 3BJIC 3DZFA 4YAEA 4BVKA 4YR9A 2Y9PB 3DD5A 4F2HA 1XZLA 4LJLA 2WV9A 5FX2A 4D3SA 2AC7A 4ZVUA 3EODA 5EWMB 1C1XB 5J47A 4JT8A 1FP4A 1VE6A 1GCAA 1YB2A 3K2QA 4HDCA 5FWDA 3RUAA 2AQHA 1IPEA 2HQRA 2R2AA 3CY6A 4R5HA 1OYYA 4UC0A 4I9UA 4W5JA 1TIPA 1R27A 5KNDA 2VP3A 1IOVA 2AUNA 2AUMA 2NGRA 2PX5A 4KFRA 4M83A 3U5TA 4UKDA 3F73A 1V96A 3N2ZB 1N33B 1J2JA 2PKEA 5AI8A 4A0QA 3N74A 3IB3A 3SYMA 5IF3A 2WQZA 4NDNE 1PVVA 4ZC1A 3K30A 2IXDA 5EUQB 1PJ2A 3A70A 3CCCA 1OLUA 5ICEA 2J45A 1FRQA 2C5LA 5U1PA 6GPBA 3M6MD 3MBOA 1DEKA 4MICA 3F6BX 1R50A 3W9BA 3L40A 5FWXA 1PI3A 3PDWA 3URMA 2DFDA 2FDCA 4LCEA 1P18A 2PQ2A 5JFTA 4TLMB 3GFOA 4CI9A 1G8PA 4EMSA 4WACA 4RZSA 5ALQA 5GP1A 4IGFA 2V8OA 1GGFA 5LSAA 1MX5A 1UC5B 1N2CE 2Z8XA 5DCUA 1X3LA 5CA1A 1ZVQA 3OCUA 4N0DA 5FA6A 2C7QA 3HWRA 4Z1MD 1W36D 1B6GA 2NIPA 2V9CA 2ZE8A 1Y7HA 5J1SB 2QVXX 3B8EA 2BFBB 3MWLA 4GM0A 4KVGA 3RVSA 5LYJB 1K7YA 1CB0A 4R8VA 2XIQA 4DTIA 4HNRA 1K63A 4DDMA 3ZWCA 2VWHA 1FP6A 4Y98A 4JBIA 3GLSA 2F67A 5BN4A 2ZWVA 2J30A 1C7EA 1NMEA 5JG7A 1ZR4A 4QOSA 4J0CA 4LQ4A 4Y8VA 5D3ZA 1FC0A 1C7RA 3P9NA 2AOTA 4WADA 5ISMA 3UANA 3RSCA 1FNCA 5TT1A 3ZE7A 3P2KA 3CF2A 1U3DA 4FCVA 2ZRCA 4XIJA 3FOZA 1YJQA 4EYOA 3F4LA 4KXMA 1WBBA 1JHZA 3NH9A 4G2TA 5AK3A 2YHIA 3I6QA 4W6ZA 2QW8A 2BFDA 2VKTA 4HTFA 3PICA 1L5WA 2HDOA 4C7BA 2WF5A 2WNSA 1KTVA 1OOEA 2CZGA 4CMEC 2CUNA 1T26A 3CX4A 1WMSA 3BRQA 2ODBA 2FZ4A 1D1SA 3G0GA 1Z62A 4HT3B 2VQDA 4WXMA 5KSPA 4OUDA 2PR2A 1EXVA 1EMDA 4Q5IA 2R97A 4RABA 2XQGA 1MPTA 2ZSHA 3DTTA 4EIWA 1M75A 4KGVA 1EYZA 2W2TA 2HT1A 4IIBA 3ZVMA 3IV6A 2YFKA 3NH6A 1JUDA 3D0KA 1ZN7A 2A86A 1RBQA 1WHTA 2P67A 4P9NA 3ZV7A 3RS5A 4IF4A 4WLUA 1QNFA 1E99A 5B7PA 2YJ6A 1QQTA 2EX0A 1SRRA 2HL6A 2C00A 3EOAI 2A0UA 4V0NA 3ISTA 4ZAZA 3UEOA 4PZAA 1NN5A 4EG6A 1YTLA 4AJLA 1WXHA 4CF6A 4GL2A 1P91A 2FZVA 2JRCA 3ICOA 1QBKC 3QKTA 5LDDC 1SHJA 3H97A 5KNCD 5EP1A 4K9SA 4IBOA 2ZAYA 1P6QA 4OQFA 5CPFA 1DTSA 2BTQA 2BSXA 2BFEA 2LWIA 3AI2A 2ZYHA 4FZ5A 4BFUA 1WY5A 2NUTB 3L92A 3WADA 1Z3IX 3KOYA 4K9NA 3SHQA 2HWXA 3UJ3X 3HCEA 2ZANA 3AFGA 2FEWB 2OORC 2R47A 3UYKA 3WBKA 3F7MA 3A10A 4UBIA 1JBQA 1E2EA 1GUYA 4L15A 2D2IA 1C0KA 4FBGA 4K9QA 4R3UC 2A1UA 3OLVA 5F1YA 2D1QA 3M6WA 4BZQA 3DVAA 5ADUS 4IHKA 4FFBB 4RMGA 3DFFA 1EGHA 4B6PA 4DC9A 4R68A 1P3Y1 4YRBA 2N46A 2IZ1A 2C7VA 3IKMB 4K87A 4CDRA 3V7WA 3I1YA 4ACAA 4OGLA 1IOZA 1ID1A 4G0QA 5GQSA 1X87A 5TS3A 3U37A 3GJTA 3HDYA 3KTAB 3FNFA 1E89A 2FG6C 1UDXA 3JWIA 4GM1A 4GVXA 1WE2A 5TR9A 3U13A 1MHTA 4LOAA 1UANA 2QN8A 3AEQA 4COOA 2YWCA 2G36A 1V4NA 3EVCA 1XCOA 3IJPA 4B6FA 2B3DA 2IPAB 1OF1A 3RBXA 3H9GA 4F96A 2VP2A 3SBOA 1L7PA 5HKKD 1F3OA 3R6WA 2Q2NA 3KJGA 5CD1A 2A0WA 2WK1A 1VRVA 2NXCA 4Q16A 5GADl 1JQEA 5LFAA 3UY4A 2KB0A 3ZH9B 1EK1A 1I36A 1Z29A 4OIMA 4FJ0A 4YN3A 4K0RA 4KYUA 3DKPA 4II3A 1KMCA 2HEGA 2VI5A 3L1HA 4NX2A 4OTZA 5CYOA 4F60A 5KVQA 2BHSA 2Z6QA 4BX0A 1BW9A 1YS7A 1OGJA 4QHSA 4RLQA 1C1DB 2ZS9A 4GVPA 1NJFA 2EP8A 2V59A 1TVCA 2HI0A 2WZBA 5HR5A 2FQ1A 3PFBA 4J0JA 4V1CI 2O5EA 1K5HA 4MP6A 4BLUA 3HQ4O 1D6NA 4EM6A 4RF2A 1UEXC 2BZSA 3CG4A 3NT5A 3RYIB 1P0MA 2J0VA 4O2BA 3VZCA 4JODA 4A5OA 5AVWA 3HLYA 2X9GA 2ZJ0A 1ENOA 3VU9A 4D44A 1H94A 1IMJA 2H8GA 3JQPA 2H7VA 4D4GA 1NW3A 4ZC8A 2HK8A 4LC9A 3PDHA 5ARBA 2AXEA 1UPBA 4OAOA 1SBZA 4GIBA 4XYMA 3TE7A 3K1YA 1CQIA 3ZI7A 1JR6A 1RACA 2I29A 3C3YA 3QVXA 3SX0A 3HBJA 1AUOA 3N86A 5JFGA 1T3GA 1LLUA 3KG2A 3MGGA 3ZHQA 1N0VC 1P73A 2IH2A 2X40A 2EERA 1LFDB 4HVAA 4F3KA 5BN3B 1HX7A 2GBCA 2WU1A 1IOLA 2X2FA 4WW0A 3BPSA 5K9ZA 4PSUA 5B6PA 3K73O 4MAAA 5JEDA 2NNLD 2I66A 2VDJA 1QC5B 3AFIA 3TLEA 3BFXA 1S7CA 5A7HA 2VYFA 3KE8A 4QARA 4LXIA 3QX8A 3UXEA 3OQNA 3DZ8A 5EAIA 3MCVA 5F35A 3EQ6A 3RFFA 1Z5GA 3PE4A 3K70C 5LZ4A 5BSUA 2Z3WA 5JH7A 2HX1A 4JOSA 4LDRA 5KWEA 1GL6A 5PNTA 4K5QA 4WXPA 3VPCA 3GT4A 3HKBB 3E48A 4R9RA 1DO0A 1NZFA 2ZB4A 4R7ZA 3CYFA 1UJCA 1WMBA 3BIFA 4W8GA 1T0BA 3MCZA 3OA0A 3VU1A 4D96A 3D3QA 3FYHA 1QF7A 4XIIA 1E3SA 1ZQ1A 4N9QA 3DMPA 4RPKA 2AFIB 3T4UA 1KZ6A 2QW1A 3VKUA 3CW2A 1CT9A 1AURA 1OYOA 2R7LA 1J8DA 4HEHA 4O4LA 1TGYA 5K8IA 3PV0A 4TV9F 3FSGA 5AP9A 2HBYA 1QGOA 1I1NA 3VFDA 1C9NA 1M34A 4HD8A 1HYBA 2CDAA 2XUKA 3FWYA 3R0IA 3DDSA 4O33A 1RZRD 1GGJA 1EFKA 3OZIA 4JC8A 1AHHA 2QTCA 3IKJA 3Q7IA 4KIUA 1LC0A 3UH1A 4YUZA 4ZMBA 4F6RA 3OKCA 5P8WA 4CKEA 1RWVA 3NM4A 4WFJA 1HO3A 2B3TA 1F60A 2ZQZA 5ELMA 3RJZA 5BQOA 3JQGA 3A36A 3K9BA 1XNQB 1E2IA 4EVQA 2AOUB 3TLJA 1GTG1 4GKAA 1X7ZB 4LE2A 3CSSA 3A0UA 3BXXA 4CT5A 3E7PA 3GQBB 3WL6A 2NU6A 3AEUB 2IYAA 3DPSA 2BP7A 4NF2A 2C4TA 2XE7A 3UFXB 4Y3UA 3D4NA 4EKNB 4H0CA 3SZ3A 4YRLA 1FY2A 3CVOA 2HC9A 1Z17A 1B0ZA 3KB1A 4LOLA 4BO3A 4E1AA 2QRGA 3F71A 3LRXA 2HU5A 5FB3A 4KLRA 3ROTA 4FXPA 1F4VA 2HA2A 2VYND 4HS4A 4KRYA 1F4LA 4QGSA 4D3XA 1ZM4A 3A4LA 4PSCA 4YA6A 4MCAA 4AG5A 2PJUA 3K9CA 5DHSA 2ZYWX 1V5WA 3OZUA 5C2JB 4ND2A 2JJ1A 2OV1A 1T5HX 3P0FA 2MSWA 2ZAGA 1VLZA 1YONA 1R3UA 1H93A 1VSBA 2F00A 1H2ZA 5KBYA 3Q9SA 3LXXA 3D54D 3DF7A 2FQQA 2JEZA 4MVYA 1CBUA 4TRNA 3ZWKA 4FR2A 4L2IB 2J0SA 4DIEA 2C3UA 3FMFA 5ETJA 3RG8A 3AETB 5KYXB 1M9NA 4CCYB 2UKDA 4V0MA 1MVOA 5FDFA 1H8HD 3ZY5A 3D43A 1H5UA 3IOEA 1G3IA 1U4SA 3PT5A 3ZD7A 1FFGA 3H9UA 1A50B 3E3AA 3I01A 1WWKA 5G02A 4D0NA 2JAWA 3RCBA 1KI6A 2OV4A 3VC2A 1ODJA 2GN1A 2XITA 2CLMB 3T1TA 4YS6A 2EZUA 2BE9A 3I9OA 1JBEA 4GEGA 1DDIA 5ED4A 4TMWA 4GHWA 2OXRA 4Z8YA 3AMVA 2C4MA 1ZD4A 4Y2RA 3LKBA 2RJNA 1QCZA 1PEYA 3A4NA 3TI9A 3ICCA 4RFSB 3PNLA 3KD2A 2DCMA 2PWBA 2II6A 3QKRA 3W4KA 1GTZA 1CUAA 2JK1A 3A2LA 3PIDA 2EJVA 1JQ5A 2PZBA 2XADA 2QUZA 4BO2A 4DLKA 1AQ6A 1E60A 1XVTA 3OOHA 3RF7A 3M9XA 3A1CA 4WZBE 3LBAA 4G5YA 3I2JA 1CDEA 2WKSA 4RD0A 1V4VA 2A59A 2C59A 4LRUA 4BV3A 4P98A 2QGNA 5FUVA 4HLDA 5AVOA 5A3VA 3HJGA 5FTLA 2C4KA 3LP5A 1Z6YA 4G1BA 3ETDA 5G0TA 3C15C 2Z6UA 3GPCA 4BCBA 3AW9A 3O03A 2FDXA 3IVRA 1GSOA 3Q7TA 2FSPA 2ZJYA 4OXRA 5EKUA 2PUVA 4DR3B 4P1ZA 1SXIA 2J41A 3K9GA 3UK0A 2HMTA 3OJEA 3MG9A 4GBED 4CKZA 1K98A 5HFAA 4D0GA 2ZM6B 3HDJA 2MSLA 1PSDA 1Q7CA 3T5AA 2E4AA 2HZBA 4Z9FA 1ZUIA 3V7UA 1X9GA 5DMXA 1L5ZA 1A9YA 4FHGA 1M33A 2QMOA 4LF4B 4UUMA 1B16A 2EC5A 1KU6A 2BRUA 1KYYA 1JLKA 1PJQA 2O0MA 3DNFA 4M8NE 4Q4JB 5EQJB 4YP6A 2IP2A 5HDBB 3PXAA 4B31A 2ZIZA 1GKLA 5AHXA 5FWYB 4A2QA 5BN5B 5IPFA 1TTPB 1Q50A 1JDPA 1YVRA 2Z4RA 4Q24A 4B44A 1PQUA 4J07A 1EFLA 5GM2A 4DEVA 3BRSA 1ZUWA 1M2KA 5E3JA 4AKHA 3CBGA 3FKQA 4G0VA 2MMCA 4BWFB 3A04A 3E9RA 4URHA 1CZLA 2UUCB 3M81A 4D4JA 4EMTA 5GIPE 5IN5A 4LYHA 4MUBA 1Y9AA 3UC5A 2EW2A 4KBYA 4UU0A 5HIAA 1A98A 1KJQA 3L0BA 2ATCA 2RC6A 1XCLA 3CT4A 3JVVA 4JI3B 3I0ZA 1MD9A 3O95A 4CDMA 3UT5A 4G36A 4RHCA 2E48A 3L6EA 2LKCA 3SHOA 4ECEA 1U5AA 3K70D 5JJBA 1TK3A 4FFRA 2P9YA 4M1WA 4TTVA 4C0BA 2DHCA 2CB9A 3PUZA 3NCTA 2BGKA 4FILA 1MO5A 2CL5A 2CLEB 4BNWA 1EG7A 5J5CA 1ACMA 3WYNA 1YS4A 1SA0B 3AWIA 4DSUA 1A5TA 3ZZ0A 3QHPA 2QTFA 3ZBQA 5AXDA 1G291 2YC4C 3NHMA 4IVPA 1ZD1A 2P9BA 2VDVE 1TLTA 4DSZA 3F0TA 4Q6WA 4EZBA 1RVDA 2VN8A 1WCV1 4JXZA 4ER5A 1KZYC 4KXYA 3IXQA 1H2YA 3LQ1A 2BCGY 1V7QA 5I47A 2A9PA 2ZJ7A 3DMHA 3RAFC 1V2HE 2F3RA 3U7QB 1AZSC 2Q1YA 4BMNA 1RLMA 4ZV4A 5A1JA 4PGHA 2PH7A 4HB4A 5L51A 1N3IA 1GKYA 1M5RA 1O96B 1NURA 4JUDX 1ABEA 3A2NA 2C78A 1L5SA 2D54A 4WT7A 2AUTA 1R37A 3H04A 2XCSB 1TMGE 3PRKE 1ZD2P 1Z83A 1S7GA 3GUYA 2JBWA 4C87A 2A88A 1WSAA 2DWOA 2B21A 5EGNA 2HYDA 1SKYE 5DTQA 3WS7A 3K6SB 3LA6A 4FBLA 5DMHA 1WSDA 1RU3A 1DT3A 1GZ4A 4IQFA 1N2ZA 3DO5A 4BQNA 2X41A 3C7DB 1SXHA 3WV5A 1YD7A 5MN6A 4P3OA 1OASA 5BUSA 3IHWA 3OWXA 3AFMA 1M1ZA 3E2IA 1NJ8A 1UFKA 4U0JA 1QQBA 1XEFA 3OZWA 1TCBA 4FSDA 3DAHA 3M3PA 1XRLA 3PFIA 4P3YA 3U6KA 3H4MA 4DCSA 3T9BA 3OEYA 3KTFA 4XKJA 4AG3A 1CF2O 3SMQA 3BWCA 2GNOA 1L7EA 2WWVD 2O3SA 3G7SA 1PZXA 2UYYA 5BW6B 4HJXA 1WZ2A 2PT7A 3EZ2A 4EHBA 1DAFA 2CWWA 4IX1A 4JVNA 4KRFA 1B43A 1X7WB 3BF8A 1X0VA 3H5VA 3KJIA 5FPQA 5LA6A 4IZ6A 4A03A 5B4UA 2WM9B 3LYHA 5EWMA 3DL7A 4DIMA 2OO7A 4XOUA 2Y66A 3PBKA 1C4OA 1XZFA 1PUXA 3L7JA 1ADBA 4RVNA 3PHCA 2AG0A 2D5LA 3ZYZA 2XKBA 1QAMA 4JLNA 4IDQA 1F12A 1Y3HA 3NEJA 3HYLA 2JCYA 3WHPA 3PPYA 3TSOA 1MF7A 2OMEA 1UUFA 4W1SA 1L7OA 3IBSA 1M1YE 3OSUA 2Z2ZA 3DKRA 4GQAA 1XU4A 3OF3A 4TMXA 4WNAA 4YJGB 3FGOA 3RJ9A 3WL4A 1YR6A 4CM4B 7ABPA 3AVXA 1UBJS 4FHZA 3KQVA 5C1IA 1SN7A 4TTJA 4PHFA 3EIOA 4AW9A 3CA8A 3CSUA 4H15A 4ZYVA 2AC2A 3VOTA 1XZMA 1YQUA 3AFHA 2JI6A 2GO1A 1BKDR 3MRSA 1W36B 1UQRA 3UUWA 4QTXA 4C03A 1T3ZA 3EXHC 1SZDA 3P52A 3QBJA 3LE8A 2IELA 3ZKWA 1GZ3A 5A4JA 2GILA 4Q4AA 3T1OA 4X65B 1VL8A 3R7LA 3IERA 2V96A 4NJOA 1ZR2A 4FU0A 4EF5A 3U56A 2OCAA 5EWLB 5BNZA 4G5RA 4DJFC 2FY8A 5LYJA 2BFBA 2XDQB 2WWTA 4WZZA 1Y5IA 3QJGA 4PQYA 4PYMA 3U2QA 2P2NA 2G80A 3AHFA 2P6MA 2QN1A 2DY1A 3E18A 3QLTA 5DYTA 2CD9A 1GKUB 4J7CA 5K6RA 1MB3A 4TM8A 1NBAA 1BKYA 4YDQA 5I3ZA 1S8AA 5HK8A 2YCLA 3WWOA 4TV9B 1TTHA 2Q4BA 2PYIA 3BHIA 5HF9A 3M1LA 2O7RA 3M8KA 4LNAA 5E3HA 3A28A 2D0PB 2NSHA 3LRTA 1OX5A 5AVKA 2VHZA 5JTUA 5DT9A 1VG8A 3CRMA 2VH1A 4RWZA 2ZIVB 1XYGA 3AO0B 2AXQA 2VBCA 4CM8A 2AJ8A 2QRMA 3ZLUA 3U16A 1E94E 1I4TD 1NU6A 4EL5A 2I33A 3NS7A 4AROA 3IEIA 3FJOA 4G26A 1YQDA 3U40A 3OQ1A 2FX2A 2H3HA 1S4QA 1L8XA 1TZMA 4IXMA 3O74A 3S68A 3S1AB 3DFMA 1JLLB 2DKFA 2X5KO 5EMLA 4ARZA 2Y3IA 4GP6A 5D7BA 3VPFA 4EUKA 1K88A 3THXB 4L5JA 4DQKA 2GLUA 5K2OA 5JS1A 3BCUA 4R8MA 1E6EA 2V7QD 2WD7B 1F9EA 2BWJA 3TPCA 3EIWA 4C4SA 4HGQA 4E5PA 2J5BA 4KX5A 4V03A 2FWIA 4I1SA 5DCYA 3GN2A 4A0HA 4BJ1A 4U2CA 1ZEJA 3IB6A 2QMEA 3C39A 1IEQA 2JJYA 3ERCA 1V3QE 2P4EA 1NVWQ 2G1JA 2CXHA 4FC7A 2BFAA 5DLQC 5E9QA 4MQBA 3LUGA 3PUHA 2VHQA 4L0MA 3WGTA 4ZI3A 1X7HA 1PJBA 4KVFA 3L4BC 5E1MA 2ZATA 2GPYA 1J8QA 2IFTA 3G8BA 1H23A 3QLUA 4XCQA 4NFHA 2AN9A 2X5XA 2XBMA 4FYHA 1E92A 4UU8A 5BR4A 2B2CA 2NTYC 1GO2A 1XNHA 4L07A 4XSHA 4MWGA 1OLSB 3AJEA 4ZQHA 3RH0A 4DRXB 1DCTA 2WA2A 2PFSA 1X19A 3K5HA 5GGXA 3G0BA 3H9BA 2RG7A 1TTQB 2NUTA 3ESAA 3KTOA 3SM9A 5IM5A 5H0IA 4TYMA 3DPIA 4PO3X 3V97A 1TA0A 2XXAA 1GRNA 3GRZA 3DAFA 1KYZA 1TJ4A 3N75A 2NUBA 4JA0A 3VTFA 5I7FA 2WTEA 2QGFA 5E2BA 4MS3B 4IIHA 3H9QA 1Y4UA 1A2OA 1R5BA 5ALKA 1F2VA 2C61A 5LVAA 1G7RA 4YT8A 4ZICA 2I1QA 1LXCA 2F7SA 1F06A 3WB1A 2AQKA 4AMGA 4YRGA 4W7HA 1DLJA 2HPHA 2KQUA 2I67A 2ZBGA 4WCFC 5EIHA 4XQEA 3RUFA 3S6JA 4RULA 3LY8A 4PQEA 3CZ5A 3F1LA 5T41A 3LX8A 4TN1A 1EFCA 4PPYA 2QMYA 4I5IA 4Y6QA 5I8ZA 3BJEA 2EW8A 5AKGA 3KTAA 2X1LA 2AQIA 5DH9A 1TAUA 1CEQA 3MJFA 1IUPA 3QOFA 3WYAA 1ISIA 1JHUA 3E82A 2HRZA 3RC8A 3F74A 4WNYA 4HQNA 4F56A 3OZDA 1MIHA 4QBIA 4YTEA 5L8VA 1CR0A 2J7KA 2ZT8A 1T1JA 3OU7A 1JHAA 2CUKA 4FYJA 2VK2A 4NPHA 3OQOA 3HBLA 1HUQA 1Q7BA 1XRSB 3FMOB 3N2LA 3OTOB 1KZ1A 1ND6A 3PL1A 1RR6A 4BLSA 3ZJ5A 3HCFA 1EJ6A 1J24A 1RYNA 1VJ5A 3FVWA 3NHKA 3QMVA 2Q0QA 4PF1A 5T4FA 4ASUA 2EFJA 2QXUA 2WUVA 4BP3A 2O48X 4NU5A 2OCBA 2PUHA 1C1DA 1PD1A 2ZBVA 4XUGB 4ZQBA 3KSAC 1B42A 5BSFA 1NJSA 4G85A 4IHJA 4MV5A 1RC0A 4JJIA 4PAQA 3HBAA 3VC1A 4F4CA 1PFKA 3BMNB 2PU7A 5LD2C 3RYIA 5IG2A 1P4AA 3O90A 1RDFA 1RJ9B 4YRCA 4BAUA 2YFHA 5A3RA 4JCCA 4Q9HA 1QIFA 2O07A 3RWMB 2V97A 3EIFA 3GJ3A 3O1HB 1CD5A 4BTLA 3WL8A 3SS8A 1ZXBA 4KFCA 5FUMA 1CQJB 1W9HA 1HQYE 1HT0A 3VXKA 5CEFA 1E9VA 3LGSA 3M6FA 1KZ4A 1LDNA 2ZITA 3DUWA 3UTDA 2J7PD 4BATA 4KXLA 4BNLA 1N2IA 5B53A 3LUDA 4KC0A 2UZ0A 5C51B 2PS9A 4ZK2A 1I6KA 1D4OA 1JKJA 2PT6A 621PA 1Y6ZA 1HWYA 4I50F 3UJ9A 3VQTA 4LC0A 1XNGA 1P2DA 2Y4NA 3LPDA 5DZSA 4RA6B 5IH3A 4A0RA 1RAGA 2BKUA 3QEOA 5CUQA 3KEQA 5ERXA 3I64A 4QJBA 3TI7A 3OFJA 1JPUA 3KT6A 5D5HA 3L1JA 4UNQA 3LG2A 3QE3A 1LS1A 1NN1A 4NV0A 1XEWX 1WQ1R 2MSKA 1Q20A 3LY9A 3RUEA 3W5BA 4KUGA 1FLDA 3QPCA 3BWEA 1Z8FA 3AVVA 2PRJA 5AJVB 5JOQA 1ZHHA 4P53A 1XXHE 3PXDA 4XOIA 2H4HA 1BDHA 4LYFA 3RIEA 3MAJA 5HVNA 3C3WA 3VYUB 4TL7A 3FZQA 4BMYA 4XPIA 3JSAA 3DE1X 3L4SO 4WINA 1TU0A 1H2EA 1H6BA 1NW6A 5CCXA 4N0PA 2CJWA 3WGGA 2B82A 1FLAA 2AFIA 3QXXA 5DHFA 1N9ZA 5J9FA 3LZDA 5CDUA 1XAHA 1CY2A 3O3CA 2GJ9A 1SO8A 4ZZ2A 2DOKA 2ECFA 3KT8A 1JAXA 2QN7A 3DZIA 4CLRA 4FFVA 2G72A 4G4SO 4LS3A 1ZUD1 2C96A 3GZJA 2E3JA 5AVYA 2R4QA 1L4NA 3B1WA 3QUQA 5KTNA 1DARA 1SUBA 1C3LA 1QCCA 3F98A 4EPXA 3WY9A 4JB8A 1DADA 2XPCA 1JJ7A 4TKMA 2OWDA 3OY2A 1U8AA 2PUDA 4NS1A 4OB7A 3FDXA 4AUKA 4TYPA 4KB5A 5KI6A 1GZUA 3JQEA 1BE6A 4ATNA 2I6SA 4R1PA 2ZR8A 5TQ0B 2HNBA 4UMVA 2QRPA 4LWPA 3AEUA 4J0HA 2ZROA 1W9MA 2FRDC 3UFXA 1OAOA 2CJFA 2R84A 3CFYA 4QUJA 3N7TA 2QTVB 3EEYA 3T3HA 1JA1A 2AFRA 2Z8YM 2CUZA 1HOTA 1T4DA 2QHXA 3BC1A 3M6AA 3OBIA 1NW9B 2XA9A 5DTMA 4EBFA 2PA3A 1PK9A 3P4XA 4XVQA 4H1WA 2Q9BA 4L50A 3OX2A 3VISA 4UFOA 4F5ZA 5IULC 5KPJA 1MX1A 3T5DA 3L04A 4RJLA 1TCCA 2WRZA 2IZOA 2ZUUA 1I33A 4DCJA 2IEAA 2XMDA 1P1RA 4TT8A 1SC9A 4DJEC 4ZYUA 3OQMA 1QYCA 2ZPAA 3L46A 1MJGA 4QSHA 2QUIA 5FJJA 2OY0A 2XCIA 1A4UA 2I8LA 4JLUA 4ALJA 2I0FA 2I62A 3A6DA 3OFNA 5E4JA 9ABPA 5DWVA 2ZJ5A 4L2IA 3V1UA 2HBRA 4Q9LA 4U9UA 2QG6A 4RK7A 1ZCZA 2K87A 4UMFA 2C5AA 4CCYA 4Z3KA 4DR5B 1OTXA 1VPLA 1U7PA 1VB3A 3DHEA 3KV1A 1LB1B 1PP4A 3VPDA 1ACJA 1Y48E 2QM8A 1HA3A 4GPBA 4HWGA 1JDNA 2XNJA 4Q37A 3KWMA 1PJSA 4IXNA 5COBA 1X77A 4MWDA 1O97C 5AXBA 2BEJA 5KTYA 2PZGA 2AEMA 2WM8A 5DCWA 3ZQ6A 3ABIA 1GGNA 4MH0R 5HUQA 1W581 4O1MA 1UJBA 1MDFA 4ZU1X 3R0QA 1EQAA 5HS4A 2UZ1B 3OT1B 2IVZA 1MO3A 1T8WA 2IV2X 1EUCA 1K86A 4HUQB 1N6OA 5ICCA 4MGYR 1Q21A 3S1LA 4N0MA 4PAMA 2WD9A 1L4EA 4A8JC 5L3QB 2QLNA 2ZRMA 1XDDA 3O1IC 3PJDA 3K1AA 2VH5R 4IP0A 3CNBA 2O2YA 1FNNA 2FUEA 4YUAA 3W77A 5DYYA 4PYJA 4ZZ0A 3FFWA 1UDBA 4Z4FA 1TPZA 1W6RA 2W6ID 3DOUA 4GLFA 2NZUG 3KQPA 3QKSA 4XWAA 2E49A 1HE1C 2NPFA 1T91A 3W5JA 2ARKA 1O94A 5H3CA 1XTVA 3O0TA 2B35A 2NQTA 4Z0TA 5JMWA 3AR8A 3ENWA 1ADYA 1M72A 1JB1A 4URWR 4HSGA 3QVMA 4ZJPA 3VKWA 4OEHA 1ABFA 1P61B 2CGEA 4TLDA 3VSBA 2L18A 2YYSA 4YJKA 4MYDA 5EESA 4P4SA 1H4QA 4AP5A 4IH9A 1WULS 3UAOA 2ZCVA 3V33A 2D1FA 2WA1A 2Q1WA 3ABSB 3GFGA 4IM7A 3UB2A 4DZTA 2OPHA 1MQSA 1BS2A 2PLRA 3I6BA 3R6TA 4E6PA 3ZU2A 4HS9A 1SVMA 2CDRA 2E21A 2TECE 2ZTUA 4Q82A 4TXJA 2AD1A 5JZOA 1NPTO 1KI2A 4BFWA 4B3MB 4NTZA 3HFJA 3T5BA 1F2TA 3W5VA 3P2YA 4UM8B 1T0PA 2W70A 3JQBA 4FKBA 3O31A 1ZVKA 4FKMA 5EMJA 5BN5A 5FWYA 3ONVA 3CF4A 4RIGA 5LB2A 5JUWA 3BL5A 3INNA 3VX3A 2EFYA 2GETA 3IP8A 4C5CA 3AUJB 4NG5A 1YQ9A 1KMQA 1YFLA 4L85A 2CNLA 2GEUA 3MILA 3SD7A 2RARA 2A67A 1NUTA 3M6XA 9ATCA 4DSAA 2CV1A 1MQ9A 3VOBA 4HCJA 3LVQE 5C8ZA 3K70B 5E7MA 3F4BA 4PYLA 2FXIA 3OZFA 3UN1A 2APJA 3HFSA 2QBYB 3KALA 3CISA 3VHLB 1VSVA 2DFLA 2FX5A 2WABA 5THXA 2GARA 4IYJA 5MN4A 1I94B 2DETA 3F3KA 4NMXB 3MTBA 1JAIA 3DOFA 3IUQA 3ZXIA 5INTA 3LCMA 5G3ZA 3RGGA 2BJVA 2P4UA 4H4EA 2H92A 4YPVA 4IR7A 5KOHB 1UBLS 3HXOA 3L9WA 5FL3A 2FW7A 1NKSA 3FSRA 4IW3B 4X20A 3KFXA 4H6PA 1JLMA 2J32A 2P68A 4QBFA 4Y6RA 2UZ3A 4DIKA 4GD3Q 2C54A 2JZNA 1KMMA 1XCPA 1U3TA 3S2UA 2O3QA 3OEHD 4OY3A 1NJ5A 2VXBA 3OLWA 3EXG1 4QAQA 1XVLA 2D2VA 1V47A 3E81A 3EFEA 1TKAA 2WYVA 1O77A 4TQAA 1IATA 3CLTD 1I80A 1U0EA 2RGAA 4P35A 4WD3A 3PQEA 3IBCA 1M73E 1V6AA 3QKWA 4PVDA 1IQRA 2Z1MA 3U7QA 3ICQB 4LZPA 3N2KB 4TS1A 2OUIA 3GD5A 5DCLA 2VAPA 3QOWA 4DNFA 2H4ZA 1KFEB 4X63A 5I8WA 1ULBA 4A0GA 4CMKA 1OXUA 3IAAA 3LT1A 2BFOA 3SXJA 1MDBA 2WJPA