5GOTA

Crystal structure of sp-ptp, low molecular weight protein tyrosine phosphatase from streptococcus pyogenes
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
150
structure length
150
Chain Sequence
MKKVCFVCLGNICRSPMAEFVMKSIVSSDVMMIESRATSDWEHGNPIHSGTQSILKTYQINYDITKCSKQITITDFNTFDYIIGMDSDNVKNLKEMSQHQWDSKIYLFREGGVPDPWYTNDFEETYQLVRKGCQDWLSRLMSKEYLEHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Low molecular weight phosphotyrosine phosphatase family prot
publication title Crystal structure of SP-PTP, a low molecular weight protein tyrosine phosphatase from Streptococcus pyogenes
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Hydrolase
total genus 60
structure length 150
sequence length 150
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2016-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5gotA00
2J48A 2R47A 2PUFA 2LUOA 1FSPA 1L5YA 1D2AA 3KHTA 4N0PA 3JS5A 1U0SY 3QLUC 3GL9A 2OQRA 3IPCA 3LUAA 3LUGA 3QX9A 2FMFA 1JDPA 3IP7A 1ZH4A 4E7OA 1NTRA 5B3JC 3KLNA 1I3CA 4KK3A 2FTKE 1SD5A 4MRMA 1RPJA 2JVIA 2FEWB 1Z17A 3H5IA 2WMYA 1CEYA 3M6MD 1GCGA 4LE1A 4S04A 2H3HA 1SRRA 4EYOA 5GOTA 3RVNA 2FLWA 4YV7A 4MR8B 3OM1A 3GWGA 1QP0A 1ZH2A 3EODA 4Z0NA 3ROTA 5JNUA 2VUIB 3NHMA 4Z4HA 5T7BA 2R25B 1YK0A 3RQIA 1LJUA 4MQEA 1DRJA 4W5QA 4MQFA 1JF8A 4O1HA 3FFXA 3H5TA 3LOPA 3A0UA 3A3KA 2PUBA 3GRCA 4HYEA 2WJWA 3BRQA 2GKGA 3G1WA 3QLVA 4EVQA 1W9HA 4RDCA 3GA5A 4RY9A 5CHYA 3T95A 5JS1A 4LE0A 3F7NA 3LKBA 2B1JA 1ZGZA 4MS4B 2NUBA 3N53A 5IBQA 2QVCA 1Z12A 5JNRA 3EGCA 3LUFA 4JB0A 1WETA 3H1GA 4IGAA 3O2QB 3QELB 4NCAA 1TM2A 3FDFA 4MS3B 3DGFC 2L2QA 2MYNA 4PYRA 3T8YA 4ZMSA 1DRKA 4G0ZA 1MB0A 1ZN2A 4HNSA 2LIVA 4RK4A 4WUTA 2PAFA 3CS3A 4MAAA 1Z2EA 4TLLB 3MMNA 1DC7A 2QW1A 1NXOA 1F4VA 4MYRA 3ILHA 4Z4CA 2ID9A 4LX8A 2ZAYA 5CNKA 5GQSA 3EQ2A 5IX8A 4MR9B 5CNIA 1QNLA 8ABPA 4P98A 4Y9TA 5EWJB 5KWSA 2PJUA 1RXEA 5HM6A 5KQPA 4MGEA 3C6QA 3IDOA 4DN6A 1S8NA 1LJLA 4WXEA 3CNBA 1BDIA 2OENG 4EYKA 1QPZA 1FFGA 1MVOA 2PL9A 2E4WA 2IPNA 2E4XA 3F73A 3JVIA 2WRZA 3FFTA 4F06A 4LE2A 3NBMA 1EHCA 1QO0D 4KZKA 3URMA 5BRAA 3OM0A 2HPHA 3BRSA 3EJWA 2FLKA 3EULA 3RVPA 4KREA 1ISSA 2QSJA 2MYTA 4MRMB 4LRQA 2PLNA 4QYWA 2FVYA 1BVHA 4L4UA 1DCFA 2DRIA 1EWKA 2NZVG 1OXBB 4GNRA 1GLGA 2A9PA 3LUKA 1JX6A 1USKA 3O1IC 5DKFA 3SM9A 2QV0A 4H3HB 4B09A 1MIHA 3M9XA 3CG4A 2RJNA 1KMIY 1HEYA 2IPAB 4JP1A 5TPWA 1YVUA 5EWMA 1P8AA 3Q7RA 1ZAYA 2IOYA 3NNDA 4IMIB 2P4UA 3EQZA 3H5VA 5BR1A 2IKSA 2FKAA 3OMWA 3QEMA 1B00A 1Z16A 4HNQA 2HJ9A 2GBPA 1NXTA 3N75A 3A10A 9ABPA 2FMHA 4IMJB 4Z4IA 2X7XA 4RK1A 4LDAA 4N0QA 3O21A 3SG0A 4XXHA 2W42A 1D1QA 3QX8A 1EFAA 3QLVC 3HS3A 4YWHA 1LBIA 3OLYA 4QYMA 3O2JA 3FGZA 3DBIA 5TPZA 4DADA 2F8SA 3H5LA 2A9RA 4ZPJA 2VYCA 3RH0A 3RVRA 3CTPA 6CHYA 3HXMA 3TMYA 5D2CA 3KYJB 3RVLA 2PUCA 3RVSA 4OTZA 3MM4A 3N0RA 4MLCA 1Z18A 5CNMA 2PL1A 1USIA 3HUTA 4MR7A 2TMYA 3TO5A 5EWLB 1E2BA 4YCSA 2HQBA 2LPMA 3O2SB 2NZUG 4G0OA 4LZLA 4IRXA 2E4ZA 3DGEC 1VPWA 4P1ZA 2N9UA 2HQOA 4FE7A 4KMRA 3OQOA 4O1IA 3LUCA 4XLTA 2I6FA 4NV3A 3LKVA 1A04A 3OMXA 2PUDA 3KTOA 3CKMA 1YTUA 4G0QA 4JA2A 4MPTA 2A9OA 1U2QA 2PE5A 2FMIA 5BQ3A 5FWXA 4KFCA 4XASA 2VUHB 3H1EA 3Q7SA 5FWYA 3B2NA 3MF4A 1ZITA 1OXKB 2IYNA 4RU1A 4IILA 4RKQA 2CWDA 4UHKA 1R8JA 3QLTA 3HV2A 1NXSA 4F8JA 2IPLA 5C5CA 1DG9A 5IUNC 2FMKA 3C97A 1TVMA 3HO1A 2MSWA 3HSYA 4Z4FA 4ETMA 5IUKC 3I45A 4RV5A 3RVMA 4YRZA 5TQ2B 1VRVA 4YP9A 4OATA 4W5OA 2WWVD 3TD9A 1DBQA 4GPAA 5DCLA 2ZWMA 1TLFA 1CYEA 5TQ0A 4F11A 4KPYA 3MA0A 1GCAA 4G0XA 3LFTA 2O20A 4OLBA 1MAVA 4RY8A 1PEAA 3ILYA 1KGSA 1JDNA 3K9CA 4EUKA 1M5TA 4PEVA 4ETNA 5IULC 1VKRA 3N6VA 3NNSA 3HEBA 5TPWB 1BDJA 2E4VA 3UUGA 1VLZA 2PUGA 1XHFA 4PZ0A 1GUDA 4FE4A 3P9YA 4WZZA 3GYBA 3JPYA 3KYIB 5TE9A 4OLAA 3TX6A 5HQJA 3QEMB 3K4HA 3KSMA 4G0PA 3VNBA 4NCBA 3LMKA 1K66A 2HSGA 2L17A 2V0NA 4OBBA 5PNTA 3VNAA 2M98A 5FBKA 5ABPA 1GUBA 4G0MA 1NXPA 3HVRA 1W25A 2FQXA 5IC5A 3OLZA 1PEYA 4RXTA 4XARA 5FBHA 4EGSA 4KNYA 4H60A 3O75A 1EWTA 1A0OA 3D8UA 2GX6A 3A0RB 1U8TA 1PNRA 1DZ3A 3SY8A 4RZSA 1YMVA 1H9CA 1ZESA 1Z15A 4MR7B 1NY5A 4MS1A 2GI4A 2L19A 4G0YA 1YIOA 4F12A 4TLMB 5CNJA 5KQGA 4G97A 3N0WA 2FW0A 4O5AA 4E7PA 2FQWA 5JNSA 4EY3A 2FN8A 1E6MA 1MB3A 3HZHA 4YLEA 6ABPA 3MYYA 3SAJA 1E6LA 4LDZA 2PKXA 3DLBA 1QMPA 1E6KA 3CFYA 3UKJA 3HUUA 2LBPA 1APBA 4JOQA 5FWXB 4MS4A 5I4CA 4KVFA 4KQCA 5FWYB 2R48A 1JWLA 2PUAA 2AYXA 4MQEB 2JBAA 2JRLA 1ZGGA 1J56A 2CHEA 4MQFB 4JAVC 1JH9A 4ZYLA 5JNTA 1DJMA 1T34A 1LK0A 4W5RA 1SXHA 3Q7TA 3DZDA 1USGA 4EYGA 1YS7A 1AB6A 2FXIA 2H0AA 2QU7A 3O1JC 5TQJA 5KI6A 2M1ZA 3QEKA 2QXYA 3IP5A 5IEBA 1QP4A 3O1HB 3Q9SA 4QICA 1C0EA 1KRXA 2XDYA 1KRWA 4HNRA 3E3MA 5JS2A 5BRJA 3BILA 1Z26A 4WXMA 4ML3A 4RXUA 3HDGA 1M2FA 2E4YA 5TQ0B 1M5UA 3GT7A 5E3JA 4KRFA 1TMYA 4EYQA 1DCMA 1DCKA 3RVOA 1YK1A 4FB4A 4RKRA 4UHJA 3H5WA 2BGGA 3NNNA 3CHYA 2QVGA 4H3KB 2LP4Y 1JFSA 2VK2A 2CHFA 3JVDA 4EVRA 3L6UA 2MSKA 1P6UA 5ED4A 5C5EA 3T38A 3EAFA 3RVQA 4RK5A 2NT4A 1Y1LA 4RWEA 2FQYA 4Z9BA 1XWWA 3BREA 1ZVVA 3L49A 3OLWA 1ABEA 3KG2A 1FFWA 4Q6BA 4M88A 1NATA 3N0XA 2Q5CA 3JY6A 3MQ4A 1BDHA 3C3KA 3BBLA 2MYUA 2YHBA 4RY0A 4RK7A 2B4AA 3H6GA 1ISRA 4D74A 1D1PA 4CBVA 3CZCA 3LUJA 2RJOA 3HJFA 2HQRA 3LTEA 1PHRA 1BA2A 1JYFA 1K68A 1ZY2A 4KQ9A 2PUEA 2GWRA 1QQBA 2JVKA 3SQNA 3IP9A 1JFVA 4EVSA 3C3MA 1ZDMA 4D6XA 5DGCA 3I09A 3ROFA 5TPZD 2P9HA 2QR3A 4DQDA 4N41A 4PE5B 4ZMRA 4MS1B 1EWVA 3T6KA 2PMCA 4YO7A 5IUJC 1LBHA 3CRNA 1JHZA 2CD7A 3QK7A 3LUHA 3KS9A 3CG0A 4N03A 5JNWA 2IDMA 4RS3A 1AB5A 3TB6A 3I5AA 3Q15C 1SXIA 2FN9A 1RZRA 1DBPA 1ZHHA 3OO1A 3G85A 2ID7A 3OQNA 4N76A 1F51E 1FQWA 2NT3A 1SXGA 3JPWA 3OLXA 5KC9A 3KKEA 3QLUA 4YR7A 3KLOA 4WT7A 5EWMB 4OG2A 2YHAA 4XFKA 3E61A 4YS6A 3CLKA 1QO0A 4RXMA 1XHEA 1JLKA 2KYRA 2JBAB 2JCGA 3DLHA 1Z2DA 5B3JA 1PNTA 3FFWA 1QQAA 3N8IA 2R4QA 3OLVA 4IF4A 5F64A 2JB9A 4TN5A 5EWLA 4N47A 3W9SA 3LUDA 3UK0A 4G86A 4RK6A 2JVJA 1NXWA 5T3YA 4Q6WA 1PUXA 1NXXA 3NHZA 1L5ZA 3OO0A 2FSPA 1TJYA 2WJAA 4JB2A 3H6HA 4L85A 3R0JA 1JL3A 3KCNA 4TMYA 4MR8A 3CZ5A 4Z4EA 1P2FA 1JBEA 3GBPA 1YMUA 3RVKA 3H1FA 4WWHA 2RDMA 5JNVA 1IIBA 3KJXA 4RSMA 3HK2A 4W5NA 3MIZA 1A2OA 4PICA 2F8TA 1BAPA 3SNKA 3IP6A 1RZRD 2E4UA 2MYPA 5KQLA 2FEPA 3GV0A 5DLEA 4ZJPA 3RVJA 4ETIA 1QKKA 1D5WA 4S05A 4KK4A 3HCWA 4XAQA 4YGXB 2AYZA 3F6CA 3D02A 5TQ2A 4D6YA 3M9WA 3S99A 2FEKA 1ABFA 1UDRA 7ABPA 4F3TA 3F6PA 3H75A 3OQMA 3QELA 5KC8A 1Z25A 1YS6A 1NXVA 4NQRA 4MS3A 1DC8A 3FMVA 5HKOA 3HDVA 1URPA 2IPMA 3H5OA 3O74A 1EAYA 1JYEA 1DP4A 3C3WA 2WY2D 4W5TA 4RK0A 4JASB 2QZJA 4Z4GA 3HM9A 2RGYA 2WB4A 4QPJC 3GBVA 1D4ZA 5IEJA 4NICA 5HSGA 1Z13A 3EDCA 2L18A 1DBWA 1FFSA 1U04A 3JTEA 1RXIA 4KV7A 5DTEA 1P6QA 1JFTA 2A9QA 1U2PA 4MR9A 1QP7A 4Z9AA 5EWJA 3IPAA 1RNLA 2JK1A 1M2EA 5KQMA 3CU5A 2MSLA 3Q41A 4Q7EA 4Z99A 1C4WA 1CHNA 3I42A 4MLDA
chains in the Genus database with same CATH superfamily
3K0BA 4F4HA 3I2GA 3QUCA 2O48X 3RSZA 1EXDA 2C5GA 4EA8A 2JANA 2YC2C 3K9BA 4ND4A 3JYLA 1EJ2A 2F67A 2IYAA 2YQ4A 4PBSA 3VSDA 4D82A 4WA7A 1L2TA 3S2FA 4DLKA 1GRNA 2FMTA 1B0PA 2Q3BA 1S02A 2B8NA 4S1NA 3V8BA 3LUAA 1YDMA 2AZXA 1CRLA 4UATA 1K5HA 2H4FA 3AJEA 3VRHA 1PF7E 5HS6A 1XTQA 2ES4A 3U3KA 3B6KA 4PZ9A 5JDCC 1XMJA 4ZQGA 3SXUA 4V39A 4M1QA 4QUGA 4WNAA 5ALRA 3UV7A 5K6AC 1J8YF 1RC8A 3SICE 4BWVA 1M83A 1Z63A 3DS8A 4C7BA 1SRRA 4DLWA 5C9ZA 4J4BA 1DDIA 2D1SA 3CF4G 3PVCA 4RPCA 2D1FA 9ATCA 1L5HA 1KO8A 2C3YA 3E23A 4D4LA 1JZSA 3NIGB 3VR1A 2YCLA 1WUHS 4TTAA 2R25B 3I9V6 2E49A 4AMBA 3ZGZA 3KT8A 2IU3A 2Q2OA 1DI0A 5EL0A 1A9SA 1CERA 1EGMB 1Y8ZA 1B6SA 2R84A 3FHLA 3LOPA 2ZYDA 1VJ0A 2W98A 2PUBA 3Q88A 5FLEX 5REQB 3LPDA 4PN7A 9MHTA 2VG8A 4PNZA 5DO9A 3DEJA 1W19A 3GA5A 3AUFA 3VPFA 1JDZA 2XHZA 3DYIA 3SEAA 4K2HA 1JTVA 2OLKA 1B2RA 1R74A 3FVWA 3GRUA 3UCEA 5F23A 2C20A 2PN1A 3N53A 3R20A 4LECA 1ZL0A 4ZEVA 2O50A 3SDSA 2A1TR 3ML1A 3U31A 4CM1A 2ZJZA 3JSAA 1S1MA 1IAVA 2HA2A 3B5EA 2AFVA 3DAOA 5KOHB 1GGHA 3HB9A 5COBA 3O4FA 2C88A 5FLYA 3S2SA 5KSZA 4BS9A 1SCNE 1EBBA 1TUGA 5CLGA 1VSQA 5LL6P 2ZU0C 5DTJA 2GKSA 1IBSA 1R4NA 2OOSA 1N6KA 5EN4A 2VP3A 3ZDYB 4Z3OA 4RK4A 4QTUB 1W96A 2IZOA 4WUTA 3LDGA 1M2OA 4UC0A 1G41A 3C24A 1YZUA 3GROA 3V9PA 3WLHA 1H85A 2ODBA 5LP6A 1Q1GA 1X1TA 2ZBVA 3CC8A 4FHDA 1U7UA 2IF0A 4IF6A 4DBZA 1H0RA 4HQ0A 3ZDDA 2O6LA 3T3EA 5EPUA 3P5SA 2BEWA 1I36A 2WAYA 2ZAYA 3BHMA 4KB5A 3L8MA 3WBJA 2EP8A 1SK8A 2YXEA 1RVV1 4MR9B 1QNLA 4P3PA 3GGPA 4P98A 4RDHA 2VLIA 1ZH6A 4H7DA 4Y9TA 3C7CB 2PVCA 4OJMX 3QKUA 1RWNA 3QV1A 2BGMA 3PA8A 4LDJA 3VR5D 3P0RA 1M6VB 2ILTA 2JAHA 4I6EA 4LXGA 2GEKA 1H3NA 4HEA1 3ND6A 1XCPA 1XRQA 2QTVA 1YCGA 1LXCA 4X8OA 1C1HA 1JG7A 3UN1A 5L4NA 2NVUA 3ZS8A 3FAZA 4UUNA 3G82C 1BQEA 1NIJA 1S3FA 2EX0A 3KKPA 1GZUA 5D1NA 4NARA 3KAKA 3EXFB 3VM6A 5MDHA 1THZA 1V8BA 4YRKA 3BXOA 1AQYA 4AMUA 3I1JA 3TRIA 4HGNA 2VSNA 1GZ3A 2PBZA 3B3FA 1H5UA 1GLGA 2J5BA 2V5UA 4JYPA 4PXYA 1PAUA 3SEFA 1XIVA 1MC5A 3TPCA 3GLGE 1E1DA 1HC7A 4Q9JA 3A1EA 1V16A 3F3YA 3CKYA 3OT5A 5ARCA 4BMNA 1A76A 1SBNE 3O8QA 3O4GA 2PX2A 3UCFA 1NPTO 3WWEA 3EPHA 2XZPA 1K8QA 2W8ZA 2Y4OA 4QRHA 4UFOA 1R50A 2J6BA 4KQGA 3CPSA 3I04A 5DLQC 3KV1A 5BR1A 3TJRA 3AHHA 3BERA 1SVSA 1L6IA 2TMKA 2I6SA 4HGZA 4XGRA 4QWMA 4PC6A 5IAGA 4AUEA 4HWRA 3K3PA 3NS7A 5A7FA 2IRWA 2RHRA 3BWBA 4WHMA 5MGNA 1MHPA 1N2ZA 1NXTA 1AZTA 2X86A 2FMHA 4LYFA 3P9RA 1CV2A 2BZ1A 3OTWA 2C9MA 1VC2A 2GTIA 3GRYA 2W42A 1VKNA 1U3WA 4QUJA 4FXOA 1USVA 3SYRA 3SZUA 3FN4A 2O52A 2HI0A 5EXSA 1X2EA 3IB6A 3IT1A 5G1NA 3DBOB 2WYOA 3SXPA 1RC1A 4ZV7A 3U9TA 1U2RA 3EG5A 1O6GA 3I72A 4J90A 1F2TA 2OYCA 3RVLA 3ZDZB 4LK3A 2VKTA 1KQGA 2UVPB 3TQTA 3NDPA 1EK6A 3OIUA 4JS0A 2R86A 4G1CA 5BYAA 3NDJA 1JEQA 4I4CA 2YOHA 4OP2A 3IR6A 1ZOPA 2VJAA 1HO3A 5M2QA 4ARUA 3U40A 5GMOA 2RH9B 3IYLW 4RJTA 3GFOA 1T2VA 3QXCA 3WZLA 1ORDA 2HHLA 5LR6A 1X8JA 3IOEA 1T8RA 4PNHA 3EUWA 1RMYA 5EP4A 4X8MA 1IEQA 1PK7A 2QQEA 4Y9DA 3WHIA 5F2EA 3SU8A 4CM6A 5GAJA 5D86A 1XRMA 1U0FA 5FTNA 3PTAA 4CWAA 1Y3HA 4ITRC 4PLVA 5DNVA 4YN3A 4QLAA 2RI6A 1HBJA 4RORA 3ZVKA 1K3TA 4RD1A 2BONA 4XLZA 3ONVA 3HLKA 5FAKA 3ET4A 2O8NA 3ODGA 3TG8A 1M5RA 4NYMR 3G3EA 1CY4A 3VZCA 1FP4B 1U0JA 5KOYA 2P9TA 1I2BA 1KVUA 1E2EA 1E8MA 4CT0A 1VLVA 2NO4A 4W5OA 2QP4A 3QZUA 7ABPA 1X7ZA 1QRTA 4IEEA 1NFFA 1TUIA 2FSVA 3R5KA 4IJQA 1U90A 2ZJ0A 3M4XA 4BN4A 3U4CA 1GUYA 3H6KA 3PHBE 3RANA 1Z7YA 3LF2A 3GFGA 1J21A 3M6XA 1NA5A 1NW3A 3AKEA 3M5CA 3Q6NA 1M1UA 1P7YA 3ZHYA 3HXOA 4LXXA 4ND2A 1JDNA 4JI1B 5C35A 3PC6A 4R16A 2YWGA 2Z8YA 3UUEA 2QN2A 5I9IA 2F9FA 2VYND 1XHFA 4BDTA 1F0NA 4X6UA 3RAEC 4TKZA 1FW6A 1PYGA 2FZCA 3JPYA 2OG2A 3KYIB 1VZ2A 4GMGA 4KIUA 3RS0A 3AR2A 1Y4SA 2Z5GA 1PX0A 3JWPA 2BJVA 3CVUA 1ISFA 1Z2NX 4QXQA 3OQIA 2JRCA 1PZEA 1MJGA 4INAA 2EBWA 3VGJA 4G9EA 3OHMA 1LPMA 4M7WA 2OV1A 3OA0A 1SOMA 2PPVA 1AUXA 4O4HA 4AS2A 2QVZX 1Y37A 2Q49A 5JANA 3WMRA 5HOQA 4KYIB 2WNIA 4WXPA 4YUWA 1ZEMA 2G9QA 1U8TA 3QXXA 1SKAA 4IJ5A 5J63A 5DJ5A 4G84A 1M74A 3GJRA 1NE2A 4EG3A 2QI9F 2WD8A 2P5SA 4ZCIA 4F3YA 3UKOA 1GA4A 4JC5A 3W5DA 2NYAA 2PBRA 1OBHA 1YIOA 2NZJA 1HE5A 4Q00A 3EVZA 1W44A 1JKJA 1AKUA 4O5AA 3P5BA 2IS6A 1YFJA 3TN7A 1MV8A 3WGQA 1XN1A 1I33A 1Q1EA 4KLZA 2G1AA 1JIVA 4HPXB 3OPYI 4NU5A 3EH1A 4OGLA 2ZP1A 3ASZA 4P2GA 5BWBA 1NVUQ 2BC9A 4P53A 3UWOA 4DVGA 4ZHSA 1KF0A 2BUAA 1J8DA 2DJ5A 3O8OB 2J6IA 3UAOA 3H9CA 3FCAA 4MS4A 3B7WA 3N8NA 4EQZA 3OZAA 4IRMA 3S2IA 4MQEB 3RSOA 4IIDA 1U9JA 2JD0A 4QTXA 4KXUA 4IICA 4EDHA 4F9GA 1CXZA 2EFGA 2YJZA 5C2JB 3G02A 5BN5A 2LKCA 2C9ZA 4FGZA 5BXYA 2YRWA 5IDWA 3IMGA 4L8GA 1AGXA 1AB6A 3SHTA 2WIFA 2QU7A 2ZI5A 1VCMA 4X60A 3LWNA 2DWCA 1S4QA 4DCCA 4MEJA 2CKDA 3Q9SA 4BZXA 4A8JA 5HQ3A 2UXDB 2P1DA 1AKEA 3JWEA 3MTQA 4ZODA 2A9JA 4G5GA 4LWPA 1NUQA 2PV7A 3EFOA 2ZXFA 4ML3A 4G4SP 3LE8A 1TZBA 2XMRA 3W5IA 3KIPA 3R9XA 5FCDA 3EH2A 2BN4A 3CPHA 2WHPB 2P2CA 1QE0A 1RC0A 2VHWA 4P4NA 1T1JA 1TTHA 4OPMA 4B84A 3C5WP 4H3KB 2FNAA 2QVGA 3G0DA 3GFBA 3VH1A 4M83A 2GTHA 3E0XA 4EVRA 4GPBA 4GXTA 3ZWVA 2C2WA 3L6UA 3HXTA 2K2WA 3LXRA 1MX1A 2H48A 3H7AA 3D0RA 2H4XA 2QRVA 2XTNA 4JV5B 3KVOA 2NU7B 4NMLA 1VYUA 4Z9BA 4D25A 1J1UA 1E1RA 1OYYA 3BFVA 3OHPA 1G3IA 3CRVA 3OC0A 4QG7A 4URFA 4AFNA 4M88A 4WAUA 4B40A 3FCCA 1M66A 3H99A 4R8LA 3PJDA 1KAQA 3UGQA 2AKYA 2EX1A 3R7FA 1PFYA 1MX9A 1YBMA 2CCJA 3ILSA 4MGIR 2I6QA 4B6JA 5JRJA 4PRYA 1P45A 2B4KA 3B1KA 1KEZA 3MJ4A 4FINA 3VR4H 5IT5A 5E0OA 3NH6A 1NIPA 2F3TA 5FFMA 1HNNA 2OCYC 3F5FA 1CUIA 3DMDA 4NH4A 5JJ5A 4BYMA 1Q44A 4L8LA 3QVTA 2OA0A 1QBKC 1YR6A 5F52A 4CMIA 1RWPA 4JUAA 4RTPA 3EPJA 4DMKA 3NWBA 4F1JA 4JLVA 1HGXA 1PJLA 3H5AA 1B1CA 2PMCA 2AHOA 3LCMA 3BGIA 3ACCA 2O6HA 4LOKA 1AKWA 2VVTA 3QUAA 3U4DA 1CIVA 1WD7A 4HYQA 5DX1A 1U80A 3O26A 1SKYE 2V5AA 4V24A 1RYDA 1SXIA 2X13A 1RZRA 1MA3A 1C0IA 1X7DA 3ZGXA 2R6HA 4OMDA 7GPBA 3IVXA 2VWPA 1CUUA 1SEVA 3GIWA 1NYTA 3H18A 3HN2A 4X61A 4P32A 4ZK2A 4IO0A 2GWHA 3TUZC 1G8GA 1M7HA 2DAPA 4U2GA 3OLXA 1A9TA 3WRYC 4DJAA 5MFZA 2OORA 2HBZA 4BC1A 1M0EA 5KX5B 1W47A 4B6FA 2YINC 3F7MA 3IAM1 4Q7QA 3NTOA 2I3ZA 3LHIA 3LT5A 1XHEA 4M8IA 4PWYA 4D97A 4CEIB 3CMCO 5D87A 3TSOA 4E5KA 4BNKA 4LJ7A 4GR9A 1X7WB 4JBXA 4PM4A 2R4QA 2PEYA 2OC4A 1CUCA 3AFMA 4FGUA 4FMBB 5F64A 1OU4A 2D3TA 4KXNA 3S3TA 1C80A 1MZVA 2JHFA 5FNVB 5IW8A 3UMBA 1U5BB 2AL7A 2DGDA 1HYEA 2XUQA 1FRQA 4K87A 4NULA 2A58A 2F48A 1GZ4A 2WF7A 3ECAA 3F9IA 4Q3CA 1OX4B 3D1JA 5TSDA 1OFGA 1L5KA 1GPNA 3R0JA 1YZVA 2QP9X 2P4SA 2YJ3A 5B1SA 2BCGY 4YH1A 1NQ5A 1P9LA 4EJ0A 2NV2B 5CDYA 2PTGA 3WP0A 1ELOA 4QT0A 1YMUA 2WJHA 3I12A 2XEDA 4B1FA 4IUCS 3USCS 3WIDA 2XXAB 1JI0A 4R05A 4ZOBA 1UMCB 4D44A 2F8TA 2JCVA 5ER9A 4TOIA 3DQZA 4RD6A 4YV1A 3ISVA 2GCEA 3H9EO 3IR7A 1I2ZA 3DBRB 1V25A 1DLIA 4I46A 1YHYA 4FHEA 1O96A 3JXEA 1XLTA 2ATEA 5D3KA 1N1DA 4IGIA 5JJIA 2NLOA 2AFIB 3VR3D 4BNMA 3V1YA 5KKCA 2RI0A 3SQLA 3NHBA 5KYXB 4I7EA 3NIWA 3ZY2A 1YT5A 4RZ3A 3TWOA 1S1CA 4V2IA 3TOXA 4ENVA 1A9QA 4EZIA 4MDFA 5BW4A 4MAMA 5BSGA 1XZEA 3R0ZA 2NZXA 1N92A 5KOHA 3WOVA 1ZPDA 1UQRA 4BNYA 5IDXA 5JTTA 2J3IA 1Q2XA 3OF2A 3WNZA 3SPXA 1LY1A 2NYVA 1S5PA 2IW3A 4MUFA 3GLFA 1G6OA 3PX2A 1AHPA 4WKNA 4HO1X 1A2QA 4TTPA 3GT3A 1IULA 2G8NA 1EIZA 2HWUA 2VF4X 4ZWNA 4D43A 1NF9A 2JGJA 4A0HA 1GPYA 3ORYA 4IVPA 2VSOA 4PZCA 1QHNA 1TLLA 2WA2A 4C88A 4LHZA 1A5ZA 1C0PA 2QXTA 2ZIVB 3AW9A 1UPTA 4RTQA 3JQAD 3GGCA 4QPPA 1H2BA 3BE8A 2OY0A 3EC7A 2XE4A 2OHXA 4MR9A 1RYNA 2GXAA 3LSYA 4OHPA 3RV3A 1JDUA 4MAFA 1II0A 1M2EA 2JD2A 3GG2A 2ATXA 4G5FA 4HB3A 3G89A 2PO7A 3W9BA 4HRAA 3BZUA 4NLLA 4CG1A 4BNIA 4RHYA 3GAFA 1UAAA 3FNEA 3OPQA 3HCAA 4U7GA 4V1CI 5AVVA 2Q3DA 2Q8QA 1VRWA 1K3UB 4I0WB 4GSKA 3O90A 3O92A 1GRVA 3LHFA 5JTUA 2WHXA 4FFNA 3TBFA 3O31A 4B5KA 4P4TA 4MW0A 3S29A 3AEYA 1JDPA 2VDNB 3QOWA 4LWQA 1ZR4A 4RHUA 2DVMA 3HADA 4FNGA 3TLGB 5B3JC 3EXFA 4YUZA 3TZLA 1CHDA 1MJ5A 1C3JA 2IZZA 2YFHA 3AHIA 1DXHA 3VU3A 1E2HA 1LDYA 1CJVC 2PYIA 3M5DA 1M6NA 3N0VA 4PZZA 4FBGA 3TXYA 3VNSA 1XQWA 1E7RA 1YQWA 2J9ZB 5AK0A 4C05A 5DCUA 4C4YA 3OSZA 3OD1A 1YAHA 4AYXA 4Y1GA 2N1MA 1PTKA 1S2LA 1Y1RA 4KXMA 1A5TA 3LKZA 2VDWA 3OUZA 1ZMRA 3OJOA 1KP2A 3PDUA 2DG2A 2R8RA 3D4IA 5ELMA 3JQAB 4BWFB 1ATIA 4LSZA 4HDKA 2IYSA 1L5RA 3N3AC 1ZA1A 1RHMA 3EF3A 5CMLA 3V33A 1VSUA 2PGAA 3OKFA 2B4TO 4HUQB 1HT0A 2IP1A 1XD2A 2YWEA 4HAUA 1DTSA 5A2QA 1E3JA 3HE3A 4HYEA 1L8XA 1N57A 1V6CA 1JWBB 1PT7A 2G4CA 2WJWA 3C39A 4FGJA 4MZXA 4X3PA 4GQBA 1XZKA 1UKEA 3EBLA 3MEQA 4FEEA 1J2YA 3KNZA 4J8PA 3TQHA 3UJPA 3L92A 5EHQA 5AXDA 4H4DA 4V0ME 2QDXA 5EXDA 2YWJA 2RHHA 3GJSA 1E1CB 2AN9A 2GS9A 5TRTA 4XWKA 1SBYA 2EF0A 4CF6A 5JNRA 1T36B 3LUFA 1RXUA 3GNLA 4OIFA 2D0OB 1VL2A 3U7RA 2GJSA 1ULSA 1WMAA 3DZIA 4DCSA 1P0FA 3H1GA 3NQ41 4Q4JB 4ECEA 3QELB 4Y67A 5FL3A 1XR3A 3JRNA 3L7KA 2V97A 2ZJFA 3S1LA 2EEZA 2YRFA 3L05A 1NBME 3L84A 4AI6A 1HT3A 1XZPA 4ZMSA 4FMCF 2HNAA 1V7PC 1B6GA 5FA8A 1XNQB 1QVAA 2BDUA 3PC3A 2BGLA 3OT1A 1SBHA 1ZN2A 2LIVA 3GEGA 2XRZA 4QUAA 1GZ5A 5I7EA 5BUQA 1E69A 5FI0B 1Z2EA 4PQGA 4DV7B 5J2TF 1OI7A 1NXOA 2GYWA 4Q7JB 4MYRA 1GZ6A 2ZZKA 3HCDA 2XTAA 2PX4A 2ID9A 4DSNA 4YRMA 1KMHA 3OZDA 4F3RA 3KAQA 1XU9A 4TMZA 1S2MA 3L0IB 2B4YA 3ANXA 3BFXA 3D54D 2JJ2D 7MHTA 1MZPA 5J58A 1TQ4A 1XJQA 5B1YA 1OKKA 1RXEA 1DKUA 5F76A 4IW3B 2N46A 4OH1A 2X0NA 4UDXX 1NF8A 1PU2A 3GQVA 3T3HA 3FPLA 4KQHA 3DDUA 5DGXA 3ST7A 1IB0A 4A15A 1ZHFA 1AK2A 4KFSA 3ZTTA 3AEQA 4ER5A 4EBBA 2G7MC 2NO6A 1LTHR 4LE2A 2VEDA 1PG5A 4DR3B 1FP4A 4FFVA 3QIAA 4AMVA 4C0AC 5T5QA 4MVJF 5AW1A 3LBNA 2QTTA 4DRYA 5IMSA 1REQB 2KPOA 4IHKA 1I8TA 2BMEA 4JJEA 2CLHB 2ORYA 3ZCVA 1ZIXA 1E7YA 3RCBA 1A4UA 4MRMB 2VS1A 5DNCA 1BVHA 1XNJA 1VCNA 2FVYA 3QVLA 4L4UA 1NQXA 2B0JA 3MFYA 1EWKA 1WZUA 2NZVG 4GNRA 4JKOA 1GOTA 3RU3A 1UK8A 4PO3X 3ON5A 3V2HA 1VPLA 4WCVA 1G7TA 1KYIA 3RC3A 4PZDA 3CG4A 4ZVOA 1OIWA 2XZLA 1R2QA 1RAEA 2ADMA 1KWGA 3G2MA 5CM8B 5ALYA 4YONB 1RI4A 4FZRA 3MQ2A 4EHDA 1IHXA 4P7JA 5L51A 3E1SA 5HIJA 2YJ5A 1TADA 3DE7X 5F5NA 1OTHA 2EG5A 1Z2OX 4N3BA 1OYWA 2A9VA 3JU3A 1UKAA 3IKLA 3OFND 4RTNA 4C0XA 2XGGA 4PYQA 5JXIA 2QPLA 4BC0A 1FX1A 3A4TA 1ULBA 4HB4A 3KZKA 4KE8A 4LJYA 4WKGA 3GUHA 4GMDA 5IM4A 1VMDA 2GYVA 3T3IA 1EFAA 2DKOA 1M1YA 2Z9DA 2R6ZA 3HA5A 4GRDA 3U44B 5F1OA 3T12A 4BMVA 4QM7A 1ZGBA 2F2TA 2IP2A 3RWMB 4AS1A 4QARA 1JR3A 3TDKA 3GWZA 1H1TA 1ZUWA 3RVSA 2XW6A 3N0RA 2D5CA 5CNMA 3HUTA 1LQ2A 4DA6A 5DE3A 5C80A 5T4HA 1Z82A 4UVDA 3M89A 1FVOA 4KQEA 4G1BA 4DR7B 1XVVA 2GBIA 4IOKA 4O1IA 5K0ZA 1RDFA 4LJ8A 3CLTC 4NV3A 3ZNQA 1OD6A 1I1NA 1KMQA 2WTMA 2XYQA 3T99A 2I76A 4GLLA 1W4BA 4M1KA 3VJLA 3O8OA 2WDPA 2C94A 4Q16A 4ENWA 2VYNA 2XCQA 5H59A 3AYZB 5HKBA 3LNTA 1LDEA 1HYBA 4BEBA 2VUHB 3DZKA 4DTIA 5IKEA 1V1MA 4NECA 4QU8A 1RAAA 1K6MA 2C2YA 3GY0A 1GZ7A 4AJEA 1C9NA 3I0NA 3OJCA 3P9NA 4PC3A 4HBGA 4B8YA 2CV1A 1T9ZA 1R8JA 2W2TA 3ECSA 3AKYA 1GPLA 3DHWC 1KVQA 1OXUA 4Q39A 3QYPA 3PE4A 4D6PA 5HUHA 3ZHSA 4WTOA 5LQRA 3N2YA 1M8PA 5DHAA 1NUHA 3AVYA 3I2KA 4FS8A 3T9AA 1C81A 1N3IA 2G07A 5FTLA 1YUBA 1JHPA 2EWVA 2Z08A 4QDTA 3SLGA 2XMZA 3L0BA 4CMHA 1LWOA 4AZ0B 2BUCA 3CLSD 4HN2A 5A4MS 4YAIA 5EMKA 3OEYA 5LB2A 4DMLA 3PZRA 4CTMA 4QYXA 5JOQA 2WHPA 3GFPA 4DMGA 4NPAA 2H08A 1ZMOA 3PGMA 2NSDA 4GUDA 1P9WA 1V8PA 1OHHD 2QZ4A 1H42A 4GX1A 3IQIX 4P84A 4ND6A 4X1KA 1UC4B 2H00A 2ERCA 2JBHA 3K9CA 4IHJA 2JGIA 3DWIA 3C6MA 2HV8A 3JZAA 4RIFA 3RO7A 2OBBA 1DHTA 2YV2A 2FWBA 4QOIA 5IABA 1BSVA 1AM4D 3H1TA 1BXKA 2P30A 4J0JA 4NDZA 5JWHA 2NU7A 2PZGA 2BOVA 4H6WA 5FL7D 2OZKA 2WC1A 3LVRE 4ZOCA 4Q9HA 2ICAA 4EMBA 5H5JA 1E59A 4GI1A 4JFRA 1NT2A 2XZOA 2ZTSA 5BSUA 3ZE1B 1X87A 3NTUA 4HX5A 2ZG6A 3Q8MA 2ZRNA 3LMKA 2IXEA 2NTNA 4IH1A 1SQ6A 4IYJA 5FBKA 1YRWA 4BV2A 2DT5A 3A32A 1K2WA 3MPUA 3ZGNA 4DG8A 3P0HA 5FUQA 5F73A 3FW1A 2GX6A 2ZWAA 1PNRA 1I2DA 3I6MA 2D2IA 1N6RA 1QNFA 2CZQA 4KO8A 1QK4A 2AE1A 4N6GA 5D00A 1IN8A 1KU0A 4HKTA 4LS3A 4M0LA 4REMA 3UO8B 4M1WA 2XVZA 2FPKA 5BW6B 3LQ2A 1F1BA 4EB6B 1SAYA 3DDSA 1FYDA 1BQ4A 4CKYA 4FKZA 3ZUGA 4CRWB 4DLRA 3OE1A 2BI7A 4EF5A 2HF9A 3IESA 3OURA 3PDIB 4F8YA 1Q50A 3A6DA 5JPIA 2CZCA 2N47A 2HEGA 3IULA 4UM7A 3CX3A 4FYIA 4ND7A 4O59O 3ADDA 3GLQA 2QNRA 2QW8A 3RAJA 3UKJA 4GECA 4RPJA 2C5FA 2P69A 3BWCA 1E9CA 4TYMA 5I4CA 2CYAA 2ECPA 2F3SA 3JAWB 3T34A 3HC7A 2JHAA 4EA6A 1WDTA 4DQVA 1JPVA 1PK8A 2PKQP 1E7SA 3BD8A 4ZYLA 1X7WA 4IIJF 5FBWB 5F9FA 1T34A 3A36A 3ET5A 5LXTF 3V00A 3FKJA 1RMTA 2XOXA 1UBNA 4HNHA 4DCTA 3QU2A 3G88A 1KZ7B 1M2NA 1TJ3A 1XLVA 2ECQA 3PFIA 5FNVA 1U5BA 1ADGA 1JV2B 1BU5A 4M9UA 1H93A 3G2NA 1Y48E 1P4JA 1OX4A 2IZ1A 4H7PA 3SZOA 4ACBA 5CCXA 5EIXA 4OLHA 5LLDA 1JMYA 4P80A 1V9LA 4X97A 4A6XA 2O59A 3NXKA 2QEQA 4QHTA 2XLCA 4WFIA 1CZOA 5AI8A 1J8MF 1Z0AA 2D2XA 2HU8A 4B82A 5JU6A 1WNTA 4LY0A 4MINA 3P1JA 1WBJB 2EHDA 4I4IA 5CH3A 1R0ZA 2G63A 2CSUA 3EHDA 3LLVA 4V0QA 4Z54A 1UMCA 2WYHA 1U6IA 1DBVO 3MHTA 3TEFA 1FB5A 4DM7A 1NBOA 3DBRA 2VPTA 4ZVKA 5IF3A 3BA1A 5ED4A 1E9AA 1GZDA 2CVOA 2ZWIA 5IKOA 3CVJA 4ED9A 5L9AA 3W1EA 4CJXA 2GK3A 2XQGA 4WLNA 3CW2A 3VYWA 3UMYA 3DMHA 3MS2A 1JHUA 2YXPX 1VHJA 4B71A 4XPIA 5CT5A 1G17A 4FILA 1E0SA 1HE2A 3F67A 5CYOA 1D1PA 1V1RA 2OCLA 5FULA 1FA9A 3M6WA 3KALA 3VX4A 1JZQA 1Z4MA 2IYPA 2I80A 2QJWA 2B94A 4R1OA 1TX4B 1K68A 1D2RA 1PJRA 8ATCA 1PSWA 3SHQA 1QAQA 2HA7A 5IMBA 3E5HA 3OFJA 4RQAA 3T3GA 2Y71A 1V45E 2A8YA 3ZJVA 2O05A 3ADKA 4BJHB 4BJ3A 2WHRA 3GI1A 5F5LA 3IV9A 3TL6A 4DQDA 3JQCA 3AEXA 1YR7A 2WUEA 3DMFA 3R3YA 5IJXA 3UHAA 4GXNA 4FX5A 2DMRA 4YJHB 2PY6A 4NZPA 3WKDA 5HFAA 2EU8A 1NLZA 1FLDA 5FBLB 5C51B 2ZYHA 4ZO7A 5AK4A 4LOJA 1ZOSA 4MVXA 4N9QA 4R7GA 4JROA 3HABA 5A3SA 4U2BA 3ZK9A 3SKYA 3GGOA 3PGVA 1XZ8A 2H6EA 2G9VA 2I3AA 1WXGA 3TB6A 5IT0A 4DG5A 1XPUA 5CH5A 3TZHA 2ETXA 3QUSA 4MKGA 4CQNA 2R7NA 3A04A 1F51E 4MUJA 3FOAA 2XUOA 4Y1EA 4DLAA 3KSBC 1ZJ6A 3DT9A 3E82A 4BBJA 2DHDA 5KC9A 2YY5A 3DEAA 1DJQA 4MWSA 4WT7A 4EBFA 1E9RA 4EI7A 2J6CA 5H4HA 2QYTA 4J49A 3L4BC 1ZN8A 4X92A 5CVTA 3IA7A 2JCGA 3U13A 1W29A 2OFXA 3VSCA 5IAJA 4AICA 4I1PA 4LJ5A 2X2OA 5JEDA 4JVNA 3BFPA 5D01A 1XP5A 2JB9A 2C5AA 2QE7D 1HSZA 1L8OA 4TKLA 5E2AA 3ZX4A 4ZHQA 3K7EA 1NRWA 3UK0A 1UBCA 1S3IA 4NPHA 4RK6A 1OWLA 1O03A 4Z8YA 3TEJA 5DT9A 4EJ2A 3A9CA 1II8B 4PFJA 2G3YA 4UKDA 4XUEA 2XGMA 3C3CA 3KTDA 1G5HA 1SIBE 2QX9A 3H6HA 3JD3A 4JEHA 4RKFA 5J5AA 5JE8A 1I5OA 1ZJ4A 1H2RS 4JJIA 1E8NA 1RRGA 3B52X 3GEIA 2HGSA 3DZCA 4X45A 4OGKA 1WXWA 4KR7A 1FE8A 5KDOA 1E18A 1CE8B 3LK6A 3NX4A 4IIYA 3T9FA 3D7LA 3H1FA 2FCRA 1YA6A 5IVDA 4YMSA 1B41A 1M76A 1O97D 2AMFA 2IPXA 3OY7A 5T4BA 1ECGA 4EO9A 2GEDA 4JJKA 1CDZA 1SWVA 2ZE6A 2A88A 1EZ4A 4HUQA 4BNLA 3UXYA 4AAYA 2FEPA 3HYCA 4GO1A 4C6SA 4ER7A 3MCVA 3CGWA 5GJCA 1IB6A 2P35A 2RK4A 3BC1A 1RIFA 2W90A 1IWOA 2OXTA 2CDNA 3SCZA 4LJLA 4TXMA 4W1SA 5DLYA 3V4ZA 4X6YA 2AYZA 1BHJA 1R6XA 4A9AA 1E1CA 1IY1A 3FZGA 1T1IA 4OREX 1Q16A 4GNKA 1VL8A 4KRYA 3M9WA 2X4GA 5BSTA 2NUAB 2FEKA 4MYSA 5HGXA 2XTZA 2IA5A 1G6KA 1WLYA 1YD7A 2FFBA 2BISA 2XWSA 4MIKA 4RZHA 5KNLA 3QELA 4FP9A 1Z25A 4CFYA 3HTXA 5FPYA 1DPGA 3GRPA 3QU7A 2FXVA 1G4HA 3FMVA 5AICA 5TXGA 4K0RA 2VKQA 1S6YA 3E9CA 4QASA 3RIMA 4B17A 1JYEA 3EGWA 4GEKA 4KR6A 1BX0A 2HDOA 4X1YB 1L5MA 3I64A 5EEGA 3SR0A 3T5BA 5J4KA 3L82B 4L95C 1PQYA 2FK8A 2GEJA 4WRRA 1ZD8A 4MHTA 3O47A 3JWHA 1FW8A 3IBFA 1JIQA 4KX5A 3I83A 3JTEA 3BXGA 1H5QA 4YX9A 1RQ2A 4ALLA 1YL5A 5BOSB 5BO5A 1K06A 2B20A 1YVRA 2VWGA 4ZRNA 1VTKA 3T5AA 2Y2VA 2PPLA 4ZOEA 1F7VA 4MW1A 1N5DA 2B2CA 1J2TA 3CX7A 1YQ9A 3IV6A 3OU6A 1SHJA 4R2LA 4QA9A 5B4UA 3E5NA 3IP8A 4WINA 2GM3A 2QAGA 3NIFB 2MCFA 5IZ4A 2FA9A 3HCBA 4YI5A 3IVMA 5ESRA 4A0QA 2OQRA 3MINB 4BZQA 1QRRA 3NW9A 3QEBZ 9GPBA 2PFGA 2O0MA 4QDUA 1T0PA 3SYTA 4F3KA 3C6XA 4KDEA 3P7MA 1V3TA 4JLNA 4RZ2A 1U1FA 1MJFA 2FTKE 2Y92A 1HWYA 1NWHA 2FZVA 3PXBA 2WI8A 4MRMA 4J3NA 4F92B 1J2EA 5AVKA 5IVHA 3LTNC 4G5OA 3ZVNA 1HV8A 1Z6TA 2D54A 2RGDA 3FNIA 3PGXA 4FC7A 2PUJA 4HPJB 2IFTA 1JE1A 3THWB 1AF7A 1XZHA 3CLRC 1HYQA 4V3BA 4DREA 3S2EA 1KZGB 3W2EA 5FBRB 3THYB 2IIBA 3UZUA 1QP0A 2SBTA 4MQMA 5JNUA 2VUIB 3B5IA 4H7EA 1BVRA 1PJBA 2PX0A 2J85A 3G0GA 1U4OA 4B7CA 2JJ2A 1FS5A 4U6NA 3ANNA 5E9AA 3LLCA 1BOOA 5CFZA 7ADHA 1VE9A 4S24A 4GKAA 1WIWA 1FLAA 1CYDA 3L06A 4JBNA 4JP8A 1BJTA 4Z7NB 1Z68A 4J0IA 5JH7F 4HEA6 4CLOA 2C3PA 3DOEA 3PQ7A 4HYYA 5I7OA 4CR8A 5DULA 2B1JA 1XKTA 2D5LA 2FDCA 1JQDA 3KZXA 3I1IA 1Z12A 2Q6TA 3U4QA 1T1RA 5IJ0B 5DHFA 1K4YA 1KQNA 1MGPA 4P58A 2VRNA 4UBLA 3WVNA 1WETA 3FX2A 5JHHB 4EKEA 3TQSA 4QJBA 3VTFA 3S27A 4URUR 4BLWA 1FFEA 3IPXA 4G2NA 1TEZA 1UFRA 2P7IA 4MJXA 1OIVA 4PYRA 4IIXA 4M8LA 1WMFA 1GP2A 2P2YA 2KM1A 3FNHA 1A1VA 4YAUA 4L5BA 1XTVA 1OLSB 1W4CA 1U63A 2FV8A 1CEXA 4HZGA 5EAIA 4Q4DA 2XNCA 4MQ5A 3ZDQA 4ZDWA 4Z7OB 4WKCA 2PEZA 1HSOA 3ZJ5A 1JSLA 4I1UA 1QTIA 2NZYA 1E66A 4IGKA 5DTIA 5C0OE 3FIUA 1U31A 1U8AA 2ECFA 3RLFA 5D51S 5KVQA 4BVFA 5CNKA 3OQBA 1D0VA 3DC7A 4K9QA 4A36A 4JJFA 5D6OA 1Q5PA 2N42A 3UT5B 1KJYA 2O4CA 4TSFA 1U3CA 4YFVA 2FOIA 1KFBB 2R7AA 3EMVA 3OFNA 1T0IA 5DHPA 3WFIA 4B76A 2L0XA 2HXYA 3OIGA 3QKSB 3WKBA 1BG6A 1GITA 1X19A 4D45A 2V55B 3IQXA 2NYRA 2R8BA 4GLJA 1TW3A 3VYVA 1RXVA 1BYIA 2P2LA 3IERA 2CVPA 4YHBA 4PTZA 3QFFA 3HU2A 2D13A 5A9SB 1NQOA 1QFXA 4L4SA 2NUPB 3KEQA 5BN3A 1JEOA 1EGHA 2J59A 5HX7A 2JIBA 1WMSA 2PRSA 4OK3A 2GHIA 1VCOA 2QMUA 4GH5A 4R2WA 5DK4A 5FPPA 4ZCPA 3PFWO 1Y9AA 1P75A 3DHNA 3BK2A 3EJWA 4UHEA 1NR7A 4DVJA 5ES4B 2YX1A 1UZUA 4QYWA 2A59A 1E0KA 3BXFA 3SC4A 2HRBA 5B1EA 4Q15A 3S4YA 2AYYA 1HQKA 1USKA 4NCXA 2P9EA 4Y2XA 3K9LA 3EQ9A 1DO0A 3VDMA 2QP3A 4BE7B 1DS6A 1VXOA 2XT6A 5CLIA 2G1PA 1UBMS 3IRVA 2HBQA 4J16A 2F6RA 3RRFA 2X42A 3EXEB 1RSZA 1F2DA 1STOA 1V11B 2VBFA 3CRQA 3HU5A 3Q7RA 4JQOA 4Y0NA 3EVBA 4B3GA 3EQZA 5IRCD 3QMWA 2ZQ5A 2HSDA 2GRAA 2W0SA 5TS3A 2Q7DA 3OMWA 4QOGA 1TEXA 5IAAA 1EFUA 4MCAA 3FOEC 1VYTA 1T9CA 1CBUA 3F47A 1FCJA 3GT4A 3V7UA 3CVWA 1W36D 3ZGVA 1JDSA 5F1PA 1D1QA 5FWDA 4EKGA 3PUHA 2BM1A 4PYLA 1V5FA 4KACA 5FAXA 3VKWA 5TVKA 2D0DA 2R00A 2TMDA 4LBZA 5EP3A 4I5IA 4Y2TA 4NAHA 3R24A 2QUHA 4LBWA 2HHHB 3H84A 1YB6A 4FLFA 1USIA 3D5EA 3LT2A 4A7PA 3D4LA 3L4SO 1F4LA 1NW9B 2OGSA 5KPJA 4P3XA 3ZVRA 4MUHA 3GDFA 2EG9A 3KYBA 1I7SB 3O4RA 3RSLA 4NNJA 4QOEA 2HNKA 5EERA 1OHHA 1HYHA 4UEQA 4YJ3B 5D84A 1N4AA 1GTJ1 3JQ8B 3VJRA 2D5BA 2RFLA 1SPXA 1LBSA 4KODA 2XCRB 3FUXA 2CVZA 3WLMA 3CZAA 2JH3A 3DMGA 5PGMA 5IWCA 1IN7A 3P8ZA 4JA2A 2Y0EA 2PA0A 2PUVA 2VTVA 4K6CA 5C4GB 5HW0A 3Q8LA 4K6FA 4HN9A 5IU6A 2WYUA 2NWQA 3DCJA 4EF4A 1UJ6A 2ZJOA 4KWEA 2RONA 3UK7A 4BP1A 1FNCA 1V4VA 3FTFA 2HREA 4Y9RA 4D5EA 3B2NA 2CMKA 1MH9A 3E7FA 4TUYF 3L7NA 1ILWA 1DDGA 4IILA 4DAOA 3MXOA 3C6BA 3NU1A 1O6FA 2IELA 4OJQA 5DGIA 1TQ8A 1T9GR 5FYQA 2YTZA 2YW2A 1W36B 1AMUA 4NNPA 3DHEA 3R8CA 1LVHA 821PA 1V9SA 1U7XA 4JLKA 3FTDA 2I71A 5EJ2A 3W8NA 3I45A 4U6QA 1A4IA 1TKAA 4CQLB 1I7DA 2FX2A 3OOWA 2ZRLA 3AKCA 3MWGA 4JH0A 3OF3A 1MQ9A 1F0PA 1UOQA 3VU1A 4DJFC 2DLDA 1Z7WA 2Y1CA 5K3BA 4CDMA 2C00A 1A5BB 1OUMA 3TE7A 2VSQA 2I6GA 3H4MA 3TVYA 1R37A 1SBCA 1IONA 1RWOA 2H7XA 1N6PA 2W6QA 1CP3A 3AFGA 5CT8A 1IEXA 1AS0A 3A1WA 1XPOA 3HY4A 4HDRB 4I1IA 2P68A 2FRXA 2VCHA 3ILYA 1I6LA 3DEKA 1UWLA 2G36A 2QD3A 4LHSA 1FVXA 1EM8B 1L5FA 2IYZA 3R7WB 3JQPA 2JI4A 4G0WA 2RHGB 1PTJA 3PGKA 4XYMA 4INPA 4IJKA 2DBVO 4AP5A 3LRPA 4G0PA 3L07A 3OVMA 1UJ2A 1XEWY 2Z2KA 1GO2A 3NORA 4ND5A 3W4JA 2AR7A 1NOIA 1BCRB 4P7GA 1UCFA 2X0RA 4ZO4A 4DDVA 4F91B 4U7DA 3VKVA 3A7DA 5MFPA 2ZVQX 2UZAA 1BXRA 5ALLA 3OLZA 5DU2A 4RX1A 4F56A 4KNYA 3I53A 3TR0A 3CN7A 3O75A 2SNIE 2TECE 3C7DB 1PW7A 4R8SA 1AG9A 1RI2A 3BE4A 4ZQBA 2CL7X 1U8CB 2HSEA 3CQ9A 4RGVA 4DB4A 1A72A 1MR3F 3Q3CA 1NY5A 3DAHA 1NVVQ 4FCTA 4YJHA 4CMGA 4DHWA 2EKZA 5L45A 1UBLS 1E58A 1SCKA 1N4DA 2B2XA 4OJTA 5D3MA 1NL3A 2HRZA 1BE8A 1NSFA 2R8ZA 3PCTA 1PV1A 3S99A 5EE0A 4D3SA 5HRUA 4D9MA 1D1SA 1NVXQ 2MT9A 2GF9A 2IIVA 2OAP1 3BAZA 1WB6A 3MYYA 5AI6A 2PR7A 2HPAA 2ZR0A 4YMTA 3MTDA 4L8WB 1Q0TA 2B4RO 3I4CA 1X1SA 4LWOA 4BLVA 4EOGA 1P18A 3MN1A 5JSYA 4KVFA 2XLBA 1F0YA 2Z8YM 4MA5A 1DJNA 3HBFA 4K1XA 5KTTA 1KYTA 1RYZA 5FBVB 2DFNA 2XD4A 1JFFB 1AUOA 1OPRA 2P3OA 2Q2VA 2YVQA 4JMPA 1GGVA 4MQFB 4TL8A 4WE3A 3WLQA 4W5RA 1SC4A 3NUQA 2WKQA 2AF4C 1LB1B 3IEIA 4HL6A 2CLEB 1JB1A 4EFDA 2EHJA 3EZNA 5EZYF 1CZLA 4HDCA 1E6WA 3O1JC 1ZGHA 2ZTHA 2CBXA 2JIPA 2ODWA 1YR9A 2QKYA 2QUJA 2AXQA 3CZ9A 3QFCA 1II8A 2HMUA 2BT4A 3FF1A 3ER8A 1EAMA 5CEFA 1E2KA 5TF0A 2QLNA 1RLTA 3LBFA 4Z53A 3COPA 1RLMA 1RJEA 4WXYB 2Z56A 4YB8A 4OBXA 4M37A 3HB0A 1D2HA 1EXMA 2F3PA 3OCCA 1E1QD 4GOXA 1OROA 4TV9F 2A5GA 4UXHA 3WK5A 2I6UA 4PSDA 3WL5A 3U3DA 4M9ZA 2WTUA 3TPZA 1TVKA 2YQ5A 1LF0A 3IBGA 5ALQA 5SY9A 3RC2A 3T4XA 5KNBD 1NPYA 2FR8C 4Q1AA 1E77A 4UQPA 3WYEA 2P4EA 3KR2A 3IAM6 1JEYB 4ARIA 1O6CA 4AQ7A 3Q0IA 3N58A 4YMGA 1I3KA 1UWCA 1RHJA 2NQ8A 1P91A 1UH5A 4S1TA 5CXQA 5CEEA 1J23A 5ESDA 1G5PA 1ULUA 1JAHA 3K9GA 4D42A 2QHXA 2R751 1JIJA 2QTCA 3IDAA 5CX4A 1NVFA 1WVGA 2CYBA 1XDGA 3BBLA 4EMUA 4U4AA 3DCNA 2NUAA 2Q6LA 1EDOA 1V8DA 1ISRA 2GLUA 1UOEA 2QE7A 4DNXA 1CY7A 1XWFA 3EYWA 3IEXA 3LTEA 1JIXA 4ZZ0A 1E6UA 4CQMB 4KQ9A 4UUAA 2I03A 5AVRA 4AT1A 2BM8A 4WKOA 2HIHA 4R1SA 1D5CA 1WB4A 4A16A 1AT1A 2RG7A 4BL5A 2VDQB 1QZZA 3BTUA 2Z58A 3IFSA 3N7TA 4A8PA 3ZJTA 1KIFA 2Y1OA 1N5JA 3JD1A 5DW3A 4JY7A 1ZGAA 4ONEA 4TPKA 1AQUA 3Q7PA 5CGQB 2CW5A 4QGFA 4X7PA 1FSFA 4Q3OA 1A3CA 1DV1A 3C14C 3KS9A 3M2PA 4X6LA 3WSVA 3TTUA 4Q4AA 4C2BA 1YB4A 3VI4B 1LLCA 1Z4JA 2W6CX 4TN1A 5D5QA 3ZDXB 3NRJA 2OO5C 1G63A 4V38A 3ZQUA 3SLKA 3X1ZA 3JQ9A 1KSHA 1I7NA 2DQZA 1RWMA 3SJBA 2O5CA 1L5WA 1SXGA 2GCGA 4W1RA 3VX3A 2Z4SA 2BBWA 1HG0A 3L7IA 4RVUA 1TA9A 3TE6A 4OG2A 4E5VA 3K15A 1U1IA 1JLKA 1QYRA 2CXPA 2JBAB 2VAPA 4UZFA 3ZGLA 1X39A 5KNCH 5ALJA 2HEIA 3FNGA 2BEUA 4A73A 4PFQA 4R83A 2J9GA 5FPSA 4COOA 1WKVA 4TZ6A 16PKA 3AR8A 2OHIA 2WYVA 1IRXA 4MKIA 3JVVA 2NU8A 4YJ2F 1GKLA 4WKPA 5C1DA 2AG5A 1OREA 3AVQA 2B1GA 2HN9A 4FE3A 3OO0A 4NBSA 4YCAA 2UV8A 3ZJ4A 2Y3IA 1W6RA 5BT8A 2EJBA 4DJTA 3THWA 4W99A 1W2WB 1E63A 3HB5X 2FW6A 3GGDA 4F60A 2YH2A 2YV4A 3P96A 5B3AA 3WLIA 1D2EA 4TLBA 2SICE 2P8SA 3BUSA 2RDMA 1AA9A 1E0JA 4OBEA 5ICFA 2JGRA 2QENA 2Q5EA 2ZROA 1XELA 1NVKA 2VQFB 3QY9A 1F06A 1GTG1 1VPDA 2O7VA 5GPBA 1FUKA 1XZQA 3F8SA 4I8XA 3AH8A 2I8AA 3AHCA 2XA2A 1MRZA 5B1HA 2C7BA 2ESRA 4TWZA 5EIEA 5KO2A 1QIEA 4GS5A 2CXXA 4BO2A 1R6VA 1KDTA 1US8A 2C5EA 3EWNA 3NB0A 1OTYA 4JZKA 5G0SA 3UW1A 3OU2A 3T0FA 2BHNA 2GZ3A 4UD6A 4UAJA 2X3YA 1H2YA 4UCWA 1ODLA 5AVYA 2O3SA 1QIFA 2WT8A 1KE2A 3BE6A 5IJ0A 1Y9ZA 1F8FA 5LQUA 2I6XA 1I6MA 3ZI4A 3D1LA 2ZIXA 2Z0MA 3FYUB 4UVHA 2F55A 2OFFA 3VOSA 4ZV4A 1ADFA 2WU3A 1C30A 2WTAA 4YXWD 5BWLA 2VJBA 2IZ5A 5KC8A 1BNCA 3VZSA 2VLBA 4OYRA 2IPMA 2RIPA 3O74A 2BIFA 1MCZA 5J4YA 4JLOA 4IV5A 3R76A 1W5SA 1QGAA 2QMZA 1RT9A 2QRNA 4Q7MB 4EUFA 3I2YX 1M54A 3OLCX 4BVAA 3KQYA 5JXJA 4R3UC 1EUZA 1Z6GA 4JASB 4GGOA 4WN9B 4YAJA 3VR0A 2X7HA 3CRZA 1N6HA 3DAPA 3UEOA 1O0CA 4TQ9A 5IEJA 2E0IA 3EDCA 5JS6A 5AW3A 1H3EA 3FOWA 5DTEA 2CJYA 3DB2A 1J6UA 1H05A 4N5DA 1UBHS 3UJAA 3KTFA 3UT5A 4Z9AA 1OVGA 4J91A 1WXEA 4LF4B 5BMVA 2QTRA 3JD0A 2HPZA 4KN9S 1U2DC 4DY6A 4FEAA 1Z22A 3QKSA 1IM2A 4QUIA 4C4AA 2R47A 1SBIA 3IVRA 3E3AA 5EY5B 1KI3A 4G65A 1LGYA 3KDPA 5CCBA 2OLEA 1IY0A 2GYUA 2OMKA 2PMKA 1WRBA 4DEYA 4BAZA 3EVTA 1DG1G 4US0R 4JBYA 3SF8B 4B73A 2QPOA 1TJPB 2GMWA 1TM5E 3LUGA 4PHTA 1ZH4A 3IBCA 3K0AB 4MKRA 4JQZA 5JVDA 5GINE 2JHGA 4YR9A 1E2JA 1RJ9B 2GZHA 5GGYA 3QYAA 2PGIA 4XVCA 1Z2PX 2B6HA 2ORWA 4UTOA 3NDBB 4BJ1A 1RPJA 2FEWB 4ZDKA 4M6WB 4G8DA 2WHEA 2BJHA 2EQAA 2E5WA 4N5NA 4BMYA 3EGOA 2X19A 4IUYA 1H6AA 3U81A 2DH5A 2BKUA 2ZAMA 5I7RA 3BXXA 3IBTA 2DFPA 2QTLA 4YCNA 2WQ7A 3NHWA 1KEPA 1ZH2A 3K5PA 2HJHA 2X7JA 3EXEA 1ISIA 1GG9A 4KGXA 1Q7EA 3KVRA 3A9UA 4YP1A 5U4QA 2B5OA 3FGNA 4QU0A 3FPAA 3QVSA 5AJWA 3WLKX 3AJ8A 2XSZD 1JQKA 2AEFA 5HIMA 1W48A 3P19A 4PIMA 1R27A 2W2KB 3ONEA 3QLVA 3F5MA 2GJ9A 4AX4A 2KX7A 3SBXA 1W0JA 4Z8XA 2WQZA 4BGUA 1KH1A 4OI2A 1NI5A 1DAKA 2P40A 4C29A 1HFJA 3ZWDA 2HDNB 3DONA 3N07A 3H16A 1NG9A 2I91A 1EG7A 1HQCA 4NBVA 3JATB 1PZFA 3EFHA 4R3WA 3UMFA 3E5MA 3ICWA 5H68A 3RQSA 1P4GA 3WIVA 4BN5A 2OHGA 3BHJA 2D5AA 4HFJA 4P4SA 3SE7A 4DUGA 4K0KB 2YN0A 1IWBB 3A6GA 4CTOA 1E4OA 3G8BA 3VVMA 3PQ5A 3GQBB 4UNSA 4TMXA 2BKAA 4RL4A 1GD1O 1PLLA 3W3AH 4YYEA 5FP0A 4AS3A 2P79A 4NYIQ 3WFJA 4X62B 1QOPB 2XQIA 3HL4A 4PG6A 4YJ3A 3F8TA 3NTRA 4IX9A 3JQ8A 4JEIA 1J1ZA 4PYOA 2M6LA 3DKVA 3N2ZB 4QDOA 1RBMA 4CMBA 2JZOA 2ZT7A 4ZAXA 2E89A 5L3ZA 1PYDA 1U1CA 2IHJA 1LJ8A 2IY7A 3EQ2A 3VR4A 4GYKA 5I8PA 2VJPA 3KUCA 3LA8A 3NIBA 1LPPA 4Q3AA 5LU9A 1M1NB 4KQMA 1IHDA 3FCOA 2O5VA 4CN9A 4YMUA 4E11A 5K3FB 5IHPA 1DTEA 1Z7EA 5J2UF 5FPQA 4D4GA 2E85A 3I9OA 3K9FC 1TK3A 3PNBA 1QPZA 3I23A 4NABA 2WW8A 2AG6A 2EATA 2QY9A 4RA6B 2IPNA 2GFQA 3KHUA 4DJDC 2YIDA 3CUUA 3BA6A 4HK4A 1ZD2P 4OJKA 4G01B 1RIIA 5E6UB 1ZN9A 4HVAA 1Y89A 1HYGA 5KTYA 3VPSA 3FPGA 4C76A 2C59A 4KYUA 4ZVSA 1UKBA 3BRSA 5CVCA 5L8VA 4KVGA 1J7JA 4LV6A 1JAYA 4C43A 1G8KA 4YV0A 4G0UA 2GERA 2ZS9A 3ZNPA 1QIGA 4GR5A 2Y76A 4POOA 1XZIA 3JQFC 3GPBA 4PYJA 1OXBB 1YJAA 1MRNA 4J07A 4REQB 5JAQA 3GUCA 3BIWA 4BXOB 4HDRA 1GCIA 2G09A 2HSJA 3JD2A 3WMGA 2D4HA 4GX0A 5BRNA 4ESEA 1NUSA 1ITZA 3IV7A 3L8GA 5LBIA 4RVSA 3SDZA 1QZUA 3VR6D 2X3FA 4QG3A 3OPXA 1WV1A 1QS0B 5LJIA 3KJHA 2H0RA 1ZP6A 2F1KA 2X8LA 3Q8WA 3R7WA 2RGWA 4PLTA 5KYNA 2PL3A 4JL5A 2W2MA 4DXDA 2QAJA 1E60A 1Y1QA 3LT4A 3TLKA 1NY6A 2WD9A 4OUDA 5ALGA 5FTKA 2AR9A 4W9MC 4NXMB 2OEPA 2NO9A 2X7XA 3DJFA 4A8TA 2PGDA 2HRCA 2QL7A 4OJYA 1NVDA 3QX8A 3PXCX 3HLTA 4YJDA 4ZEXA 4PLFA 4FOSA 6CHYA 1SG9A 3PNPA 4J0FA 4JBGA 4R9RA 4YUXA 3Q9LA 5LUAA 1O94D 3P9ZA 4EFLA 4A27A 3DBHA 3GRFA 3S28A 1UKZA 1JHQA 1OI4A 1YGYA 3DWFA 4TYYA 1ZD9A 4P7KA 2HQBA 4EHIA 2LW7A 1VLJA 3GDHA 3E9ZA 4LZLA 5AKYA 3K5IA 4Q12A 1XZDA 2ANBA 5EJ9A 4ZGWA 1CQJB 4A1FA 3G5AA 4L5AA 3NI2A 5I51A 1VJ1A 1KPIA 1ZXBA 2ST1A 3HV0A 1EA5A 4AKGA 4OU5A 4E08A 2UXBB 1C8VB 3R7BA 1I51A 4ZQEA 5KYVA 4QQ8A 3O38A 2CV0A 2A0WA 2ONKA 3C1TA 4MRAA 3GLHE 1KMMA 2PIDA 4J94A 3GZ4A 4DGSA 4QNRA 5K0CA 3RS9A 4GPD1 2JEYA 4IO1A 1OQAA 4KSYA 3T7IA 4RTSA 4TTRA 1IRIA 1ZITA 2P6PA 2VZ0A 4P81A 1Y1KE 1JFFA 3AUTA 2OGWA 3QOYA 5JFTA 3R3UA 5K6TA 3DOUA 4UHFA 2AH5A 5FKJA 2J0SA 4PXAA 4E46A 5K0GA 2W00A 1J4AA 1N3BA 3B1XA 3HYLA 4FYHA 4LPSA 2YUIA 4PYMA 3C43A 2Z1NA 5IZCA 2JH8A 3HSYA 3NVMB 3TLZA 4MWOA 4LXIA 3I8XA 1RBZA 2IHKA 2XEXA 2AEEA 3N8KA 1TMGE 3LCRA 5B58T 2X5KO 4HQ6A 1PJ3A 3TTVA 1VL1A 2G9ZA 4KDRA 2QBYA 2PSHA 1QHHB 1NRXA 1J00A 4XOIA 1KFCB 2ZW9A 4XIJA 1JHAA 1RM3A 3EPLA 1KJ9A 1XXLA 1CTQA 4F11A 2ORVA 3ZCSA 5CD1A 1CB0A 1VHTA 2DJIA 2AQHA 5H16A 3FRJA 3OPYA 4TX1A 5DSXA 1ECLA 5LDDC 2B7CA 1JBKA 3I52A 1J2JA 3D7RA 3ABIA 4C5AA 5K8VA 3RC8A 2QX6A 3DZBA 5BYKA 2CLFB 4RM2A 1SVLA 3PIRA 3TNDA 2Y05A 3FHOA 1FZTA 2PUGA 1A8QA 1L4LA 1GUDA 4RACA 4FE4A 4UBMA 1G16A 5TEWA 3ZWMA 2EJUA 3UXHA 2QSUA 2VHUA 4XQGA 2GNPA 1AGYA 4MVJP 3QEMB 1TQDA 1T1SA 4MGYR 4YREA 3KSMA 3GLUA 1C7QA 1GU1A 4J2HA 1VA4A 4QHYA 1ORVA 4WZ6A 1IK6A 4D3ZA 2ZI7A 1I4TD 4Z9YA 4OBBA 1BW9A 1EK2A 1T6NA 1XA3A 2QLLA 1AQLA 1GADO 4G1VA 4MGHA 2ZDGA 1Y3DE 4M8KA 4XARA 4F71A 3AM4A 3RB8A 3VZRA 2HF8A 4IIEA 3WGZA 1TIKA 4FUTA 2JIOA 3NM5A 1B73A 4B80A 2XB6A 1DIOB 4HJRA 3CT4A 2D1TA 3OG9A 2HRQA 4RNCA 1FQKA 3IMKA 5LQAA 5GGXA 5EP1A 5IXSA 1MEJA 1OAOA 4CDGA 4ZAZA 4F4UA 1J49A 2F43B 2DEUA 1V26A 3VHXA 4CLRA 3M34A 3OJEA 2YDXA 1GN8A 4D9CA 4S2EA 1MB3A 3NVDA 3RF7A 4YLEA 1VA5A 4F45A 3OZBA 1X38A 1NGSA 1P44A 2ZIAA 3LVBA 2VBCA 3GNSA 3I4LA 3ESYA 4RGBA 5D85A 3WWOA 1Z0FA 3DYBA 2I2WA 4NH0A 2XDWA 3A4MA 1RKQA 4QJ5A 1AKYA 3AZQA 3HDYA 3WGLA 1Y8RB 2C1EA 2JK0A 4YACA 4CLEA 3JR3A 3UMRA 1EB8A 1KZ6A 2PM8A 4E2YA 4LRTB 5DFAA 4K9KA 2ZYWX 3N05A 3E81A 1IFXA 4B2IA 2JBAA 5DI3B 1VXRA 3O95A 4JAVC 1NPDA 1PO7A 2VXCA 1OMOA 4J0DA 2MWMA 4EQ6A 2RGEA 3OETA 3H8WA 5CW1A 1MLDA 2Z2YA 1SU6A 3TQOA 2GXQA 5FFFA 1YZHA 5IH3A 3VMMA 2HIMA 5JCOC 5L3SA 3GFRA 3BCRA 4B7AA 1IUOA 1OBOA 3X1YA 4IIUA 2WR8A 4QXAA 3TI9A 1DFGA 1WS6A 4H3SA 1DV2A 1ZZGA 3E3MA 4DXAA 1LC3A 3DMPA 4AG5A 5CDTA 1FXUA 2HM7A 3GN2A 1J0AA 1K4MA 1NQAO 4K8RB 3VHRA 3G23A 1LK7A 1TMYA 3E9MA 1DCKA 4I1SA 1ODCA 4RKRA 4UHJA 3MTGA 3HXLA 2QRHA 4GPTA 1ULZA 3FA2A 2G80A 4N49A 3MFQA 1O97C 2O2IA 2VK2A 5KNDH 3IAHA 4E4TA 3SN6A 3VZQA 2K87A 4OJNA 3MLBA 3QXGA 3W05A 3V1LA 3LX5A 3MCWA 4KO2S 3A06A 4IKPA 5BW5A 1FUEA 1TU3A 3FNQA 1XKXA 5FIUA 4CV3A 1EE1A 3W2HA 1W88B 2UYYA 3GZJA 3NIDB 1FQOA 4CW7A 4CL0A 1SQ5A 2WE8A 2XOKD 3GLRA 3DLCA 3KPWA 3RK4A 3E1KA 5KJCA 1MTZA 1W34A 2LWIA 3HVUA 4RK7A 4XX0A 1ST3A 3FYUA 4OQ4A 1V2HE 4YPOA 3U56A 3GNQA 2DUJA 2ZIEA 3RYFB 3HJFA 1UR5A 1RI3A 3HQ4O 1WXQA 4G4JA 3HXKA 5T3UA 2JLUA 3ICOA 3OX3A 5HHTA 2Q3FA 1AS3A 5L95A 4X8LA 4NE2A 2M2IA 4QWWA 2P75A 2CMDA 4YRBA 1IVNA 2P67A 4NBUA 1PDWA 2ZFUA 4ALNA 2IH5A 3TCNA 3CXUA 5A3RA 1KEVA 3U0VA 3W5UA 4D46A 1MO6A 1QAMA 1LBHA 1KNQA 4TRJA 1U11A 3AOEC 1OGIA 3DE3X 4A6DA 4FMDF 1CCWA 3KJIA 4RWZA 4BLRA 4D5GA 3DYVA 3H13A 3Q15C 4V2UA 2HGZA 2FN9A 3M6FA 5JAIA 1SN7A 5LMCA 4O63O 3U7GA 5AM0A 1P4HA 1WZEA 2NT3A 3I9LA 4O4IF 4D99A 3FMPB 1JEDA 4BVLA 1I4OA 1MDFA 2QX8A 1P2UA 3SNHA 3G0HA 3WYCA 3BMCB 3PQ4A 4M53A 1H1LB 4N12A 4DE5A 5K0JA 1R12A 3FPHA 1A82A 4M1EA 5EGNA 3RIYA 3SF8A 4BPBA 2JBWA 4IF4A 4D41A 1XZCA 2BR4A 2PSJA 4G67A 4RULA 4N18A 1CUXA 3KSZO 1OW3B 1V3VA 3PHCA 4JNKA 3WHPA 3UHPA 1QE3A 2RSLA 3K92A 3MJVA 1I9GA 3QQPA 1NXWA 2OAEA 3G59A 1GSOA 4OFBA 4Q7LA 2IU4A 3UGKA 4CGYA 5LYJB 2ZB8A 2HU7A 1TQ6A 2DUMA 3DDCA 4BO8A 1TAHA 3E58A 3HJTA 1ANKA 1V6AA 2GJKA 3CLVA 1J5XA 1W4ZA 1EVIA 3DPIA 3X43A 3B6MA 1P2FA 2J7KA 3BOSA 3R0VA 2QGFA 2W2VA 1TJNA 2QU8A 1G20E 4LJ6A 1E2UA 2C8VA 4ME6A 3GJZA 4IQ4A 1WOYA 1YE5A 3EUFA 2P11A 4WK4B 3PXEA 3JD4A 2QTBA 1JIIA 2VJDA 1RW4A 3Q5DA 2PS3A 1CULC 4JYAB 3EQ6A 5BNFA 2P9FA 2YOGA 5BSMA 1ZD5A 3TXAA 5FV7A 5A03A 3G9TA 2BZ0A 2QJRA 5BP7A 4B3RB 5BNTA 2I4OA 1OYVA 4OHXA 3HDHA 2VHQA 3CLHA 1YQQA 3IUNA 2PGLA 3ZHTA 4WKBA 1BIFA 2BUBA 5AIAA 4B3MB 4RHXA 4MVJD 1P5JA 4TZTA 4H7KA 4RH3A 5T8KA 1GQRA 3R1IA 4JIMA 3DT6A 1M9NA 4MQUA 2QRKA 3AR3A 3GQBA 5EI5A 1BMFD 2GN6A 1SVOA 2QAIA 3W7BA 4I50A 1IH8A 4FMCB 1IPHA 1G5QA 1MIOB 2VF7A 4JB8A 2G5TA 1V5GA 4MTLA 1RAIA 3INNA 4RIGA 2WWIA 2XH8A 3G5UA 3U49A 3WO0A 5IWAB 3W8FA 3HYRA 1G8YA 1MRSA 2QA5A 2HMTA 3QPDA 1RMQA 1AGPA 4GBGA 2X1MA 1IVYA 2GASA 3B2QA 4RD4A 3ZHXA 4B8ZA 5I4IA 1U04A 2BYTA 1OXXK 2ODNA 1CVIA 4GX5A 2YZ7A 1ECCA 1RAFA 1QG2A 1T1EA 1WQ3A 3V2GA 1R3DA 2JGKA 2DFKB 5BR7A 2AOXA 5G41A 4G9GA 1M1NA 3R3WA 4II7A 5B4TA 2GXUA 4LG1A 4LBYA 3GR6A 2VO1A 3PFGA 1SXJA 1W46A 1ADBA 4CM7A 2VJCA 1WUIS 2CVFA 4G85A 3W6PA 2DPLA 2BLNA 2MIIA 2ONZA 2OO3A 3KHTA 4MSUA 2C29D 4RA6A 3TFWA 5LDHA 1SXQA 1CIJA 1WUKS 2LR0A 3RIHA 3PU6A 1ID1A 3CB4A 2A6PA 5E6UA 2GETA 3FETA 2FMFA 4PSCA 3L6RA 5FOWA 4KK3A 3B3JA 4BVHA 1YO6A 4QELA 3SBEA 3USES 3ZZUA 1H1DA 4OQPA 2DP4E 2OD9A 3N3BC 4TTQA 1WLSA 2V6MA 1PGOA 4JU9A 4M7RA 1ZCFA 3DF9A 3E22A 4REQA 3ZTWA 4F9TA 2VQDA 1R16A 4BXOA 3AZPA 3HKEA 1SIWA 5HZKA 1KI8A 5GOTA 3A3PA 1QBGA 1S7GA 5ALNA 1E8DA 1TCBA 1KVRA 1I80A 2QNIA 4QBGB 3HHPA 3ROTA 4CFSA 4O2LA 3WA6A 4OCZA 3AB8A 1OFIA 5KYUB 3GJYA 1YZLA 2FJUA 4GZ3A 2ONJA 4LFBB 4YRPA 2KJQA 2YDYA 1Z45A 1JF8A 2NADA 1YWGO 2XA1A 1DAFA 5LNK1 4NYMQ 3A1CA 3RBAA 4IFBA 1RQPA 4M0EA 4CKCB 2W6ID 3HPQA 1Y9EA 1FRNA 4R5MA 4RHFA 1QDUA 1DXYA 4IIBA 3RYHB 4BO7A 2GEBA 3NO4A 1Z2AA 4QYIB 4PCUA 3LW8A 3UBTA 1RWXA 1T26A 2ERXA 5DBHX 2PV0A 3ZKWB 5BQFA 1XAJA 4B3SB 4GKKB 1JQBA 2I3DA 3VUFA 1DKQA 4RJIA 2CDRA 4X7BA 4DNPA 5KSOA 3MGCA 2UYQA 2XDQA 3S2UA 5CDGA 4TRRA 4UQLA 3THXB 3OZXA 4Y3UA 3A05A 1AQIA 3I92A 4BQSA 1TM4E 2AKAB 4D56A 1QGDA 5HOEA 4R3NA 4C2AA 5F7OA 3O8BA 3ESZA 5CB4F 1EVYA 1V5EA 4TT3D 1KK1A 1UOOA 4P4GA 2HU5A 3LLUA 4QLOA 3NRBA 3SJCA 3INTA 4HCJA 1YASA 1DMSA 2RCYA 1DC7A 5A5DA 3VR6A 4F04A 3A2KA 4P86A 3L8DA 5FWAA 3NUGA 4U5XA 1K0FA 2J08A 4LF6B 4IP0A 3OM9A 1IN6A 2J5RA 1G0OA 2H52A 4WY8A 4EJSA 4JOBA 1PJCA 3ZOKA 5KWSA 2BFBA 3LGXA 1YRBA 4U9UA 5TARA 4KC0A 1K86A 5F3DA 4DCMA 3A8TA 1UDBA 4M1ZA 4I19A 4MGEA 3NYQA 1U9IC 2A0XA 1FUUA 5KPDA 2IYVA 5EIWA 4EHHA 2R7LA 4TS4A 1JHMA 3OFKA 3RC7A 3WMWA 2BHRA 2G70A 4QBKA 5U9CA 3ICEA 4GT1A 4ZYZA 5DTMA 3FCSB 4DA8A 4TYQA 3K9HA 3Q3HA 4A92A 4KZKA 1HFKA 1O94A 1XU4A 1ZC4A 1UDWA 1VIYA 1B14A 1L1RA 1U94A 2NQ2C 2Q4DA 3EZ2A 3EZXA 2HPHA 3THRA 4HB2A 3W9YA 3ZBQA 5ADUS 1QHHA 3C0KA 4FPXA 1FFAA 3OIFA 1BFDA 1QHGA 4X63A 3VAAA 3CCBA 2BM0A 1V7CA 2JAXA 4H35A 3FLMA 2OHJA 1JDBC 1WB5A 2ZDHA 4HUTA 4EYSA 2QV0A 1MIHA 3FTCA 2GUGA 3M9XA 3BL8A 1E4VA 1EBUA 4GUAA 2UYHA 1YRHA 4LC0A 1GCUA 4F2PA 3EB9A 4RVOA 1JLRA 3PFKA 1O9GA 2VDPB 4K7JA 4XI9A 1SUCA 3NNDA 1U98A 3VOTA 3UPTA 1JXMA 3OP1A 3W5CA 4NE9A 4UREA 2WTEA 3Q98A 1W1UA 3QEMA 1B00A 1X7YB 3DO8A 1E5LA 2C97A 3HWSA 5FI1B 2GJ4A 1UINA 5I8ZA 2BPOA 4LDAA 3O21A 4LQDA 4WVFA 1Z33A 5JV5A 1IJBA 3TAHA 1T4CB 4UAGA 3D4NA 2ZYUX 4EGAA 5D3QA 3TKYA 4KR2A 1KPGA 1Q19A 2R6FA 1UDXA 2AMVA 2C84A 2QM8A 3G13A 2G4LA 3GRVA 4K3VA 4MQBA 4OYLA 4ITVA 4ZI7F 2ZSIA 3R40A 2F8SA 1GNLA 1K8RA 2XTMA 1P77A 4IQ8A 3GMTA 5DSZA 5EZQA 4E94A 2BHLA 4Q4HB 4MRRA 3FXAA 1OOEA 4HXYA 1D4OA 3CZ4A 1C7ZA 3TNFA 2F43A 2NXCA 3LWBA 4KH1A 3RV4A 2DERA 2ZUEA 4FE7A 1VG0B 3O93A 4ERNA 5JRDS 3M8KA 3WKAA 1UT6A 1GRQA 3CV3A 1K0UA 2YWRA 2V3CC 1Y6RA 1NMQA 2HSZA 1AO0A 1NT4A 4L50A 4XW2A 3EGDA 3LJKA 4RPKA 2JJ1A 2NSYA 2R7MA 1DAHA 2ACVA 1I01A 2Z3VA 3QGMA 1C9DB 1CJUC 3O5AA 4MCHA 3HSSA 4GI3A 1SBTA 1QGED 1TKBA 2FUG1 1A1SA 3DTTA 4I9HA 4R8RA 1WP4A 3SZ3A 2NTYC 3M5PA 4ZMBA 1GL3A 5DI3A 1D03A 1JA1A 1Z3IX 2IUTA 3I2IA 4WNIA 4QT4A 4B3TB 1NVMB 4LTNA 2FN4A 3R6TA 3WLFA 1YOVA 3ICCA 4IIJB 3KZNA 2ZLBA 2W2LD 4EL5A 5LXTB 4PVDA 4HDNB 1FLVA 1LPSA 1VQ1A 3EZ7A 4FNMA 4FT2A 4OHFA 4S1VA 3IA2A 5DIFA 3T9EA 1N7IA 4AK9A 4JSTA 3EDRA 3KB6A 3Q7QA 4CM9A 2V4MA 5HFJA 4Z4FA 4V03A 5IUKC 3KOUA 2QUAA 5SZHB 3NHPA 4BQEA 3VGPA 4KLNA 4YP9A 4C0SA 4DLXA 2WAAA 3IMFA 5KAMA 1P80A 4MW7A 3RUFA 3DR3A 5CA0F 1ESCA 1HEUA 2GQ0A 2B8JA 4ZVMA 4FYWA 5EVCA 3B70A 3HCFA 1IPFA 4GMHA 2ZIZA 3L0PA 2CXQA 4HXGA 4FDVA 4E2FA 5KOJA 2WKPA 1ECPA 1FTYA 3PFHA 5FUMA 5IKPA 4HUJA 4LF8B 3C1OA 3SDBA 4O5OA 1HF3A 1YZKA 4YRNA 4GU5A 4XUGB 4BKQA 3HBLA 4BNGA 1BEZA 2VJNA 2AUTA 2JFGA 2CXSA 2BKLA 5FPHA 5TPWB 3UFXA 3D64A 5CLQA 3SJAA 1X1AA 2V6FA 2V7XA 1J8QA 2ZPTX 3VTZA 3K05A 3TX6A 2DULA 2KE5A 2EIHA 3A6ZA 5BWMA 3PPXA 5AW9A 2FWRA 3VNBA 1ZU5A 1HE3A 1E1LA 2ZTMA 4NCBA 3H1BA 5LCXA 3D0KA 1YQTA 4KPGA 2ZGVA 2O06A 1Y7LA 1VBKA 2J4FA 2N1BA 2YWHA 3NHRA 4GBED 1M10A 3OTHA 4KU4A 3EA5A 3DG9A 5C53B 1QTNA 3REOA 2ZBEA 3QPUA 3IDZA 3RT1A 4C4ZA 4IXWA 1A0OA 3VC3A 4TS1A 1DJLA 2XY4A 1ZR2A 1NP6A 2R1TB 2DH6A 2Q45A 1SUBA 3F4BA 1Z15A 3MJCA 4M54A 4B81A 4YV2A 3WQHA 1WHSA 5IKXA 3DMYA 5LMZA 1AUQA 1TOAA 4R8KA 3F6EX 4NBTA 3EEOA 5LMNB 1SQFA 3Q8XB 2C5HA 1H0HA 2FAXA 1Y1PA 1SCIA 1TKRA 2ZWPA 3B3GA 4N8DA 1RAGA 3GLGB 4TQUS 1YSCA 2BR3A 4BTEA 1E6MA 1E2PA 2H5JA 2R6AA 1QX3A 5DWVA 3O8NA 4DMUB 2P3LA 4I66A 3PWSA 5DISB 4JU8A 1YE8A 3V4SA 2R2AA 2AQ8A 1GNVA 3ETCA 5A05A 2E82A 2QLFA 3M1AA 1N33B 3MOSA 4LTMA 4YQEA 4IOLA 1NJ5A 3F6BX 3O0DA 4QUDA 3LYAA 1H1LA 2VBGA 4B34A 1DKRA 5EIFA 3RKRA 4P0QB 4NX2A 4X1IB 4J0QA