5GOTA

Crystal structure of sp-ptp, low molecular weight protein tyrosine phosphatase from streptococcus pyogenes
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
150
structure length
150
Chain Sequence
MKKVCFVCLGNICRSPMAEFVMKSIVSSDVMMIESRATSDWEHGNPIHSGTQSILKTYQINYDITKCSKQITITDFNTFDYIIGMDSDNVKNLKEMSQHQWDSKIYLFREGGVPDPWYTNDFEETYQLVRKGCQDWLSRLMSKEYLEHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Low molecular weight phosphotyrosine phosphatase family prot
publication title Crystal structure of SP-PTP, a low molecular weight protein tyrosine phosphatase from Streptococcus pyogenes
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Hydrolase
total genus 60
structure length 150
sequence length 150
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2016-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5gotA00
3QEMA 2CWDA 1E6KA 3H6GA 2YHAA 3HEBA 3M9WA 4GPAA 1QNLA 2LPMA 1C0EA 4RK0A 2ID7A 3FMVA 4P98A 1NXWA 5F64A 1QP7A 1OXBB 4PZ0A 4P1ZA 2IOYA 4ETIA 3F6CA 3FDFA 2FEWB 4Z0NA 3O1HB 4RZSA 5T7BA 3HK2A 4KK4A 3W9SA 4DQDA 3M6MD 4MR7A 3CZ5A 3OLXA 1D1PA 3QX9A 2WRZA 1NXXA 1P6UA 2ZWMA 3ILYA 3TD9A 2WB4A 5IEJA 1BDIA 1BDJA 2R47A 3DZDA 2WMYA 1PHRA 1ZH4A 4M88A 1DC8A 3H5OA 1NXOA 4L85A 3IP5A 1KGSA 3OQMA 5E3JA 4F06A 4H60A 1NXPA 2A9QA 2PUAA 4OLBA 1ZDMA 4KZKA 1JL3A 4OTZA 4MQEA 4XXHA 1VPWA 4DADA 2N9UA 1JYEA 4IRXA 4OG2A 1E6LA 2FLKA 2FN8A 2A9OA 4EGSA 2FKAA 4LE0A 3EQ2A 4XARA 3FGZA 1JFTA 3DGFC 1EWVA 1U04A 4UHKA 4LE2A 3NBMA 5BQ3A 1LJLA 1ISRA 2QVGA 4NCAA 4F3TA 2CD7A 2IKSA 2O20A 4MGEA 2PAFA 3MA0A 2B1JA 3GV0A 2LP4Y 3URMA 1TVMA 2PMCA 2P9HA 4WZZA 4MS3A 3QEKA 4S04A 3RVMA 3O2QB 3BRQA 4RSMA 5DGCA 4N47A 2V0NA 1Z26A 1USIA 3JPWA 3O1IC 3OMXA 3Q15C 2QR3A 3RVSA 3QX8A 5ABPA 2FW0A 1K68A 3O2SB 1JYFA 1BDHA 2PUGA 4JOQA 3BREA 1JFVA 1USGA 5KI6A 3K4HA 3IPAA 2QSJA 2NT3A 2QW1A 3LUDA 5FWXA 4Z4HA 2FVYA 4G0PA 1QKKA 4RK1A 1W9HA 1PNTA 2FMFA 2R4QA 2WY2D 4YWHA 1DG9A 3HS3A 4FE7A 1VLZA 3CU5A 1MAVA 1EWTA 5TPZD 4ZPJA 4MLCA 3TB6A 1CHNA 4MS3B 3VNBA 2RJNA 3EAFA 2JVIA 3IDOA 2F8TA 1ZHHA 1U8TA 2M1ZA 3D02A 3C6QA 3CZCA 5JNRA 3TO5A 1BA2A 1DP4A 3HUUA 2L17A 5IULC 4NCBA 5BRJA 3H6HA 3C3KA 3MIZA 1SD5A 1KMIY 5FWXB 4XAQA 3EDCA 3I45A 3SM9A 1GUDA 1DC7A 1M5UA 5ED4A 3RVPA 4YO7A 4OLAA 4Z9BA 4H3KB 4MPTA 4E7PA 5KQPA 2IPMA 3CTPA 3KLOA 4O1IA 5KC8A 3QK7A 3LKVA 4Z4IA 4RXTA 3HZHA 1GUBA 4Z4EA 3EJWA 5I4CA 2M98A 3LUHA 5IUJC 1ZGGA 4RK7A 2Q5CA 3KSMA 1ABEA 4L4UA 4QYWA 2I6FA 3GBVA 5HKOA 2PUEA 4RS3A 2GKGA 1Z2EA 3LUAA 3H5TA 3IP6A 3F73A 4KPYA 2A9PA 4MS1A 1QP0A 4PE5B 2MYNA 4FE4A 2FMHA 1M2EA 1SXIA 1UDRA 2QVCA 3KG2A 4IILA 4JP1A 4N0QA 1URPA 4LX8A 4EY3A 1CEYA 3A3KA 3OLZA 3LFTA 4F8JA 5KWSA 1EHCA 5GOTA 3CS3A 1IIBA 4RXMA 1RXEA 4NQRA 1JDPA 3N0XA 3BBLA 3H5LA 3IPCA 4QYMA 4W5OA 3QLUC 1TJYA 2QU7A 5DKFA 1JHZA 1D4ZA 4EUKA 3SNKA 4W5RA 4WXEA 4YP9A 3LUFA 2JBAB 3G1WA 3NHMA 1ZN2A 4MS4A 4HNSA 1RPJA 1ZAYA 3MM4A 2KYRA 4MR9A 3ROTA 4MRMA 5GQSA 3SAJA 2RGYA 3NNSA 1Z17A 3HXMA 2PJUA 3GT7A 1NXSA 3TX6A 4EVRA 3D8UA 4G0XA 4Z9AA 3HDVA 2IPNA 5DTEA 4EVQA 3CNBA 3QELB 1YTUA 3Q7RA 1XHFA 3F7NA 2FXIA 3QEMB 4KRFA 4Y9TA 1QO0D 2IYNA 3Q9SA 2FEPA 1JLKA 2HQOA 1LK0A 4MS4B 1DBWA 4YR7A 1DRKA 4YV7A 1RZRA 5KQMA 4JASB 4RWEA 4S05A 4W5NA 2R48A 4YGXB 3RH0A 3RVNA 4B09A 1QQBA 3E61A 3QLUA 1DBPA 2L18A 3OM1A 1VRVA 2FQYA 5T3YA 1T34A 5BR1A 1U2QA 1APBA 2P4UA 4G86A 4RK6A 2QZJA 4MR7B 1ISSA 1NTRA 3OLVA 1TLFA 1TM2A 4NV3A 3H1EA 4MYRA 3KLNA 3R0JA 2FTKE 2BGGA 2NT4A 1M2FA 1XHEA 2E4WA 2WJWA 3I42A 2R25B 2AYZA 3M9XA 1YVUA 2L2QA 3H5IA 3DLBA 4UHJA 2A9RA 2QV0A 5FBHA 3RQIA 2J48A 1Y1LA 4ZMRA 3UK0A 3OLWA 4YS6A 1Z15A 3KYJB 3Q41A 2RJOA 2L19A 4OATA 3A0UA 1ZVVA 3H1GA 2E4YA 2IPLA 4XLTA 2WWVD 2FQXA 1JX6A 1DZ3A 5TPWA 3KTOA 4F12A 2VK2A 4O5AA 4LE1A 4MQEB 1P6QA 2PLNA 4Q6WA 1Z18A 5EWLA 3MYYA 2AYXA 4LDZA 4RK4A 3A0RB 3CG4A 1ZITA 1Z25A 3H75A 3FFTA 1YS7A 4KFCA 4LRQA 5TE9A 2MYUA 4G0ZA 5CNJA 4ETNA 3O75A 3ROFA 1U2PA 2LIVA 1Z16A 3T8YA 3N75A 3GA5A 1A0OA 3IP9A 4HYEA 1EFAA 4G0QA 3OM0A 1EAYA 4Z99A 5TQ0A 3BRSA 4QICA 1AB5A 1NY5A 2FEKA 5TPZA 1L5ZA 1JDNA 1QMPA 5TPWB 5C5EA 4ZJPA 2VYCA 3N8IA 5IEBA 4FB4A 1BVHA 3RVQA 1GCAA 2MSWA 4EVSA 1QQAA 2H3HA 2QXYA 3Q7SA 3S99A 1D2AA 2FQWA 3GL9A 3OO1A 1B00A 6CHYA 4YLEA 1CYEA 2MYTA 3RVJA 2IDMA 3O2JA 4PYRA 5TQ2A 2HQBA 5BRAA 4N41A 4OBBA 1VKRA 5EWJA 4JB2A 1Z13A 4ETMA 3KJXA 4G97A 2VUHB 3E3MA 4KQCA 5TQ0B 5IBQA 5IC5A 1JBEA 3H5WA 4Z4CA 2JCGA 3NNNA 2HPHA 5JNTA 3HJFA 3C3MA 3QLVC 5KC9A 3FFWA 2CHFA 1GLGA 2OENG 4E7OA 3G85A 2DRIA 2CHEA 3KS9A 2E4VA 1K66A 5IUKC 1SXHA 3JVDA 3GYBA 1DRJA 3CLKA 4F11A 4KK3A 4JA2A 5B3JC 2E4ZA 5TQ2B 4EYQA 5HSGA 5JS1A 1WETA 1KRWA 1W25A 2E4UA 2FN9A 3O21A 4Q7EA 2FMKA 3UKJA 2MYPA 1LBIA 3I5AA 5HM6A 1YIOA 3BILA 1RNLA 5IUNC 1NXVA 2TMYA 1PEYA 9ABPA 2FLWA 4EYKA 1H9CA 4O1HA 4RY9A 4MS1B 3EQZA 1FQWA 3N53A 1I3CA 3SG0A 2JVKA 3LUKA 4G0MA 3LMKA 4RU1A 3L6UA 1FSPA 2NZVG 2PKXA 1YK1A 4JB0A 1BAPA 1Z2DA 4RV5A 4HNRA 2IPAB 4MAAA 4ZYLA 3QLVA 1QP4A 5IX8A 3JY6A 3JVIA 8ABPA 2GBPA 3JTEA 4Z4FA 4TLLB 2JRLA 4N76A 4KVFA 5CNMA 2MSLA 3C97A 2PUFA 1LBHA 4D74A 4LZLA 3IP7A 3KHTA 2HJ9A 1D1QA 4WT7A 5B3JA 3T38A 3EULA 3OMWA 4MR9B 3H5VA 1A04A 3TMYA 4MRMB 1QO0A 3O1JC 4DN6A 1YS6A 1YMUA 1HEYA 2JK1A 3FFXA 1LJUA 1SRRA 4YRZA 4WXMA 3LTEA 5JNSA 1MB0A 2JB9A 1FFSA 1ABFA 3DBIA 4PICA 3F6PA 3SY8A 5PNTA 5CNIA 3Q7TA 1RZRD 4MQFA 5JNUA 2HSGA 4QPJC 3LKBA 3CFYA 1JWLA 1L5YA 2H0AA 4TMYA 2HQRA 5JS2A 3HSYA 1ZH2A 3HUTA 3CHYA 1JFSA 3K9CA 2WJAA 2PE5A 2B4AA 3HV2A 1S8NA 3N0RA 1SXGA 1ZY2A 3OO0A 5C5CA 4KNYA 4RY8A 4XASA 3GBPA 1ZGZA 4IMJB 2NUBA 1FFWA 1MVOA 3DGEC 1KRXA 2GX6A 3C3WA 4WWHA 5JNVA 2VUIB 1ZESA 5EWMA 4GNRA 3JPYA 4ZMSA 4W5TA 3GRCA 1YK0A 3CRNA 3LUGA 1P2FA 4MQFB 1RXIA 4KQ9A 5TQJA 1Z12A 4KREA 3SQNA 3MMNA 3P9YA 2JVJA 1C4WA 3T6KA 4W5QA 2FMIA 4ML3A 3RVRA 1DBQA 4KMRA 3L49A 1DCKA 4JAVC 5DLEA 1DCMA 3OLYA 4LDAA 1F4VA 3I09A 5EWLB 1NXTA 2XDYA 1TMYA 1YMVA 4EYOA 3N0WA 5D2CA 5EWMB 3CG0A 2PUBA 3O74A 4RKRA 1M5TA 2PUCA 2LBPA 4TLMB 2F8SA 4RK5A 1GCGA 3VNAA 2ID9A 4H3HB 4NICA 1P8AA 4RDCA 1AB6A 4Q6BA 3N6VA 6ABPA 3UUGA 3H1FA 2NZUG 2RDMA 2X7XA 4CBVA 2OQRA 1XWWA 3OQNA 1PEAA 3RVOA 1E6MA 3DLHA 4KV7A 1DCFA 3A10A 3NNDA 5DCLA 5CHYA 5FWYA 1F51E 2PL1A 5FBKA 3MF4A 4MR8A 3EODA 3HDGA 2GI4A 3KYIB 3RVKA 3HCWA 2FSPA 3CKMA 2PUDA 4RY0A 2W42A 1FFGA 1EWKA 3EGCA 1R8JA 4G0OA 4G0YA 4RXUA 1MB3A 3HM9A 3HVRA 1PNRA 3B2NA 1JH9A 7ABPA 3HO1A 5EWJB 4Z4GA 2MSKA 1OXKB 3RVLA 1PUXA 2JBAA 1QPZA 4XFKA 3KCNA 1JF8A 4PEVA 2ZAYA 3LUCA 5HQJA 3LOPA 4EYGA 2GWRA 1E2BA 3ILHA 3MQ4A 5FWYB 1A2OA 1DJMA 2LUOA 4MR8B 3KKEA 2E4XA 2PL9A 4N03A 4TN5A 4IGAA 4WUTA 4D6YA 4YCSA 4HNQA 1U0SY 3NHZA 3OQOA 1USKA 1D5WA 2YHBA 3LUJA 4IF4A 3QLTA 5KQLA 1NATA 3GWGA 1MIHA 3JS5A 3T95A 3QELA 4MLDA 4D6XA 5CNKA 5JNWA 5KQGA 4RKQA 4N0PA 4IMIB 1J56A
chains in the Genus database with same CATH superfamily
1ZXBA 1MJGA 3OCVA 3T4XA 1U2GA 3H6GA 4ZEWA 5I47A 2XWPA 1E6WA 1XUOA 2QD1A 1HFWA 2HMVA 3KR9A 1UOEA 4WNIA 1HQCA 1NNLA 1JSCA 2QNIA 5C7LO 5LA6B 4ND4A 2CLEB 5GGXA 1XTPA 4B6EA 1E4EA 3H3XA 1R0WA 1RLJA 3D3KA 4P4SB 4WN3A 3BMXA 3KEFA 5H0IA 1LSSA 2PNJA 4BVJA 1E99A 3HCBA 4XFDA 3TEFA 3CEAA 3QX9A 1NXXA 1DX9A 1R6AA 4ZVUA 2BHRA 1QHSA 1UJMA 3LZ6A 1P74A 1SXJA 4G4JA 4KU4A 2P0EA 4W7SA 2QBYB 4W5JA 1U7HA 4FZJA 4B84A 2CYCA 3HCOA 1F38A 3D6UA 4QHSA 1A96A 2G1PA 3WRYA 3RTGA 2EBHX 2C4HA 2XWQA 3HG7A 2EKLA 2Q3BA 4M0LA 4GR4A 5AJHA 2WZQA 1GZDA 1OLXA 1RQXA 4RMGA 4DYHA 1FP7A 5EZYB 4KZKA 1JL3A 3HHPA 5J9FA 1DIHA 4MYDA 4W82A 5I5GA 4IRXA 1NSTA 5MGNA 3PA8A 1YMQA 2FDXA 2QI9F 2YKGA 3G79A 3WZ2A 3F7TA 1D09A 1IHOA 4EKNB 4RSGA 1EVYA 1AUOA 5DE3A 4DV4B 4UAVA 4MGEA 3UAXA 4PAQA 3TRFA 3LWBA 4NFLA 4DIEA 4JVMA 3PI7A 2JAXA 3V4VB 2F9LA 5HKKD 3N5CA 5J4KA 2KSQA 4HQ6A 4WZZA 1D6NA 3G8CA 4HQFA 1XCJA 3MJHA 1DC3A 3GR6A 1U7OA 2ZSKA 2I2WA 3GG9A 1VM6A 2FH5B 1F3LA 2XUAA 3PITA 4F9FA 4NTZA 1RI5A 3TSYA 3HH8A 3D1VA 3H9EO 2TSYB 3BREA 2X8BA 1EUQA 4BLSA 3V00A 4B6JA 1Y1KE 2AB0A 3BZWA 2NV2B 4E15A 1L9XA 1WXXA 3U62A 5JSZA 1TCBA 4OYHA 2ZT7A 4ZVPA 2X0NA 3WOHA 4C7MA 2AWNA 4EKYA 1GM5A 2C98A 2GGSA 3W9BA 4J0DA 5BQXA 1PV1A 2Q49A 2O8VA 2KE5A 3CU5A 2O05A 4PNZA 4B31A 1RHJA 4D4MA 5C37A 5EIEA 1IBLB 4UOEA 1TC1A 2JGRA 3OZUA 3TB6A 3ZQUA 1XL0A 3TDNA 2YIJA 3IDZA 4JLSA 3C24A 4BYMA 4DIOA 2F8TA 5DBEX 1Z2PX 2VYVA 2WMDA 3D6MA 3KB6A 4XX0B 1TVCA 2HIHA 3I6IA 3UV3A 1PL0A 3Q11A 2VT6A 3OECA 4RF2A 3RSFA 1P9WA 2PRIA 1NVUQ 2X4DA 2YJNA 3QVGA 4Q01A 2AXNA 2AZXA 4CIVA 2UZ1B 3QYAA 4C4OA 4IIJB 4G8CA 1Z6QA 1SD5A 1SKAA 2FUG6 3V33A 3C8UA 2C9YA 4EFLA 3GU3A 4BKUA 4W5HA 3RVPA 5TV2A 5DF1A 2JRCA 1CE8B 4X20B 1G16A 1ICIA 4QBTA 3CTPA 4EB8A 1A5TA 1GQQA 3D4IA 1Z5OA 2CMDA 4A0HA 3FSEA 3G2NA 4PLPA 2BTQB 4L74A 3STVA 2FR1A 4BN4A 4RXTA 1VG0B 1YZ3A 1MB2A 3A1SA 4L0QA 2FFRA 2XRYA 3ADOA 4BVLA 1KQGA 4X1YA 1OXUA 1DDGA 2CNKA 3JZFA 4OP1A 1K3TA 4R6XA 5JEEA 1RM0A 1SA0A 4NYMQ 3QE2A 3SS9X 2ZM5A 1FVOA 5FH9A 5CIWA 1TF7A 1X0VA 1VG9B 1BE8A 3D6JA 1OBFO 1V5FA 4PSDA 4R1PA 2FMHA 4CQMD 3NC0C 1NQVA 1X7WB 2ZIWB 1B23P 2QTMA 5J43A 3SIRA 2PKCA 1VRWA 3QX7A 4F8JA 3HBFA 3PVSA 4M7RA 3KSUA 1EVQA 3PQ5A 4RXMA 5EKSA 5EYPA 5TMBA 1JG2A 3IILA 2C4NA 1KHTA 5ILOA 2A58A 2UZ3A 2V45A 2YJZA 4FVTA 1DHRA 3X1YA 3QLUC 1LWOA 4GAEA 4YMLA 2PHZA 3VOTA 4LDQA 4KSBA 3EVDA 4AIRA 4YRMA 1XROA 3ABZA 4NH4A 3OZXA 5K0CA 2OGUA 1YUMA 4KR7A 3F4KA 5HCUA 5AOAA 5ELMA 4OL0A 1OA1A 4DCGA 3L0BA 4XPZA 3DBLA 3DB2A 3BBPA 4PAMA 1RJ9A 1T3LA 3LC1O 2LCIA 3ROTA 2BGJA 4M6WA 4HN4B 4M76B 1VDMA 4UXHA 1Z6GA 2O3QA 2YVKA 1KTVA 4TWJA 1T1GA 3J7AC 2PJUA 1RJGA 2GK4A 1NXSA 1EE9A 2RHLA 3SQLA 2WMNB 1T6ZA 1VCHA 3IODA 4QEKA 1Q1BA 1OAOC 2P1RA 1KY5A 1PK7A 4XEUA 3DHVA 4PM4A 1NR5A 1QS0B 3MRTA 2K7FA 1BH6A 4G0VA 1I13A 1M6EX 1N6KA 3IYLW 1U31A 3V1TC 4LF9B 2IYNA 5KDOA 1JXMA 4OFBA 4PGGA 1JLKA 1YB4A 2XQKA 4NV1A 4XVHA 5CVJA 4JDPA 3FGOA 3KR2A 1C3JA 1KWKA 3OM8A 4Y2JA 4YGXB 4YRNA 2DUUA 4Z51A 1RP1A 2IUTA 1W5BA 3BUSA 1L7PA 3DCNA 2X23A 3QLUA 4DMLA 2GN8A 3TTUA 5K8IA 4CL3A 1U5AA 1R12A 4L08A 4D9BA 3IE0A 2V65A 1TM2A 1QVWA 4XIFA 3W3ZB 3FOWA 5FR1A 4TMWA 3E03A 1KE1A 1EHIA 1XHEA 4W5WA 3KIPA 1J2TA 4PCUA 1R6BX 2AYZA 1SBHA 2OM6A 4EUEA 4UM9B 4P9NA 1EFKA 1ZISA 1CQIA 3RUFA 1NW4A 3PGLA 5ESDA 4XFJA 4QVIA 2XT6A 4M0PA 3R9XA 4EUHA 3TK1A 3RWOA 1S7CA 3RT7A 1KMHA 3H4MA 4WXPA 5LC1A 1IE3A 3FZEA 1H3EA 4O5AA 1IUPA 3A9SA 4EPTA 2O2YA 1HR0B 3FWHA 1FFXB 1OAOA 5G0SA 3W6PA 3MYYA 3DAOA 1NJ5A 4RLHA 3ABIA 4EFKA 3WRVA 3H75A 1JTEA 1VSBA 2OBXA 2QN1A 4YACA 3PS9A 3E9RA 3FUVA 3R3SA 3W4KA 2I66A 3L7YA 1C9EA 4MUJA 3O4HA 1K2VN 1S1MA 4FIDA 5CNJA 4CG2A 5F9FA 1U8EA 5IXSA 2BH2A 2YZ2A 4EG4A 3UM9A 3LH5A 4F4UA 4PSCA 1NNEA 4FDAA 1T4BA 2IS4A 4LX0A 2I7VA 2OUKA 1LV7A 3IT3A 3DTVA 3OFSA 4JP2A 3S7TA 1NJ6A 1EAYA 1JIUA 5TQ0A 3TXYA 4DE5A 1QH1A 1FXUA 2YZMA 1U8UA 2NZXA 3KL4A 1L5ZA 3CUTA 1DEXA 4BATA 1OGIA 4YT5A 4FB4A 3H84A 1Q84A 4YFVA 3QUAA 3HV0A 2JGFA 3KPVA 2IX3A 3HYCA 1QQAA 3D2LA 2XUQA 4QOHA 5CCDA 3ZHBA 2H3HA 3AU9A 2VPPA 3HCCA 3IVAA 3NT4A 3RTAA 1JJFA 6CHYA 3O91A 2O52A 2JGIA 3ZY5A 1Q14A 4XQGA 3HDQA 5JH7A 1FYXA 2HA3A 4MGKR 4ZAGA 2OXIA 4E5VA 1P1JA 1Q1NA 1VKRA 3ITEA 5JQGB 3P45A 1GITA 4TXHA 4MOWA 1O7JA 5E9JA 4BVBA 2AXPA 3WR5A 2E1PA 4ZZ0A 1U1EA 1DAIA 2PA3A 2H3EA 2W2PA 3A1EA 3EB9A 3SP1A 4B3DA 5CLJA 5ADHA 1PZEA 2XGGA 1KEEB 1KXZA 4Y6OA 5B12A 1WTCA 1ZD4A 2IIBA 2XE4A 4B34A 4EB3A 4F2DA 3TE7A 4DA4A 3PEWA 4IZHA 1PV2A 4ZZ2A 1YL5A 4GBMA 4QO8A 3A6FA 3WHLA 3ZLTA 1MENA 4EG0A 4GI5A 1FJ2A 2YRWA 4HEA6 4L2IA 5FO0A 4CNQA 2RAPA 1R50A 1R64A 1VJRA 3K1AA 4UCWA 5GINE 1EIWA 1WSBA 3AI2A 4EUNA 3DLAA 2FHPA 4XM0A 1SXJE 3GRFA 4DV5B 3AL0C 4KK3A 1XF9A 1S0UA 4IDCA 4KC0A 4G01B 1P4HA 1ZNWA 2JGDB 4KOAA 5JC8A 1T0UA 3GP5A 4L28A 1E9RA 1E3WA 3VO2A 2BF4A 1ESMA 2ZSHA 2E4UA 5U1PA 5CM2Z 1Z47A 1RFGE 1UXIA 2GESA 3R9KA 1UC4B 3QOXA 3LZCA 3QXXA 3EVCA 4F97A 2H1LA 5GM2A 1E9SA 5G4KA 3IKMB 3KWJA 2ZBPA 9ATCA 4RTMA 5B37A 1FSZA 2J6HA 2AJTA 2BD0A 2IZ0A 1N7GA 2PX8A 1PEYA 2B0CA 3K5WA 1WUYA 1PR4A 4XA8A 1O6GA 3T7DA 9ABPA 1X2BA 4GZLA 2C92A 1GILA 1N0HA 3NTXA 1JPUA 4NBLA 4X1IB 3VGPA 2Q46A 3PHIA 5GV7A 3CLSD 2ZU6A 5CIYA 3C1UA 5LA6F 5TARA 4DV3B 2QW0X 3K0AB 3P9NA 1EAMA 2IIPA 1Z34A 3O90A 1F2DA 4FGSA 3STHA 3AVPA 4ZCRA 4G8JA 2QRKA 4LDJA 2PX6A 4MAAA 4QAQA 5B7PA 1SKQA 1CUZA 5B36A 4N7JA 1QUEA 2FKNA 3K9QO 3GJQA 1QQ5A 1N75A 3KXLA 5FOWA 1KDVA 2PRYA 4G5SA 4MB0A 5YASA 2FV8A 2GFIA 2ZKIA 1CZOA 1YFKA 3QVUA 1F0NA 2AXQA 2WYVA 4L4SA 1LBHA 3HI4A 3O8OB 4R0VA 1VQ1A 5HIJA 1Z6TA 3EF0A 2R8BA 2QUAA 3ZQ6A 4BOYA 3WGVA 5IXJA 1L7MA 3K6JA 4L5JA 1XRJA 4OK3A 1CJSA 3GBSA 4V0MA 4WZBB 5D51S 3THOA 1WO8A 3TG8A 4HKTA 2OQIA 1DTEA 1L5GB 4PYJA 2ZSIA 2RB5A 4LBVA 4R8SA 1YOVA 3F7OA 3K6RA 2I3BA 5EZYF 3NIDB 4HVAA 4BWYA 3ZD7A 4RESA 3DKIA 1KVQA 1GU1A 2DT5A 4LSGA 3OHSX 5LDGA 4EHBA 5BW4A 1TI7A 2QLTA 3MTAA 4G6ZA 3RRJA 2CXXA 2HSGA 4LRSB 3LKBA 2XKBA 3WGGA 4DMFA 2B5OA 5B1DA 5ICFA 3A4NA 3SJBA 1TK3A 5BSMA 3KYDA 5LBTA 4EHNA 2ZSJA 1UK7A 3PIIA 4KDFA 4CTJA 4ILEA 1IY1A 3N0RA 2P3LA 4D26A 5JCJA 1IEVA 4W9RA 1ZGZA 2FRVA 2X9VA 1W5AA 3ENNA 2HF8A 4N6OA 2OYCA 3AR3A 3T5MA 1P7YA 1A9RA 4KN8A 4KR2A 2ATXA 821PA 1K0FA 2J59A 4OXIA 2ORIA 2C4KA 4OXQA 4RWZA 5TT1A 1Y6RA 5CT5A 1TDJA 1RS0A 1XJWA 2FWMX 3G59A 2CKMA 1LPBB 1P7ZA 3HUFA 4GEKA 3HDYA 4DEVA 3HFJA 1Y3FE 2GPNA 3D8TA 1GPKA 2CL5A 3PE3A 3G0HA 2XXBA 4H1UA 2C7PA 4D3YA 1EGHA 1DRWA 2ODBA 1KYVA 3T52A 1YR3A 2CLLB 2ISCA 1SQFA 3LLCA 1IQRA 1C8KA 1XZMA 4R9VA 4ADSG 2RG7A 3G2KA 2V4MA 4RZIA 3U9SA 3NJ8A 3ZGXA 1ZM7A 1HLFA 1B16A 2D2VA 3L8HA 2XZTA 4FC6A 4M83A 3RVRA 4E31A 1I7NA 2Z98A 3OVMA 3BEOA 4ER0A 2AUNA 4AMUA 5EXXA 1DVRA 4QREA 2HA2A 3RRXA 2PXXA 3E2IA 3W5DA 1X74A 3K3PA 1Y8QA 5DMXA 5EWLB 4AIIA 2ZRHA 3A11A 5LMZA 4FYJA 5MN6A 2VEOA 3SFZA 3LKDA 1BMQA 4HQOA 5JYCA 2YV1A 2YJ3A 5KYYA 1EZZA 4IIJF 3INYA 4PAOA 6LDHA 3KKQA 2Y67A 1VIAA 3CT4A 4DLVA 3MD0A 4CMIA 1GIAA 1I6WA 2XYGA 2Z1NA 1AB6A 3ANSA 3EWNA 2VDPB 1G2QA 3EDYA 1CF2O 1SFRA 3IPRA 4QC2A 5KHAA 3UUGA 1KJYA 3GNTA 3V9PA 3DDOA 5IXYA 1YVPA 4LQLA 2X13A 2ZRDA 4G81A 4WY2A 1DCFA 2YHIB 1ZN8A 1VGRA 2GXQA 1XIVA 5FPHA 4J07A 4PQRA 2QTWB 1UC5B 4BV2A 4UVDA 3VR4H 2VI5A 2PV0A 4O8CA 4OJYA 3T61A 4CZ2A 2XYQA 2WF7A 4G5QA 1TA0A 1CY0A 4JL8A 2A3NA 2G4VA 3GLQA 4PN3A 3C6ZA 2A0UA 3CWQA 4TLDA 4CV2A 2QROA 2JNWA 421PA 4DJAA 2IEDA 4AS3A 1SG6A 3LL7A 3BWXA 1OXKB 1E0JA 3W5UA 4ER3A 4ZDJA 1V5GA 1X1SA 2FZWA 1M1UA 2Z1DA 1C4XA 3FDZB 5ALXA 1ZP6A 3ZLUA 4AMGA 1GZ6A 1G8HA 4KLZA 5IDWA 3IUNA 4QTUB 2IPOA 2JGNA 4MIKA 3TM5A 4RHUA 5K99A 4W99A 1J21A 3ECCA 3NEYA 2KHZA 4L7QA 3A6LA 2PANA 4ZWNA 3LPMA 3R3YA 1M10A 3PIDA 5CXUA 1OXMA 2PO7A 2Z8ZA 4Z7NB 1U0SY 4Q9AA 4WW0A 5DCWA 2BP7A 1OLUA 1GHTA 2J5BA 3DR3A 5D3ZA 1BMTA 4JQZA 4X00A 3NM6B 4QU0A 1NVVQ 2GXUA 3K71B 1U2TA 1CNFA 2EAUA 3KKPA 4ZALA 1J56A 2PSHA 2GB4A 3WQBA 1E96A 1NPYA 2CJPA 1XAGA 3SC2B 3SYKA 3AK4A 4BB6A 1GQ2A 1Z35A 2W70A 5JD5A 4OQPA 1YIAA 1ZR2A 4YUZA 5H3LA 4QQRA 1NX6A 5F64A 1MTZA 2C4VA 3HB1A 3JWJA 3LHDA 1TZKA 4IX9A 4QGAA 5E6RA 3DPSA 4F3NA 1XRLA 3EUAA 1RHQA 2GASA 4ESVA 4K9QA 5JD6A 2RHTA 3U3XA 1G8SA 1Z62A 1YNOA 4XQ9A 1Z6AA 1XQ1A 4IFBA 3LWNA 4B2LA 4LV8B 1XO1A 4FZVA 4H35A 4K9MA 2IFTA 2C8VA 7REQB 2W00A 4BNXA 1PWYE 2L82A 5BSKA 5KNBD 1E1RA 1ZD2P 2WWRA 4ND8B 13PKA 1RRGA 1DC8A 1MDBA 1NXOA 1WLSA 5T5QA 2VPYA 3NMUF 3WRXC 3V8QA 1N7IA 1NONA 1PJ8A 1R66A 2VG8A 3D8HA 1V95A 4Y2PA 5KVQA 4C4XA 2F90A 4MUEA 3BDIA 2PD6A 1JIKA 1NR1A 1EMDA 3W1VA 3E82A 3PUIA 4DJFC 2QSYA 1NUHA 1LW7A 4OG2A 1M0WA 2BHSA 3A1UA 2W6JA 2HHHB 4KB5A 2NU9B 3LA8A 4F3KA 5CGQB 2JGLA 1GL6A 3ZDQA 3KAPA 3OIUA 3M70A 5JQWA 1R0RE 4UHEA 2ZVJA 1NRIA 5LP6C 5IC6A 2ZROA 5DWQA 2B21A 1GPYA 1OGYA 1IOLA 3V8EA 2C1XA 5FCDA 2I6XA 2PUJA 4XOIA 5FQOA 4AJEA 4BFLA 1J20A 3WB0A 2IXBA 3RUDA 1YQTA 2EWMA 1R9GA 4K3VA 1M74A 3HDHA 1ZCZA 3C16C 3CX6A 5A0TA 1NVKA 3EGOA 4JT4A 4ARCA 4BAGA 1YUNA 5DISB 2IZZA 2IDKA 2DCMA 3ESYA 2NT3A 2PLRA 1I30A 4Y2GA 3EK2A 4TMTA 1V7QA 5GP1A 2CSUA 3ISJA 4G0PA 1IZ9A 3QMPA 3PWZA 1W9HA 3A3PA 3WHIA 3LQQA 3WLJA 4MLPA 4KOEC 1I7QB 3QXGA 5I7WA 1DX6A 2ZR8A 3KO8A 1LSOA 5KYKA 1BYIA 3FJ1A 5AJVB 3COVA 2J4CA 3T1YB 2WP8J 1XR3A 3EAFA 2NSJA 5A5FA 2JIZA 4FFVA 4QTTB 1OX6A 4UFNA 3GLHB 4AXBA 3SD7A 5LD2C 2XQFA 1YZKA 2HDNB 2RGXA 4EZBA 4C6RA 1TRKA 2GEVA 2L17A 2O2JA 4NAUA 4XIJA 4I99A 5JQGF 2NZ2A 4Z3KA 4UVEA 5LP6A 1FJGB 2XI4A 1CRLA 1LF5A 2KM1A 2RAUA 2WPDA 2HD4A 3B12A 4FX5A 3S28A 3TW0A 5BRJA 4NBNA 3M4NA 3SLRA 4ARAA 1O5OA 2WWIA 1DIBA 1J09A 1XCMA 3X0DA 1GUDA 1M5UA 3QVTA 3GJTA 3UWSA 2R1TA 4E4YA 2G4LA 4OM8A 3OKFA 1QR2A 3A58B 2IPMA 4RHEA 4REOA 2IUYA 1MTOA 3I2YX 1CY7A 3MWEB 4KVAA 4JEMA 3DT8A 5TJHA 1U9YA 4HNAA 5EXEA 1EZ4A 3HZHA 1YE3A 3WADA 1SRQA 5HR5A 1A9TA 4LGVA 3UT6A 1C7IA 2JI7A 3BXFA 7MDHA 4TZ0A 3VC2A 2NV6A 4A3SA 3U4QB 1QHFA 3V2HA 3WGNA 1QANA 2IEAA 2PU5A 3HA2A 3LUAA 4WY5A 2WG1A 3FX2A 3LCJA 1CUVA 3ETHA 5EJGA 2WHRA 5FR2A 3MOGA 3WYEA 1EYZA 5DNDA 2BL4A 1NMEA 4QWMA 3MUOA 1I9CA 1JPJA 1KI1A 4PHCA 4MJ3A 5ALFA 3IDAA 2Z9BA 4ARVA 4X7RA 1JDPA 1ULAA 3SU8A 3HMKA 1FMTA 2RHRA 3RJMA 1A8UA 3KZXA 5CD1A 3DMNA 5CAEA 1IULA 1FX1A 2QRUA 2NAFA 4MVJE 1AA9A 2Z5GA 1X8LA 4LJ6A 4R5MA 5CB6A 1FNCA 3ES9A 1KMNA 1ZAYA 3BCHA 4A4DA 3FYHA 3NBYC 4PYOA 2KYRA 4NH0A 4GMKA 2VYND 2GHRA 1Y8CA 4HMOA 2VTDA 1Q1QA 5FNZA 2NU8A 4JC4A 1Y6ZA 1NMYA 4H7HA 2AD1A 3IBGA 2VHCA 4OQXA 2QMEA 2V7TA 1WUKS 2GCOA 3D8UA 5IWAB 1M2VA 1IRXA 5EUMA 4LZZA 3EE6A 4C3VA 4DCPA 3Q7RA 4BN0A 4Q37A 1NLZA 2Q4DA 1GNSA 3F7NA 4U5QA 5FUMA 2ZTMA 2P5YA 2QJFA 4YAGA 5G2OA 3ZJYA 5KREA 2BSAA 3ACCA 1FBTA 2V9ZA 3KT6A 4IKPA 2QJRA 4V24A 2UYYA 4KP7A 3FUWA 3ZJ5A 5K8UA 5LR6A 1R8XA 3NQ41 4JASB 3N7UA 3VTAA 4DM3A 2OHJA 2AMLA 2ZE6A 1VI5A 3NTVA 4FNMA 3LVFO 3PRYA 1HRDA 2FQYA 1S2NA 4IFTA 2VAWA 2BCJQ 5DM4A 1HDCA 3CW9A 1XZEA 1YCFA 3A4TA 4M0FA 2XVYA 1TQ2A 2FI1A 4IUYA 3RFFA 1OFUX 2FAXA 2VHUA 4JIMA 3IAXA 4LUCA 5CXQA 1DTWB 3MSXA 3PDJA 3OPQA 2ZAMA 3DQZA 5E8RA 4IRUB 1TOAA 2ZUWA 1UPBA 1YVUA 4H27A 4I4IA 2VCHA 3RRYA 5KNCA 1LPNA 2IA5A 4AKSA 3A7DA 3TWOA 4U9HS 4WK2B 3WDKA 1GRRA 4ARZB 4YT2A 3IJ5A 1IQPA 4XWAA 2C4TA 3L92A 3Q7QA 2VAPA 4PXYA 1PNOA 2Q5QA 3C5VA 3A4IA 3G9QA 4HXYA 2VP3A 4F12A 2PS3A 3MS2A 3RJTA 1T4DA 2OFOA 2PZAA 4YFYA 1RQGA 5GOZA 2QIPA 2VTKA 1CPYA 2I4MA 2R6ZA 2W4MA 4HB3A 1ZO8A 4B17A 1JEEA 3IPYA 4X91A 3H1PA 5TE9A 2V6IA 4AY2A 1VL6A 1KF0A 4ND7A 2PS9A 4MYHA 1MABB 1Y8RA 2B83A 3IESA 3DO6A 2BT4A 3PL1A 3H2KA 4L8FA 3AM5A 1W8IA 3MK31 2HJWA 1HTBA 4DJEC 3AVYA 3FUUA 2G5GX 5BYAA 2KLHA 5ESWA 3HSSA 4JJGA 5JW6A 1P1HA 3JASA 4CKCB 1EFPA 2W6OA 3I37X 4JT8A 2OC4A 5JMPA 1Y3HA 4IJ6A 3VQTA 4D98A 3RCBA 3JALB 4XI9A 4CFYA 2DPGA 3QYPA 4B40A 5LXTA 4TUYA 1UFRA 1VJ5A 3U7GA 2PWZA 2UZ4A 4JROA 3CX4A 3AF3A 2IEBA 3E8MA 3KL2A 1UMCA 4ONEA 4Q3KA 3QEOA 3LX5A 2FWIA 2ZCVA 1YZHA 1G63A 2AOTB 1L4BA 2BTOA 3CR8A 4WBXC 2KPOA 4DQ0A 3HXOA 3THYB 2OOKA 1ZNQO 3G9UA 3O4VA 4M0EA 1F1JA 1CULC 1KI6B 4GLLA 4O0MA 1WY7A 4WPGA 2HH9A 1FPMA 1GA4A 1PW7A 4JEHA 4IZ6A 1Y7LA 5K01A 3S8MA 1GKYA 2P62A 4UHBA 3F3YA 3R20A 4RYDA 1JR4A 1ONBA 2OG1A 1YRLA 2NVUB 3W5IA 2ECPA 2YMPA 4RA9B 3OM9A 4MV4A 3PCRB 2EZ9A 3A6GA 1B8VA 2VUUA 2P1DA 2JZCA 1V6AA 5D00A 4M0MA 2DRIA 2FZEA 2AN4A 2D0OB 3KS9A 1SVSA 4MULA 4A1OA 4YJHA 1YO6A 1W30A 2C2YA 1SXHA 2DSNA 1BOOA 1NBMA 2ODNA 2Y1LA 3PUJA 4LTDA 4AUKA 4WN9A 2G83A 5E4FA 1J5XA 2F1RA 2IEYA 4OK6A 6NULA 2MR6A 2WUVA 3EOAI 5FV7A 2GS9A 2AI2A 2M6SA 2NADA 2NSYA 1I4LD 2QRZA 2Y6VA 1N8NA 4KMMA 4N3NA 1AM4D 3B1FA 1QUFA 2NSDA 3G6KA 3IAHA 2AEMA 2DECA 5AT1A 3BGDA 5DEOA 1N4AA 1SB8A 3FN4A 2Z6QA 2ZRBA 2I1VB 2E7ZA 2LXNA 4DDWA 2VRBA 1DAGA 3TXAA 3EA4A 3N8DA 3PNKA 1GL7A 4OX9Y 1WJGA 1OWNA 4KYVA 3IUJA 3OBBA 1JHQA 3HNRA 2QT9A 2PNFA 5HHTA 2HU2A 4G0MA 4TV9B 2ZBDA 4CMEC 4NR0A 4NHOA 1JLMA 1YK1A 4O4IA 4FMCB 5E6UA 4JB0A 4RACA 1HDOA 1MC4A 2B37A 3IA7A 3OUTA 5ALWA 2O48X 2JLCA 2VL7A 3BH0A 4PF1A 2R6AA 4V2UA 4FGZA 1Q17A 4Z4FA 2ZDHA 5BN3B 3FAKA 3L82B 1W5EA 2H2IA 4JUFA 2OGWA 4KVFA 4NQZA 4MVJH 4ZOLB 2PRSA 4ZC1A 1H2YA 2LW7A 3UXHA 5LYYA 4EKIA 1OLOA 3GGOA 4Q3AA 1K86A 1TZMA 1QJCA 2ZRJA 3H5VA 1LB1B 4R83A 4ZO6A 4C30A 4CKEA 1W0JA 1AV7A 3QVSA 4XYLA 3LTEA 2GZMA 3JV7A 2C0QA 1ZOSA 3UG6A 4WLEA 1ZM3A 2EFCB 5L7WA 3KOZA 2GVDC 3FGPA 3DE3X 4RDHA 3OTIA 1L5YA 1VBMA 3G6WA 3HSYA 5JCPA 2PSSA 2NO5A 2OV6A 1WE2A 5B2FA 2Z6VA 3MHTA 3B51X 5BSVA 2ZS7A 2IS2A 5H4HA 3UBMA 4CMEA 5JT1A 4KNYA 3B6EA 2C54A 3KJNA 4P4NA 2W6QA 4WJKB 4W1PA 3EMDA 2F8MA 3KT8A 2WWXA 4D46A 3TUZC 5FP0A 2GD2A 3NCTA 4AO7A 1GEEA 3ZDCA 3Q8KA 1JAXA 2O7VA 4ZGWA 2JGJA 4XTRA 5K0FA 2BEVA 3DCYA 1LLCA 1XVAA 2VT3A 3GRCA 2ZXFA 3OQVA 3ZU3A 4ZEVA 1XTRA 1Q22A 2FPUA 3DDZX 3H42B 5T6MA 3U3JA 3B7GA 3ZGYA 4JI7B 4WSOA 3G88A 5EXDA 3LYAA 4CL2A 1RQRA 4H7EA 3AP3A 4UUBA 3UENA 1E59A 3EGXB 3WA6A 3D7RA 2JFPA 1JR6A 3NDJA 1O4VA 1IG0A 5KX5B 3EGVA 3OPYA 2P2YA 1MXFA 4RABA 4CLXA 3EVZA 4X24A 2HF9A 3DWGA 1OXTA 4TTJA 1T4GA 1L7DA 4PC1A 4QT0A 1L8LA 1B0AA 3DMHA 4YAFA 5LU9A 4MKHA 1P4AA 4HDQB 4YMSA 4H0FA 5CX4A 4IDGA 2ZLBA 2VF2A 4NG5A 4DTCA 1FRNA 4EO4A 2UYOA 3ZKAA 2C9DA 4ENVA 4PLFA 2F8SA 4PG6A 4QU5A 4WTOA 1VG8A 4QYSA 2Q1WA 4GP9A 2JBWA 1P8AA 2IOFA 1GGHA 3EMBA 2DR3A 2XDQB 1BRMA 3Q7EA 4ZQGA 3AHEA 5JLJA 2Z3VA 5A3RA 1DDOA 5HOQA 1YOBA 3K4PA 4R3WA 2GPWA 4RE5A 1NU8A 1XG5A 1U80A 1C4KA 2WAOA 3KT3A 4P3OA 1B15A 3ZH2A 3PXXA 5B5SA 5I8PA 4ISBA 3EPKA 1FMCA 3IQHX 3K15A 4V39A 4FHCA 1TMGE 2FP4A 5AOBA 3DFIA 5K3AA 2NUPB 2I3GA 1NKTA 1R8JA 3LY9A 1GZ4A 4NJMB 3MOSA 1CQJB 1DJPA 3VNRA 5F98A 3QXCA 2BMJA 1TW3A 4IM7A 3VYUB 3PG5A 3QFFA 2FWPA 1X1QA 3DMRA 4HGRA 1Z82A 4CCSA 3NEJA 1ZNYA 2KQUA 2PXAA 1QOPB 2C78A 2QL7A 3QXHA 4IXDA 4UEWA 5EWJB 5IMSA 3BXZA 1VB3A 3NU1A 3GPBA 3EX7C 4O1MA 2XITA 4XFKA 2FOXA 2HMUA 4B75A 3CUYA 5JFGA 3K0HA 4LF5B 4HMPA 3IAFA 5LJIA 1R18A 1UZAA 1MR3F 1A2OA 5JG7A 2FEOA 2ZYIA 2QTTA 2ZUSA 3PDCA 4M1OA 4R0MA 5JR3A 5L3RA 4IGAA 3CPSA 4W6ZA 3RAFC 1F17A 4EQ6A 3VZQA 1QU3A 1F06A 3ADDA 1P1RA 3QLTA 1CT9A 2VHXA 3CGWA 3MJTA 4RZUA 2G28A 2VN8A 2CCJA 4EHHA 2JLUA 5DK6A 4QGFA 1T6YA 4L75A 3DC2A 1Y4ZA 3KJFA 2OKCA 4J03A 4JLPA 2V6JA 4PWYA 3ZHOA 2YNMC 4E12A 1CS0A 2VP4A 5GVSA 3M9WA 1DSSG 4RJTA 4FMPA 1G4AE 2PCLA 1QO9A 2A5GA 3ENWA 3HU1A 4WEOA 2Q7DA 1KEPA 2OOSA 2WQZA 3AJ9A 3IQXA 5H02A 4DZTA 3ZD8A 1EWQA 4S2EA 1FYEA 1VL5A 3ROGA 4URZR 4C0JA 5LYJB 1OJ7A 2WFLA 3HBJA 3R9IA 4NZPA 4A2CA 2W22A 4FONA 2VWQA 4MA4A 4K8RB 1DQYA 1TO1E 1Y5MA 3QHAA 5CTJA 4EFDA 4D3DA 1U1IA 4KK4A 2WSYB 4AYTA 4PO9A 4EO9A 3KTAA 3E1KA 1D1PA 5JAQA 2ASEA 5FHQA 3TQHA 2I0FA 4C6HA 2FSUA 4CL8A 4EK9A 1BDIA 5MHTA 1M9NA 1J2UA 2G06A 2R47A 3KB8A 1W9MA 3GI1A 1VHLA 3L02A 4DPMA 2QTBA 3DYBA 4KQ2A 1RYHA 2Z43A 3TX2A 1SC9A 2PBRA 3ACDA 5CX1A 2WE8A 3A2LA 3W05A 4JGGA 4OAOA 2X6RA 3H5NA 3T7IA 3NV7A 3WTBA 1FUUA 2J7PD 2CVOA 4R1SA 1DO2A 2P5SA 1E77A 4CMKA 3R0ZA 3Q3JB 1QE0A 3EXEA 4BQSA 3C2QA 4HI0E 3SR3A 5F2KA 1E4EB 1OAKA 1V1RB 3NAGA 1DRVA 4BO7A 1CFZA 1TNDA 3D59A 1GFSA 4XM1A 1F8FA 3Q0EA 2ZXUA 4JOCA 2G09A 3ZKWB 4Y2XA 1KWGA 5JAHA 2EHDA 3BXOA 3CV3A 3DVQX 1SXJB 3LY8A 2C82A 3KEGA 4UU7A 3URMA 1CY8A 4RFVA 3BTSA 3HEAA 2OBLA 4GH5A 1KP9A 3VSDA 2K4MA 4EGQA 4ZTUB 1E94E 1I33A 3U37A 1KDRA 2ES4A 1M0SA 4DR3B 3ZD6A 3AVUA 4FBMA 3OMXA 5CB8A 1GUFA 4KAFA 3B9RA 4X8HA 2EOAA 4C78A 1OLXB 1Y7HA 1JYFA 2AE1A 1Q1EA 3D7LA 3LFUA 4IKOA 4JOQA 4XCXA 4AU1A 5KYWA 1XXHA 3VXKA 3FVRA 2H54A 4BCDA 2YC4C 3DDHA 4QSMA 1DQRA 2XV1A 3I5UA 4ZFNA 5BR7A 1MVNA 1EA5A 1PR6A 3K53A 4NCKA 1G5TA 5KCMA 4Z4HA 2PTGA 1ZWKA 4O3MA 4MCJA 1V11B 5DLPA 2H29A 2GCEA 3TZLA 2JIOA 2VHQA 1NBME 2XT0A 1PO7A 3AEUA 3NM4A 3PC8C 3V7WA 1YR2A 3DYIA 2JANA 2WD8A 1K6MA 1GFIA 3HS3A 3I9V6 4XCVA 4N65A 1QIJA 3H9CA 2D1TA 1D8AA 2AX3A 4Y6LA 1P18A 2NYRA 1MO4A 2HK6A 2XA9A 4QOFA 3LXXA 5CT8A 4EA7A 2ESRA 4KRYA 2MCFA 1NUSA 3MCUA 1G0OA 4M46A 5B55A 4C4PA 1DP4A 2CY0A 4BC1A 2IV2X 3VU9A 2OE2A 2C20A 2YN2A 4QBGB 1MOZA 1K7EB 1EDEA 4RVOA 2BI4A 4B8YA 2H8GA 3JQEA 4LYJA 2WFZA 3OU7A 4P81A 3ESDA 3GLKA 1JEQA 1U7DA 3WL5A 1D2GA 5JSZB 2IYSA 3ZZ1A 1WDMA 4OLHA 2CN1A 2FW9A 2ZAIA 4JT2A 1JSLA 3E8XA 4IP0A 4MP8A 2JLAA 1G2PA 1SPBS 4BU0A 3TNFA 2EGHA 3QK7A 3Q9NA 4PFKA 1MKYA 3Q10A 3F3KA 4Z4IA 4HF7A 3FIUA 4NL4H 3C3DA 4R2WA 1OSNA 4GRAA 4RHTA 3VYRB 3V8VA 1OB2A 1QHHB 1ZI8A 3W5SA 3HGTA 5BR8B 2ZR0A 1ODCA 3LUHA 3IMKA 3HO1A 5EGSA 3PFGA 4QYWA 3F5FA 3NHSA 1YL6A 1N5MA 2Z0MA 3GA0A 3QG5A 3QVGB 4ARUA 1JHAA 1WW3A 3DLPX 4N12A 2ZAGA 4H2DA 4QL3A 5JJCA 3HGQA 2XWSA 1P2TA 1K97A 2BFMA 3BWEA 2HJRA 2P4SA 3OJXA 3SHFA 3W5CA 4BNJA 4MUYA 4BYGA 1XU7A 4JP1A 4K9SA 1Y4DE 1RYEA 3ON5A 3VOAA 4F92B 2CFSA 1PJ2A 2XBUA 1EBUA 1WZCA 2IEGA 3RI3A 2IEZA 2FLVA 2GF0A 3H7IA 4K9RA 5DHSA 3IVGA 3GUZA 3OZDA 3L7CA 2H1RA 5CHEA 1P0MA 2IZ7A 1YI0A 4DC9A 5JZOA 4GD3Q 2FJPA 2LR0A 4IL5A 4IIYA 4RMIA 4TV9F 1UJ4A 4C7OB 5JADA 1W5TA 2GNPA 3S1SA 3OIGA 1A7AA 3NS7A 4BNNA 2DHEA 4KBYA 3HP1A 1UC9A 1LI4A 1NVTA 2HIAA 4FMCF 4X8OA 4MVJG 3T94A 3ZIAD 3VUEA 2I2XB 3NHFA 3V1LA 3LHKA 4KJXA 3QF7A 4L16A 5E6SA 1KETA 4CI9A 2B2XA 1LF0A 4V0LA 1EK5A 3DL0A 1PRYA 4Z5XA 2GLXA 2C95A 1JVBA 4ZOLF 3VZSA 3PUXA 1XA3A 2QS9A 2I34A 1TAQA 3VPSA 4IW3B 3SSOA 4IWYA 5JBQA 1MG0A 3LHIA 3QELB 4G4SO 5EYPB 2CWWA 2EKBA 1O89A 3RARA 4WVFA 4CLDA 1TGVA 1SVMA 2WIBA 1BYUA 4Y0VA 5ICEA 3DWFA 1E1QD 4NZNA 4FN5A 1U2SA 1QO0D 4A91A 2VHVA 3BMOB 3KWLA 4GLFA 3RAGA 1OZFA 1JQEA 1WP4A 1N2GA 2PQ2A 2LDXA 4H7JA 1QYVA 4PFQA 1DRKA 3DBLB 2H1SA 4MKIA 4DDKA 3CWCA 4EW3A 2WTUA 2O5CA 1RJ9B 2OFPA 5DM1A 2N0SA 1I01A 4PIPA 4B09A 3CX8A 5ALVA 3LDUA 2E89A 5KWEA 2P4UA 2WG0A 3L77A 4HWKA 5EQDA 1E9DA 3RC1A 1L4LA 3IBSA 1K7CA 1NTRA 2B92A 3OZBA 4BQPA 5C18A 1XVIA 1VA5A 3H1EA 3IP8A 2QLBA 5LZ8A 3KLNA 2YJ5A 3R0JA 1HQYE 3TH5A 3VZRA 2BMVA 2NT4A 3U81A 4NDZA 1YVEI 3OUZA 1AXGA 3ZVRA 1ISJA 4HS4A 4JWTA 2JI9A 3L8DA 4AJIA 5ES3A 3HN7A 3H17A 1UDXA 3F9IA 1EUYA 1WDLA 3AIIA 2QE7A 4BIIA 1XE3A 1Z5GA 2RJOA 3A0UA 1BJKA 2PX2A 4J76A 4OATA 5EY5B 3WL7A 1EDDA 4XLTA 4K3UA 3VR2D 2AMVA 4IWNA 4RTQA 4JLKA 2F8LA 3AESA 1TRHA 2AZ4A 3S5UA 1S9DA 3A70A 8ATCA 1GADO 3F0TA 4BKRA 5JANA 1HYQA 4CM4B 4UTZA 2XZLA 3SKYA 2IVFA 3AETA 1K5PA 3GLUA 3Q12A 4LRQA 5E4JA 1QIIA 5KX5F 3SIPA 3GZNB 2XQJA 4GXNA 3L4SO 4LWZA 1QHGA 2J09A 1BMFD 4KG7A 5G1OA 4ZV7A 2BEJA 3T8YA 3F97A 4S35A 4K6GA 3FYDA 1UDAA 2JJMA 3N75A 1ZMBA 4UE3S 3B1JA 4ZVTA 4EW2A 4R31A 2R1VA 2YQZA 4AP6A 1C0LA 3Q2OA 4P0TA 1HFKA 3Q40A 1M0EA 1AO0A 4AMVA 3R9XB 5BRNA 2B9EA 1NY5A 4KPGA 1JWBB 4WI1A 4QUGA 4O4JA 1I2BA 1KMHB 1P81A 3CEJA 3LG2A 2V7XA 4W7IA 1E8MA 3NHAA 1EDZA 3KK0A 3N8IA 3ZJVA 1G21A 1RMYA 2OV8A 4YXWA 4OQEA 2GRAA 4UEOA 2XOXA 1T5IA 1N3BA 1HO3A 3ASZA 4QQ8A 1BEZA 1E7SA 4ND1A 1U8XX 2O7NA 1D2AA 3CUUA 3WLLA 5A4AA 1SKYE 1CVIA 2WF8A 1N2OA 1N6OA 2GA9A 4FFRA 4RQBA 4TWAA 3T3DA 5IHXA 1V5WA 3DOCA 1CYEA 1G7TA 3ONFA 3UJ6A 1QVAA 5DBGA 2C3PA 2PR7A 4K03A 1HDEA 3ZZTA 4WV3A 2ZSUA 4G97A 3SYNA 4J4HA 1G5QA 1K9SA 2GR9A 1LQTA 2ZVDA 5TQ0B 4XB2A 3QFHA 2ZBRA 3NXSA 3RWBA 3RNOA 3E5MA 2FGKA 4Y6QA 5KNDA 3RR2A 1C3OA 4F1WA 1T3TA 3CH5A 4K9PA 1FFEA 2DFKB 1PUIA 2CHFA 1ZICA 3TQOA 4YRAA 4TLEA 2OGSA 5CVTA 1WUHS 3OP1A 2VFAA 3R3JA 4B3MB 3NETA 4E08A 1WIWA 4U3JA 5CYGA 2PAAA 1MC5A 2I7TA 2EGGA 5FULA 3IT1A 5K0EA 1AK1A 1LQUA 1NUUA 2Y05A 3WS7A 3FY4A 2AI3A 4M9UA 2HQSA 1WETA 4Q34A 2DERA 4INOA 4GVLA 4DDMA 2REXB 1C9MA 5C4MA 4BB9A 4MWTA 1KIAA 3HP4A 5CFLA 1NBOA 3L1UA 2DWCA 4BMNA 4YBZA 5B3KA 1NURA 4X6LA 4CVNA 4TV8A 1E4VA 2YVUA 5CMLA 5CM9C 2NPOA 3IA2A 3D8BA 4U1RA 1FU7A 1QTIA 5JWRA 4PLGA 5L3QA 3LQRA 4M22A 1ZD3A 1RRMA 2I6QA 3HNPA 1P1CA 3NX4A 4L2IB 4PZCA 5F3RA 4ZXPA 3N53A 2WW8A 1EPUA 3K1AB 3QH4A 3BWCA 3TECE 1N32B 5L3VA 1PWXA 1VL8A 2VDRB 2HMWA 2OPBA 3OZIA 2Q29A 4P3PA 5DIZA 3ND5A 5GJVC 5LYJF 3MJVA 4Y18A 3NOVA 2BF7A 3AFOA 4ZQBA 4EMSA 4BJ1A 1H2XA 1VBNA 1Z0FA 3QWFA 4UCFA 1QP4A 1EH5A 1E3WB 2EFYA 1OH7A 1LPOA 2QIOA 4EX7A 1Y1QA 3FDXA 2A1TS 3PR3A 1IHYA 1CUGA 1UF9A 3G7SA 1YZGA 5G4KB 4M0DA 2J6BA 1XXHE 3RTEA 1QFMA 4B3CA 1L4EA 4GMHA 1K9VF 4YRIA 1XKQA 1SXJD 3O8DA 3RTCA 3DL4A 3E3LA 3T35A 4DRZA 4NK4A 1RYFA 3IJEB 2HCTA 3MEQA 1H22A 3P9SA 3LT5A 4QDZA 5H81A 2IV3A 2Q0HA 2H7VA 5ALDA 3WP0A 5HUJA 2WM3A 4GW3A 5GONA 2NU7A 3HL0A 4L0DA 4DNXA 1TM4E 1ZGBA 3N6RA 3PFFA 5KVVA 5BURA 3VU0A 2QUIA 4IJMA 3U7FB 1G3IA 221PA 1JBQA 2IYWA 4LGYA 5EEGA 1DB3A 1PAUA 1TFRA 3R8CA 3UOGA 2IHZA 1XWFA 2J0UA 2JGMA 3D0KA 4C5BA 2WLTA 1NZJA 3SZLA 3KR1A 4OJKA 3NAQA 4CLOA 2RIRA 3MN1A 4E32A 5DEIA 1EUCA 3EPPA 3U4CA 4YQYA 5I01A 5IF9A 1V26A 4CF6A 4YAKA 1QOZA 1X1AA 3ROKA 5EIHA 2GZAA 4P4GA 4JUBA 1RTKA 4NMLA 2O54A 2G0NA 2IQIA 3UJ9A 3K0SA 3LKZA 2DBYA 1IN4A 4B0PA 4UAUA 2AVDA 3UEOA 3QIVA 4QNRA 5F1KA 3PXDA 5EERA 5LBUA 3R0IA 1SIBE 4HDRB 1PFQA 5A0FA 4EI2A 3OWOA 4F45A 4Q9HA 4ZMSA 3U60B 4QGGA 3ZD9A 1IC6A 3LQ1A 2EU8A 3QYJA 2WYOA 1KDYA 3UJ7A 3GJZA 1YKFA 4QJ5A 3VI4B 2FEXA 3VR5H 3WNCA 2FPPA 4G2NA 5AMXA 1W29A 1PS8A 3I9OA 3C3JA 2JVJA 1EK6A 3F46A 3KYDB 1BCRA 2F3RA 1JB1A 4ML3A 2QW8A 4H6WA 1N0IA 1A27A 2J5RA 4IOJA 4PLTA 2HRZA 1XVTA 1TJ5A 5G1PA 1VFPA 3PPXA 1W0CA 1N2IA 1ZD8A 4P84A 5DI3A 2ZYVX 3TSZA 4K5QA 2GVNA 3VYTB 5D87A 4AY6A 3AF5A 4OSEA 5J47A 3A9TA 1G5RA 1J8FA 2ON6A 1G41A 2GERA 2VYVD 3CVJA 2EZ8A 3DKPA 1R16A 4U7WA 5AJWA 5HJ2A 4BS9A 4E33A 3ZDDA 2PUCA 4ALKA 2VTBA 4PU0A 1GCGA 4YALA 5KYTA 2N1MA 3IIKA 4ZTZB 4FUQA 2QN3A 2XVXA 3ANTA 4DR6B 4MQ4A 3K9LA 1QGYA 1XNHA 3OQBA 4ZQCB 3BF8A 2CFOA 4JI4B 3O73A 1QGOA 4M55A 3FG9A 4IDAA 5AD1A 1HYBA 2RI6A 1QLJA 1B41A 2DY1A 2WMOB 2ZRMA 2LGJA 3DWEX 1OU4A 1Y8QB 3P9PA 4G37A 5F5LA 5K2MA 4YAIA 1GTL1 1L4YA 1C1HA 4P31A 1FFGA 4YA6A 4HYQA 1WCYA 3KYCA 1GKUB 4NK5A 3WIBA 4AYWA 2OK7A 3HM9A 2I2AA 1XDUA 5KYYB 3BJEA 4M60A 4DNFA 1GTJ1 2QZZA 3I2KA 1SHZA 2P91A 4CMIB 4D0RA 4IQ8A 1K1EA 3CW2A 3IO3A 4LSWA 4QBIA 5DHPA 2RC5A 3D5QA 2ZEJA 1E2IA 5BOSB 1JF8A 5A3QA 2RK6A 4KEAA 2ZAYA 3P0JA 3LUCA 1AQLA 2D1FA 1SHUX 1Y4AE 4DMRA 1P4GA 4GYKA 3DTNA 1T3HA 1GG5A 5C46F 2PZFA 1BXGA 5DWVA 1FLAA 4D6YA 1SUPA 1JS1X 1Z88A 2FCRA 3GFBA 4FW9A 1RWKA 4W4TA 4X63A 1KQNA 4CT5A 3R74A 2J9FB 3HR7A 3U61B 1F7VA 1E7WA 1N6LA 1KKMA 2VDMB 1M7HA 1GZVA 1KYQA 3O3OB 1W52X 1XVUA 2HBRA 2W0MA 4HCJA 4RKQA 2D5AA 4MAFA 3SYMA 5KYGA 1A5BB 4KI7A 1GPBA 3WQRA 2LCQA 2NU6A 1H6BA 4Y2RA 2LPMA 5DOZA 4F91B 3L1KA 1UFKA 3FMVA 9LDTA 4IDHA 4QAJA 1Q6ZA 2OPHA 4HTFB 1EINA 1UIMA 1TIKA 3DBRA 1WVGA 3ESRA 4XUGB 3ZNPA 5KIAA 3BKWA 2Z9DA 4MW0A 4KHPB 2J0QA 5AOVA 3BH7A 4ISCA 5K0NA 1LFDB 3X1XA 3F90A 2BP7B 1OLUB 4N8EA 5IEJA 3FKSA 3G5UA 4ZYYA 1EP9A 2HXYA 1CRWG 1NJGA 2ZPUA 2HNBA 3P7MA 3U6KA 2CFRA 3UK2A 3E5RA 3B5EA 3HB4X 3AJ8A 3PF8A 4N4AA 3TLKA 4J90A 4C87A 5G0UA 3UFBA 4CM7A 1YL7A 5FBWB 2A9QA 1G7CA 3PJGA 3N74A 1Y1PA 3LW8A 1X38A 2J0VA 2R6JA 4I7EA 3GCDA 5DT2A 4E2WA 1U98A 1P0CA 3I2IA 5K3DA 1OW3B 1G21E 5C35A 1AOXA 4MGIR 4MI6A 2E55A 2GBGA 1QYWA 4BV3A 2PM8A 1MZPA 1OFUA 2PZBA 1NRWA 2IH4A 2IDJA 1G3MA 3NBMA 3NGXA 1G4UR 4GLBA 2CB9A 4NCJA 3EMKA 3Q8MA 3ZW9A 1F8YA 5F5NA 3R8XA 4HRVA 2YMMA 1C8VB 3GN1A 4BFVA 6YASA 1WR8A 1TYZA 4AO8A 3RANA 1VZ3A 1O03A 1ZJ6A 5DFAA 1NUQA 4IRMA 2XCTB 3B48A 1NVWQ 5A71A 1JDJA 1YBVA 4RSMA 3RVMA 4S04A 5JAZA 1EFCA 1Z0JA 3R75A 4AUEA 1DQZA 3CZQA 3MQ2A 3P9RA 1KR5A 1AGYA 5T8KC 2AG8A 3L7IA 4L95C 3V80A 3TD6A 2CVHA 3QGMA 3VISA 1KEWA 1U28C 3ZCVA 4D3XA 1NQXA 1UQUA 2QW1A 4F5ZA 3G9ZA 1ID8A 1PJTA 2GWHA 4WA8A 1T9GS 5D7BA 4R2JA 4J0QA 3NALA 1ZI9A 2BFBB 4NYJR 3SXUA 3QX3A 3DTVD 1I5EA 4I1VA 2CKDA 2B2CA 1B0PA 3BQ9A 1JU4A 5J4YA 5LIPA 1E1DA 5KQGA 1ZKMA 3RT9A 5E7IA 4TWZA 2G72A 2X15A 2E1RA 1CHNA 3AO0B 1O9HA 3HCDA 3I92A 3HB9A 2HKIA 1Q77A 5AM0A 4C3OB 1XU4A 4C5CA 4BO2A 1M2HA 3H3JA 2M1ZA 2QR5A 3PCTA 3SZ3A 5IZCC 2Y1DA 2BEWB 3RSCA 3LUBA 3OOYA 3TJZA 1H2FA 2RCYA 1KNXA 2FWRA 1SC3A 4LWOA 1NLFA 5EPEA 4ER7A 2Z2JA 4FCVA 1O9BA 1U3VA 3MAAC 4G36A 1H65A 4I2VA 3O92A 3W1WA 4QHTA 2JS7A 3D7MA 3M0EA 4L9SA 4V2IA 4ZV4A 5CA1A 3TGLA 3IP1A 3L0DA 2ZGVA 4JDUA 4CG1A 2CLOB 5T8KA 1IG3A 3DHNA 4H9GA 4C1BA 2DHDA 4QLOA 2HWWA 1U28A 3AB8A 3OE5A 4AECA 2QORA 4JI8B 4IS2A 2J8ZA 3A26A 3QKIA 5HF8A 1F6BA 3R41A 3RGGA 2IY9A 2QUBA 4JOBA 4BNTA 3MPOA 3G0BA 1BGVA 2W2XA 3AY6A 4RD6A 1ABEA 4RK7A 4HDKA 4TKMA 5D3QA 5JH7F 1FK8A 1YB7A 1GVHA 2RHGB 3BG5A 3GAMA 4HWGA 3LT0A 4J7AA 4MW6A 3TR5A 5LP6B 1W4RA 2YJ6A 4PGFA 1RKBA 4RZ2A 2ZJOA 4WZAA 2YOFA 2YH2A 3H16A 5EESA 3ETJA 2CLSA 5I7EA 4D0SA 2W0SA 3GFRA 2UZIR 4WNCA 3T41A 1UDRA 1KR2A 1R74A 3I9MA 2ZTVA 4OHOA 2R1TB 5U4XA 5IZCA 3BXHA 2CLIB 3MLEA 3S70A 1OFTA 2IL1A 2QTRA 3PXUA 5BNZA 3ONVA 3IURA 4YMUA 1IIBA 721PA 3B85A 2R62A 4N7BA 4DCNA 3ONNA 5HE9A 3WVNA 1L5VA 4GX1A 1P60A 1TJYA 1XGKA 2C2GA 2YZKA 2P4HX 3KB2A 4RPLA 1RXCA 1T3GA 1U3TA 2PKYX 5CLHA 3DAGA 1XPRA 1K7XB 4RNDB 2OXTA 4N7MA 2GEBA 3ZDYB 3LT4A 2ZWIA 3EGDA 3RRMA 3PQ2A 2X1LA 1NT2A 2Q6VA 3K96A 3MRXA 1EVIA 3MM4A 4IQ0A 4QXQA 4FFPA 4MR9A 4ZT3A 5BQOA 3UMVA 3GMDA 1I1HA 4HVTA 4MRMA 4GWKA 1IOWA 4LXXA 4EHDA 5AO9A 4MCIA 2REBA 2H17A 2PRKA 3KHSA 3E3OA 1C30A 2F48A 3FNRA 2ONJA 3W79A 3CNBA 4A27A 4FDMA 2NTNA 2WFAA 3FTQA 2Y1OA 3QLJA 3RC7A 2POCA 4ARIA 5CAEB 5LKAA 3UFXA 1IM2A 2FEPA 4LZNA 1HWYA 3KWFA 1DMRA 4JXKA 1F2UA 3EQ9A 5DHTA 3ZWCA 1BXRA 4R0NA 2CFCA 3IMFA 1X94A 3QHPA 1GY8A 5IJWA 2VXCA 2CXQA 2CLFB 4BLPA 1Z7WA 2WC1A 3OM1A 4FHGA 2Q3DA 2AMFA 4N8DA 4P34A 1D4FA 5LQAA 1SH7A 2D0IA 1V8ZA 2X1MA 1TLFA 4G5FA 2O8BB 3PPWA 2DR2A 1VHDA 1M2VB 2HA4A 4RA6A 5KTSA 1W96A 1N33B 2BZ0A 1NVXQ 2R97A 2O9JA 4GBED 4OEHA 5JCJD 2A9RA 4PYMA 1RKQA 3KXPA 4D43A 2WNSA 4B1FA 2J48A 3TOXA 1S02A 3LAWA 3OLWA 4M8SA 3W8DA 5I4KA 4ZQFA 2O2SA 2RMKA 1NUAA 4IG4A 1ZD1A 2ZYAA 2GLTA 3BD8A 2FFQA 2IPLA 1WZEA 3HFRA 4HAXA 5K8VA 4PTYA 4C03A 1T2UA 3KTFA 4LE1A 4YI3A 5C1PA 2JD2A 2OILA 3TQTA 3O0DA 3FPSA 4XGNA 1RT9A 4ZO4A 4DEYA 4F2HA 1YZLA 3PX3A 4LXYA 4NOMA 3V5NA 3S4YA 1NBIA 3H0KA 4MVJF 4BVKA 4KR0A 3WBJA 2WNIA 1D4AA 2UDPA 2ZTHA 3WGLA 1XB2A 3B6IA 1W4BA 1PGJA 5TEWA 3ANNA 4MAMA 4R71A 4OQMA 3GEIA 1XK6A 3G82C 5IT4A 1TCAA 4P3XA 3ZX4A 4X6YA 2YY7A 3V7YA 5LMCA 1A0OA 1KBQA 1OMOA 2IGTA 3KFVA 1NN1A 4F2WA 3HZZA 4Q3BA 3SHWA 1A9QA 2WHPB 3DG9A 1JIVA 3LP8A 4UUQA 2G5CA 1CRPA 3L8CA 4QICA 4B9AA 3BB3A 3EIEA 3EC1A 4YRPA 3BPSA 2QTVA 2VYCA 1G3QA 3FVQA 2ZQ5A 3C3YA 4DM4A 5KNDH 1MGPA 1IN7A 5FO1A 3WYNA 1BHJA 2QVXX 4XDHA 2RD2A 1XNRB 3CURA 3O0TA 2XTMA 3FPFA 4Q3LA 1D2EA 2VJQA 4OQQA 2YVLA 5CB4B 2E5LB 3GJ4A 5TQ2A 1Y8RB 4B7AA 2J1LA 5BQPA 2QM7A 1I7LA 3BX1A 1ORDA 2O7QA 3ERCA 4URXR 1N2EA 4ZCLA 4BECA 1GGKA 2BLLA 1V2HE 5EG5A 3HJHA 3VUFA 5I9LA 2DAPA 2ZI4A 4E5DA 5JZMA 2R6DA 3BORA 4TL6A 3RKUA 3K20A 4DSNA 5CXXA 1ULUA 1Z7GA 3Q4GA 4UTNA 1O6BA 2YCBA 2VBFA 4HDSA 4PXAA 4RM2A 2Z5FA 3ZW8A 2P9EA 2PMBA 1XEXA 2QMUA 4FEEA 5GZ3A 5KBYA 5LXTB 3KSBC 2NACA 2XNCA 3DZCA 1UMCB 4MWDA 1ODIA 2I5PO 4D9MA 1CQZA 4NU0A 2Q0XA 2QTZA 4DCVA 5HSGA 3NWBA 3G13A 5J2UB 1U0JA 4UTVA 2NN3C 3E53A 3R3ZA 2E5FA 4K40A 1HDYA 1H4QA 3JQQA 1UT6A 3COPA 4Y2QA 1KOLA 4OLJA 4RQAA 1ZCFA 2VNJA 2YV2A 3I5AA 4ZK2A 1FMFA 4IGEA 1O57A 2H2FA 1KYYA 4DQKA 2BI7A 2YXNA 3NYWA 3BT7A 2XAUA 4Y6SA 1Q91A 2FLWA 3G0CA 4BBAA 3EXG1 3SBEA 3G0OA 3UV6A 2OFXA 2ZS9A 4JQSA 4PX2A 2IYAA 2GM3A 2VWHA 3JAWB 5AKGA 3DE7X 5TLSA 5BORA 3WGOA 1BS2A 4WLNA 4BQEA 1UBRS 3AZOA 3ZK7A 4WN9B 3OURA 1VJ1A 4I66A 1PIWA 5K3EA 3BGWA 4HAIA 4FN4A 2V3VA 2QRPA 2WJIA 4LZWA 4DG5A 3G2JA 4JLBA 1C1XA 1SQ0A 2JRLA 3AR8A 3RBZA 3ILVA 4IOMA 1AHHA 1L1QA 3D6FA 2W4QA 1K8RA 3G2IA 2IKQA 2GJ4A 2XMCA 3GRUA 2F59A 4YJFA 3ZN2A 1E1RD 4RCVA 5DYGA 2P69A 3IP7A 4BJ5A 4IDBA 5HZKA 1U0TA 2VUTA 5C4IA 4LTMA 2CEAA 3DFFA 1EX9A 1H2BA 4R9RA 1FYDA 1MEOA 1UKAA 4JELA 2ID4A 4LYFA 3VC1A 3F5SA 5TR9A 3DEIA 3BAFA 2HW8A 4KVZA 4U9UA 5JNSA 3AKCA 3OFKA 3J81A 1QRTA 1Q6YA 2XECA 4LBYA 4O4IB 5CNIA 4YO8A 5PNTA 3KD3A 4MQFA 3ZUGA 1OY1A 2PKEA 5FD8A 3TLEA 4DVJA 4IICA 1KAEA 4V1CB 3TLAA 3GUYA 4TMYA 2PMKA 3KDPA 1R4MB 3RKRA 3TZQA 3VHXA 2Q5HA 4DTIA 1NIPA 2JHPA 4ZI7B 4ZEXA 3IEUA 4GI1A 3C98A 4I9GA 1D2RA 2P9FA 2VBIA 3N59A 3MHPA 4IS3A 1WXIA 5CFRA 1S8NA 5JMWA 1AY0A 2VF4X 1PT8A 3WYAA 3H8WA 1R4AA 2CGEA 1NLYA 2YYZA 5CXSA 5FLEX 3D6HA 1KRXA 3L5OA 1NF9A 4L5CA 5KYVA 4FE3A 3G0IA 1EE1A 1QIKA 4YRCA 2H4WA 4FCTA 2DPMA 3MUFA 3FOCA 4CETA 5EINA 1AZSC 3NDRA 1UMBA 4TM8A 3TSAA 1ZR4A 1E7QA 3LQ2A 1JFFA 1LRLA 1P2FA 3EUFA 2ZTUA 1RXIA 3ANMA 2CNLA 1INLA 3OX3A 2YWDA 2Q5FA 4YJGA 4O2BA 4ZA2A 3SQNA 1T0HB 3VKHA 4QYIA 1KI4A 2VNHA 1JDTA 1TM1E 3PI6A 5COBA 3ESCA 1PLLA 4UNQA 1NMQA 4YDQA 1BHO1 2I54A 3BFXA 1N2CA 4QDOA 3FOZA 3D8RA 3TR0A 1E3TA 3Q3EA 4I4NA 4DMGA 5EMKA 1YH3A 4MB2A 5D2CA 2JIZD 1WCV1 4O02B 4TRNA 3QTTA 2BEVB 2BKAA 3N3AC 5AESA 3O74A 3GXBA 4Z0TA 4CM6A 5JSUA 2OYRA 3UPDA 1I2AA 4QFBA 2HWKA 4BQFA 3QBDA 3DVAB 2NPFA 5ITZA 4WBSA 2ZE8A 4RQUA 2WPDD 1OZAA 4MUKA 4LG1A 4Q6BA 4XQCA 4CM1A 4BX8A 2P1ZA 1KDPA 2FEAA 2Q1TA 1NVDA 2WU4A 5KOIA 1DELA 4GZ6A 1KYZA 3DV9A 4GX0A 3CUEF 5DASA 3WRWA 5DSZA 4R2KA 3ORSA 1L5RA 2CF6A 3ANLA 3FR7A 1CUXA 1X7ZA 3KHKA 4KO1S 3SC3A 3CNLA 4R7ZA 5JXHA 4FHFA 5MDHA 3IALA 3I5XA 5AK3A 1DAKA 4O25A 4W63A 4Q93A 2IY7A 4DKXA 2PUDA 1AUXA 1Y5LA 3WJ7A 2IQ5A 3CO0S 3AR2A 2JJQA 3N07A 3VV2A 5F7OA 5LP6F 1Y7PA 3EVEA 3PSHA 1XHLA 3BL8A 3Q88A 5AVVA 1UJ6A 4HWRA 4QXOA 4ECEA 1RTTA 4J29A 2FSHA 2EBUA 1LNZA 3A4LA 2JBAA 5FPPA 1XKXA 2R79A 3A05A 3DDNA 1U7PA 5B6IA 1CSEE 1D5CA 4XYGA 2Y1WA 2LV8A 2EQAA 4CTNA 4MPDA 1E1YA 2EQBA 3JQ9A 2D2FA 2ZRCA 3HYSA 5EXTA 2QI9C 1L8XA 2B8TA 1L4GA 3K0CC 1TZ2A 4DNOA 4FEYA 3A2MA 3AKEA 3K0BA 5EE5B 3AEKB 4CKXA 3ORRA 2HJHA 3GAAA 1RLMA 4YN3A 5HVNA 5KQLA 1P2GA 3T7SA 1OLSA 1TL7C 3PD7A 5AYVA 4D6XA 4PCVA 4JKYA 2YIVX 3NHUA 4HBZA 4ITUA 1MJGM 1I4DD 3EOZA 5DNAA 2A9FA 5LNK1 4R05A 2EG5A 3DXFA 3EXFB 4RK0A 4M7PA 1OBCA 4E1VA 4EL5A 1TTTA 3LFHA 1XMXA 2BH9A 2H4YA 2A5YB 4K1XA 5HMMA 5AKIA 1KJ9A 4BX0A 2QXTA 2WNHA 4MB6A 3OTOB 4HB2A 3SICE 2B2NA 4XRRA 3RABA 5KQRA 4UNRA 3HK2A 2WPNA 4GXQA 3M6MD 4Y67A 4DHEA 2CDRA 3D8SA 3PB3A 1UPCA 1Y34E 3BZBA 3D0OA 4I81A 4M99A 3INNA 1BDJA 5D7NA 1SKYB 2Q21A 2IYUA 3QWHA 4FC7A 2R0QC 1OBHA 3GT3A 1A5SB 5ALYA 3DZJA 3V97A 1U8FO 1RBQA 1WZNA 2CUZA 4OGGA 1QX3A 1G8FA 1MX1A 1VLHA 6PFKA 1CU1A 3ECAA 3HKCA 1TQ8A 1CS0B 1SWWA 2Q7XA 3FRJA 2C5HA 4KDEA 2D62A 4R1NA 4F84A 5HJ5A 3U1BA 3FHJA 4WEQA 2H52A 1NOIA 5B3AA 4NBVA 1E98A 5B6JA 3ESAA 1UP4A 3K09C 3KBBA 4OI0A 2YXDA 3RG2A 4B4WA 2WQ6A 2Y0PA 1U3WA 2ZAOA 2A9OA 1U3CA 1M73E 1VLMA 1DXQA 2VCYA 3L7AA 3ZE6A 4D80A 5AM2A 3TG2A 3FGZA 4I1UA 4L15A 3ZHTA 4YP0A 2NP7A 5KNCD 1A9YA 1P29A 2OV2A 3KTAB 5ITVA 3HUDA 2NXCA 3OQPA 3PRKE 4L5YA 5DPMA 4ARBA 1JKJA 4DLPA 1GT6A 3KQLA 4MDYA 1O95C 4LXUA 4R7GA 4PIMA 2A9KA 2VNIA 3F6EX 1SQ5A 3CQ9A 4AWAA 2PMCA 5A4IS 3GDFA 1K0UA 5CX1B 3EEFA 4N47A 4FYXA 1NLMA 3REGA 2AZMA 4CEIA 2K2WA 4UBMA 5DTIA 5IFLA 3PENA 2ORVA 4RSHA 1NC3A 3QXSA 4EEZA 2AC2A 5AIAA 3PX2A 3H18A 1GPH1 2PN1A 3HWSA 3JD2A 1BCSA 1HL7A 2FWAA 2RFLA 5G1NA 4XPIA 4HGZA 4HEA1 4WBNA 4TZ6A 3EXEB 2HBYA 2XQVA 3AY0A 2RIPA 3CNQS 3TTSA 3EIUA 3FYSA 4KLNA 2AUMA 3V32A 3ISVA 4DDHA 3I62A 1Z45A 5BWOA 1DAMA 4NMXB 3C3CA 1L5OA 1DG9A 3K09A 1KEVA 2WJHA 1Z73A 1VLZA 1QH0A 2YV4A 3D0RA 3LT1A 4M4SA 4MICA 4US1R 3S2IA 3V4ZA 2HRBA 3ZTYA 2O23A 2D7DA 1I4EB 4LYEA 1E1MA 5H59A 4CQJA 3VNBA 3T9BA 5LDHA 4HUTA 1DIGA 3AOGA 3ZBPA 1ZHHA 4LJSA 3U7QA 3LP5A 3A9RA 1AKVA 1X1CA 5CB4F 4ZQHA 4KUEA 3AF6A 3KB1A 3N6XA 2O2GA 3FCSB 1KVSA 1MRNA 2MSDB 4N8SA 3CX3A 4RD0A 5KYWB 1O95A 5AKZA 1OTYA 4ABTA 5AI6A 1LPAB 1XXHB 4RMHA 1WSAA 3QG1A 2GZ3A 3Q87B 2HPZA 3DLTA 3AR7A 3QXJA 4XAQA 1P3JA 3JQGA 1T9CA 2DVMA 2OORC 4KDRA 4HUQA 1RHMA 4WESA 3STYA 3ZCRA 4Z7OB 5GGYA 2XYHA 2OAP1 3AEUB 4DDTA 4MPTA 3UB3A 4TYNA 4UOQA 5FTLA 4O1IA 4C7BA 1FS6A 5F9MA 3IOEA 1W34A 2FY8A 4L3OA 5LXTF 3L2OB 1O58A 2FE1A 4X71A 1K6JA 1C5KA 2MJLA 1KC1A 2HU5A 3G8BA 5FA8A 5IUJC 2HM7A 3VBCA 1JJVA 3IBTA 1KH2A 1PR1A 1WSWA 4L4UA 4OP2A 3UMFA 3VU9B 1N6RA 1NBMD 4KIGA 5J2UF 3N2GA 3Q6MA 1Z2EA 1B76A 2Q2OA 4UBJA 1RYMA 3RPEA 3UJNA 4DBZA 2CMKA 3C5WP 4QDTA 3WDMA 2X4IA 3ELWA 1JEQB 2WHXA 4OA5A 4PE5B 5JSHA 1UBKS 1H0KA 3U7JA 3UH0A 3M6WA 4F5EA 1CB0A 1U81A 3QKUA 4X92A 3WKDA 3WFZA 3QOFA 1JG3A 5I9SA 5IKOA 3AFHA 2Q2WA 4MKXA 4ZARA 3AG5A 3N0XA 4JJKA 2OHHA 4LWQA 5T4BA 4CLHA 1RM3A 5DCUA 3TPZA 4MW4A 3OCWA 2QMZA 3FOAA 1V4NA 1GNTA 1WMAA 2R5WA 3SNKA 2OORA 1MAUA 1QH8A 4M2LA 5TNXA 3FHLA 2ODQA 4XVCA 1VL1A 4F21A 4MWCA 1LK5A 4G1FA 3IVMA 3ZU2A 1MW8X 3QI2A 2D0DA 1RPTA 1XPOA 2X86A 3AUFA 3S2YA 1V35A 1I5RA 4AM8A 1Z07A 4KWEA 3NKFA 2BCGY 1HE5A 4KLCA 5ES4B 3EDQA 3S0JA 1Z17A 1ADYA 3HXLA 1QSGA 4L57A 1MAWA 4NPCA 3TEJA 4LZJA 5EKDA 1YJAA 4JYZA 2WHYA 3KOUA 3L6RA 3EJ6A 4TMFA 1XD2A 2C5AA 2E0IA 2WILA 1SCJA 2IPNA 3I0NA 3LPDA 3QU9A 4G1MB 4IHAA 4ZU3A 2XKKA 2ZZNA 1FVXA 1RRCA 1TT7A 3ORQA 5D5PA 2ZREA 5FB3A 3I28A 1V37A 4ZOQI 3NWPA 4LCJA 4QIHA 4S24A 4M38A 4LS3A 4UU8A 4CV0A 9MHTA 3NCHA 1W0JD 4O4IF 2F3SA 4YR7A 3ISTA 2G40A 1RZRA 1N2CE 1UP7A 5KQMA 1OFIA 2JFHA 4IV8A 4AD8A 5B2EA 1I1NA 2A0KA 5DW3A 2BBOA 2FZCA 2ZJ6A 1Y9EA 5E6SB 4BO8A 4BUJA 4G65A 4ZI7F 1NG9A 1U2QA 2H7YA 4HXGA 4MV1A 1ZXLA 2HCRA 2H18A 4LV5B 3AM3A 3DV0A 2IV7A 1U2ZA 2I71A 3GGCA 1JHUA 2BGGA 3I6ZA 4HQRA 3FAZA 2GPSA 2QQ5A 3H5IA 4IXTA 2G3YA 4Q4HA 2G0TA 3ZV4A 5ELXA 3DLBA 4F9TA 5C1DA 1ZD5A 3CLRC 4JJ7A 3C8DA 2PH7A 3AY3A 5TMEA 1JU9A 1T4CA 2YIMA 2WD7A 4WCVA 1L5LA 3SNHA 5IK2D 4O8ZA 1IZ0A 3IHTA 2PZEA 1OPXA 2P6NA 5DLQC 4AKGA 3O7WA 2BLNA 1ZUHA 3HDTA 4YRGA 2MWMA 5FYQA 2ZVQX 1FNMA 1SY7A 5H3HA 4EA6A 1WB6A 1XX6A 2J3LA 1YQEA 3LLSA 1NBHA 2EF1A 4GXRA 4EDHA 1H0SA 1MF7A 1DUSA 1V9SA 1M33A 3MG9A 5IAEA 3GELA 4UQLA 2ZB2A 4X64B 3TQSA 4WK0B 1BQ3A 2HHLA 4GYJA 4WACA 2X8LA 1LPSA 1ZUWA 4GZMA 4NNJA 1FMLA 3I32A 1U8YA 2Z2YA 3RODA 4DABA 1VPDA 2HO4A 2HMYB 3RU2A 4C0QC 4M86A 4MSUA 4OGFA 5CH5A 2GETA 3WGQA 5EZQA 4ESOA 4TXMA 4JT9A 3DBHB 3NASA 1GA6A 2AHOA 2X5XA 1G20E 2XLBA 1P1KA 4G4GA 2HSJA 4UW9A 3ID6C 3O4IA 3S2UA 2L0XA 2YVAA 3D2BA 1GKIA 3FTNA 4FINA 2BBWA 2YMQA 3JSXA 2D5BA 2XMZA 3AR4A 1X7XA 1XN1A 3LX6A 4HEHA 3M5PA 3O9MA 4FS3A 4ESHA 2DXIA 4QQKA 3RJ9A 1V7ZA 2FSIA 2QRGA 1SZDA 2RHMA 3G8DA 4KPUB 4NG4A 1ZCAA 2OUIA 1F0KA 4ZANA 1EM8A 3KEMA 2JATA 3K2BA 2R1VB 4FD3A 3V7FA 4BFYA 5KEIA 1J2EA 2D8MA 4Q21A 4UEQA 2FUNB 4K26A 5IBQA 1A7KA 2XUDA 4BGEA 3I0ZA 3R5TA 4RVHA