5GMFA

Crystal structure of monkey tlr7 in complex with guanosine and polyu
Total Genus 259
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
259
sequence length
810
structure length
776
Chain Sequence
b'SPWARWFPKTLPCDVTLDVSKNHVIVDCTDKHLTEIPGGIPTNTTNLTLTINHIPDISPASFHRLVHLVEIDFRCNCVPIRLGSKSNMCPRRLQIKPRSFSGLTYLKSLYLDGNQLLEIPQGLPPSLQLLSLEANNIFSIRKEQLTELANIEILYLGQNCYYRNPCYVSYSIEKDAFLNLTKLKVLSLKDNNVTTVPTVLPSTLTELYLYNNMIAEIQEDDFNNLNQLQILDLSGNCPRCYNAPFPCTPCKNNSPLQIPVNAFDALTELKVLRLHSNSLQHVPPRWFKNINNLQELDLSQNFLAKEIGDAKFLHFLPNLIQLDLSFNFELQVYRASMNLSQAFSSLKSLKILRIRGYVFKELKSFQLSPLHNLQNLEVLDLGTNFIKIANLSMFKQFKRLKVIDLSVNKISPVLEQLYYFRYDKYARSCRFKSCYKYGQTLDLSKNSIFFIKSSDFQHLSFLKCLNLSGNLISQTLNGSEFQPLAELRYLDFSNNRLDLLHSTAFEELRKLEVLDISSNSHYFQSEGITHMLNFTKNLKVLQKLMMNDNDISSSTSRTMESESLRTLEFRGNHLDVLWRDGDNRYLQLFKNLLKLEELDISKNSLSFLPSGVFDGMPPNLKNLSLAKNGLKSFIWEKLRYLKNLETLDLSHNQLTTVPERLSNCSRSLKNLILKNNQIRSLTKYFLQDAFQLRYLDLSSNKIQMIQKTSFPENVLNNLKMLLLHHNRFLCTCDAVWFVWWVQHTEVTIPYLATDVTCVGPGAHKGQSVISLDLYTC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Toll-like receptor 7
publication title Structural Analysis Reveals that Toll-like Receptor 7 Is a Dual Receptor for Guanosine and Single-Stranded RNA
pubmed doi rcsb
source organism Macaca mulatta
molecule tags Immune system/rna
total genus 259
structure length 776
sequence length 810
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13306 LRR_5 BspA type Leucine rich repeat region (6 copies)
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 5gmfA00
1W8AA 4BSRA 3M19A 1KOOA 4Z61C 2Z63A 2BEXA 5IJBA 4PERA 4LI2A 1GWBA 5AWBA 1P9AG 3ZYNA 4NKHA 3G39A 3WN4A 3C6NB 2OMVA 1A9NA 2P1QB 3W3NA 3E6JA 1WWLA 3C6PB 2WFHA 1KOHA 3P72A 1DFJI 4R08A 3UL7A 3GOZA 5IJDA 2IFGA 4RCWA 3W3KA 1M9LA 3OGLB 4NKGA 4V2CA 3VQ1A 1U0ND 4J0MA 4KNGA 4AW4A 1FO1A 1OTOA 1YRGA 4C2AB 2V9TB 1K5GC 2Z64A 4PEQB 5CMPA 3RFSA 4LXSA 2WQVA 2ID5A 4CP6A 4V2EA 5IJCA 4IM6A 2UZYA 3FXIA 5LFNA 3RJ0A 3O53A 1DS9A 3WPBA 4PSJA 3E3ZA 4V2DA 4Z8GA 3RFEA 2ASTB 5GS2B 4R07A 2V70A 4R6JA 1OOKG 3G3BA 5AWDA 4C2BB 2XWTC 4QBZA 3M18A 4EZGA 5D3IA 4UFRA 3SB4A 2WQXA 4M7EC 4L3AA 4QXEA 4LSAA 3A79B 1K5DC 3RW6A 1JL5A 3REZA 3KJ4A 2JE0A 1XCDA 1D0BA 1O6VA 4LSXC 3ZYOA 2WQUA 4B8CD 3OJAA 4J4LA 4LI1A 4MN8B 4FMZA 1OGQA 1XKUA 3TSRE 4OQTA 2OMZA 5GMHA 1ZIWA 4CC4C 4R0AA 1H6TA 4ARNA 3G06A 4WP6A 3WPCA 4R5DA 5GQRK 3RGXA 1P8VA 5GMGA 4TZHA 2Q4GW 1FT8A 3RIZA 4XSQA 4Z79A 4U7LA 1G9UA 4BV4R 2Z65A 2RR6A 3WPHA 4I6JB 3ULVA 3CIGA 1LTXA 1A4YA 2A0ZA 4Q3GA 3W3GA 2OMYA 3DZEA 2XOTA 1P8TA 4FHOA 2OMXA 4PKIG 4U09A 2JE1A 2P1PB 1IO0A 2ASSB 4FD0A 2O6SA 2Z7XB 4BSSA 4PQ8A 4G8AA 3VQ2A 4R6GA 4RWTC 4GLPA 1H6UA 2O6QA 5GMFA 5CMNA 3O6NA 4FDWA 5B4PA 2P1NB 5B0TA 2RA8A 5A5CA 4Z64C 2Z81A 4U08A 4KT1A 4R58A 5B0NA 4BSUA 3WPEA 3OJAB 4L3FA 4M7EA 1XWDC 1M10B 3WPFA 1SQ0B 3C6OB 5HDHA 3E4GA 1XECA 4P91A 1FQVA 3UL9A 3ULUA 1QYYA 5AZ5A 2O6RA 4H09A 2Z62A 4LSXA 2FT3A 3E2JA 1Z7XW 2Z82A 3JB9j 4RCAB 2CA6A 1O6SA 4K17A 4AY9X 3PMHG 1PGVA 1M9SA 1OTNA 1DCEA 5AWAA 5AWCA 4R5CA 2P1OB 3W3LA 5IYXC 2P1MB 4CC4A 3OGMB 2Z66A 1OTMA 4GT6A 3UL8A 3WPDA 3RGZA 4ECOA 1M0ZA 3W3JA 4MQWX 4U06A 4ARRA 3WPGA 3W3MA 3ZYJA 4WYKA 4CNCA 4LXRA 3ULAA 3UN9A 5HZLB 4FS7A 2JQDA 4Q62A 4KXFB 2V9SA 2BNHA 3OGKB 3BZ5A 4CILA 4QC0A 4ECNA 3CVRA 3G04C 2ELLA 3CIYA 3RFJA 4FCGA 5GS0A 4XGOA 4XOSA 2OMTA 4R6AA 4R09A 3G3AA 2Z7XA 2OMWA 3RW7A 4Z94G 3ZYIA 4HQ1A 1OZNA 2WQWA 5FTTB 1O6TA 1XEUA 2R9UA 2Y5QA 4R6FA 4Q3IA 4YEBB 4P8SA 2UZXA 3WPIA 4LSCA 4CNMA 1FS2A 4Y61B 2OMUA
chains in the Genus database with same CATH superfamily
1W8AA 4BSRA 3M19A 1KOOA 4Z61C 2Z63A 2BEXA 4NZTM 5IJBA 4PERA 4LI2A 1GWBA 5AWBA 1P9AG 3ZYNA 4NKHA 3G39A 3WN4A 3C6NB 2OMVA 1A9NA 2P1QB 3W3NA 3E6JA 1WWLA 3C6PB 2WFHA 1KOHA 3P72A 1DFJI 4R08A 3UL7A 3GOZA 5IJDA 2IFGA 4RCWA 3W3KA 1M9LA 3OGLB 4NKGA 4V2CA 3VQ1A 1U0ND 4J0MA 4KNGA 4AW4A 1FO1A 1OTOA 1YRGA 4C2AB 2V9TB 1K5GC 2Z64A 4PEQB 5CMPA 3RFSA 4LXSA 2WQVA 2ID5A 4CP6A 4V2EA 5IJCA 4IM6A 2UZYA 3FXIA 5LFNA 3RJ0A 3O53A 1DS9A 3WPBA 4PSJA 3E3ZA 4V2DA 4Z8GA 3RFEA 2ASTB 5GS2B 4R07A 2V70A 4R6JA 1OOKG 3G3BA 5AWDA 4C2BB 2XWTC 4QBZA 3M18A 4EZGA 5D3IA 4UFRA 3SB4A 2WQXA 4M7EC 4L3AA 4QXEA 4LSAA 3A79B 1K5DC 3RW6A 1JL5A 3REZA 3KJ4A 2JE0A 1XCDA 1D0BA 1O6VA 4LSXC 3ZYOA 2WQUA 4B8CD 3OJAA 4J4LA 4LI1A 4MN8B 4FMZA 1OGQA 1XKUA 3TSRE 4OQTA 2OMZA 5GMHA 1ZIWA 4CC4C 4R0AA 1H6TA 4ARNA 3G06A 4WP6A 3WPCA 4R5DA 5GQRK 3RGXA 1P8VA 5GMGA 4TZHA 2Q4GW 1FT8A 3RIZA 4XSQA 4Z79A 4U7LA 1G9UA 4BV4R 2Z65A 2RR6A 3WPHA 4I6JB 3ULVA 3CIGA 1LTXA 1A4YA 2A0ZA 4Q3GA 3W3GA 2OMYA 3DZEA 2XOTA 1P8TA 4FHOA 2OMXA 4PKIG 4U09A 2JE1A 2P1PB 1IO0A 2ASSB 4FD0A 2O6SA 2Z7XB 4BSSA 4PQ8A 4G8AA 3VQ2A 4R6GA 4RWTC 4GLPA 1H6UA 2O6QA 5GMFA 5CMNA 3O6NA 4FDWA 5B4PA 2P1NB 5B0TA 2RA8A 5A5CA 4Z64C 2Z81A 4U08A 4KT1A 4R58A 5B0NA 4BSUA 3WPEA 3OJAB 4L3FA 4M7EA 1XWDC 1M10B 3WPFA 1SQ0B 3C6OB 5HDHA 3E4GA 1XECA 4P91A 1FQVA 3UL9A 3ULUA 1QYYA 5AZ5A 2O6RA 4H09A 4NZRM 2Z62A 4LSXA 2FT3A 3E2JA 1Z7XW 2Z82A 3JB9j 4RCAB 2CA6A 1O6SA 4K17A 4AY9X 3PMHG 1PGVA 1M9SA 1OTNA 1DCEA 5AWAA 5AWCA 4R5CA 2P1OB 3W3LA 5IYXC 2P1MB 4CC4A 3OGMB 2Z66A 1OTMA 4GT6A 3UL8A 3WPDA 3RGZA 4ECOA 1M0ZA 3W3JA 4MQWX 4U06A 4ARRA 3WPGA 3W3MA 3ZYJA 4WYKA 4CNCA 4LXRA 3ULAA 3UN9A 5HZLB 4FS7A 2JQDA 4Q62A 4KXFB 2V9SA 2BNHA 3OGKB 3BZ5A 4CILA 4QC0A 4ECNA 3CVRA 3G04C 2ELLA 3CIYA 3RFJA 4FCGA 5GS0A 4XGOA 4XOSA 2OMTA 4R6AA 4R09A 3G3AA 2Z7XA 2OMWA 3RW7A 4Z94G 3ZYIA 4HQ1A 1OZNA 2WQWA 5FTTB 1O6TA 1XEUA 2R9UA 2Y5QA 4R6FA 4Q3IA 4YEBB 4P8SA 2UZXA 3WPIA 4LSCA 4CNMA 1FS2A 4Y61B 2OMUA
chains in the Genus database with same CATH topology
1W8AA 4BSRA 3M19A 1KOOA 4Z61C 2Z63A 2BEXA 5IJBA 4PERA 4LI2A 1GWBA 5AWBA 1P9AG 3ZYNA 4NKHA 3G39A 3WN4A 3C6NB 2OMVA 1A9NA 2P1QB 3W3NA 3E6JA 1WWLA 3C6PB 2WFHA 1KOHA 3P72A 1DFJI 4R08A 3UL7A 3GOZA 5IJDA 2IFGA 4RCWA 3W3KA 1M9LA 3OGLB 4NKGA 4V2CA 3VQ1A 1U0ND 4J0MA 4KNGA 4AW4A 1FO1A 1OTOA 1YRGA 4C2AB 2V9TB 1K5GC 2Z64A 4PEQB 5CMPA 3RFSA 4LXSA 2WQVA 2ID5A 4CP6A 4V2EA 5IJCA 4IM6A 2UZYA 3FXIA 5LFNA 3RJ0A 3O53A 1DS9A 3WPBA 4PSJA 3E3ZA 4V2DA 4Z8GA 3RFEA 2ASTB 5GS2B 4R07A 2V70A 4R6JA 1OOKG 3G3BA 5AWDA 4C2BB 2XWTC 4QBZA 3M18A 4EZGA 5D3IA 4UFRA 3SB4A 2WQXA 4M7EC 4L3AA 4QXEA 4LSAA 3A79B 1K5DC 3RW6A 1JL5A 3REZA 3KJ4A 2JE0A 1XCDA 1D0BA 1O6VA 4LSXC 3ZYOA 2WQUA 4B8CD 3OJAA 4J4LA 4LI1A 4MN8B 4FMZA 1OGQA 1XKUA 3TSRE 4OQTA 2OMZA 5GMHA 1ZIWA 4CC4C 4R0AA 1H6TA 4ARNA 3G06A 4WP6A 3WPCA 4R5DA 5GQRK 3RGXA 1P8VA 5GMGA 4TZHA 2Q4GW 1FT8A 3RIZA 4XSQA 4Z79A 4U7LA 1G9UA 4BV4R 2Z65A 2RR6A 3WPHA 4I6JB 3ULVA 3CIGA 1LTXA 1A4YA 2A0ZA 4Q3GA 3W3GA 2OMYA 3DZEA 2XOTA 1P8TA 4FHOA 2OMXA 4PKIG 4U09A 2JE1A 2P1PB 1IO0A 2ASSB 4FD0A 2O6SA 2Z7XB 4BSSA 4PQ8A 4G8AA 3VQ2A 4R6GA 4RWTC 4GLPA 1H6UA 2O6QA 5GMFA 5CMNA 3O6NA 4FDWA 5B4PA 2P1NB 5B0TA 2RA8A 5A5CA 4Z64C 2Z81A 4U08A 4KT1A 4R58A 5B0NA 4BSUA 3WPEA 3OJAB 4L3FA 4M7EA 1XWDC 1M10B 3WPFA 1SQ0B 3C6OB 5HDHA 3E4GA 1XECA 4P91A 1FQVA 3UL9A 3ULUA 1QYYA 5AZ5A 2O6RA 4H09A 2Z62A 4LSXA 2FT3A 3E2JA 1Z7XW 2Z82A 3JB9j 4RCAB 2CA6A 1O6SA 4K17A 4AY9X 3PMHG 1PGVA 1M9SA 1OTNA 1DCEA 5AWAA 5AWCA 4R5CA 2P1OB 3W3LA 5IYXC 2P1MB 4CC4A 3OGMB 2Z66A 1OTMA 4GT6A 3UL8A 3WPDA 3RGZA 4ECOA 1M0ZA 3W3JA 4MQWX 4U06A 4ARRA 3WPGA 3W3MA 3ZYJA 4WYKA 4CNCA 4LXRA 3ULAA 3UN9A 5HZLB 4FS7A 2JQDA 4Q62A 4KXFB 2V9SA 2BNHA 3OGKB 3BZ5A 4CILA 4QC0A 4ECNA 3CVRA 3G04C 2ELLA 3CIYA 3RFJA 4FCGA 5GS0A 4XGOA 4XOSA 2OMTA 4R6AA 4R09A 3G3AA 2Z7XA 2OMWA 3RW7A 4Z94G 3ZYIA 4HQ1A 1OZNA 2WQWA 5FTTB 1O6TA 1XEUA 2R9UA 2Y5QA 4R6FA 4Q3IA 4YEBB 4P8SA 2UZXA 3WPIA 4LSCA 4CNMA 1FS2A 4Y61B 2OMUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W8A A;  4BSR A;  3M19 A;  1KOO A;  4Z61 C;  2Z63 A;  2BEX A;  5IJB A;  4PER A;  4LI2 A;  1GWB A;  5AWB A;  1P9A G;  3ZYN A;  4NKH A;  3G39 A;  3WN4 A;  3C6N B;  2OMV A;  1A9N A;  2P1Q B;  3W3N A;  3E6J A;  1WWL A;  3C6P B;  2WFH A;  1KOH A;  3P72 A;  1DFJ I;  4R08 A;  3UL7 A;  3GOZ A;  5IJD A;  2IFG A;  4RCW A;  3W3K A;  1M9L A;  3OGL B;  4NKG A;  4V2C A;  3VQ1 A;  1U0N D;  4J0M A;  4KNG A;  4AW4 A;  1FO1 A;  1OTO A;  1YRG A;  4C2A B;  2V9T B;  1K5G C;  2Z64 A;  4PEQ B;  5CMP A;  3RFS A;  4LXS A;  2WQV A;  2ID5 A;  4CP6 A;  4V2E A;  5IJC A;  4IM6 A;  2UZY A;  3FXI A;  5LFN A;  3RJ0 A;  3O53 A;  1DS9 A;  3WPB A;  4PSJ A;  3E3Z A;  4V2D A;  4Z8G A;  3RFE A;  2AST B;  5GS2 B;  4R07 A;  2V70 A;  4R6J A;  1OOK G;  3G3B A;  5AWD A;  4C2B B;  2XWT C;  4QBZ A;  3M18 A;  4EZG A;  5D3I A;  4UFR A;  3SB4 A;  2WQX A;  4M7E C;  4L3A A;  4QXE A;  4LSA A;  3A79 B;  1K5D C;  3RW6 A;  1JL5 A;  3REZ A;  3KJ4 A;  2JE0 A;  1XCD A;  1D0B A;  1O6V A;  4LSX C;  3ZYO A;  2WQU A;  4B8C D;  3OJA A;  4J4L A;  4LI1 A;  4MN8 B;  4FMZ A;  1OGQ A;  1XKU A;  3TSR E;  4OQT A;  2OMZ A;  5GMH A;  1ZIW A;  4CC4 C;  4R0A A;  1H6T A;  4ARN A;  3G06 A;  4WP6 A;  3WPC A;  4R5D A;  5GQR K;  3RGX A;  1P8V A;  5GMG A;  4TZH A;  2Q4G W;  1FT8 A;  3RIZ A;  4XSQ A;  4Z79 A;  4U7L A;  1G9U A;  4BV4 R;  2Z65 A;  2RR6 A;  3WPH A;  4I6J B;  3ULV A;  3CIG A;  1LTX A;  1A4Y A;  2A0Z A;  4Q3G A;  3W3G A;  2OMY A;  3DZE A;  2XOT A;  1P8T A;  4FHO A;  2OMX A;  4PKI G;  4U09 A;  2JE1 A;  2P1P B;  1IO0 A;  2ASS B;  4FD0 A;  2O6S A;  2Z7X B;  4BSS A;  4PQ8 A;  4G8A A;  3VQ2 A;  4R6G A;  4RWT C;  4GLP A;  1H6U A;  2O6Q A;  5GMF A;  5CMN A;  3O6N A;  4FDW A;  5B4P A;  2P1N B;  5B0T A;  2RA8 A;  5A5C A;  4Z64 C;  2Z81 A;  4U08 A;  4KT1 A;  4R58 A;  5B0N A;  4BSU A;  3WPE A;  3OJA B;  4L3F A;  4M7E A;  1XWD C;  1M10 B;  3WPF A;  1SQ0 B;  3C6O B;  5HDH A;  3E4G A;  1XEC A;  4P91 A;  1FQV A;  3UL9 A;  3ULU A;  1QYY A;  5AZ5 A;  2O6R A;  4H09 A;  2Z62 A;  4LSX A;  2FT3 A;  3E2J A;  1Z7X W;  2Z82 A;  3JB9 j;  4RCA B;  2CA6 A;  1O6S A;  4K17 A;  4AY9 X;  3PMH G;  1PGV A;  1M9S A;  1OTN A;  1DCE A;  5AWA A;  5AWC A;  4R5C A;  2P1O B;  3W3L A;  5IYX C;  2P1M B;  4CC4 A;  3OGM B;  2Z66 A;  1OTM A;  4GT6 A;  3UL8 A;  3WPD A;  3RGZ A;  4ECO A;  1M0Z A;  3W3J A;  4MQW X;  4U06 A;  4ARR A;  3WPG A;  3W3M A;  3ZYJ A;  4WYK A;  4CNC A;  4LXR A;  3ULA A;  3UN9 A;  5HZL B;  4FS7 A;  2JQD A;  4Q62 A;  4KXF B;  2V9S A;  2BNH A;  3OGK B;  3BZ5 A;  4CIL A;  4QC0 A;  4ECN A;  3CVR A;  3G04 C;  2ELL A;  3CIY A;  3RFJ A;  4FCG A;  5GS0 A;  4XGO A;  4XOS A;  2OMT A;  4R6A A;  4R09 A;  3G3A A;  2Z7X A;  2OMW A;  3RW7 A;  4Z94 G;  3ZYI A;  4HQ1 A;  1OZN A;  2WQW A;  5FTT B;  1O6T A;  1XEU A;  2R9U A;  2Y5Q A;  4R6F A;  4Q3I A;  4YEB B;  4P8S A;  2UZX A;  3WPI A;  4LSC A;  4CNM A;  1FS2 A;  4Y61 B;  2OMU A; 
#chains in the Genus database with same CATH topology
 1W8A A;  4BSR A;  3M19 A;  1KOO A;  4Z61 C;  2Z63 A;  2BEX A;  4NZT M;  5IJB A;  4PER A;  4LI2 A;  1GWB A;  5AWB A;  1P9A G;  3ZYN A;  4NKH A;  3G39 A;  3WN4 A;  3C6N B;  2OMV A;  1A9N A;  2P1Q B;  3W3N A;  3E6J A;  1WWL A;  3C6P B;  2WFH A;  1KOH A;  3P72 A;  1DFJ I;  4R08 A;  3UL7 A;  3GOZ A;  5IJD A;  2IFG A;  4RCW A;  3W3K A;  1M9L A;  3OGL B;  4NKG A;  4V2C A;  3VQ1 A;  1U0N D;  4J0M A;  4KNG A;  4AW4 A;  1FO1 A;  1OTO A;  1YRG A;  4C2A B;  2V9T B;  1K5G C;  2Z64 A;  4PEQ B;  5CMP A;  3RFS A;  4LXS A;  2WQV A;  2ID5 A;  4CP6 A;  4V2E A;  5IJC A;  4IM6 A;  2UZY A;  3FXI A;  5LFN A;  3RJ0 A;  3O53 A;  1DS9 A;  3WPB A;  4PSJ A;  3E3Z A;  4V2D A;  4Z8G A;  3RFE A;  2AST B;  5GS2 B;  4R07 A;  2V70 A;  4R6J A;  1OOK G;  3G3B A;  5AWD A;  4C2B B;  2XWT C;  4QBZ A;  3M18 A;  4EZG A;  5D3I A;  4UFR A;  3SB4 A;  2WQX A;  4M7E C;  4L3A A;  4QXE A;  4LSA A;  3A79 B;  1K5D C;  3RW6 A;  1JL5 A;  3REZ A;  3KJ4 A;  2JE0 A;  1XCD A;  1D0B A;  1O6V A;  4LSX C;  3ZYO A;  2WQU A;  4B8C D;  3OJA A;  4J4L A;  4LI1 A;  4MN8 B;  4FMZ A;  1OGQ A;  1XKU A;  3TSR E;  4OQT A;  2OMZ A;  5GMH A;  1ZIW A;  4CC4 C;  4R0A A;  1H6T A;  4ARN A;  3G06 A;  4WP6 A;  3WPC A;  4R5D A;  5GQR K;  3RGX A;  1P8V A;  5GMG A;  4TZH A;  2Q4G W;  1FT8 A;  3RIZ A;  4XSQ A;  4Z79 A;  4U7L A;  1G9U A;  4BV4 R;  2Z65 A;  2RR6 A;  3WPH A;  4I6J B;  3ULV A;  3CIG A;  1LTX A;  1A4Y A;  2A0Z A;  4Q3G A;  3W3G A;  2OMY A;  3DZE A;  2XOT A;  1P8T A;  4FHO A;  2OMX A;  4PKI G;  4U09 A;  2JE1 A;  2P1P B;  1IO0 A;  2ASS B;  4FD0 A;  2O6S A;  2Z7X B;  4BSS A;  4PQ8 A;  4G8A A;  3VQ2 A;  4R6G A;  4RWT C;  4GLP A;  1H6U A;  2O6Q A;  5GMF A;  5CMN A;  3O6N A;  4FDW A;  5B4P A;  2P1N B;  5B0T A;  2RA8 A;  5A5C A;  4Z64 C;  2Z81 A;  4U08 A;  4KT1 A;  4R58 A;  5B0N A;  4BSU A;  3WPE A;  3OJA B;  4L3F A;  4M7E A;  1XWD C;  1M10 B;  3WPF A;  1SQ0 B;  3C6O B;  5HDH A;  3E4G A;  1XEC A;  4P91 A;  1FQV A;  3UL9 A;  3ULU A;  1QYY A;  5AZ5 A;  2O6R A;  4H09 A;  4NZR M;  2Z62 A;  4LSX A;  2FT3 A;  3E2J A;  1Z7X W;  2Z82 A;  3JB9 j;  4RCA B;  2CA6 A;  1O6S A;  4K17 A;  4AY9 X;  3PMH G;  1PGV A;  1M9S A;  1OTN A;  1DCE A;  5AWA A;  5AWC A;  4R5C A;  2P1O B;  3W3L A;  5IYX C;  2P1M B;  4CC4 A;  3OGM B;  2Z66 A;  1OTM A;  4GT6 A;  3UL8 A;  3WPD A;  3RGZ A;  4ECO A;  1M0Z A;  3W3J A;  4MQW X;  4U06 A;  4ARR A;  3WPG A;  3W3M A;  3ZYJ A;  4WYK A;  4CNC A;  4LXR A;  3ULA A;  3UN9 A;  5HZL B;  4FS7 A;  2JQD A;  4Q62 A;  4KXF B;  2V9S A;  2BNH A;  3OGK B;  3BZ5 A;  4CIL A;  4QC0 A;  4ECN A;  3CVR A;  3G04 C;  2ELL A;  3CIY A;  3RFJ A;  4FCG A;  5GS0 A;  4XGO A;  4XOS A;  2OMT A;  4R6A A;  4R09 A;  3G3A A;  2Z7X A;  2OMW A;  3RW7 A;  4Z94 G;  3ZYI A;  4HQ1 A;  1OZN A;  2WQW A;  5FTT B;  1O6T A;  1XEU A;  2R9U A;  2Y5Q A;  4R6F A;  4Q3I A;  4YEB B;  4P8S A;  2UZX A;  3WPI A;  4LSC A;  4CNM A;  1FS2 A;  4Y61 B;  2OMU A; 
#chains in the Genus database with same CATH homology
 1W8A A;  4BSR A;  3M19 A;  1KOO A;  4Z61 C;  2Z63 A;  2BEX A;  5IJB A;  4PER A;  4LI2 A;  1GWB A;  5AWB A;  1P9A G;  3ZYN A;  4NKH A;  3G39 A;  3WN4 A;  3C6N B;  2OMV A;  1A9N A;  2P1Q B;  3W3N A;  3E6J A;  1WWL A;  3C6P B;  2WFH A;  1KOH A;  3P72 A;  1DFJ I;  4R08 A;  3UL7 A;  3GOZ A;  5IJD A;  2IFG A;  4RCW A;  3W3K A;  1M9L A;  3OGL B;  4NKG A;  4V2C A;  3VQ1 A;  1U0N D;  4J0M A;  4KNG A;  4AW4 A;  1FO1 A;  1OTO A;  1YRG A;  4C2A B;  2V9T B;  1K5G C;  2Z64 A;  4PEQ B;  5CMP A;  3RFS A;  4LXS A;  2WQV A;  2ID5 A;  4CP6 A;  4V2E A;  5IJC A;  4IM6 A;  2UZY A;  3FXI A;  5LFN A;  3RJ0 A;  3O53 A;  1DS9 A;  3WPB A;  4PSJ A;  3E3Z A;  4V2D A;  4Z8G A;  3RFE A;  2AST B;  5GS2 B;  4R07 A;  2V70 A;  4R6J A;  1OOK G;  3G3B A;  5AWD A;  4C2B B;  2XWT C;  4QBZ A;  3M18 A;  4EZG A;  5D3I A;  4UFR A;  3SB4 A;  2WQX A;  4M7E C;  4L3A A;  4QXE A;  4LSA A;  3A79 B;  1K5D C;  3RW6 A;  1JL5 A;  3REZ A;  3KJ4 A;  2JE0 A;  1XCD A;  1D0B A;  1O6V A;  4LSX C;  3ZYO A;  2WQU A;  4B8C D;  3OJA A;  4J4L A;  4LI1 A;  4MN8 B;  4FMZ A;  1OGQ A;  1XKU A;  3TSR E;  4OQT A;  2OMZ A;  5GMH A;  1ZIW A;  4CC4 C;  4R0A A;  1H6T A;  4ARN A;  3G06 A;  4WP6 A;  3WPC A;  4R5D A;  5GQR K;  3RGX A;  1P8V A;  5GMG A;  4TZH A;  2Q4G W;  1FT8 A;  3RIZ A;  4XSQ A;  4Z79 A;  4U7L A;  1G9U A;  4BV4 R;  2Z65 A;  2RR6 A;  3WPH A;  4I6J B;  3ULV A;  3CIG A;  1LTX A;  1A4Y A;  2A0Z A;  4Q3G A;  3W3G A;  2OMY A;  3DZE A;  2XOT A;  1P8T A;  4FHO A;  2OMX A;  4PKI G;  4U09 A;  2JE1 A;  2P1P B;  1IO0 A;  2ASS B;  4FD0 A;  2O6S A;  2Z7X B;  4BSS A;  4PQ8 A;  4G8A A;  3VQ2 A;  4R6G A;  4RWT C;  4GLP A;  1H6U A;  2O6Q A;  5GMF A;  5CMN A;  3O6N A;  4FDW A;  5B4P A;  2P1N B;  5B0T A;  2RA8 A;  5A5C A;  4Z64 C;  2Z81 A;  4U08 A;  4KT1 A;  4R58 A;  5B0N A;  4BSU A;  3WPE A;  3OJA B;  4L3F A;  4M7E A;  1XWD C;  1M10 B;  3WPF A;  1SQ0 B;  3C6O B;  5HDH A;  3E4G A;  1XEC A;  4P91 A;  1FQV A;  3UL9 A;  3ULU A;  1QYY A;  5AZ5 A;  2O6R A;  4H09 A;  2Z62 A;  4LSX A;  2FT3 A;  3E2J A;  1Z7X W;  2Z82 A;  3JB9 j;  4RCA B;  2CA6 A;  1O6S A;  4K17 A;  4AY9 X;  3PMH G;  1PGV A;  1M9S A;  1OTN A;  1DCE A;  5AWA A;  5AWC A;  4R5C A;  2P1O B;  3W3L A;  5IYX C;  2P1M B;  4CC4 A;  3OGM B;  2Z66 A;  1OTM A;  4GT6 A;  3UL8 A;  3WPD A;  3RGZ A;  4ECO A;  1M0Z A;  3W3J A;  4MQW X;  4U06 A;  4ARR A;  3WPG A;  3W3M A;  3ZYJ A;  4WYK A;  4CNC A;  4LXR A;  3ULA A;  3UN9 A;  5HZL B;  4FS7 A;  2JQD A;  4Q62 A;  4KXF B;  2V9S A;  2BNH A;  3OGK B;  3BZ5 A;  4CIL A;  4QC0 A;  4ECN A;  3CVR A;  3G04 C;  2ELL A;  3CIY A;  3RFJ A;  4FCG A;  5GS0 A;  4XGO A;  4XOS A;  2OMT A;  4R6A A;  4R09 A;  3G3A A;  2Z7X A;  2OMW A;  3RW7 A;  4Z94 G;  3ZYI A;  4HQ1 A;  1OZN A;  2WQW A;  5FTT B;  1O6T A;  1XEU A;  2R9U A;  2Y5Q A;  4R6F A;  4Q3I A;  4YEB B;  4P8S A;  2UZX A;  3WPI A;  4LSC A;  4CNM A;  1FS2 A;  4Y61 B;  2OMU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...