5GPAA

Structural analysis of fatty acid degradation regulator fadr from bacillus halodurans
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
193
structure length
189
Chain Sequence
KKKGPKYDQIIDAAVQVIAEHGYHQAQVSKIAKAAGVADGTIYLYFNNKEDVLISLFQEKMGRFVDKIRSQMNEATDVEEKLKILVNMHFKQLAADHKLAIVTQLELTELALKINEVLKGYLNLLDELLMEGKEKGYFFQELDTRLARQMIFGTLDEVVTNWVMKDCKYDLTALVKPVHQLLLGGLRHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator (TetR/AcrR family)
publication title Structural basis of operator sites recognition and effector binding in the TetR family transcription regulator FadR.
pubmed doi rcsb
source organism Bacillus halodurans (strain atcc baa-125 / dsm 18197 / ferm 7344 / jcm 9153 / c-
molecule tags Transcription, dna binding protein
total genus 73
structure length 189
sequence length 193
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08359 TetR_C_4 YsiA-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 5gpaA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 5gpaA02
3DEWA 2QF7A 3HGGA 4BKXA 3VW2A 1TWAJ 2XPUA 3H3VK 4FE7A 4YZEA 3S1MJ 2CUEA 1I3QJ 2LFBA 3BG9A 3BTJA 2EH3A 2CQQA 4XRSA 4GCKA 3TEDA 3FRQA 2XB5A 1RESA 2HQ5A 4MXMA 3VW0A 2L7ZA 3FK7A 1W0TA 4ICHA 3Q0UA 2DMUA 3FIWA 5FKOA 4ABZA 1WH7A 5IPAA 1AKHA 2NVTJ 1Y1WJ 3TW6A 5JLXA 1WH5A 2FD5A 2NVYJ 1VF9A 2ID6A 5C3EJ 4W1UA 1IRZA 1X58A 1JKRC 2QTQA 2WB1N 2W48A 5F0CA 2TRTA 2NP5A 3HM5A 2ZB9A 3NI7A 1MBGA 5IYBJ 1IUFA 4CYCA 3CWRA 4A3CJ 2EZKA 3S17J 2YS9A 4JP0A 1NK2P 3GTQJ 5J3LA 1JJ6C 2R92J 3HOVJ 2I10A 4JYKA 5IOZA 2XGEA 2DTZA 2QKOA 3HOXJ 2M0CA 2B63J 3GTGJ 2XGDA 2E19A 1JKOC 1I6HJ 4GFBA 1U9OA 3O60A 3GTOJ 2DA1A 4CGRA 2NS8A 1BW5A 2UXIA 3BQYA 4AYBN 5EF6A 3ZQHA 1YRNB 3QKXA 2KT0A 2H1KA 3LOCA 3CJDA 1JUPA 1PUFA 2WV1A 1FIAA 4DYQA 5M5XJ 3PO3J 3GBGA 2E2JJ 1RPWA 2Y2ZA 4MFEA 3HGYA 2R5YA 3HOWJ 4HKUA 4D7NA 2G0EA 3JRDA 1VNDA 1ZR4A 4V2GA 3E7QA 4GFKA 1B8IB 2ZCNA 4M3GA 2ZCMA 1P7IA 1D5YA 1ORKA 3C2BA 2LY9A 3ZQGA 3WHCA 2R0QC 3HDDA 4M3FA 4MFDA 1WI3A 2NVQJ 5HAWA 3BTLA 2NOGA 3AQSA 2ME0A 3JRBA 1ZGWA 3BJBA 4BBRJ 3LHQA 5J1YA 1RETA 1P7JA 3BT9A 2WAQN 3KKDA 1K61A 3CRJA 4S0HB 1ETQA 3LSJA 2GFNA 4GCLA 1Z0XA 1IGNA 2YVHA 3CMYA 3EGQA 1XS9A 2VUMJ 1UMQA 2K40A 5E3MA 5EG0B 5CW8A 1FTZA 4M3DA 1XG1A 2FBQA 3ANGA 2DG7A 3K7AJ 4A3DJ 2N8GA 2D5VA 3GTLJ 3A01A 4JKZA 5HODA 3BR2A 2LP0A 2AHQA 2HI3A 3VP5A 4HNVA 2FJ1A 1LFBA 2KDZA 3MKLA 1U8BA 3HTJA 4JNNA 1H89C 2Q24A 1MSFC 3PO2J 2MW8A 5GPAA 1ZR2A 2QIBA 1JJ8C 5F27A 2FX0A 2ZOYA 5F08A 5IP6A 4NDLA 2L7MP 2YU9J 3VVZA 1UI5A 3OIOA 1JUMA 3VVXA 3S1RJ 2Y9ZA 3HIMA 1SGMA 2HOSA 4L62A 2RASA 3QPSA 2GM4A 3SJMA 3UKGA 4L5EA 2NS7A 4ACIA 3B6AA 1QVTA 2JWTA 4QTRA 3M3YJ 3VVYA 2YUSA 4G12A 3QQAA 4C3JJ 1ITYA 1MBFA 3M4OJ 2G7LA 1MNMC 3C07A 5EZHA 3B81A 4FISA 4BY1J 2HYTA 2P81A 3F1BA 1DU0A 3NPIA 2OPTA 1FTTA 3L1PA 3IH4A 4FTHA 3BNIA 4I6ZA 2GENA 2D6YA 2AO9A 3Q3SA 3G1LA 2E1OA 1VFCA 4UUSB 3JRGA 4M6VA 3BR0A 5FKKA 3NRGA 2VI6A 1BA5A 2Y9YA 2R5ZB 3CQZJ 5FJ8J 2JA8J 3Q0WA 3JREA 3HBLA 3NXCA 4MLOA 5C44J 1TWGJ 3RQIA 3V78A 1AU7A 3FISA 1MH3A 5IP9J 2DMPA 2X9DA 1ZTRA 1FJLA 2R93J 2CRGA 4BBSJ 4B3AA 3T6NA 3E7LA 4B1RA 4JL3A 2ZCXA 1LFUP 4D5CA 3RKQA 2DN0A 1IV6A 2O7TA 5AQCA 4C3IJ 4UUTA 2HXIA 4IHWA 2HOAA 1IDYA 3JRFA 1QVUA 4BXXJ 5HBUA 2DJNA 3LNQA 3S5RA 1U78A 5F0FA 3RZDJ 3ON4A 1OJLA 1JKPC 4IHVA 2L9RA 1BJZA 3TP3A 2UXPA 1HDPA 2XPWA 2L7FP 5IYCJ 2JA6J 5CXGA 4EEFG 1MBEA 1O4XA 4A3IJ 3DPJA 2HKUA 5D19A 3BG3A 5E3OA 2VKEA 1MBJA 5K7HA 2LR8A 1JT6A 3O8HA 5EG0A 3PPBA 4FCYA 4W97A 4M3EA 1A5JA 3COLA 4A3EJ 4XIDA 1ETWA 1T56A 1H8AC 4GCTA 3G1OA 3MNLA 3HTHA 5FKNA 1BW6A 1WGXA 3G1MA 4A69C 1B72B 1HOMA 3IV5A 4A3BJ 1OCTC 2M8GX 2EZLA 3RZOJ 2XSDC 1U9NA 2CJJA 3TP0A 2XPVA 2PZ9A 1DU6A 3LSGA 4XK4A 1EF4A 3B6CA 2LD5A 2RAEA 2LKXA 3BR5A 3ANPA 1ENHA 3I4NJ 3JRIA 1OFCX 2XDNA 1RKWA 3QBMA 2OI8A 3D1NI 5FLVA 2R7ZJ 4AC0A 2LTPA 1F43A 2W53A 3OOUA 2M2EA 2X48A 1APLC 2DG8A 3NNRA 5J1RA 1UI6A 2K9QA 3ZQCA 1LE8A 4XRMA 1ETKA 1IJWC 3S1QJ 2O7OA 2RHAA 4QIWN 3KKCA 2CQXA 1G2HA 2PBXA 5D1RA 4J19A 2GLOA 1ETYA 2LK2A 1F36A 2K9NA 1GV2A 1POGA 2DMTA 1RR7A 2MG4A 5GP9A 4C2MJ 1ZKGA 3O8GA 3G7RA 2JA5J 5FHPA 4D5FA 1ZK8A 5EGOB 2DA7A 4QSHA 3LSPA 2CUFA 2ELKA 2HYJA 3S2DJ 5DAJA 4UUSA 3HTIA 3MN2A 3A03A 2Y0SN 5C4JJ 4D7MA 2DA5A 3LJLA 3HEFA 2JN6A 2MSYA 2EBIA 2R5ZA 5FKLA 1QRYA 5E3LA 1MH4A 1WCMJ 3BG5A 3S14J 2Y30A 5EFYA 3PASA 5IYDJ 1GVDA 5FMPA 3BQZA 1SANA 5GPCA 5DS9A 3LWJA 3ZQFA 2CU7A 1IG7A 3JRAA 3BR3A 2UXUA 4RDUA 2WUIA 2HXOA 1JTXA 2UXHA 3VIBA 4JX4A 1NK3P 3S16J 3BR6A 1FIPA 1YRNA 2E2IJ 2NP3A 3VW1A 2VKVA 2DA6A 2MGQA 1JUSA 1E3OC 2LVSA 1GUUA 4FE4A 2QCOA 2V57A 3P9TA 5F04A 4AC6A 1ETXA 4IHXA 1K83J 3RH2A 1SFOJ 3VPRA 4DW6A 3SFIA 2M34A 3V6GA 3GEUA 3A02A 4JX6A 1GV5A 3SDGA 5BNGA 2K9SA 5M5WJ 1X2MA 1B8IA 2E2HJ 5IOYA 2UXOA 4ME9A 2HDDA 1RKTA 3RD3A 5F0HA 1GDTA 2G7GA 2M9HA 2IAIA 4M3BA 3JRHA 4B4CA 1T33A 1I50J 4UDSA 2TCTA 1B72A 1Z77A 2WGBA 4RBOA 1CQTA 1BL0A 3CCYA 3CDLA 5F1JA 1VI0A 3HKZN 2DMNA 2VPRA 2EQRA 3F0CA 1HF0A 1XC5A 3K2AA 3QPLA 3W6VA 4A3MJ 4MIMA 4XICA 4A3FJ 3GTPJ 2ECCA 5C4XJ 2XRLA 2FQ4A 2JMWA 1HCRA 5D18A 2Y31A 3KZ9A 3HOYJ 1AKHB 2NX4A 2XB0X 2QWTA 3NARA 5M5YJ 5HSZA 2JJ7A 2LLKA 4IHYA 5IP7J 1WPKA 3GTMJ 3HOUJ 3PM1A 4MO7A 4C3HJ 3GTJJ 4A3LJ 2JA7J 5K7FA 4IEJA 5EDNA 1Y1VJ 4CYCB 5K7ZA 2G3BA 2GBYA 1TWHJ 3VOXA 3HTAA 3BHQA 1ETVA 2XGCA 1HDDC 3NAUA 4DZJA 4Y52J 3IH3A 1TWCJ 4V2FA 4DZPA 4X6AJ 5FLMJ 1OCPA 4PXIA 5M3FJ 2ECBA 3VOKA 1Q1VA 5CXIA 5K58A 5EGOA 2IEKA 4GFLA 3HB9A 2JK3A 2NVXJ 2G7SA 3ZQIA 3GTKJ 4AUXA 3G56A 4A3KJ 3AQTA 2QOPA 1PUFB 1GT0C 3EUPA 3BCGA 4XRSG 1MBHA 1UG2A 3S2HJ 1TWFJ 3FK6A 4A93J 5EZGA 3OSFA 1A6IA 9ANTA 3H0GJ 3KNWA 4A3GJ 2DA2A 4NELA 1TC3C 2R5YB 2IU5A 3BRUA 4MK6A 3GZIA 1JKQC 4JX5A 5M3MJ 1UHSA 4LOCA 3JR9A 3ON2A 3FKIJ 1JTYA 4NN1A 3IUVA 1FEXA 3VUQA 3BR1A 4A3JJ 3Q0VA 2X6OA 2PMZN 1W0UA 5EYRA 2OF7A 1R9TJ 2O9LA 4Y7NJ 1NTCA 1IDZA 2COBA 1IC8A 3TW7A 4AF5A 3ZQLA 1ETOA 2YVEA 2O8KA 3BTIA 3I4MJ 3S1NJ 3HE0A 2REKA 1HLVA 5JLWA 1JGGA 5H9TA 2F07A 3LSRA 1S7EA 2ZOZA 1AHDP 2L0KA 3HOZJ 2IBDA 4DYCA 1ZQ3P 3S15J 1MSEC 1MBKA 4BY7J 3MVPA 5EEAA 4KWAA 5E3NA 3ZOBA 2DMQA 2EZIA 1X2NA 4X1EA 2EZHA 2OERA 2HOTA 3OSGA 1LE8B 4I76A 4DYRA 3DCFA 1JT0A 3A01B 5FGLA 5FKMA 5C4YA 1QPIA 2DA3A 2ME6A 3IH2A 5DTDA 2H8RA 3BTCA 3JRCA 1H88C 2ID3A 5J1UA 3JSJA 3WHBA 2GUHA 2DA4A
chains in the Genus database with same CATH superfamily
5FD6A 3CLOA 1BOAA 4FE7A 4YZEA 1P2FA 1OYIA 2LFBA 2HQAA 1I39A 2ISZA 3IC7A 1HQCA 2STWA 2EH3A 2WAEA 1SFKA 2CQQA 3D5LA 3OS2A 2F6CA 2X1CA 3MZYA 4RGXA 4BQOA 4WIBA 1SVMA 5H6QA 4PJ0C 2FNPA 1BR1A 4NC6A 3FK7A 1W0TA 3N4MA 4PFPA 4CYDA 3ROUA 1Y39A 3T0YA 4ZYEA 2DFFA 1AKHA 1WH7A 5IPAA 4BEHA 2HVRA 5DDGA 1VF9A 5DM6F 2ID6A 4KT6A 3J81Z 2UXNA 2QTQA 1XTAA 5F0CA 2TRTA 4E7HA 3HM5A 1G3SA 2ZB9A 1U5TA 1MBGA 2EZKA 4H0EA 2YS9A 3VYUB 4LK1F 1MMNA 2PFVA 1Y8RB 2WBMA 4J00A 4Q4ZF 3CUQC 1IN5A 4AU7A 2BOLA 2XGDA 2L9NA 2V9VA 4UUVA 1USSA 2E1CA 5DCMB 3O60A 1WJAA 4CGRA 2NS8A 1BW5A 4AYBN 3WGGA 3ZQHA 2FBIA 1K6YA 2KT0A 3PSIA 1MDMA 4MEXF 4X0GA 2VQLA 1PUFA 2HOEA 2VC0A 5K5QA 2DT5A 2LH9A 4BDYA 1KGSA 2ICWG 1TLHB 4A5NA 4BYYA 1PP8F 1XGMA 3C2HA 1WJEA 3WTYC 2G0EA 3R6SA 1K6OA 1QHGA 1ZR4A 1K78A 1BC7C 4M3GA 2DI3A 5GAEJ 3ZQGA 2R0QC 3F8CA 4UNOA 4XN0A 2CUZA 4MFDA 1WI3A 4HQEA 4XSZF 2QQAA 2NOGA 1DUXC 5HS8A 2ZBKA 1ZGWA 1RETA 1P7JA 1FT9A 5E1WA 2WAQN 2JZYA 5F64A 1Z91A 1T95A 4AYBA 1BC8C 3QPHA 4KISA 3CRJA 3E3VA 1FWZA 3DP7A 1ETQA 4S0HB 3RYRA 4GCLA 2F2EA 3RDIA 2D45A 1LUJB 1D8KA 3JW4A 3OOPA 3ZMSA 1QU3A 5E1XA 5EG0B 5E3MA 3W3CA 5ERIA 1X4PA 4M3DA 4WK8F 2CV0A 3FMQA 2RVCA 3ZP5A 3K7AJ 2N8GA 2K3FA 2VC1A 2PN6A 2LYCA 3BR2A 3HPHA 4E4HA 2LP0A 4RB0A 5DD8A 1D0XA 1UJ8A 2FJ1A 1LFBA 3ASOH 2R4GA 5FROA 2HZDA 3I54A 1MSFC 1H9TA 1ZGAA 3G6EI 3SZTA 4HW0A 1FOYA 4BDZA 3CCEI 3VVZA 3WU2C 2HPIA 1UI5A 3TGNA 3SWHA 1OR7C 3SDBA 1JUMA 1W5TA 2UWMA 2WAQA 1SGMA 2RASA 3IKVA 4XLFA 5LEJA 3UKGA 1LVAA 3LSTA 2AXTC 2JWTA 4LLGF 3L2UA 4O6JA 3M3YJ 2X1EA 1QPMA 3EUHA 2A05A 4G12A 3QQAA 4C3JJ 1X4OA 2R7DA 2PEXA 4HNTA 2VBWA 2G7LA 3B81A 4FISA 4ANJA 5LD2C 1V4RA 4DIQA 1DU0A 2XVCA 3NPIA 2P6SA 5CVRA 2IP2A 2GENA 2VE9A 2ZJQF 3HXLA 2D6YA 4UHTA 3Q3SA 3M07A 2GA2A 2E1OA 4M73A 1O3TA 2UUZA 2P4WA 3WODF 1EH8A 1BIAA 3BR0A 1BIBA 2P5VA 1FYKA 2Z5UA 4GYGA 2R5ZB 3AFHA 2EA2A 4ZH4F 3CQZJ 4KIFA 3RJPA 5FJ8J 3Q0WA 4OMZA 2MH2A 3VODA 1PP7U 3JREA 4FX4A 4EQQA 3HBLA 3QOEA 4EJOA 4MLOA 5C44J 4Y17A 1BN5A 5J40A 5HDNA 1AU7A 3FISA 2EFQA 3QYFA 5GTHC 2OU2A 1LJ9A 2X9DA 3I3LA 1XSDA 2CRGA 4B3AA 3BWGA 3T6NA 4ZYGA 2OAZA 3RKQA 4G9YA 1XN7A 1I1SA 3HTSB 2VOOA 2DU9A 2DFHA 3ABMH 3DBLB 3I56I 2HXIA 3LA2A 3L2RA 2HOAA 2OV7A 4L9VA 3ECOA 2DDAA 1K4SA 3GX4X 2ZMEC 1KQ0A 1U78A 3GO5A 4XOPA 5F0FA 3RZDJ 2CV2A 1ZYRF 2L9RA 3N97A 3ZCOA 4A5MA 5IYCJ 2KQRA 1SVOA 3KPHA 2QLZA 1H9GA 3RKYA 3DPJA 5D19A 3BG3A 3TDZC 5L3CA 4ZZDA 1E3PA 3OYAA 5IT3A 5E3OA 4PZJA 4OD4A 1MBJA 2F5CA 1A04A 3O8HA 4W97A 3COLA 3S93A 2Q2EA 3CESA 1H8AC 5JHFA 3MNLA 3HTHA 1WGXA 4RGRA 1B72B 1A31A 3E1SA 4AWXB 4DOZA 2FMLA 5BQTA 3ZMUA 1IRFA 1U9NA 4ZYHA 4L18B 4HA8A 4IHSA 3LSGA 4M9SA 3H5AA 2FQ3A 4UVCA 2RAEA 3BCBA 5ICFA 5E1ZB 1ENHA 2XDNA 2Y0MA 4XM3A 4CHUA 3QBMA 1X1CA 2V9PA 1T2KA 2OI8A 2KZGA 1F43A 4AC0A 3WTTC 3K1NA 2DG8A 3LAPA 1XMXA 2CFOA 3ZQQA 3H35A 4IRHA 2WA0A 3F8BA 3KZIC 2HKOA 3AG4H 2D2WA 1VQ5I 1HKQA 5J4VA 4J19A 1YHQI 1F36A 4BE0A 2HNHA 1X3UA 2QQ8A 3G7RA 3BCAA 5FHPA 4D5FA 2OZ6A 3F3XA 4BHPA 1AWCA 4QLCU 4RLFA 2DA7A 4QSHA 1W1WE 1R5ID 1SEUA 2CH0A 2HYJA 5DAJA 1IXSB 2RREA 2DOAA 1MJ9A 4D7MA 3I55I 1I1GA 2JN6A 3HEFA 1NG6A 2KKOA 4WWCA 5JVTA 4CZCA 2LNBA 4LITA 1JHFA 5H20A 3S14J 1OR7A 4ZYDA 4M74A 1GVDA 1OYYA 4U0YA 1ZAOA 5DCFA 2KHMA 2JUCA 1EA3A 1J75A 5GPCA 4WCGA 3ZQFA 1FLIA 2HVQA 2ISYA 2QA4I 3JRAA 3MMYB 2W24A 4I0BA 2ZNZA 1IF1A 1Z1DA 1G59A 3ZR8X 1O7FA 2DW4A 4M6XA 3BJOA 4RDUA 1VQNI 4YELA 2A6HF 3KYLA 3S16J 1FIPA 2LY2A 4XKBA 5EEGA 2ZXHA 1OMIA 2HQRA 2RQPA 4A2UA 2DPDA 1JUSA 4LMYA 1GUUA 3HJEA 4FE4A 4Y13A 3OYEA 3ZN1A 2MC3A 2V57A 3P9TA 5F04A 1YO5C 5GTIC 4B8XA 2O3FA 4YFXF 2M34A 1V55H 2F48A 3V6GA 3K2ZA 2XAJA 3A02A 1GV5A 5M5WJ 2R7VA 2HEOA 2LF8A 5IOYA 1ZRFA 2HFHA 2PX9A 3RD3A 3FXJA 4NUBA 2M9HA 3AKZA 4B4CA 1T33A 3CJNA 1MJBA 2Z2SB 2Y75A 3LWFA 3G3ZA 4RBOA 2AQFA 1KU7A 3AL0C 3IL2A 1LFPA 3HKZN 2DMNA 2EQRA 2XAUA 3F0CA 1XC5A 3QPLA 5LHHA 2PLYA 3W6VA 4MIMA 4A6DA 3NEUA 2RN7A 2CYYA 3M8JA 1SC7A 1F4KA 1BR2A 3K4BA 2R7RA 5D18A 3REOA 3MZHA 2QWTA 1IUYA 3HC7A 3WG9A 2EIMH 5H6RA 2ZMEA 5M5YJ 2BYVE 4G7ZF 1WRJA 2QYOA 1I3AA 2LY1A 3KCCA 3GTJJ 3W6JB 2JA7J 5K7FA 1WI9A 1VQ9I 1Y1VJ 4CYCB 3E5UA 3F21A 3VOXA 2H94A 3GWZA 3DLLF 4YFNF 2XGCA 3HRMA 3NAUA 4DZJA 4Y52J 3WTUC 2Q8KA 1SD4A 2B9SA 2OUMA 1YS6A 5M3FJ 1F1ZA 2ECBA 2QSFX 5F6FA 1MIJA 2OZUA 4E7ZA 3WTSC 2L9SA 5K58A 3HHHA 4QWQA 4GFLA 2Q0OA 2JK3A 3HB9A 2BW3B 1N25A 3ZQIA 1W36C 3H9JA 2DT6A 3DWLE 5D4RA 1XPXA 1KA8A 1EKEA 3AQTA 1Z9CA 3EUPA 3BCGA 1MBHA 3CF2A 4IHTA 3FK6A 4XRFA 4A93J 3KNWA 1A6IA 4NELA 1TC3C 2R5YB 2IU5A 2FXAA 3CCJI 2IS2A 1Z6TA 2BVMA 3BRUA 3GZIA 3GFLA 3VYSB 2DCEA 1UHSA 4LOCA 2JQ7A 1E0EA 2CO5A 1JE8A 1BI0A 4NN1A 3PL8A 2J5OA 4N9IA 4HF2A 4II3A 5H2FC 2OTLI 2BY0A 4UV9A 1W0UA 3BZ6A 2E1MB 3RQ4A 2EINH 2O6GE 1IXRC 3O2PE 1D3YA 1IV8A 2W57A 2V6EA 3LSIA 3OYBA 1KQ8A 1QBJA 2XV4S 3F6VA 3HE0A 3I4MJ 2REKA 1OCRH 2LKSA 3U9GA 1TBXA 2GOMA 5H9TA 3IRQA 4KMFA 2VJ5A 4PJNA 2V9KA 2L0KA 1U6GA 4BE2A 3S15J 1B9MA 1USTA 2DQLA 2QKMB 2JA2A 2E7WA 1MBKA 4BY7J 1ZG1A 2H1LA 4UV8A 1A35A 2F4OB 3ZOBA 2DMQA 2X0LA 1OCZH 1TW2A 4X1EA 2EZHA 2A69F 3OSGA 4EJTA 4RMNA 2FBKA 3WE2A 2P7CB 3ONQA 4XR6A 3A01B 5FKMA 3DBRB 2DA3A 3ZGKA 2M8EA 2VBXA 5J1UA 1RUOA 3BG6A 2QF7A 4M71A 3WE3A 1TWAJ 2LKPA 3VW2A 2XC7A 1S5LC 4ZDPA 3RPUD 2CUEA 3AG1H 2LBFA 3BG9A 4H4KC 2XASA 1S8NA 3KEOA 4B09A 1P4WA 2ZJPF 4ESJA 3J7AO 2XB5A 1RESA 1MNEA 3HG9A 1TP4A 3K69A 1UG0A 1LQ1A 3VW0A 3LAJA 1YI2I 4C2TA 4ICHA 3JCUC 4F91B 4BL0B 4PFOA 2R7FA 1DPRA 3FMRA 2NVYJ 5C3EJ 4IL6C 1IRZA 1ODDA 2WB1N 2W48A 3LL7A 2DO7A 3MKWB 1IN4A 3NI7A 4OWRB 3IP4B 2FF4A 3CWRA 2M3AA 3BLYA 4A3CJ 4YG2F 4JP0A 4HDUA 1JJ6C 3HOVJ 2I10A 2V1XA 5D8KB 4WXHA 2OQRA 4Y33A 2B63J 2R3SA 4UVAA 2E19A 2X85A 1JKOC 2E71A 3GTOJ 2XKOA 2UXIA 3BQYA 3GZNB 2CW8A 4YIIA 3CDHA 2H1KA 1LB2A 2EPFA 2WV1A 4DYQA 1ZG5A 3MKYB 2XKPA 3PO3J 2IGNA 1RPWA 2CS3A 2L02A 2Y2ZA 2H6CA 2K9MA 3DKXA 2YR2A 3EQLF 3HOWJ 1TW3A 2PMUA 4ZC3A 4V2GA 3E7QA 2ZCNA 2ZCMA 2UXXA 4EJWA 3QAHA 2M30A 2W85A 1XB4A 3PUFA 2VONA 3HDDA 1Z67A 4M3FA 2M4GA 2WY8Q 3EDPA 2RGVA 2ZO4A 3BTLA 1O3RA 1B6AA 2NS0A 4ZJZA 1T8IA 3KP2A 4U9LA 2ME0A 3JRBA 5CKTA 3H36A 3LHQA 3E0JB 1RI7A 3K0LA 2KFDA 2R7QA 3FF5A 1SFEA 2DFIA 2EIKH 2WV0A 3KE2A 5LBQA 1K61A 1PUEE 4GGGA 1KONA 2DOFA 2KISA 4HBLA 1VQMI 2PJRB 3TL4X 1RNLA 1HXDA 2YVHA 3CMYA 2VUMJ 1DP3A 1UMQA 3CTAA 3OS1A 3BJAA 1FTZA 3PNYA 1XG1A 1SMYF 1G3WA 2DG7A 1WJCA 1XGNA 1YJWI 3CLQA 3ZRGA 5HVQC 2V26A 2K85A 1UCRA 2NNNA 2W1OA 2BY3A 4UB8C 2KDZA 3MKLA 4JNNA 1H89C 2MW8A 1WHUA 2X1DA 5F27A 3P9CA 3Q9SA 4FASD 3SZGA 3H5NA 3S32A 3HOTA 2QSGX 3A1YA 4NDLA 2L7MP 2BBYA 3FM5A 3OIOA 3UR3C 3VVXA 3QU6A 3S1RJ 1X1DA 1BI2A 2MLKA 1UAAA 3SJMA 4L5EA 3ZMDA 4EV0A 3CO7C 1QVTA 4QTRA 1MZBA 2YUSA 5BMZA 2X4HA 4EM1A 2QBYB 3M4OJ 2L54A 2DQRA 1B1BA 4AIDA 3WGIA 5EZHA 1N77A 3VB2A 2V4JC 3WG7H 2NAZA 3MFKA 2HVSA 2P81A 3F1BA 5FFZA 1XX5A 2RV8A 2VBZA 1ZRCA 3OR2C 3RCOA 3COAC 1WVRA 1GHCA 3G1LA 4HQMA 1RIOH 3CCVI 2DK5A 4YIRX 3C1DA 4M6VA 1M1EB 4Y15A 1JI8A 5FRNA 2E5NA 3NRGA 1BA5A 3S2WA 2JRMA 1HBXG 2CV1A 3CJQB 1QA6A 2EILH 4LGWA 3MEXA 2CQKA 3EETA 3NXCA 5JR3A 3RKXA 1A36A 3RQIA 3V78A 3FXKA 2B3WA 2BHZA 1MH3A 1FMVA 3WTZA 4PJLA 2GIVA 1XCVA 4PJMA 5BPIA 2IA2A 4BBSJ 1I6XA 2ESNA 4BH9A 4CCLA 3E7LA 4B1RA 4JL3A 2XDVA 3QU3A 4D5CA 2PQ8A 1IV6A 1YW9A 2O7TA 2Y69H 1D1AA 4C3IJ 3HUGB 3E5XA 4IHWA 1ERDA 3VFZA 3PJRA 2W84A 3TBIA 3A2KA 1IDYA 4EM0B 3WU1B 3FZVA 4RB2C 1QVUA 3LNQA 2C6YA 3S5RA 3S8PA 1JKPC 4IHVA 4OMYA 1BJZA 4LB6B 1HDPA 4F3QA 2L7FP 3GEZA 2QZ8A 1HKTA 1O4XA 4L0YB 3B73A 3KP6A 4OU0A 5HLTA 2L3DA 3KFWX 3TMOA 1BR4A 3SYTA 4XLHA 3CCRI 1BBYA 5K7HA 2LR8A 1JT6A 3PPBA 2PJPA 4GRIA 4A3EJ 1ETWA 1T56A 1Z7LA 1HKSA 1EH7A 1TT5B 4B3XA 1FZPB 2CQ7A 5AIQA 4ENJA 1HOMA 4A3BJ 1OCTC 3B02A 2XSDC 2DXIA 5CVVA 1O3SA 2M0MA 3T5XA 1U0JA 1DU6A 4E7LA 3AG3H 3B6CA 5CQGA 2LD5A 1YIJI 2CSOA 4UVBA 2L7KA 2LKXA 2R7TA 3I4NJ 3ANPA 1R7JA 1RKWA 2VT3A 2M1BA 2EFOA 5HNHA 4IZZA 2R7ZJ 3I4PA 3TO9A 2W53A 5BPDA 3NNRA 5J1RA 1UI6A 2VL8A 2JSCA 4CGZA 1FBSA 4MTDA 2A2FX 5JVGF 1RR8C 2R7WA 3OYDA 2MH9A 1IJWC 5CJ9A 2ZFWA 5ICEA 4BE1A 4QIWN 3KKCA 1DGRM 1G2HA 2IS1A 5D1RA 2GLOA 2KLOA 5E20A 2DMTA 4C2MJ 3K70D 2RNJA 3OL3A 3CC7I 1ZKGA 3O8GA 4KUMA 4N4OB 4G7HF 3MKZA 4P96A 1UELB 1ZK8A 4I02A 5EGOB 5KCMA 3QOPA 1ZG3A 5LFAA 2CUFA 5DV5A 3GLLA 3L9FA 4LG0B 3GZ6A 2IVMA 4UUSA 3HTIA 3MN2A 3PSFA 5FGMA 3O6BB 1VQ6I 1VQLI 4A6EA 2HS5A 1RRJA 4CDGA 1R71A 2RDPA 3G2BA 2KL4A 2Y30A 1IN8A 3H3ZA 5KNLA 3PASA 5KAIC 5TGTA 4M9ZA 1SANA 3MD2A 2ZKZA 4KIGA 3LWJA 2HZTA 2JSPA 4IOCF 4PGHA 3ZMZA 2OD5A 3F9KA 4ITVA 1IO2A 1ZARA 4HSTA 3KP4A 3DF8A 3BZCA 4AVPA 1W7PA 4M6YA 4E7KA 5K5OA 3ASNH 1YRNA 1PVEA 2OC6A 1YW7A 2EK5A 2AQEA 1E3OC 5LLQA 1G4DA 1IN6A 4AC6A 2A61A 3VSLA 1SFOJ 4L9JA 2IXSA 3I59B 3SQNA 3VPRA 3FXMA 4NNJA 1R1UA 2K9SA 3OIPA 2JPCA 3TOAA 1B8IA 4ME9A 3EUKL 1HC8A 3QYBA 5F0HA 3JRHA 2WY7Q 3BOQA 4M3BA 4LB5A 2KIFA 1GVJA 1XDUA 2ETHA 4HF0A 1P9QC 2H6BA 1Z77A 2WGBA 4KMUX 5F1JA 3CUQA 1ZLKA 3BY6A 4L9TA 3F23A 4DBQA 4XICA 1S7AA 5C4XJ 2XRLA 2FQ4A 1FP1D 1WJFA 2Y31A 3KZ9A 3V8JA 3HOYJ 1AKHB 2NX4A 2XB0X 5L3GA 3RPQA 2XUBA 4BEHB 3VDXA 3NARA 5E17F 2BVLA 5HSZA 2JJ7A 2LLKA 4E6KG 1YX5A 4IHYA 2P5KA 3H3UA 2W00A 2NNYA 4LJZF 3W2VA 1WJDA 5B3SH 1U5TB 1X3WB 2DYRH 2G3BA 1EV7A 1TWHJ 2GBYA 4MNUA 1XGOA 3L7WA 3HTAA 3IUOA 3CC4I 1HDDC 3CD6I 4KYWA 3IH3A 2Z3YA 3ISPA 1FPQA 3CMEI 2DTRA 1G3TA 1QO0D 4X6AJ 3H9QA 1Q1VA 2ZSHB 2VQCA 3L2VA 4NHJA 2F4MB 1C0WA 4E7SA 2G7SA 2LF7A 2JPBA 4AUXA 1MDMB 2M45A 1PUFB 2BEOA 3VYRB 4XRSG 1UG2A 1TWFJ 4D9JA 3H0GJ 3G73A 1F5TA 4G6QA 2A68F 2EFNA 3U21A 3NQOA 4JX5A 1YE9A 1JKQC 5M3MJ 3P9IA 1K78B 4KA4A 3K4LA 2J5PA 3HHGA 3FKIJ 1Z05A 3IUVA 1R22A 3VSKA 2FA5A 3RI4A 3ESWB 2GAUA 3WTVC 4F7ZA 1Y6IA 2UV1A 4CSWA 4EMSA 4E7JA 3SFZA 4MGRA 4A0ZA 1CF7A 1FNNA 1D1CA 2RQQA 2RNGA 3L09A 5DD4A 4C2UA 3CUOA 3O3KA 2PMHA 2VIXA 1IC8A 3TO7A 1TNTA 3TW7A 1TTYA 2HYGD 4N0BA 3S1NJ 1HLVA 1G8XA 5KAFC 1JGGA 3V42A 1VQ7I 4BHCA 5ILVA 4RB1A 2ZOZA 4FT8A 3HOZJ 2YVXA 1O7LA 1MW7A 4HG2A 5EJCA 2ZXJA 5FO5A 1PDNC 2BXYA 4XQFA 5EEAA 2L9VA 1OISA 5HNFA 4CZZA 1T0FC 1UB9A 1P4XA 2WWYA 2V79A 2OERA 3OYKA 4I76A 1SVLA 2CUJA 4KN4X 4DYRA 1Q1HA 2JVHA 1T08B 5C4YA 2O8XA 2ME6A 1J59A 1J0RA 2H8RA 1D0YA 5D5UB 4AD9A 3QPTA 1H88C 5ED4A 2E1NA 3U1DA 2GUHA 3HSEA 2BY2A 4BKXA 2DFEA 4RM2A 3S3NA 3H3VK 3MQ0A 3L2QA 3S1MJ 5HS9A 5B5EC 2HGCA 3BTJA 5FLXK 5L3BA 4N9HA 4XRSA 4HLYA 2VQGA 4ZTJA 4ESFA 2L7ZA 3KZYA 3GLXA 3Q0UA 5HDGA 5FKOA 3TKYA 4L0ZB 4Z2YA 4A0YA 1R1VA 1Y1WJ 2GXGA 3NRVA 2FD5A 5JLXA 1KU3A 1X58A 3GFJA 4RA2A 3OYFA 5HLIA 2TDXA 3LQQA 2NP5A 3RYPA 5IYBJ 2OBPA 3S17J 3M1EA 1X19A 2A6EF 3BPVA 1NK2P 3WU0A 3OMYA 5IOZA 3I71A 2DTZA 3HOXJ 3GTGJ 4R8HA 4S05A 2GA1A 3ZPLA 1X1BA 3NS4A 3MWMA 3K10A 2LDUA 2KPMA 1YRNB 4DNCA 3QKXA 3CMAI 1YITI 1QQIA 3LOCA 1JUPA 1FIAA 5M5XJ 1Y0NA 3GBGA 3CCQI 2BZTA 3KEYA 3KLOA 4MFEA 1X1PA 3HGYA 1S6LA 2VASA 5FLXZ 4RS8A 2QQ9A 3W2AA 3K6GA 4HKUA 4D7NA 2DK8A 3JRDA 1VNDA 2M7BA 3RTRA 3CMMA 1W5SA 2P0WA 1B8IB 2MFZA 1P7IA 5AONA 2MC4A 3RKWA 1ONVA 3HKZA 2E34A 2LY9A 3F8FA 4GYIA 4RGSA 3WHCA 2ZXIA 4CUGA 5A2QK 3DTEA 1ZRDA 3FDYA 2YPRA 2NVQJ 4R79A 3AQSA 3BJBA 2BY1A 2KRHA 3CUQB 4BBRJ 3SXYA 5J1YA 3E6MA 3BT9A 3PFIA 2IA0A 3KKDA 5J4YA 2DLLA 3I64A 1WZ2A 4EJVA 5CVIA 1W4MA 3LSJA 2EIJH 4G94A 2OQGA 1IGNA 3LSHA 2VXZA 2YX4A 1TQMA 3E6BA 3QRFF 2DOEA 3JAMK 5CW8A 2H09A 4IXAA 4B44A 2FBQA 2K7LA 1SAXA 3DQVC 2Q2EB 3ANGA 3T8TA 4A3DJ 3HYIA 5ICCA 5D5XB 2D5VA 2K86A 4IRGA 1STZA 4JKZA 5J6XA 3R61A 2HI3A 3VP5A 4JOMA 4BQQA 4HNVA 2O0YA 1U8BA 4G8XA 3HTJA 4LIVA 1B9NA 3PO2J 4NB5A 2UZKA 1ZR2A 2QIBA 1YIOA 1JJ8C 4I99C 1XGSA 1GXPA 1LDKB 2FX0A 2VXDA 5IP6A 1O3QA 2FMYA 4HLXA 4LG3A 2VPLA 3DTKA 2QVOA 1AOYA 4CCJA 5HOOA 4WX9A 2HOSA 4L62A 3V7SA 2JRTA 1X1AA 3FXRA 3QPSA 5A2QZ 2Z16A 2NS7A 5JI6A 3B6AA 5D5WB 5IT9K 3VVYA 1JGSA 5GADJ 3IAS2 4O5VA 1XSXA 3M7GA 1R1TA 2W25A 3WGHA 2VLAA 3SHFA 4BY1J 2HYTA 3H0DA 3PIOF 2FRHA 3V4GA 2GXAA 2MD5A 3ABUA 2X6YA 4L9NA 1Z6RA 4OINF 3OYIA 2OPTA 3W6KB 1FTTA 4FTHA 4I6ZA 3JAMZ 4NBQA 2AO9A 1VFCA 4N4NB 2A07F 4KJZA 2K4JA 4CA0A 2MBFA 5B66C 5DCMA 1RUNA 3V8LA 1UHWA 3WTWC 1Z21A 4LLNA 3G4SI 1EH6A 4BGDA 2F5FA 3HIFA 1EJ9A 3LFKA 2MD0A 2HU9A 2IJLA 3L2CA 4BQAA 1ZH5A 3J80K 2LOOA 4KT5C 1ZLJA 5LRSA 2DMPA 1FJLA 1ZTRA 1PYVA 4WF2A 1WKMA 4I09A 1Y0UA 4A12A 4PSXA 2DN0A 2GXBA 5AQCA 3ABKH 1S9HA 4UUTA 2EV5A 2HYFA 2ZXWH 5CYVA 5DUIA 3T8RA 4HOBA 4IRVA 1R4NB 4RAGA 5IT9Z 3ELKA 3PFYA 2COMA 1MMAA 2YX7A 1XMAA 2DBBA 3P9KA 2AXLA 4KICA 1TQIA 2MYSA 2UXPA 3OL4A 3TP3A 1VQKI 4OIOF 2A6TA 2XPWA 4EEFG 1MBEA 4A3IJ 2HKUA 4BXUA 3F6OA 2WB1A 2VKEA 5EG0A 1R58A 4FCYA 1YS7A 2AS5F 4M3EA 2MLGA 3U1KA 2CFXA 1Y56A 2VJJA 3E6CC 1LEAA 1W36D 4GCTA 2DJIA 1DP7P 1BW6A 1QZZA 4II2A 4A69C 5TRDA 2L4AA 4CCMA 1Z3XA 2EZLA 2M8GX 5B1AH 3RZOJ 4BJ6C 3NWSA 2O5RA 4PJJA 4XLNF 4EATA 2CJJA 2HKXA 2ZC2A 3PQKA 3TP0A 1L3LA 4XK4A 3CCLI 2YSRA 2G9WA 1FX7A 3BR5A 1Z3YA 1OFCX 3ML6A 3JRIA 2ZMEB 3D1NI 4HYEA 2LTPA 5DEQA 5FD5A 2M2EA 1APLC 2VKHA 3GW2A 3PNVA 4D1QA 4EGZA 4U87A 2NXNB 2K9QA 3ZQCA 1AA7A 4KDPA 4CXFA 1ETKA 1FBQA 1YW8A 1IXCA 2QENA 3CC2I 1I5ZA 2KDOA 1G3YA 2O7OA 2LRDA 3S1QJ 2RHAA 3CJTB 2CQXA 2Z9OA 2LK2A 4NC7A 2K9NA 1J09A 1GV2A 1POGA 3ABLH 2VJ4A 2K27A 2CQNA 5KHDA 5AIPA 3N05A 1ZREA 2OA4A 2GOXB 2FSWA 1TT0A 4Z6YA 3F8MA 1DGWY 3LSPA 4CO8A 1QZEA 2IS6A 4HF1A 2W7NA 2ELKA 3QP6A 5CPRB 3A03A 2Y0SN 4L5JA 3OYCA 1Y8QB 2CG4A 3J81K 1FYMA 3LJLA 1MMGA 1XD7A 2I5UA 4HZFA 2R5ZA 2EB7A 3DU5A 3LSMA 3BP8A 3DPTA 1QRYA 2VE8A 3M1CA 4GXOA 1MH4A 1WCMJ 4NC8A 5FKLA 3TQNA 3KIOA 1FBUA 4AIJA 3EUHC 1E17A 5IYDJ 4HAMA 2P7VB 3BQZA 4IRIA 2RKHA 2KP6A 5CQEA 1VQ4I 5DS9A 3DV8A 1MMDA 2W82A 1K79A 3QYEA 2P5LC 1FSEA 2V1UA 1YJNI 4BU2A 2L01A 5LHIA 2UXUA 4M9XA 4DVYP 3CCMI 2F5VA 2X6XA 3DPLC 4XSXF 4K2EA 2CGPA 2DT7B 4V19K 1X3ZB 4B47A 2YU3A 2Y48A 1P4AA 3OY9A 3HRTA 3VIBA 3KYCB 3QP5A 1NK3P 2I8DA 4FETA 3HSFA 2E2IJ 2NP3A 3VW1A 2VKVA 1KZHA 1VQPI 1NHAA 2VKDA 3U2RA 2ADUA 4P1WA 2Y0SA 3KYDB 2DODA 1MGTA 4LFUA 2R7SA 3K4MA 4JBAA 4XNFA 4IHXA 5LHGA 1R23A 4DW6A 3GEUA 2DDBA 3R60A 4JX6A 4IF4A 3J7ZI 4ZDLA 5BNGA 2XSJC 1X2MA 1WFXA 2HDDA 1V5EA 3CF5F 3OYJA 1GDTA 4KITB 1OCCH 2IAIA 2QUFA 1I50J 4OD5A 3CCSI 3DEEA 4PCQA 4MTEA 3GUDA 1D1BA 2L4MA 1B72A 1ACIA 1CQTA 1BL0A 2LBFB 3CCYA 3CDLA 1VI0A 3FXQA 2A3SA 2VPRA 1HF0A 3K2AA 2Q1ZB 4RAYA 4A3MJ 2XAQA 1N78A 5CVJA 5IY5H 3I5UA 1KYZA 3DBHB 2ECCA 5KK1A 4XKVA 2KJCA 2IGOA 1R4MB 1U2WA 2QQBA 1T98A 3ABTA 4C9YA 4I7HA 3FHNA 3KEQA 4A0XA 5IP7J 1WPKA 3GTMJ 2B1EA 4MO7A 4HV5A 1IAWA 5D5VB 4IEJA 5EDNA 5K7ZA 2BXZA 1YX3A 1SMTA 3S3MA 2E1MC 3LSKA 4DJAA 2QKLB 3BHQA 1ETVA 2GWRA 3CO6C 4P9FA 4CH7A 3R0JA 4UB6C 2NVUB 2XROA 1TWCJ 4V2FA 4DZPA 1FOWA 1OCPA 5LGUA 2LREA 2CW0F 3H5RA 4KFCA 4R1HA 1FOKA 4XONA 2IEKA 2NVXJ 3AL0B 4ZDOA 3H1CA 2VB6A 4A3KJ 4GO1A 4NQWA 3K4KA 1S29A 3VEPA 1GT0C 2QOPA 4OOIA 3M9AA 9ANTA 2VJIA 4A3GJ 4HV6A 3FX3A 1FSHA 5D8LB 4MK6A 4CICA 3CP2A 3OWTA 3GFIA 1YTYA 3OYLA 4U9NA 1JTYA 3OS0A 4KIBA 1HW2A 4IPAA 1FEXA 3BR1A 2PMZN 4FHTA 2ZSIB 2L2OA 4UY8I 3VYTB 3GF2A 2HTSA 2O9LA 3DPUA 4O3MA 2ZFUA 2FU4A 4XKCA 1NG7A 3K4NA 3ZQLA 3K1PA 2YVEA 1P6RA 2F4IA 2WC2A 3BTIA 3R4KA 5JLWA 3HZJA 3MAJA 1R49A 2KRFA 3I58A 2IPQX 3LSRA 1OLTA 2V1DA 2D1VA 1ZHFA 1W7PD 3DLAA 1ZQ3P 3IWFA 3MVPA 4KWAA 1BM9A 5E3NA 2DAOA 2EZIA 1ON2A 1U3EM 1JT0A 3CJRB 5FGLA 2PBIA 1FOXA 1BI1A 2EA4A 1QPIA 1R5HA 5DTDA 3BTCA 5ILSA 1T39A 3JRCA 2KIQA 2ID3A 3JSJA 3A4CA 2E7XA 1R6RA 2PMZA 3WHBA 3DEWA 2QEXI 5D4SA 2ELJA 3HGGA 2XPUA 2QGUA 1I3QJ 2XGXA 2K3PA 1IRXA 2OCEA 2K02A 4ETSA 4GCKA 3TEDA 3FRQA 3BDDA 4FQGA 2HQ5A 3GFMA 4WXDA 4U7DA 2IS4A 3JSPA 2LC2A 4MXMA 3FM3A 2G7UA 5J47A 2JT1A 2DMUA 3FIWA 1BJAA 4ABZA 2NVTJ 1JHHA 1YOVB 3GVAA 5GAHJ 4E7IA 3E6DA 3TW6A 1WH5A 4MQVA 1XMKA 2ESHA 5TJJA 4I2OA 2PG4A 4W1UA 4BJTA 2BV6A 1JKRC 3K8PC 1OYWA 5HDKA 1B59A 4AM3A 2E5ZA 1IUFA 2XF7A 4CYCA 5JHUA 3CDIA 3JTGA 5ICGA 2STTA 3GTQJ 3DXJF 5J3LA 2R92J 1K7AA 4JYKA 2XGEA 5CVUA 2QKOA 4JK1X 4XLCA 4EVIA 2M0CA 4LD5A 1RC9A 3SEQA 3ERMA 1I6HJ 4GFBA 1A6QA 1U9OA 2DA1A 1KQ9A 2NOJB 3ZMVA 5EF6A 1JXSA 2ZCWA 3GMEA 2BW3A 3CP8A 3OYMA 1YQAA 3OV8A 3V7CA 1D8JA 3FHZA 2FOWA 3CJDA 2M7AA 2VODA 3OR1C 3D0SA 4S04A 4MEYF 3Q5FA 2KIUA 2E2JJ 1SD6A 2F5DA 3C7JA 5D6FA 2HWVA 2R5YA 4ZTFA 1D0ZA 3DU6A 5FB2A 4ASNA 1S3JA 1RZ4A 3OYNA 3L2WA 2Z33A 2Z1DA 2HDWA 3BC8A 4GFKA 1YJ9I 3GXOA 1GXQA 3KP3A 1D5YA 4HEA2 4ZZLA 1ORKA 3C2BA 3MZ8A 4JQFA 3PUBA 1KU2A 1NH3A 2VN2A 2B0LA 2NRAC 1HSJA 5HAWA 4G7OF 2KMUA 1U8RA 2H8WA 3HL2A 4XL9A 2NYXA 2CWEA 3M8FA 4YFKF 1OKRA 2XAFA 3MCZA 3HTUA 3JTHA 2EFWA 4LLLA 4TV7A 2W4SA 3ZN0A 3F72A 1LPQA 3LA7A 1UFMA 4HPQA 1DPUA 3I53A 1QNTA 2GFNA 4B48A 1Z0XA 3UNGC 4YIFA 3TOBA 2EWNA 3BG7A 3EGQA 4YRVA 1FY7A 1XS9A 2ZJ2A 3AG2H 2K40A 4Y3OA 4BNCA 1QZYA 4CCNA 4I0AA 2IT0A 4Q47A 4AIHA 3G71I 4OAZA 4M72A 4OIPF 3GTLJ 2HQNA 3QWLA 5DUKA 2KZVA 1LVKA 1XSVA 2EV0A 5HODA 3A01A 1LEBA 2AHQA 3ERED 2XF6A 2GIZA 3HSRA 5LEKA 1XDSA 2H27A 2Q24A 3H9GA 3PQJA 4XORA 5GPAA 2KIMA 2P6TA 3EPZA 2ZOYA 5F08A 2WADA 2YU9J 4HX8A 4ZYAA 3KZZA 2Y9ZA 3HIMA 4E70A 4ON0A 1J9IA 4ESBA 2GM4A 1H0MA 4NQWB 4ACIA 4QPQA 5KVRA 4OIRF 4U88A 2R7OA 2XAHA 2Z99A 4LIUA 1B4AA 1ZGJA 1ITYA 1MBFA 2M87A 2QWWA 3FMSA 4C2MA 1MNMC 3C07A 3HPGA 4G6TB 1WQ2A 4F55A 2QSHX 3OYHA 3D5RC 2IA1A 4XMYA 3L1PA 3IH4A 3F22A 3J7AY 3BNIA 2JVGA 1MNDA 4UUSB 3JRGA 2JUGA 5FKKA 4J01A 4P5OA 2IW5A 2VI6A 4U0VA 2Y9YA 3EYIA 3S3OA 2MA3A 2JA8J 2FOKA 2JTVA 2ZJRF 4XLAA 4ENKA 5BOXA 1TWGJ 1SD7A 1REPC 5IP9J 1KYWA 4G6DA 2ZNYA 1ULYA 3Q9VA 4XOTA 2R93J 6PAXA 2R7XA 4Q5SF 3FKJA 1IRGA 5DM7F 2HDCA 2ZCXA 1LFUP 3EUAA 3FWEA 4BS9A 4KNYA 1FYLA 4DQ2A 1IW7F 1W7PB 3DEUA 3FXUA 3JRFA 2DPUA 4WXCA 5HS7A 1T38A 4RAFA 4BXXJ 4PSWA 4EGYA 3DFGA 5HBUA 2DJNA 3OYGA 3E97A 3ON4A 1OJLA 4RLQA 2V6CA 2F5EA 3BJ6A 3HRUA 3RIRA 2JA6J 5CXGA 2E35A 3K9TA 2XAGA 1J5YA 4BUPA 4HX4A 2PJRA 2X6WA 1TNSA 3P7NA 3GYHX 4ENMA 4HDVA 1V5FA 1R36A 2BGCA 2HPMA 3KP5A 4XKWA 5D6EA 4BACA 1A5JA 3IWZA 4XIDA 5CLSA 3G1OA 3LMMA 5FKNA 3G1MA 2FEZA 3V8KA 2LSOA 3IV5A 5JFRA 3P5JA 2WTEA 4FX0A 4IJAA 1VQOI 2PZ9A 2XPVA 5L3EA 2A5WA 3C18A 3F8NA 4IVNA 1EF4A 3GZ5A 5TISC 2OTJI 4XN3A 4C30A 1UZCA 2LMDA 3T1BA 3K1MA 1K4TA 5FLVA 3OOUA 2X48A 4F93B 2O03A 3W2WA 4EM2A 4BXFA 1WJ5A 3SEZA 4B43A 2ACJA 1LE8A 4XRMA 3ECHA 1HW1A 1V5GA 2FJI1 3DTIA 4AVZA 5E79C 3M8EA 4HNUA 3HOSA 1J7KA 4IOAF 2PBXA 2QBYA 3LA3A 1ETYA 3ZQ7A 5EEHA 4OIQF 3SZPA 5GP9A 1RR7A 2MG4A 1LKXA 3KLNA 2V7FA 2OCCH 2JA5J 3C3WA 4IX7A 4MQ9F 3H92A 1S7OA 4RGUA 1F9NA 2XRNA 2EV6A 1W5CC 2IGKA 3S2DJ 2IRFG 5C4JJ 2DA5A 4IQJA 4EJUA 4P9UA 5J8FA 1MJAA 4P55A 2MSYA 2EBIA 2XIGA 5E3LA 3BG5A 3FXLA 1QGPA 1R00A 2M4KA 3J7YJ 5EFYA 3A0BC 1GLNA 1T0FA 3ULQB 1QHHD 1WJBA 5FMPA 1BOBA 1J2XA 2BE5F 1MKMA 1L0OC 2KJBA 3TO6A 1WSUA 3KX2A 4BQNA 2CU7A 3IHUA 1IG7A 2ZY9A 3BR3A 4IO9F 1CF7B 5E8GA 1E2XA 3HUGA 2VBYA 5L3FA 2K4BA 2WUIA 2HXOA 3C2GA 3FXOA 1JTXA 2UXHA 3ZMTA 2KRCA 4JX4A 5E8IA 4DBRA 1IZ1A 1SD5A 3BR6A 1LNWA 1UHMA 2DA6A 2MGQA 2MABA 1IN7A 5L3DA 3BROA 2LVSA 1BI3A 4I98B 1Z7UA 4XBFA 1V3FA 2A5YB 2QCOA 2V1NA 4U0WA 1SAUA 1TQPA 1ETXA 1ON1A 1P92A 3GCMA 2LG4A 1K83J 5B1BH 3RH2A 5HLHA 1U5TC 2DYSH 1D5VA 3SFIA 4MHGA 4PUSA 2RC4A 3PNTA 3SDGA 2HR3A 1VZ0A 1XCBA 2E2HJ 1MMSA 2UXOA 3KETA 1YFHA 3DKWA 2E36A 1RKTA 3RPUA 5E18F 3IKTA 5LGNA 2G7GA 3AAFA 3V7RA 5F1RA 1OPCA 3K4CA 3A0HC 4UDSA 2TCTA 1TZLA 4LK0F 4YEJA 1DDNA 1HSTA 5LRRA 1VQ8I 2HTJA 4XLPF 3X2QH 4I01A 2K5CA 1FMWA 2B7EA 3VTIA 3RSNA 4D0PA 4A3FJ 5LGTA 3GTPJ 3D5SC 3IRRA 2JMWA 1HCRA 4IKFA 2XF5A 1LDDA 2EFPA 1LDJA 3BPXA 3IAM2 3I9V2 3WTXC 1S72I 4IQ4A 2FUG2 1VTNC 3HRSA 4KN7X 1FC3A 3HOUJ 1T6SA 3PM1A 2ELHA 3KP7A 4PK4A 4C3HJ 2XHKA 1ZN2A 3LFUA 5BS6A 2X51A 4A3LJ 3PIPF 3VOEA 2CW7A 4HRIA 1SFUA 3ZXSA 1WWXA 3EYYA 3J80Z 2P8TA 2PFBA 1R5GA 3CCUI 5DYMA 4BHBA 1FP2A 5FLMJ 3CZ6A 4PXIA 2D1HA 3QODA 5FRMA 5K1YA 4OAYA 2R7UA 2OJED 3VOKA 4HX7A 5CXIA 1YLFA 5EGOA 2EJRA 2PI0A 1HW5A 2IGMA 1KU9A 3GTKJ 3G56A 4RB3C 3I0TA 4LG0A 2M5WA 3TDUC 4L5IA 4ENNA 1OCOH 1ZELA 1I27A 3S2HJ 2G7HA 2VQHA 4U7BA 4PDKA 5EZGA 3OSFA 1TL8A 2DA2A 1MD0A 2E60A 5K5RA 1DQUA 2FE3A 1G6NA 1SFXA 2VOPA 4AIKA 2WAFA 4QPOA 1YYVA 4HSRA 1V54H 4XLEA 3JR9A 3ON2A 3E5QA 3VUQA 4DGWB 4A3JJ 2FNAA 3Q0VA 1YG2A 2X6OA 4GCVA 2GZWA 4RM3A 4F92B 5EYRA 5J8CA 3FBIB 2OF7A 4F52A 1R9TJ 3VWBA 4Y7NJ 1NTCA 4RAZA 1N75A 2K9LA 3NWTA 1IDZA 2COBA 1O57A 3DKYA 5FFXA 3K4JA 4AF5A 1ETOA 3FBNB 2GQQA 2QM3A 1CGPA 2O8KA 1HA8A 3K70C 4CCKA 2F07A 2BHYA 3R0AA 1S7EA 4Y4RA 1AHDP 5HLGA 1E3HA 2IBDA 4DYCA 4Q48A 1MSEC 2FBHA 1OQYA 3OIQA 5ILUA 1PJRA 1X2NA 3I59A 2VT2A 2HOTA 1LE8B 3JSOA 3DCFA 2O61A 4PGGA 3BZKA 4BJ5C 3IH2A 5GAGJ 3L00A 2CMPA 2L5QA 3LQRA 4UXNA 4GDFA 4CCOA 4BAYA 2DA4A
chains in the Genus database with same CATH topology
3DEWA 2QF7A 3HGGA 4BKXA 3VW2A 1TWAJ 2XPUA 3H3VK 4FE7A 4YZEA 3S1MJ 2CUEA 1I3QJ 2LFBA 3BG9A 3BTJA 2EH3A 2CQQA 4XRSA 4GCKA 3TEDA 3FRQA 2XB5A 1RESA 2HQ5A 4MXMA 3VW0A 2L7ZA 3FK7A 1W0TA 4ICHA 3Q0UA 2DMUA 3FIWA 5FKOA 4ABZA 1WH7A 5IPAA 1AKHA 2NVTJ 1Y1WJ 3TW6A 5JLXA 1WH5A 2FD5A 2NVYJ 1VF9A 2ID6A 5C3EJ 4W1UA 1IRZA 1X58A 1JKRC 2QTQA 2WB1N 2W48A 5F0CA 2TRTA 2NP5A 3HM5A 2ZB9A 3NI7A 1MBGA 5IYBJ 1IUFA 4CYCA 3CWRA 4A3CJ 2EZKA 3S17J 2YS9A 4JP0A 1NK2P 3GTQJ 5J3LA 1JJ6C 2R92J 3HOVJ 2I10A 4JYKA 5IOZA 2XGEA 2DTZA 2QKOA 3HOXJ 2M0CA 2B63J 3GTGJ 2XGDA 2E19A 1JKOC 1I6HJ 4GFBA 1U9OA 3O60A 3GTOJ 2DA1A 4CGRA 2NS8A 1BW5A 2UXIA 3BQYA 4AYBN 5EF6A 3ZQHA 1YRNB 3QKXA 2KT0A 2H1KA 3LOCA 3CJDA 1JUPA 1PUFA 2WV1A 1FIAA 4DYQA 5M5XJ 3PO3J 3GBGA 2E2JJ 1RPWA 2Y2ZA 4MFEA 3HGYA 2R5YA 3HOWJ 4HKUA 4D7NA 2G0EA 3JRDA 1VNDA 1ZR4A 4V2GA 3E7QA 4GFKA 1B8IB 2ZCNA 4M3GA 2ZCMA 1P7IA 1D5YA 1ORKA 3C2BA 2LY9A 3ZQGA 3WHCA 2R0QC 3HDDA 4M3FA 4MFDA 1WI3A 2NVQJ 5HAWA 3BTLA 2NOGA 3AQSA 2ME0A 3JRBA 1ZGWA 3BJBA 4BBRJ 3LHQA 5J1YA 1RETA 1P7JA 3BT9A 2WAQN 3KKDA 1K61A 3CRJA 4S0HB 1ETQA 3LSJA 2GFNA 4GCLA 1Z0XA 1IGNA 2YVHA 3CMYA 3EGQA 1XS9A 2VUMJ 1UMQA 2K40A 5E3MA 5EG0B 5CW8A 1FTZA 4M3DA 1XG1A 2FBQA 3ANGA 2DG7A 3K7AJ 4A3DJ 2N8GA 2D5VA 3GTLJ 3A01A 4JKZA 5HODA 3BR2A 2LP0A 2AHQA 2HI3A 3VP5A 4HNVA 2FJ1A 1LFBA 2KDZA 3MKLA 1U8BA 3HTJA 4JNNA 1H89C 2Q24A 1MSFC 3PO2J 2MW8A 5GPAA 1ZR2A 2QIBA 1JJ8C 5F27A 2FX0A 2ZOYA 5F08A 5IP6A 4NDLA 2L7MP 2YU9J 3VVZA 1UI5A 3OIOA 1JUMA 3VVXA 3S1RJ 2Y9ZA 3HIMA 1SGMA 2HOSA 4L62A 2RASA 3QPSA 2GM4A 3SJMA 3UKGA 4L5EA 2NS7A 4ACIA 3B6AA 1QVTA 2JWTA 4QTRA 3M3YJ 3VVYA 2YUSA 4G12A 3QQAA 4C3JJ 1ITYA 1MBFA 3M4OJ 2G7LA 1MNMC 3C07A 5EZHA 3B81A 4FISA 4BY1J 2HYTA 2P81A 3F1BA 1DU0A 3NPIA 2OPTA 1FTTA 3L1PA 3IH4A 4FTHA 3BNIA 4I6ZA 2GENA 2D6YA 2AO9A 3Q3SA 3G1LA 2E1OA 1VFCA 4UUSB 3JRGA 4M6VA 3BR0A 5FKKA 3NRGA 2VI6A 1BA5A 2Y9YA 2R5ZB 3CQZJ 5FJ8J 2JA8J 3Q0WA 3JREA 3HBLA 3NXCA 4MLOA 5C44J 1TWGJ 3RQIA 3V78A 1AU7A 3FISA 1MH3A 5IP9J 2DMPA 2X9DA 1ZTRA 1FJLA 2R93J 2CRGA 4BBSJ 4B3AA 3T6NA 3E7LA 4B1RA 4JL3A 2ZCXA 1LFUP 4D5CA 3RKQA 2DN0A 1IV6A 2O7TA 5AQCA 4C3IJ 4UUTA 2HXIA 4IHWA 2HOAA 1IDYA 3JRFA 1QVUA 4BXXJ 5HBUA 2DJNA 3LNQA 3S5RA 1U78A 5F0FA 3RZDJ 3ON4A 1OJLA 1JKPC 4IHVA 2L9RA 1BJZA 3TP3A 2UXPA 1HDPA 2XPWA 2L7FP 5IYCJ 2JA6J 5CXGA 4EEFG 1MBEA 1O4XA 4A3IJ 3DPJA 2HKUA 5D19A 3BG3A 5E3OA 2VKEA 1MBJA 5K7HA 2LR8A 1JT6A 3O8HA 5EG0A 3PPBA 4FCYA 4W97A 4M3EA 1A5JA 3COLA 4A3EJ 4XIDA 1ETWA 1T56A 1H8AC 4GCTA 3G1OA 3MNLA 3HTHA 5FKNA 1BW6A 1WGXA 3G1MA 4A69C 1B72B 1HOMA 3IV5A 4A3BJ 1OCTC 2M8GX 2EZLA 3RZOJ 2XSDC 1U9NA 2CJJA 3TP0A 2XPVA 2PZ9A 1DU6A 3LSGA 4XK4A 1EF4A 3B6CA 2LD5A 2RAEA 2LKXA 3BR5A 3ANPA 1ENHA 3I4NJ 3JRIA 1OFCX 2XDNA 1RKWA 3QBMA 2OI8A 3D1NI 5FLVA 2R7ZJ 4AC0A 2LTPA 1F43A 2W53A 3OOUA 2M2EA 2X48A 1APLC 2DG8A 3NNRA 5J1RA 1UI6A 2K9QA 3ZQCA 1LE8A 4XRMA 1ETKA 1IJWC 3S1QJ 2O7OA 2RHAA 4QIWN 3KKCA 2CQXA 1G2HA 2PBXA 5D1RA 4J19A 2GLOA 1ETYA 2LK2A 1F36A 2K9NA 1GV2A 1POGA 2DMTA 1RR7A 2MG4A 5GP9A 4C2MJ 1ZKGA 3O8GA 3G7RA 2JA5J 5FHPA 4D5FA 1ZK8A 5EGOB 2DA7A 4QSHA 3LSPA 2CUFA 2ELKA 2HYJA 3S2DJ 5DAJA 4UUSA 3HTIA 3MN2A 3A03A 2Y0SN 5C4JJ 4D7MA 2DA5A 3LJLA 3HEFA 2JN6A 2MSYA 2EBIA 2R5ZA 5FKLA 1QRYA 5E3LA 1MH4A 1WCMJ 3BG5A 3S14J 2Y30A 5EFYA 3PASA 5IYDJ 1GVDA 5FMPA 3BQZA 1SANA 5GPCA 5DS9A 3LWJA 3ZQFA 2CU7A 1IG7A 3JRAA 3BR3A 2UXUA 4RDUA 2WUIA 2HXOA 1JTXA 2UXHA 3VIBA 4JX4A 1NK3P 3S16J 3BR6A 1FIPA 1YRNA 2E2IJ 2NP3A 3VW1A 2VKVA 2DA6A 2MGQA 1JUSA 1E3OC 2LVSA 1GUUA 4FE4A 2QCOA 2V57A 3P9TA 5F04A 4AC6A 1ETXA 4IHXA 1K83J 3RH2A 1SFOJ 3VPRA 4DW6A 3SFIA 2M34A 3V6GA 3GEUA 3A02A 4JX6A 1GV5A 3SDGA 5BNGA 2K9SA 5M5WJ 1X2MA 1B8IA 2E2HJ 5IOYA 2UXOA 4ME9A 2HDDA 1RKTA 3RD3A 5F0HA 1GDTA 2G7GA 2M9HA 2IAIA 4M3BA 3JRHA 4B4CA 1T33A 1I50J 4UDSA 2TCTA 1B72A 1Z77A 2WGBA 4RBOA 1CQTA 1BL0A 3CCYA 3CDLA 5F1JA 1VI0A 3HKZN 2DMNA 2VPRA 2EQRA 3F0CA 1HF0A 1XC5A 3K2AA 3QPLA 3W6VA 4A3MJ 4MIMA 4XICA 4A3FJ 3GTPJ 2ECCA 5C4XJ 2XRLA 2FQ4A 2JMWA 1HCRA 5D18A 2Y31A 3KZ9A 3HOYJ 1AKHB 2NX4A 2XB0X 2QWTA 3NARA 5M5YJ 5HSZA 2JJ7A 2LLKA 4IHYA 5IP7J 1WPKA 3GTMJ 3HOUJ 3PM1A 4MO7A 4C3HJ 3GTJJ 4A3LJ 2JA7J 5K7FA 4IEJA 5EDNA 1Y1VJ 4CYCB 5K7ZA 2G3BA 2GBYA 1TWHJ 3VOXA 3HTAA 3BHQA 1ETVA 2XGCA 1HDDC 3NAUA 4DZJA 4Y52J 3IH3A 1TWCJ 4V2FA 4DZPA 4X6AJ 5FLMJ 1OCPA 4PXIA 5M3FJ 2ECBA 3VOKA 1Q1VA 5CXIA 5K58A 5EGOA 2IEKA 4GFLA 3HB9A 2JK3A 2NVXJ 2G7SA 3ZQIA 3GTKJ 4AUXA 3G56A 4A3KJ 3AQTA 2QOPA 1PUFB 1GT0C 3EUPA 3BCGA 4XRSG 1MBHA 1UG2A 3S2HJ 1TWFJ 3FK6A 4A93J 5EZGA 3OSFA 1A6IA 9ANTA 3H0GJ 3KNWA 4A3GJ 2DA2A 4NELA 1TC3C 2R5YB 2IU5A 3BRUA 4MK6A 3GZIA 1JKQC 4JX5A 5M3MJ 1UHSA 4LOCA 3JR9A 3ON2A 3FKIJ 1JTYA 4NN1A 3IUVA 1FEXA 3VUQA 3BR1A 4A3JJ 3Q0VA 2X6OA 2PMZN 1W0UA 5EYRA 2OF7A 1R9TJ 2O9LA 4Y7NJ 1NTCA 1IDZA 2COBA 1IC8A 3TW7A 4AF5A 3ZQLA 1ETOA 2YVEA 2O8KA 3BTIA 3I4MJ 3S1NJ 3HE0A 2REKA 1HLVA 5JLWA 1JGGA 5H9TA 2F07A 3LSRA 1S7EA 2ZOZA 1AHDP 2L0KA 3HOZJ 2IBDA 4DYCA 1ZQ3P 3S15J 1MSEC 1MBKA 4BY7J 3MVPA 5EEAA 4KWAA 5E3NA 3ZOBA 2DMQA 2EZIA 1X2NA 4X1EA 2EZHA 2OERA 2HOTA 3OSGA 1LE8B 4I76A 4DYRA 3DCFA 1JT0A 3A01B 5FGLA 5FKMA 5C4YA 1QPIA 2DA3A 2ME6A 3IH2A 5DTDA 2H8RA 3BTCA 3JRCA 1H88C 2ID3A 5J1UA 3JSJA 3WHBA 2GUHA 2DA4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DEW A;  2QF7 A;  3HGG A;  4BKX A;  3VW2 A;  1TWA J;  2XPU A;  3H3V K;  4FE7 A;  4YZE A;  3S1M J;  2CUE A;  1I3Q J;  2LFB A;  3BG9 A;  3BTJ A;  2EH3 A;  2CQQ A;  4XRS A;  4GCK A;  3TED A;  3FRQ A;  2XB5 A;  1RES A;  2HQ5 A;  4MXM A;  3VW0 A;  2L7Z A;  3FK7 A;  1W0T A;  4ICH A;  3Q0U A;  2DMU A;  3FIW A;  5FKO A;  4ABZ A;  1WH7 A;  5IPA A;  1AKH A;  2NVT J;  1Y1W J;  3TW6 A;  5JLX A;  1WH5 A;  2FD5 A;  2NVY J;  1VF9 A;  2ID6 A;  5C3E J;  4W1U A;  1IRZ A;  1X58 A;  1JKR C;  2QTQ A;  2WB1 N;  2W48 A;  5F0C A;  2TRT A;  2NP5 A;  3HM5 A;  2ZB9 A;  3NI7 A;  1MBG A;  5IYB J;  1IUF A;  4CYC A;  3CWR A;  4A3C J;  2EZK A;  3S17 J;  2YS9 A;  4JP0 A;  1NK2 P;  3GTQ J;  5J3L A;  1JJ6 C;  2R92 J;  3HOV J;  2I10 A;  4JYK A;  5IOZ A;  2XGE A;  2DTZ A;  2QKO A;  3HOX J;  2M0C A;  2B63 J;  3GTG J;  2XGD A;  2E19 A;  1JKO C;  1I6H J;  4GFB A;  1U9O A;  3O60 A;  3GTO J;  2DA1 A;  4CGR A;  2NS8 A;  1BW5 A;  2UXI A;  3BQY A;  4AYB N;  5EF6 A;  3ZQH A;  1YRN B;  3QKX A;  2KT0 A;  2H1K A;  3LOC A;  3CJD A;  1JUP A;  1PUF A;  2WV1 A;  1FIA A;  4DYQ A;  5M5X J;  3PO3 J;  3GBG A;  2E2J J;  1RPW A;  2Y2Z A;  4MFE A;  3HGY A;  2R5Y A;  3HOW J;  4HKU A;  4D7N A;  2G0E A;  3JRD A;  1VND A;  1ZR4 A;  4V2G A;  3E7Q A;  4GFK A;  1B8I B;  2ZCN A;  4M3G A;  2ZCM A;  1P7I A;  1D5Y A;  1ORK A;  3C2B A;  2LY9 A;  3ZQG A;  3WHC A;  2R0Q C;  3HDD A;  4M3F A;  4MFD A;  1WI3 A;  2NVQ J;  5HAW A;  3BTL A;  2NOG A;  3AQS A;  2ME0 A;  3JRB A;  1ZGW A;  3BJB A;  4BBR J;  3LHQ A;  5J1Y A;  1RET A;  1P7J A;  3BT9 A;  2WAQ N;  3KKD A;  1K61 A;  3CRJ A;  4S0H B;  1ETQ A;  3LSJ A;  2GFN A;  4GCL A;  1Z0X A;  1IGN A;  2YVH A;  3CMY A;  3EGQ A;  1XS9 A;  2VUM J;  1UMQ A;  2K40 A;  5E3M A;  5EG0 B;  5CW8 A;  1FTZ A;  4M3D A;  1XG1 A;  2FBQ A;  3ANG A;  2DG7 A;  3K7A J;  4A3D J;  2N8G A;  2D5V A;  3GTL J;  3A01 A;  4JKZ A;  5HOD A;  3BR2 A;  2LP0 A;  2AHQ A;  2HI3 A;  3VP5 A;  4HNV A;  2FJ1 A;  1LFB A;  2KDZ A;  3MKL A;  1U8B A;  3HTJ A;  4JNN A;  1H89 C;  2Q24 A;  1MSF C;  3PO2 J;  2MW8 A;  5GPA A;  1ZR2 A;  2QIB A;  1JJ8 C;  5F27 A;  2FX0 A;  2ZOY A;  5F08 A;  5IP6 A;  4NDL A;  2L7M P;  2YU9 J;  3VVZ A;  1UI5 A;  3OIO A;  1JUM A;  3VVX A;  3S1R J;  2Y9Z A;  3HIM A;  1SGM A;  2HOS A;  4L62 A;  2RAS A;  3QPS A;  2GM4 A;  3SJM A;  3UKG A;  4L5E A;  2NS7 A;  4ACI A;  3B6A A;  1QVT A;  2JWT A;  4QTR A;  3M3Y J;  3VVY A;  2YUS A;  4G12 A;  3QQA A;  4C3J J;  1ITY A;  1MBF A;  3M4O J;  2G7L A;  1MNM C;  3C07 A;  5EZH A;  3B81 A;  4FIS A;  4BY1 J;  2HYT A;  2P81 A;  3F1B A;  1DU0 A;  3NPI A;  2OPT A;  1FTT A;  3L1P A;  3IH4 A;  4FTH A;  3BNI A;  4I6Z A;  2GEN A;  2D6Y A;  2AO9 A;  3Q3S A;  3G1L A;  2E1O A;  1VFC A;  4UUS B;  3JRG A;  4M6V A;  3BR0 A;  5FKK A;  3NRG A;  2VI6 A;  1BA5 A;  2Y9Y A;  2R5Z B;  3CQZ J;  5FJ8 J;  2JA8 J;  3Q0W A;  3JRE A;  3HBL A;  3NXC A;  4MLO A;  5C44 J;  1TWG J;  3RQI A;  3V78 A;  1AU7 A;  3FIS A;  1MH3 A;  5IP9 J;  2DMP A;  2X9D A;  1ZTR A;  1FJL A;  2R93 J;  2CRG A;  4BBS J;  4B3A A;  3T6N A;  3E7L A;  4B1R A;  4JL3 A;  2ZCX A;  1LFU P;  4D5C A;  3RKQ A;  2DN0 A;  1IV6 A;  2O7T A;  5AQC A;  4C3I J;  4UUT A;  2HXI A;  4IHW A;  2HOA A;  1IDY A;  3JRF A;  1QVU A;  4BXX J;  5HBU A;  2DJN A;  3LNQ A;  3S5R A;  1U78 A;  5F0F A;  3RZD J;  3ON4 A;  1OJL A;  1JKP C;  4IHV A;  2L9R A;  1BJZ A;  3TP3 A;  2UXP A;  1HDP A;  2XPW A;  2L7F P;  5IYC J;  2JA6 J;  5CXG A;  4EEF G;  1MBE A;  1O4X A;  4A3I J;  3DPJ A;  2HKU A;  5D19 A;  3BG3 A;  5E3O A;  2VKE A;  1MBJ A;  5K7H A;  2LR8 A;  1JT6 A;  3O8H A;  5EG0 A;  3PPB A;  4FCY A;  4W97 A;  4M3E A;  1A5J A;  3COL A;  4A3E J;  4XID A;  1ETW A;  1T56 A;  1H8A C;  4GCT A;  3G1O A;  3MNL A;  3HTH A;  5FKN A;  1BW6 A;  1WGX A;  3G1M A;  4A69 C;  1B72 B;  1HOM A;  3IV5 A;  4A3B J;  1OCT C;  2M8G X;  2EZL A;  3RZO J;  2XSD C;  1U9N A;  2CJJ A;  3TP0 A;  2XPV A;  2PZ9 A;  1DU6 A;  3LSG A;  4XK4 A;  1EF4 A;  3B6C A;  2LD5 A;  2RAE A;  2LKX A;  3BR5 A;  3ANP A;  1ENH A;  3I4N J;  3JRI A;  1OFC X;  2XDN A;  1RKW A;  3QBM A;  2OI8 A;  3D1N I;  5FLV A;  2R7Z J;  4AC0 A;  2LTP A;  1F43 A;  2W53 A;  3OOU A;  2M2E A;  2X48 A;  1APL C;  2DG8 A;  3NNR A;  5J1R A;  1UI6 A;  2K9Q A;  3ZQC A;  1LE8 A;  4XRM A;  1ETK A;  1IJW C;  3S1Q J;  2O7O A;  2RHA A;  4QIW N;  3KKC A;  2CQX A;  1G2H A;  2PBX A;  5D1R A;  4J19 A;  2GLO A;  1ETY A;  2LK2 A;  1F36 A;  2K9N A;  1GV2 A;  1POG A;  2DMT A;  1RR7 A;  2MG4 A;  5GP9 A;  4C2M J;  1ZKG A;  3O8G A;  3G7R A;  2JA5 J;  5FHP A;  4D5F A;  1ZK8 A;  5EGO B;  2DA7 A;  4QSH A;  3LSP A;  2CUF A;  2ELK A;  2HYJ A;  3S2D J;  5DAJ A;  4UUS A;  3HTI A;  3MN2 A;  3A03 A;  2Y0S N;  5C4J J;  4D7M A;  2DA5 A;  3LJL A;  3HEF A;  2JN6 A;  2MSY A;  2EBI A;  2R5Z A;  5FKL A;  1QRY A;  5E3L A;  1MH4 A;  1WCM J;  3BG5 A;  3S14 J;  2Y30 A;  5EFY A;  3PAS A;  5IYD J;  1GVD A;  5FMP A;  3BQZ A;  1SAN A;  5GPC A;  5DS9 A;  3LWJ A;  3ZQF A;  2CU7 A;  1IG7 A;  3JRA A;  3BR3 A;  2UXU A;  4RDU A;  2WUI A;  2HXO A;  1JTX A;  2UXH A;  3VIB A;  4JX4 A;  1NK3 P;  3S16 J;  3BR6 A;  1FIP A;  1YRN A;  2E2I J;  2NP3 A;  3VW1 A;  2VKV A;  2DA6 A;  2MGQ A;  1JUS A;  1E3O C;  2LVS A;  1GUU A;  4FE4 A;  2QCO A;  2V57 A;  3P9T A;  5F04 A;  4AC6 A;  1ETX A;  4IHX A;  1K83 J;  3RH2 A;  1SFO J;  3VPR A;  4DW6 A;  3SFI A;  2M34 A;  3V6G A;  3GEU A;  3A02 A;  4JX6 A;  1GV5 A;  3SDG A;  5BNG A;  2K9S A;  5M5W J;  1X2M A;  1B8I A;  2E2H J;  5IOY A;  2UXO A;  4ME9 A;  2HDD A;  1RKT A;  3RD3 A;  5F0H A;  1GDT A;  2G7G A;  2M9H A;  2IAI A;  4M3B A;  3JRH A;  4B4C A;  1T33 A;  1I50 J;  4UDS A;  2TCT A;  1B72 A;  1Z77 A;  2WGB A;  4RBO A;  1CQT A;  1BL0 A;  3CCY A;  3CDL A;  5F1J A;  1VI0 A;  3HKZ N;  2DMN A;  2VPR A;  2EQR A;  3F0C A;  1HF0 A;  1XC5 A;  3K2A A;  3QPL A;  3W6V A;  4A3M J;  4MIM A;  4XIC A;  4A3F J;  3GTP J;  2ECC A;  5C4X J;  2XRL A;  2FQ4 A;  2JMW A;  1HCR A;  5D18 A;  2Y31 A;  3KZ9 A;  3HOY J;  1AKH B;  2NX4 A;  2XB0 X;  2QWT A;  3NAR A;  5M5Y J;  5HSZ A;  2JJ7 A;  2LLK A;  4IHY A;  5IP7 J;  1WPK A;  3GTM J;  3HOU J;  3PM1 A;  4MO7 A;  4C3H J;  3GTJ J;  4A3L J;  2JA7 J;  5K7F A;  4IEJ A;  5EDN A;  1Y1V J;  4CYC B;  5K7Z A;  2G3B A;  2GBY A;  1TWH J;  3VOX A;  3HTA A;  3BHQ A;  1ETV A;  2XGC A;  1HDD C;  3NAU A;  4DZJ A;  4Y52 J;  3IH3 A;  1TWC J;  4V2F A;  4DZP A;  4X6A J;  5FLM J;  1OCP A;  4PXI A;  5M3F J;  2ECB A;  3VOK A;  1Q1V A;  5CXI A;  5K58 A;  5EGO A;  2IEK A;  4GFL A;  3HB9 A;  2JK3 A;  2NVX J;  2G7S A;  3ZQI A;  3GTK J;  4AUX A;  3G56 A;  4A3K J;  3AQT A;  2QOP A;  1PUF B;  1GT0 C;  3EUP A;  3BCG A;  4XRS G;  1MBH A;  1UG2 A;  3S2H J;  1TWF J;  3FK6 A;  4A93 J;  5EZG A;  3OSF A;  1A6I A;  9ANT A;  3H0G J;  3KNW A;  4A3G J;  2DA2 A;  4NEL A;  1TC3 C;  2R5Y B;  2IU5 A;  3BRU A;  4MK6 A;  3GZI A;  1JKQ C;  4JX5 A;  5M3M J;  1UHS A;  4LOC A;  3JR9 A;  3ON2 A;  3FKI J;  1JTY A;  4NN1 A;  3IUV A;  1FEX A;  3VUQ A;  3BR1 A;  4A3J J;  3Q0V A;  2X6O A;  2PMZ N;  1W0U A;  5EYR A;  2OF7 A;  1R9T J;  2O9L A;  4Y7N J;  1NTC A;  1IDZ A;  2COB A;  1IC8 A;  3TW7 A;  4AF5 A;  3ZQL A;  1ETO A;  2YVE A;  2O8K A;  3BTI A;  3I4M J;  3S1N J;  3HE0 A;  2REK A;  1HLV A;  5JLW A;  1JGG A;  5H9T A;  2F07 A;  3LSR A;  1S7E A;  2ZOZ A;  1AHD P;  2L0K A;  3HOZ J;  2IBD A;  4DYC A;  1ZQ3 P;  3S15 J;  1MSE C;  1MBK A;  4BY7 J;  3MVP A;  5EEA A;  4KWA A;  5E3N A;  3ZOB A;  2DMQ A;  2EZI A;  1X2N A;  4X1E A;  2EZH A;  2OER A;  2HOT A;  3OSG A;  1LE8 B;  4I76 A;  4DYR A;  3DCF A;  1JT0 A;  3A01 B;  5FGL A;  5FKM A;  5C4Y A;  1QPI A;  2DA3 A;  2ME6 A;  3IH2 A;  5DTD A;  2H8R A;  3BTC A;  3JRC A;  1H88 C;  2ID3 A;  5J1U A;  3JSJ A;  3WHB A;  2GUH A;  2DA4 A; 
#chains in the Genus database with same CATH topology
 5FD6 A;  3CLO A;  1BOA A;  4FE7 A;  4YZE A;  1P2F A;  1OYI A;  2LFB A;  2HQA A;  1I39 A;  2ISZ A;  3IC7 A;  1HQC A;  2STW A;  2EH3 A;  2WAE A;  1SFK A;  2CQQ A;  3D5L A;  3OS2 A;  2F6C A;  2X1C A;  3MZY A;  4RGX A;  4BQO A;  4WIB A;  1SVM A;  5H6Q A;  4PJ0 C;  2FNP A;  1BR1 A;  4NC6 A;  3FK7 A;  1W0T A;  3N4M A;  4PFP A;  4CYD A;  3ROU A;  1Y39 A;  3T0Y A;  4ZYE A;  2DFF A;  1AKH A;  1WH7 A;  5IPA A;  4BEH A;  2HVR A;  5DDG A;  1VF9 A;  5DM6 F;  2ID6 A;  4KT6 A;  3J81 Z;  2UXN A;  2QTQ A;  1XTA A;  5F0C A;  2TRT A;  4E7H A;  3HM5 A;  1G3S A;  2ZB9 A;  1U5T A;  1MBG A;  2EZK A;  4H0E A;  2YS9 A;  3VYU B;  4LK1 F;  1MMN A;  2PFV A;  1Y8R B;  2WBM A;  4J00 A;  4Q4Z F;  3CUQ C;  1IN5 A;  4AU7 A;  2BOL A;  2XGD A;  2L9N A;  2V9V A;  4UUV A;  1USS A;  2E1C A;  5DCM B;  3O60 A;  1WJA A;  4CGR A;  2NS8 A;  1BW5 A;  4AYB N;  3WGG A;  3ZQH A;  2FBI A;  1K6Y A;  2KT0 A;  3PSI A;  1MDM A;  4MEX F;  4X0G A;  2VQL A;  1PUF A;  2HOE A;  2VC0 A;  5K5Q A;  2DT5 A;  2LH9 A;  4BDY A;  1KGS A;  2ICW G;  1TLH B;  4A5N A;  4BYY A;  1PP8 F;  1XGM A;  3C2H A;  1WJE A;  3WTY C;  2G0E A;  3R6S A;  1K6O A;  1QHG A;  1ZR4 A;  1K78 A;  1BC7 C;  4M3G A;  2DI3 A;  5GAE J;  3ZQG A;  2R0Q C;  3F8C A;  4UNO A;  4XN0 A;  2CUZ A;  4MFD A;  1WI3 A;  4HQE A;  4XSZ F;  2QQA A;  2NOG A;  1DUX C;  5HS8 A;  2ZBK A;  1ZGW A;  1RET A;  1P7J A;  1FT9 A;  5E1W A;  2WAQ N;  2JZY A;  5F64 A;  1Z91 A;  1T95 A;  4AYB A;  1BC8 C;  3QPH A;  4KIS A;  3CRJ A;  3E3V A;  1FWZ A;  3DP7 A;  1ETQ A;  4S0H B;  3RYR A;  4GCL A;  2F2E A;  3RDI A;  2D45 A;  1LUJ B;  1D8K A;  3JW4 A;  3OOP A;  3ZMS A;  1QU3 A;  5E1X A;  5EG0 B;  5E3M A;  3W3C A;  5ERI A;  1X4P A;  4M3D A;  4WK8 F;  2CV0 A;  3FMQ A;  2RVC A;  3ZP5 A;  3K7A J;  2N8G A;  2K3F A;  2VC1 A;  2PN6 A;  2LYC A;  3BR2 A;  3HPH A;  4E4H A;  2LP0 A;  4RB0 A;  5DD8 A;  1D0X A;  1UJ8 A;  2FJ1 A;  1LFB A;  3ASO H;  2R4G A;  5FRO A;  2HZD A;  3I54 A;  1MSF C;  1H9T A;  1ZGA A;  3G6E I;  3SZT A;  4HW0 A;  1FOY A;  4BDZ A;  3CCE I;  3VVZ A;  3WU2 C;  2HPI A;  1UI5 A;  3TGN A;  3SWH A;  1OR7 C;  3SDB A;  1JUM A;  1W5T A;  2UWM A;  2WAQ A;  1SGM A;  2RAS A;  3IKV A;  4XLF A;  5LEJ A;  3UKG A;  1LVA A;  3LST A;  2AXT C;  2JWT A;  4LLG F;  3L2U A;  4O6J A;  3M3Y J;  2X1E A;  1QPM A;  3EUH A;  2A05 A;  4G12 A;  3QQA A;  4C3J J;  1X4O A;  2R7D A;  2PEX A;  4HNT A;  2VBW A;  2G7L A;  3B81 A;  4FIS A;  4ANJ A;  5LD2 C;  1V4R A;  4DIQ A;  1DU0 A;  2XVC A;  3NPI A;  2P6S A;  5CVR A;  2IP2 A;  2GEN A;  2VE9 A;  2ZJQ F;  3HXL A;  2D6Y A;  4UHT A;  3Q3S A;  3M07 A;  2GA2 A;  2E1O A;  4M73 A;  1O3T A;  2UUZ A;  2P4W A;  3WOD F;  1EH8 A;  1BIA A;  3BR0 A;  1BIB A;  2P5V A;  1FYK A;  2Z5U A;  4GYG A;  2R5Z B;  3AFH A;  2EA2 A;  4ZH4 F;  3CQZ J;  4KIF A;  3RJP A;  5FJ8 J;  3Q0W A;  4OMZ A;  2MH2 A;  3VOD A;  1PP7 U;  3JRE A;  4FX4 A;  4EQQ A;  3HBL A;  3QOE A;  4EJO A;  4MLO A;  5C44 J;  4Y17 A;  1BN5 A;  5J40 A;  5HDN A;  1AU7 A;  3FIS A;  2EFQ A;  3QYF A;  5GTH C;  2OU2 A;  1LJ9 A;  2X9D A;  3I3L A;  1XSD A;  2CRG A;  4B3A A;  3BWG A;  3T6N A;  4ZYG A;  2OAZ A;  3RKQ A;  4G9Y A;  1XN7 A;  1I1S A;  3HTS B;  2VOO A;  2DU9 A;  2DFH A;  3ABM H;  3DBL B;  3I56 I;  2HXI A;  3LA2 A;  3L2R A;  2HOA A;  2OV7 A;  4L9V A;  3ECO A;  2DDA A;  1K4S A;  3GX4 X;  2ZME C;  1KQ0 A;  1U78 A;  3GO5 A;  4XOP A;  5F0F A;  3RZD J;  2CV2 A;  1ZYR F;  2L9R A;  3N97 A;  3ZCO A;  4A5M A;  5IYC J;  2KQR A;  1SVO A;  3KPH A;  2QLZ A;  1H9G A;  3RKY A;  3DPJ A;  5D19 A;  3BG3 A;  3TDZ C;  5L3C A;  4ZZD A;  1E3P A;  3OYA A;  5IT3 A;  5E3O A;  4PZJ A;  4OD4 A;  1MBJ A;  2F5C A;  1A04 A;  3O8H A;  4W97 A;  3COL A;  3S93 A;  2Q2E A;  3CES A;  1H8A C;  5JHF A;  3MNL A;  3HTH A;  1WGX A;  4RGR A;  1B72 B;  1A31 A;  3E1S A;  4AWX B;  4DOZ A;  2FML A;  5BQT A;  3ZMU A;  1IRF A;  1U9N A;  4ZYH A;  4L18 B;  4HA8 A;  4IHS A;  3LSG A;  4M9S A;  3H5A A;  2FQ3 A;  4UVC A;  2RAE A;  3BCB A;  5ICF A;  5E1Z B;  1ENH A;  2XDN A;  2Y0M A;  4XM3 A;  4CHU A;  3QBM A;  1X1C A;  2V9P A;  1T2K A;  2OI8 A;  2KZG A;  1F43 A;  4AC0 A;  3WTT C;  3K1N A;  2DG8 A;  3LAP A;  1XMX A;  2CFO A;  3ZQQ A;  3H35 A;  4IRH A;  2WA0 A;  3F8B A;  3KZI C;  2HKO A;  3AG4 H;  2D2W A;  1VQ5 I;  1HKQ A;  5J4V A;  4J19 A;  1YHQ I;  1F36 A;  4BE0 A;  2HNH A;  1X3U A;  2QQ8 A;  3G7R A;  3BCA A;  5FHP A;  4D5F A;  2OZ6 A;  3F3X A;  4BHP A;  1AWC A;  4QLC U;  4RLF A;  2DA7 A;  4QSH A;  1W1W E;  1R5I D;  1SEU A;  2CH0 A;  2HYJ A;  5DAJ A;  1IXS B;  2RRE A;  2DOA A;  1MJ9 A;  4D7M A;  3I55 I;  1I1G A;  2JN6 A;  3HEF A;  1NG6 A;  2KKO A;  4WWC A;  5JVT A;  4CZC A;  2LNB A;  4LIT A;  1JHF A;  5H20 A;  3S14 J;  1OR7 A;  4ZYD A;  4M74 A;  1GVD A;  1OYY A;  4U0Y A;  1ZAO A;  5DCF A;  2KHM A;  2JUC A;  1EA3 A;  1J75 A;  5GPC A;  4WCG A;  3ZQF A;  1FLI A;  2HVQ A;  2ISY A;  2QA4 I;  3JRA A;  3MMY B;  2W24 A;  4I0B A;  2ZNZ A;  1IF1 A;  1Z1D A;  1G59 A;  3ZR8 X;  1O7F A;  2DW4 A;  4M6X A;  3BJO A;  4RDU A;  1VQN I;  4YEL A;  2A6H F;  3KYL A;  3S16 J;  1FIP A;  2LY2 A;  4XKB A;  5EEG A;  2ZXH A;  1OMI A;  2HQR A;  2RQP A;  4A2U A;  2DPD A;  1JUS A;  4LMY A;  1GUU A;  3HJE A;  4FE4 A;  4Y13 A;  3OYE A;  3ZN1 A;  2MC3 A;  2V57 A;  3P9T A;  5F04 A;  1YO5 C;  5GTI C;  4B8X A;  2O3F A;  4YFX F;  2M34 A;  1V55 H;  2F48 A;  3V6G A;  3K2Z A;  2XAJ A;  3A02 A;  1GV5 A;  5M5W J;  2R7V A;  2HEO A;  2LF8 A;  5IOY A;  1ZRF A;  2HFH A;  2PX9 A;  3RD3 A;  3FXJ A;  4NUB A;  2M9H A;  3AKZ A;  4B4C A;  1T33 A;  3CJN A;  1MJB A;  2Z2S B;  2Y75 A;  3LWF A;  3G3Z A;  4RBO A;  2AQF A;  1KU7 A;  3AL0 C;  3IL2 A;  1LFP A;  3HKZ N;  2DMN A;  2EQR A;  2XAU A;  3F0C A;  1XC5 A;  3QPL A;  5LHH A;  2PLY A;  3W6V A;  4MIM A;  4A6D A;  3NEU A;  2RN7 A;  2CYY A;  3M8J A;  1SC7 A;  1F4K A;  1BR2 A;  3K4B A;  2R7R A;  5D18 A;  3REO A;  3MZH A;  2QWT A;  1IUY A;  3HC7 A;  3WG9 A;  2EIM H;  5H6R A;  2ZME A;  5M5Y J;  2BYV E;  4G7Z F;  1WRJ A;  2QYO A;  1I3A A;  2LY1 A;  3KCC A;  3GTJ J;  3W6J B;  2JA7 J;  5K7F A;  1WI9 A;  1VQ9 I;  1Y1V J;  4CYC B;  3E5U A;  3F21 A;  3VOX A;  2H94 A;  3GWZ A;  3DLL F;  4YFN F;  2XGC A;  3HRM A;  3NAU A;  4DZJ A;  4Y52 J;  3WTU C;  2Q8K A;  1SD4 A;  2B9S A;  2OUM A;  1YS6 A;  5M3F J;  1F1Z A;  2ECB A;  2QSF X;  5F6F A;  1MIJ A;  2OZU A;  4E7Z A;  3WTS C;  2L9S A;  5K58 A;  3HHH A;  4QWQ A;  4GFL A;  2Q0O A;  2JK3 A;  3HB9 A;  2BW3 B;  1N25 A;  3ZQI A;  1W36 C;  3H9J A;  2DT6 A;  3DWL E;  5D4R A;  1XPX A;  1KA8 A;  1EKE A;  3AQT A;  1Z9C A;  3EUP A;  3BCG A;  1MBH A;  3CF2 A;  4IHT A;  3FK6 A;  4XRF A;  4A93 J;  3KNW A;  1A6I A;  4NEL A;  1TC3 C;  2R5Y B;  2IU5 A;  2FXA A;  3CCJ I;  2IS2 A;  1Z6T A;  2BVM A;  3BRU A;  3GZI A;  3GFL A;  3VYS B;  2DCE A;  1UHS A;  4LOC A;  2JQ7 A;  1E0E A;  2CO5 A;  1JE8 A;  1BI0 A;  4NN1 A;  3PL8 A;  2J5O A;  4N9I A;  4HF2 A;  4II3 A;  5H2F C;  2OTL I;  2BY0 A;  4UV9 A;  1W0U A;  3BZ6 A;  2E1M B;  3RQ4 A;  2EIN H;  2O6G E;  1IXR C;  3O2P E;  1D3Y A;  1IV8 A;  2W57 A;  2V6E A;  3LSI A;  3OYB A;  1KQ8 A;  1QBJ A;  2XV4 S;  3F6V A;  3HE0 A;  3I4M J;  2REK A;  1OCR H;  2LKS A;  3U9G A;  1TBX A;  2GOM A;  5H9T A;  3IRQ A;  4KMF A;  2VJ5 A;  4PJN A;  2V9K A;  2L0K A;  1U6G A;  4BE2 A;  3S15 J;  1B9M A;  1UST A;  2DQL A;  2QKM B;  2JA2 A;  2E7W A;  1MBK A;  4BY7 J;  1ZG1 A;  2H1L A;  4UV8 A;  1A35 A;  2F4O B;  3ZOB A;  2DMQ A;  2X0L A;  1OCZ H;  1TW2 A;  4X1E A;  2EZH A;  2A69 F;  3OSG A;  4EJT A;  4RMN A;  2FBK A;  3WE2 A;  2P7C B;  3ONQ A;  4XR6 A;  3A01 B;  5FKM A;  3DBR B;  2DA3 A;  3ZGK A;  2M8E A;  2VBX A;  5J1U A;  1RUO A;  3BG6 A;  2QF7 A;  4M71 A;  3WE3 A;  1TWA J;  2LKP A;  3VW2 A;  2XC7 A;  1S5L C;  4ZDP A;  3RPU D;  2CUE A;  3AG1 H;  2LBF A;  3BG9 A;  4H4K C;  2XAS A;  1S8N A;  3KEO A;  4B09 A;  1P4W A;  2ZJP F;  4ESJ A;  3J7A O;  2XB5 A;  1RES A;  1MNE A;  3HG9 A;  1TP4 A;  3K69 A;  1UG0 A;  1LQ1 A;  3VW0 A;  3LAJ A;  1YI2 I;  4C2T A;  4ICH A;  3JCU C;  4F91 B;  4BL0 B;  4PFO A;  2R7F A;  1DPR A;  3FMR A;  2NVY J;  5C3E J;  4IL6 C;  1IRZ A;  1ODD A;  2WB1 N;  2W48 A;  3LL7 A;  2DO7 A;  3MKW B;  1IN4 A;  3NI7 A;  4OWR B;  3IP4 B;  2FF4 A;  3CWR A;  2M3A A;  3BLY A;  4A3C J;  4YG2 F;  4JP0 A;  4HDU A;  1JJ6 C;  3HOV J;  2I10 A;  2V1X A;  5D8K B;  4WXH A;  2OQR A;  4Y33 A;  2B63 J;  2R3S A;  4UVA A;  2E19 A;  2X85 A;  1JKO C;  2E71 A;  3GTO J;  2XKO A;  2UXI A;  3BQY A;  3GZN B;  2CW8 A;  4YII A;  3CDH A;  2H1K A;  1LB2 A;  2EPF A;  2WV1 A;  4DYQ A;  1ZG5 A;  3MKY B;  2XKP A;  3PO3 J;  2IGN A;  1RPW A;  2CS3 A;  2L02 A;  2Y2Z A;  2H6C A;  2K9M A;  3DKX A;  2YR2 A;  3EQL F;  3HOW J;  1TW3 A;  2PMU A;  4ZC3 A;  4V2G A;  3E7Q A;  2ZCN A;  2ZCM A;  2UXX A;  4EJW A;  3QAH A;  2M30 A;  2W85 A;  1XB4 A;  3PUF A;  2VON A;  3HDD A;  1Z67 A;  4M3F A;  2M4G A;  2WY8 Q;  3EDP A;  2RGV A;  2ZO4 A;  3BTL A;  1O3R A;  1B6A A;  2NS0 A;  4ZJZ A;  1T8I A;  3KP2 A;  4U9L A;  2ME0 A;  3JRB A;  5CKT A;  3H36 A;  3LHQ A;  3E0J B;  1RI7 A;  3K0L A;  2KFD A;  2R7Q A;  3FF5 A;  1SFE A;  2DFI A;  2EIK H;  2WV0 A;  3KE2 A;  5LBQ A;  1K61 A;  1PUE E;  4GGG A;  1KON A;  2DOF A;  2KIS A;  4HBL A;  1VQM I;  2PJR B;  3TL4 X;  1RNL A;  1HXD A;  2YVH A;  3CMY A;  2VUM J;  1DP3 A;  1UMQ A;  3CTA A;  3OS1 A;  3BJA A;  1FTZ A;  3PNY A;  1XG1 A;  1SMY F;  1G3W A;  2DG7 A;  1WJC A;  1XGN A;  1YJW I;  3CLQ A;  3ZRG A;  5HVQ C;  2V26 A;  2K85 A;  1UCR A;  2NNN A;  2W1O A;  2BY3 A;  4UB8 C;  2KDZ A;  3MKL A;  4JNN A;  1H89 C;  2MW8 A;  1WHU A;  2X1D A;  5F27 A;  3P9C A;  3Q9S A;  4FAS D;  3SZG A;  3H5N A;  3S32 A;  3HOT A;  2QSG X;  3A1Y A;  4NDL A;  2L7M P;  2BBY A;  3FM5 A;  3OIO A;  3UR3 C;  3VVX A;  3QU6 A;  3S1R J;  1X1D A;  1BI2 A;  2MLK A;  1UAA A;  3SJM A;  4L5E A;  3ZMD A;  4EV0 A;  3CO7 C;  1QVT A;  4QTR A;  1MZB A;  2YUS A;  5BMZ A;  2X4H A;  4EM1 A;  2QBY B;  3M4O J;  2L54 A;  2DQR A;  1B1B A;  4AID A;  3WGI A;  5EZH A;  1N77 A;  3VB2 A;  2V4J C;  3WG7 H;  2NAZ A;  3MFK A;  2HVS A;  2P81 A;  3F1B A;  5FFZ A;  1XX5 A;  2RV8 A;  2VBZ A;  1ZRC A;  3OR2 C;  3RCO A;  3COA C;  1WVR A;  1GHC A;  3G1L A;  4HQM A;  1RIO H;  3CCV I;  2DK5 A;  4YIR X;  3C1D A;  4M6V A;  1M1E B;  4Y15 A;  1JI8 A;  5FRN A;  2E5N A;  3NRG A;  1BA5 A;  3S2W A;  2JRM A;  1HBX G;  2CV1 A;  3CJQ B;  1QA6 A;  2EIL H;  4LGW A;  3MEX A;  2CQK A;  3EET A;  3NXC A;  5JR3 A;  3RKX A;  1A36 A;  3RQI A;  3V78 A;  3FXK A;  2B3W A;  2BHZ A;  1MH3 A;  1FMV A;  3WTZ A;  4PJL A;  2GIV A;  1XCV A;  4PJM A;  5BPI A;  2IA2 A;  4BBS J;  1I6X A;  2ESN A;  4BH9 A;  4CCL A;  3E7L A;  4B1R A;  4JL3 A;  2XDV A;  3QU3 A;  4D5C A;  2PQ8 A;  1IV6 A;  1YW9 A;  2O7T A;  2Y69 H;  1D1A A;  4C3I J;  3HUG B;  3E5X A;  4IHW A;  1ERD A;  3VFZ A;  3PJR A;  2W84 A;  3TBI A;  3A2K A;  1IDY A;  4EM0 B;  3WU1 B;  3FZV A;  4RB2 C;  1QVU A;  3LNQ A;  2C6Y A;  3S5R A;  3S8P A;  1JKP C;  4IHV A;  4OMY A;  1BJZ A;  4LB6 B;  1HDP A;  4F3Q A;  2L7F P;  3GEZ A;  2QZ8 A;  1HKT A;  1O4X A;  4L0Y B;  3B73 A;  3KP6 A;  4OU0 A;  5HLT A;  2L3D A;  3KFW X;  3TMO A;  1BR4 A;  3SYT A;  4XLH A;  3CCR I;  1BBY A;  5K7H A;  2LR8 A;  1JT6 A;  3PPB A;  2PJP A;  4GRI A;  4A3E J;  1ETW A;  1T56 A;  1Z7L A;  1HKS A;  1EH7 A;  1TT5 B;  4B3X A;  1FZP B;  2CQ7 A;  5AIQ A;  4ENJ A;  1HOM A;  4A3B J;  1OCT C;  3B02 A;  2XSD C;  2DXI A;  5CVV A;  1O3S A;  2M0M A;  3T5X A;  1U0J A;  1DU6 A;  4E7L A;  3AG3 H;  3B6C A;  5CQG A;  2LD5 A;  1YIJ I;  2CSO A;  4UVB A;  2L7K A;  2LKX A;  2R7T A;  3I4N J;  3ANP A;  1R7J A;  1RKW A;  2VT3 A;  2M1B A;  2EFO A;  5HNH A;  4IZZ A;  2R7Z J;  3I4P A;  3TO9 A;  2W53 A;  5BPD A;  3NNR A;  5J1R A;  1UI6 A;  2VL8 A;  2JSC A;  4CGZ A;  1FBS A;  4MTD A;  2A2F X;  5JVG F;  1RR8 C;  2R7W A;  3OYD A;  2MH9 A;  1IJW C;  5CJ9 A;  2ZFW A;  5ICE A;  4BE1 A;  4QIW N;  3KKC A;  1DGR M;  1G2H A;  2IS1 A;  5D1R A;  2GLO A;  2KLO A;  5E20 A;  2DMT A;  4C2M J;  3K70 D;  2RNJ A;  3OL3 A;  3CC7 I;  1ZKG A;  3O8G A;  4KUM A;  4N4O B;  4G7H F;  3MKZ A;  4P96 A;  1UEL B;  1ZK8 A;  4I02 A;  5EGO B;  5KCM A;  3QOP A;  1ZG3 A;  5LFA A;  2CUF A;  5DV5 A;  3GLL A;  3L9F A;  4LG0 B;  3GZ6 A;  2IVM A;  4UUS A;  3HTI A;  3MN2 A;  3PSF A;  5FGM A;  3O6B B;  1VQ6 I;  1VQL I;  4A6E A;  2HS5 A;  1RRJ A;  4CDG A;  1R71 A;  2RDP A;  3G2B A;  2KL4 A;  2Y30 A;  1IN8 A;  3H3Z A;  5KNL A;  3PAS A;  5KAI C;  5TGT A;  4M9Z A;  1SAN A;  3MD2 A;  2ZKZ A;  4KIG A;  3LWJ A;  2HZT A;  2JSP A;  4IOC F;  4PGH A;  3ZMZ A;  2OD5 A;  3F9K A;  4ITV A;  1IO2 A;  1ZAR A;  4HST A;  3KP4 A;  3DF8 A;  3BZC A;  4AVP A;  1W7P A;  4M6Y A;  4E7K A;  5K5O A;  3ASN H;  1YRN A;  1PVE A;  2OC6 A;  1YW7 A;  2EK5 A;  2AQE A;  1E3O C;  5LLQ A;  1G4D A;  1IN6 A;  4AC6 A;  2A61 A;  3VSL A;  1SFO J;  4L9J A;  2IXS A;  3I59 B;  3SQN A;  3VPR A;  3FXM A;  4NNJ A;  1R1U A;  2K9S A;  3OIP A;  2JPC A;  3TOA A;  1B8I A;  4ME9 A;  3EUK L;  1HC8 A;  3QYB A;  5F0H A;  3JRH A;  2WY7 Q;  3BOQ A;  4M3B A;  4LB5 A;  2KIF A;  1GVJ A;  1XDU A;  2ETH A;  4HF0 A;  1P9Q C;  2H6B A;  1Z77 A;  2WGB A;  4KMU X;  5F1J A;  3CUQ A;  1ZLK A;  3BY6 A;  4L9T A;  3F23 A;  4DBQ A;  4XIC A;  1S7A A;  5C4X J;  2XRL A;  2FQ4 A;  1FP1 D;  1WJF A;  2Y31 A;  3KZ9 A;  3V8J A;  3HOY J;  1AKH B;  2NX4 A;  2XB0 X;  5L3G A;  3RPQ A;  2XUB A;  4BEH B;  3VDX A;  3NAR A;  5E17 F;  2BVL A;  5HSZ A;  2JJ7 A;  2LLK A;  4E6K G;  1YX5 A;  4IHY A;  2P5K A;  3H3U A;  2W00 A;  2NNY A;  4LJZ F;  3W2V A;  1WJD A;  5B3S H;  1U5T B;  1X3W B;  2DYR H;  2G3B A;  1EV7 A;  1TWH J;  2GBY A;  4MNU A;  1XGO A;  3L7W A;  3HTA A;  3IUO A;  3CC4 I;  1HDD C;  3CD6 I;  4KYW A;  3IH3 A;  2Z3Y A;  3ISP A;  1FPQ A;  3CME I;  2DTR A;  1G3T A;  1QO0 D;  4X6A J;  3H9Q A;  1Q1V A;  2ZSH B;  2VQC A;  3L2V A;  4NHJ A;  2F4M B;  1C0W A;  4E7S A;  2G7S A;  2LF7 A;  2JPB A;  4AUX A;  1MDM B;  2M45 A;  1PUF B;  2BEO A;  3VYR B;  4XRS G;  1UG2 A;  1TWF J;  4D9J A;  3H0G J;  3G73 A;  1F5T A;  4G6Q A;  2A68 F;  2EFN A;  3U21 A;  3NQO A;  4JX5 A;  1YE9 A;  1JKQ C;  5M3M J;  3P9I A;  1K78 B;  4KA4 A;  3K4L A;  2J5P A;  3HHG A;  3FKI J;  1Z05 A;  3IUV A;  1R22 A;  3VSK A;  2FA5 A;  3RI4 A;  3ESW B;  2GAU A;  3WTV C;  4F7Z A;  1Y6I A;  2UV1 A;  4CSW A;  4EMS A;  4E7J A;  3SFZ A;  4MGR A;  4A0Z A;  1CF7 A;  1FNN A;  1D1C A;  2RQQ A;  2RNG A;  3L09 A;  5DD4 A;  4C2U A;  3CUO A;  3O3K A;  2PMH A;  2VIX A;  1IC8 A;  3TO7 A;  1TNT A;  3TW7 A;  1TTY A;  2HYG D;  4N0B A;  3S1N J;  1HLV A;  1G8X A;  5KAF C;  1JGG A;  3V42 A;  1VQ7 I;  4BHC A;  5ILV A;  4RB1 A;  2ZOZ A;  4FT8 A;  3HOZ J;  2YVX A;  1O7L A;  1MW7 A;  4HG2 A;  5EJC A;  2ZXJ A;  5FO5 A;  1PDN C;  2BXY A;  4XQF A;  5EEA A;  2L9V A;  1OIS A;  5HNF A;  4CZZ A;  1T0F C;  1UB9 A;  1P4X A;  2WWY A;  2V79 A;  2OER A;  3OYK A;  4I76 A;  1SVL A;  2CUJ A;  4KN4 X;  4DYR A;  1Q1H A;  2JVH A;  1T08 B;  5C4Y A;  2O8X A;  2ME6 A;  1J59 A;  1J0R A;  2H8R A;  1D0Y A;  5D5U B;  4AD9 A;  3QPT A;  1H88 C;  5ED4 A;  2E1N A;  3U1D A;  2GUH A;  3HSE A;  2BY2 A;  4BKX A;  2DFE A;  4RM2 A;  3S3N A;  3H3V K;  3MQ0 A;  3L2Q A;  3S1M J;  5HS9 A;  5B5E C;  2HGC A;  3BTJ A;  5FLX K;  5L3B A;  4N9H A;  4XRS A;  4HLY A;  2VQG A;  4ZTJ A;  4ESF A;  2L7Z A;  3KZY A;  3GLX A;  3Q0U A;  5HDG A;  5FKO A;  3TKY A;  4L0Z B;  4Z2Y A;  4A0Y A;  1R1V A;  1Y1W J;  2GXG A;  3NRV A;  2FD5 A;  5JLX A;  1KU3 A;  1X58 A;  3GFJ A;  4RA2 A;  3OYF A;  5HLI A;  2TDX A;  3LQQ A;  2NP5 A;  3RYP A;  5IYB J;  2OBP A;  3S17 J;  3M1E A;  1X19 A;  2A6E F;  3BPV A;  1NK2 P;  3WU0 A;  3OMY A;  5IOZ A;  3I71 A;  2DTZ A;  3HOX J;  3GTG J;  4R8H A;  4S05 A;  2GA1 A;  3ZPL A;  1X1B A;  3NS4 A;  3MWM A;  3K10 A;  2LDU A;  2KPM A;  1YRN B;  4DNC A;  3QKX A;  3CMA I;  1YIT I;  1QQI A;  3LOC A;  1JUP A;  1FIA A;  5M5X J;  1Y0N A;  3GBG A;  3CCQ I;  2BZT A;  3KEY A;  3KLO A;  4MFE A;  1X1P A;  3HGY A;  1S6L A;  2VAS A;  5FLX Z;  4RS8 A;  2QQ9 A;  3W2A A;  3K6G A;  4HKU A;  4D7N A;  2DK8 A;  3JRD A;  1VND A;  2M7B A;  3RTR A;  3CMM A;  1W5S A;  2P0W A;  1B8I B;  2MFZ A;  1P7I A;  5AON A;  2MC4 A;  3RKW A;  1ONV A;  3HKZ A;  2E34 A;  2LY9 A;  3F8F A;  4GYI A;  4RGS A;  3WHC A;  2ZXI A;  4CUG A;  5A2Q K;  3DTE A;  1ZRD A;  3FDY A;  2YPR A;  2NVQ J;  4R79 A;  3AQS A;  3BJB A;  2BY1 A;  2KRH A;  3CUQ B;  4BBR J;  3SXY A;  5J1Y A;  3E6M A;  3BT9 A;  3PFI A;  2IA0 A;  3KKD A;  5J4Y A;  2DLL A;  3I64 A;  1WZ2 A;  4EJV A;  5CVI A;  1W4M A;  3LSJ A;  2EIJ H;  4G94 A;  2OQG A;  1IGN A;  3LSH A;  2VXZ A;  2YX4 A;  1TQM A;  3E6B A;  3QRF F;  2DOE A;  3JAM K;  5CW8 A;  2H09 A;  4IXA A;  4B44 A;  2FBQ A;  2K7L A;  1SAX A;  3DQV C;  2Q2E B;  3ANG A;  3T8T A;  4A3D J;  3HYI A;  5ICC A;  5D5X B;  2D5V A;  2K86 A;  4IRG A;  1STZ A;  4JKZ A;  5J6X A;  3R61 A;  2HI3 A;  3VP5 A;  4JOM A;  4BQQ A;  4HNV A;  2O0Y A;  1U8B A;  4G8X A;  3HTJ A;  4LIV A;  1B9N A;  3PO2 J;  4NB5 A;  2UZK A;  1ZR2 A;  2QIB A;  1YIO A;  1JJ8 C;  4I99 C;  1XGS A;  1GXP A;  1LDK B;  2FX0 A;  2VXD A;  5IP6 A;  1O3Q A;  2FMY A;  4HLX A;  4LG3 A;  2VPL A;  3DTK A;  2QVO A;  1AOY A;  4CCJ A;  5HOO A;  4WX9 A;  2HOS A;  4L62 A;  3V7S A;  2JRT A;  1X1A A;  3FXR A;  3QPS A;  5A2Q Z;  2Z16 A;  2NS7 A;  5JI6 A;  3B6A A;  5D5W B;  5IT9 K;  3VVY A;  1JGS A;  5GAD J;  3IAS 2;  4O5V A;  1XSX A;  3M7G A;  1R1T A;  2W25 A;  3WGH A;  2VLA A;  3SHF A;  4BY1 J;  2HYT A;  3H0D A;  3PIO F;  2FRH A;  3V4G A;  2GXA A;  2MD5 A;  3ABU A;  2X6Y A;  4L9N A;  1Z6R A;  4OIN F;  3OYI A;  2OPT A;  3W6K B;  1FTT A;  4FTH A;  4I6Z A;  3JAM Z;  4NBQ A;  2AO9 A;  1VFC A;  4N4N B;  2A07 F;  4KJZ A;  2K4J A;  4CA0 A;  2MBF A;  5B66 C;  5DCM A;  1RUN A;  3V8L A;  1UHW A;  3WTW C;  1Z21 A;  4LLN A;  3G4S I;  1EH6 A;  4BGD A;  2F5F A;  3HIF A;  1EJ9 A;  3LFK A;  2MD0 A;  2HU9 A;  2IJL A;  3L2C A;  4BQA A;  1ZH5 A;  3J80 K;  2LOO A;  4KT5 C;  1ZLJ A;  5LRS A;  2DMP A;  1FJL A;  1ZTR A;  1PYV A;  4WF2 A;  1WKM A;  4I09 A;  1Y0U A;  4A12 A;  4PSX A;  2DN0 A;  2GXB A;  5AQC A;  3ABK H;  1S9H A;  4UUT A;  2EV5 A;  2HYF A;  2ZXW H;  5CYV A;  5DUI A;  3T8R A;  4HOB A;  4IRV A;  1R4N B;  4RAG A;  5IT9 Z;  3ELK A;  3PFY A;  2COM A;  1MMA A;  2YX7 A;  1XMA A;  2DBB A;  3P9K A;  2AXL A;  4KIC A;  1TQI A;  2MYS A;  2UXP A;  3OL4 A;  3TP3 A;  1VQK I;  4OIO F;  2A6T A;  2XPW A;  4EEF G;  1MBE A;  4A3I J;  2HKU A;  4BXU A;  3F6O A;  2WB1 A;  2VKE A;  5EG0 A;  1R58 A;  4FCY A;  1YS7 A;  2AS5 F;  4M3E A;  2MLG A;  3U1K A;  2CFX A;  1Y56 A;  2VJJ A;  3E6C C;  1LEA A;  1W36 D;  4GCT A;  2DJI A;  1DP7 P;  1BW6 A;  1QZZ A;  4II2 A;  4A69 C;  5TRD A;  2L4A A;  4CCM A;  1Z3X A;  2EZL A;  2M8G X;  5B1A H;  3RZO J;  4BJ6 C;  3NWS A;  2O5R A;  4PJJ A;  4XLN F;  4EAT A;  2CJJ A;  2HKX A;  2ZC2 A;  3PQK A;  3TP0 A;  1L3L A;  4XK4 A;  3CCL I;  2YSR A;  2G9W A;  1FX7 A;  3BR5 A;  1Z3Y A;  1OFC X;  3ML6 A;  3JRI A;  2ZME B;  3D1N I;  4HYE A;  2LTP A;  5DEQ A;  5FD5 A;  2M2E A;  1APL C;  2VKH A;  3GW2 A;  3PNV A;  4D1Q A;  4EGZ A;  4U87 A;  2NXN B;  2K9Q A;  3ZQC A;  1AA7 A;  4KDP A;  4CXF A;  1ETK A;  1FBQ A;  1YW8 A;  1IXC A;  2QEN A;  3CC2 I;  1I5Z A;  2KDO A;  1G3Y A;  2O7O A;  2LRD A;  3S1Q J;  2RHA A;  3CJT B;  2CQX A;  2Z9O A;  2LK2 A;  4NC7 A;  2K9N A;  1J09 A;  1GV2 A;  1POG A;  3ABL H;  2VJ4 A;  2K27 A;  2CQN A;  5KHD A;  5AIP A;  3N05 A;  1ZRE A;  2OA4 A;  2GOX B;  2FSW A;  1TT0 A;  4Z6Y A;  3F8M A;  1DGW Y;  3LSP A;  4CO8 A;  1QZE A;  2IS6 A;  4HF1 A;  2W7N A;  2ELK A;  3QP6 A;  5CPR B;  3A03 A;  2Y0S N;  4L5J A;  3OYC A;  1Y8Q B;  2CG4 A;  3J81 K;  1FYM A;  3LJL A;  1MMG A;  1XD7 A;  2I5U A;  4HZF A;  2R5Z A;  2EB7 A;  3DU5 A;  3LSM A;  3BP8 A;  3DPT A;  1QRY A;  2VE8 A;  3M1C A;  4GXO A;  1MH4 A;  1WCM J;  4NC8 A;  5FKL A;  3TQN A;  3KIO A;  1FBU A;  4AIJ A;  3EUH C;  1E17 A;  5IYD J;  4HAM A;  2P7V B;  3BQZ A;  4IRI A;  2RKH A;  2KP6 A;  5CQE A;  1VQ4 I;  5DS9 A;  3DV8 A;  1MMD A;  2W82 A;  1K79 A;  3QYE A;  2P5L C;  1FSE A;  2V1U A;  1YJN I;  4BU2 A;  2L01 A;  5LHI A;  2UXU A;  4M9X A;  4DVY P;  3CCM I;  2F5V A;  2X6X A;  3DPL C;  4XSX F;  4K2E A;  2CGP A;  2DT7 B;  4V19 K;  1X3Z B;  4B47 A;  2YU3 A;  2Y48 A;  1P4A A;  3OY9 A;  3HRT A;  3VIB A;  3KYC B;  3QP5 A;  1NK3 P;  2I8D A;  4FET A;  3HSF A;  2E2I J;  2NP3 A;  3VW1 A;  2VKV A;  1KZH A;  1VQP I;  1NHA A;  2VKD A;  3U2R A;  2ADU A;  4P1W A;  2Y0S A;  3KYD B;  2DOD A;  1MGT A;  4LFU A;  2R7S A;  3K4M A;  4JBA A;  4XNF A;  4IHX A;  5LHG A;  1R23 A;  4DW6 A;  3GEU A;  2DDB A;  3R60 A;  4JX6 A;  4IF4 A;  3J7Z I;  4ZDL A;  5BNG A;  2XSJ C;  1X2M A;  1WFX A;  2HDD A;  1V5E A;  3CF5 F;  3OYJ A;  1GDT A;  4KIT B;  1OCC H;  2IAI A;  2QUF A;  1I50 J;  4OD5 A;  3CCS I;  3DEE A;  4PCQ A;  4MTE A;  3GUD A;  1D1B A;  2L4M A;  1B72 A;  1ACI A;  1CQT A;  1BL0 A;  2LBF B;  3CCY A;  3CDL A;  1VI0 A;  3FXQ A;  2A3S A;  2VPR A;  1HF0 A;  3K2A A;  2Q1Z B;  4RAY A;  4A3M J;  2XAQ A;  1N78 A;  5CVJ A;  5IY5 H;  3I5U A;  1KYZ A;  3DBH B;  2ECC A;  5KK1 A;  4XKV A;  2KJC A;  2IGO A;  1R4M B;  1U2W A;  2QQB A;  1T98 A;  3ABT A;  4C9Y A;  4I7H A;  3FHN A;  3KEQ A;  4A0X A;  5IP7 J;  1WPK A;  3GTM J;  2B1E A;  4MO7 A;  4HV5 A;  1IAW A;  5D5V B;  4IEJ A;  5EDN A;  5K7Z A;  2BXZ A;  1YX3 A;  1SMT A;  3S3M A;  2E1M C;  3LSK A;  4DJA A;  2QKL B;  3BHQ A;  1ETV A;  2GWR A;  3CO6 C;  4P9F A;  4CH7 A;  3R0J A;  4UB6 C;  2NVU B;  2XRO A;  1TWC J;  4V2F A;  4DZP A;  1FOW A;  1OCP A;  5LGU A;  2LRE A;  2CW0 F;  3H5R A;  4KFC A;  4R1H A;  1FOK A;  4XON A;  2IEK A;  2NVX J;  3AL0 B;  4ZDO A;  3H1C A;  2VB6 A;  4A3K J;  4GO1 A;  4NQW A;  3K4K A;  1S29 A;  3VEP A;  1GT0 C;  2QOP A;  4OOI A;  3M9A A;  9ANT A;  2VJI A;  4A3G J;  4HV6 A;  3FX3 A;  1FSH A;  5D8L B;  4MK6 A;  4CIC A;  3CP2 A;  3OWT A;  3GFI A;  1YTY A;  3OYL A;  4U9N A;  1JTY A;  3OS0 A;  4KIB A;  1HW2 A;  4IPA A;  1FEX A;  3BR1 A;  2PMZ N;  4FHT A;  2ZSI B;  2L2O A;  4UY8 I;  3VYT B;  3GF2 A;  2HTS A;  2O9L A;  3DPU A;  4O3M A;  2ZFU A;  2FU4 A;  4XKC A;  1NG7 A;  3K4N A;  3ZQL A;  3K1P A;  2YVE A;  1P6R A;  2F4I A;  2WC2 A;  3BTI A;  3R4K A;  5JLW A;  3HZJ A;  3MAJ A;  1R49 A;  2KRF A;  3I58 A;  2IPQ X;  3LSR A;  1OLT A;  2V1D A;  2D1V A;  1ZHF A;  1W7P D;  3DLA A;  1ZQ3 P;  3IWF A;  3MVP A;  4KWA A;  1BM9 A;  5E3N A;  2DAO A;  2EZI A;  1ON2 A;  1U3E M;  1JT0 A;  3CJR B;  5FGL A;  2PBI A;  1FOX A;  1BI1 A;  2EA4 A;  1QPI A;  1R5H A;  5DTD A;  3BTC A;  5ILS A;  1T39 A;  3JRC A;  2KIQ A;  2ID3 A;  3JSJ A;  3A4C A;  2E7X A;  1R6R A;  2PMZ A;  3WHB A;  3DEW A;  2QEX I;  5D4S A;  2ELJ A;  3HGG A;  2XPU A;  2QGU A;  1I3Q J;  2XGX A;  2K3P A;  1IRX A;  2OCE A;  2K02 A;  4ETS A;  4GCK A;  3TED A;  3FRQ A;  3BDD A;  4FQG A;  2HQ5 A;  3GFM A;  4WXD A;  4U7D A;  2IS4 A;  3JSP A;  2LC2 A;  4MXM A;  3FM3 A;  2G7U A;  5J47 A;  2JT1 A;  2DMU A;  3FIW A;  1BJA A;  4ABZ A;  2NVT J;  1JHH A;  1YOV B;  3GVA A;  5GAH J;  4E7I A;  3E6D A;  3TW6 A;  1WH5 A;  4MQV A;  1XMK A;  2ESH A;  5TJJ A;  4I2O A;  2PG4 A;  4W1U A;  4BJT A;  2BV6 A;  1JKR C;  3K8P C;  1OYW A;  5HDK A;  1B59 A;  4AM3 A;  2E5Z A;  1IUF A;  2XF7 A;  4CYC A;  5JHU A;  3CDI A;  3JTG A;  5ICG A;  2STT A;  3GTQ J;  3DXJ F;  5J3L A;  2R92 J;  1K7A A;  4JYK A;  2XGE A;  5CVU A;  2QKO A;  4JK1 X;  4XLC A;  4EVI A;  2M0C A;  4LD5 A;  1RC9 A;  3SEQ A;  3ERM A;  1I6H J;  4GFB A;  1A6Q A;  1U9O A;  2DA1 A;  1KQ9 A;  2NOJ B;  3ZMV A;  5EF6 A;  1JXS A;  2ZCW A;  3GME A;  2BW3 A;  3CP8 A;  3OYM A;  1YQA A;  3OV8 A;  3V7C A;  1D8J A;  3FHZ A;  2FOW A;  3CJD A;  2M7A A;  2VOD A;  3OR1 C;  3D0S A;  4S04 A;  4MEY F;  3Q5F A;  2KIU A;  2E2J J;  1SD6 A;  2F5D A;  3C7J A;  5D6F A;  2HWV A;  2R5Y A;  4ZTF A;  1D0Z A;  3DU6 A;  5FB2 A;  4ASN A;  1S3J A;  1RZ4 A;  3OYN A;  3L2W A;  2Z33 A;  2Z1D A;  2HDW A;  3BC8 A;  4GFK A;  1YJ9 I;  3GXO A;  1GXQ A;  3KP3 A;  1D5Y A;  4HEA 2;  4ZZL A;  1ORK A;  3C2B A;  3MZ8 A;  4JQF A;  3PUB A;  1KU2 A;  1NH3 A;  2VN2 A;  2B0L A;  2NRA C;  1HSJ A;  5HAW A;  4G7O F;  2KMU A;  1U8R A;  2H8W A;  3HL2 A;  4XL9 A;  2NYX A;  2CWE A;  3M8F A;  4YFK F;  1OKR A;  2XAF A;  3MCZ A;  3HTU A;  3JTH A;  2EFW A;  4LLL A;  4TV7 A;  2W4S A;  3ZN0 A;  3F72 A;  1LPQ A;  3LA7 A;  1UFM A;  4HPQ A;  1DPU A;  3I53 A;  1QNT A;  2GFN A;  4B48 A;  1Z0X A;  3UNG C;  4YIF A;  3TOB A;  2EWN A;  3BG7 A;  3EGQ A;  4YRV A;  1FY7 A;  1XS9 A;  2ZJ2 A;  3AG2 H;  2K40 A;  4Y3O A;  4BNC A;  1QZY A;  4CCN A;  4I0A A;  2IT0 A;  4Q47 A;  4AIH A;  3G71 I;  4OAZ A;  4M72 A;  4OIP F;  3GTL J;  2HQN A;  3QWL A;  5DUK A;  2KZV A;  1LVK A;  1XSV A;  2EV0 A;  5HOD A;  3A01 A;  1LEB A;  2AHQ A;  3ERE D;  2XF6 A;  2GIZ A;  3HSR A;  5LEK A;  1XDS A;  2H27 A;  2Q24 A;  3H9G A;  3PQJ A;  4XOR A;  5GPA A;  2KIM A;  2P6T A;  3EPZ A;  2ZOY A;  5F08 A;  2WAD A;  2YU9 J;  4HX8 A;  4ZYA A;  3KZZ A;  2Y9Z A;  3HIM A;  4E70 A;  4ON0 A;  1J9I A;  4ESB A;  2GM4 A;  1H0M A;  4NQW B;  4ACI A;  4QPQ A;  5KVR A;  4OIR F;  4U88 A;  2R7O A;  2XAH A;  2Z99 A;  4LIU A;  1B4A A;  1ZGJ A;  1ITY A;  1MBF A;  2M87 A;  2QWW A;  3FMS A;  4C2M A;  1MNM C;  3C07 A;  3HPG A;  4G6T B;  1WQ2 A;  4F55 A;  2QSH X;  3OYH A;  3D5R C;  2IA1 A;  4XMY A;  3L1P A;  3IH4 A;  3F22 A;  3J7A Y;  3BNI A;  2JVG A;  1MND A;  4UUS B;  3JRG A;  2JUG A;  5FKK A;  4J01 A;  4P5O A;  2IW5 A;  2VI6 A;  4U0V A;  2Y9Y A;  3EYI A;  3S3O A;  2MA3 A;  2JA8 J;  2FOK A;  2JTV A;  2ZJR F;  4XLA A;  4ENK A;  5BOX A;  1TWG J;  1SD7 A;  1REP C;  5IP9 J;  1KYW A;  4G6D A;  2ZNY A;  1ULY A;  3Q9V A;  4XOT A;  2R93 J;  6PAX A;  2R7X A;  4Q5S F;  3FKJ A;  1IRG A;  5DM7 F;  2HDC A;  2ZCX A;  1LFU P;  3EUA A;  3FWE A;  4BS9 A;  4KNY A;  1FYL A;  4DQ2 A;  1IW7 F;  1W7P B;  3DEU A;  3FXU A;  3JRF A;  2DPU A;  4WXC A;  5HS7 A;  1T38 A;  4RAF A;  4BXX J;  4PSW A;  4EGY A;  3DFG A;  5HBU A;  2DJN A;  3OYG A;  3E97 A;  3ON4 A;  1OJL A;  4RLQ A;  2V6C A;  2F5E A;  3BJ6 A;  3HRU A;  3RIR A;  2JA6 J;  5CXG A;  2E35 A;  3K9T A;  2XAG A;  1J5Y A;  4BUP A;  4HX4 A;  2PJR A;  2X6W A;  1TNS A;  3P7N A;  3GYH X;  4ENM A;  4HDV A;  1V5F A;  1R36 A;  2BGC A;  2HPM A;  3KP5 A;  4XKW A;  5D6E A;  4BAC A;  1A5J A;  3IWZ A;  4XID A;  5CLS A;  3G1O A;  3LMM A;  5FKN A;  3G1M A;  2FEZ A;  3V8K A;  2LSO A;  3IV5 A;  5JFR A;  3P5J A;  2WTE A;  4FX0 A;  4IJA A;  1VQO I;  2PZ9 A;  2XPV A;  5L3E A;  2A5W A;  3C18 A;  3F8N A;  4IVN A;  1EF4 A;  3GZ5 A;  5TIS C;  2OTJ I;  4XN3 A;  4C30 A;  1UZC A;  2LMD A;  3T1B A;  3K1M A;  1K4T A;  5FLV A;  3OOU A;  2X48 A;  4F93 B;  2O03 A;  3W2W A;  4EM2 A;  4BXF A;  1WJ5 A;  3SEZ A;  4B43 A;  2ACJ A;  1LE8 A;  4XRM A;  3ECH A;  1HW1 A;  1V5G A;  2FJI 1;  3DTI A;  4AVZ A;  5E79 C;  3M8E A;  4HNU A;  3HOS A;  1J7K A;  4IOA F;  2PBX A;  2QBY A;  3LA3 A;  1ETY A;  3ZQ7 A;  5EEH A;  4OIQ F;  3SZP A;  5GP9 A;  1RR7 A;  2MG4 A;  1LKX A;  3KLN A;  2V7F A;  2OCC H;  2JA5 J;  3C3W A;  4IX7 A;  4MQ9 F;  3H92 A;  1S7O A;  4RGU A;  1F9N A;  2XRN A;  2EV6 A;  1W5C C;  2IGK A;  3S2D J;  2IRF G;  5C4J J;  2DA5 A;  4IQJ A;  4EJU A;  4P9U A;  5J8F A;  1MJA A;  4P55 A;  2MSY A;  2EBI A;  2XIG A;  5E3L A;  3BG5 A;  3FXL A;  1QGP A;  1R00 A;  2M4K A;  3J7Y J;  5EFY A;  3A0B C;  1GLN A;  1T0F A;  3ULQ B;  1QHH D;  1WJB A;  5FMP A;  1BOB A;  1J2X A;  2BE5 F;  1MKM A;  1L0O C;  2KJB A;  3TO6 A;  1WSU A;  3KX2 A;  4BQN A;  2CU7 A;  3IHU A;  1IG7 A;  2ZY9 A;  3BR3 A;  4IO9 F;  1CF7 B;  5E8G A;  1E2X A;  3HUG A;  2VBY A;  5L3F A;  2K4B A;  2WUI A;  2HXO A;  3C2G A;  3FXO A;  1JTX A;  2UXH A;  3ZMT A;  2KRC A;  4JX4 A;  5E8I A;  4DBR A;  1IZ1 A;  1SD5 A;  3BR6 A;  1LNW A;  1UHM A;  2DA6 A;  2MGQ A;  2MAB A;  1IN7 A;  5L3D A;  3BRO A;  2LVS A;  1BI3 A;  4I98 B;  1Z7U A;  4XBF A;  1V3F A;  2A5Y B;  2QCO A;  2V1N A;  4U0W A;  1SAU A;  1TQP A;  1ETX A;  1ON1 A;  1P92 A;  3GCM A;  2LG4 A;  1K83 J;  5B1B H;  3RH2 A;  5HLH A;  1U5T C;  2DYS H;  1D5V A;  3SFI A;  4MHG A;  4PUS A;  2RC4 A;  3PNT A;  3SDG A;  2HR3 A;  1VZ0 A;  1XCB A;  2E2H J;  1MMS A;  2UXO A;  3KET A;  1YFH A;  3DKW A;  2E36 A;  1RKT A;  3RPU A;  5E18 F;  3IKT A;  5LGN A;  2G7G A;  3AAF A;  3V7R A;  5F1R A;  1OPC A;  3K4C A;  3A0H C;  4UDS A;  2TCT A;  1TZL A;  4LK0 F;  4YEJ A;  1DDN A;  1HST A;  5LRR A;  1VQ8 I;  2HTJ A;  4XLP F;  3X2Q H;  4I01 A;  2K5C A;  1FMW A;  2B7E A;  3VTI A;  3RSN A;  4D0P A;  4A3F J;  5LGT A;  3GTP J;  3D5S C;  3IRR A;  2JMW A;  1HCR A;  4IKF A;  2XF5 A;  1LDD A;  2EFP A;  1LDJ A;  3BPX A;  3IAM 2;  3I9V 2;  3WTX C;  1S72 I;  4IQ4 A;  2FUG 2;  1VTN C;  3HRS A;  4KN7 X;  1FC3 A;  3HOU J;  1T6S A;  3PM1 A;  2ELH A;  3KP7 A;  4PK4 A;  4C3H J;  2XHK A;  1ZN2 A;  3LFU A;  5BS6 A;  2X51 A;  4A3L J;  3PIP F;  3VOE A;  2CW7 A;  4HRI A;  1SFU A;  3ZXS A;  1WWX A;  3EYY A;  3J80 Z;  2P8T A;  2PFB A;  1R5G A;  3CCU I;  5DYM A;  4BHB A;  1FP2 A;  5FLM J;  3CZ6 A;  4PXI A;  2D1H A;  3QOD A;  5FRM A;  5K1Y A;  4OAY A;  2R7U A;  2OJE D;  3VOK A;  4HX7 A;  5CXI A;  1YLF A;  5EGO A;  2EJR A;  2PI0 A;  1HW5 A;  2IGM A;  1KU9 A;  3GTK J;  3G56 A;  4RB3 C;  3I0T A;  4LG0 A;  2M5W A;  3TDU C;  4L5I A;  4ENN A;  1OCO H;  1ZEL A;  1I27 A;  3S2H J;  2G7H A;  2VQH A;  4U7B A;  4PDK A;  5EZG A;  3OSF A;  1TL8 A;  2DA2 A;  1MD0 A;  2E60 A;  5K5R A;  1DQU A;  2FE3 A;  1G6N A;  1SFX A;  2VOP A;  4AIK A;  2WAF A;  4QPO A;  1YYV A;  4HSR A;  1V54 H;  4XLE A;  3JR9 A;  3ON2 A;  3E5Q A;  3VUQ A;  4DGW B;  4A3J J;  2FNA A;  3Q0V A;  1YG2 A;  2X6O A;  4GCV A;  2GZW A;  4RM3 A;  4F92 B;  5EYR A;  5J8C A;  3FBI B;  2OF7 A;  4F52 A;  1R9T J;  3VWB A;  4Y7N J;  1NTC A;  4RAZ A;  1N75 A;  2K9L A;  3NWT A;  1IDZ A;  2COB A;  1O57 A;  3DKY A;  5FFX A;  3K4J A;  4AF5 A;  1ETO A;  3FBN B;  2GQQ A;  2QM3 A;  1CGP A;  2O8K A;  1HA8 A;  3K70 C;  4CCK A;  2F07 A;  2BHY A;  3R0A A;  1S7E A;  4Y4R A;  1AHD P;  5HLG A;  1E3H A;  2IBD A;  4DYC A;  4Q48 A;  1MSE C;  2FBH A;  1OQY A;  3OIQ A;  5ILU A;  1PJR A;  1X2N A;  3I59 A;  2VT2 A;  2HOT A;  1LE8 B;  3JSO A;  3DCF A;  2O61 A;  4PGG A;  3BZK A;  4BJ5 C;  3IH2 A;  5GAG J;  3L00 A;  2CMP A;  2L5Q A;  3LQR A;  4UXN A;  4GDF A;  4CCO A;  4BAY A;  2DA4 A; 
#chains in the Genus database with same CATH homology
 3DEW A;  2QF7 A;  3HGG A;  4BKX A;  3VW2 A;  1TWA J;  2XPU A;  3H3V K;  4FE7 A;  4YZE A;  3S1M J;  2CUE A;  1I3Q J;  2LFB A;  3BG9 A;  3BTJ A;  2EH3 A;  2CQQ A;  4XRS A;  4GCK A;  3TED A;  3FRQ A;  2XB5 A;  1RES A;  2HQ5 A;  4MXM A;  3VW0 A;  2L7Z A;  3FK7 A;  1W0T A;  4ICH A;  3Q0U A;  2DMU A;  3FIW A;  5FKO A;  4ABZ A;  1WH7 A;  5IPA A;  1AKH A;  2NVT J;  1Y1W J;  3TW6 A;  5JLX A;  1WH5 A;  2FD5 A;  2NVY J;  1VF9 A;  2ID6 A;  5C3E J;  4W1U A;  1IRZ A;  1X58 A;  1JKR C;  2QTQ A;  2WB1 N;  2W48 A;  5F0C A;  2TRT A;  2NP5 A;  3HM5 A;  2ZB9 A;  3NI7 A;  1MBG A;  5IYB J;  1IUF A;  4CYC A;  3CWR A;  4A3C J;  2EZK A;  3S17 J;  2YS9 A;  4JP0 A;  1NK2 P;  3GTQ J;  5J3L A;  1JJ6 C;  2R92 J;  3HOV J;  2I10 A;  4JYK A;  5IOZ A;  2XGE A;  2DTZ A;  2QKO A;  3HOX J;  2M0C A;  2B63 J;  3GTG J;  2XGD A;  2E19 A;  1JKO C;  1I6H J;  4GFB A;  1U9O A;  3O60 A;  3GTO J;  2DA1 A;  4CGR A;  2NS8 A;  1BW5 A;  2UXI A;  3BQY A;  4AYB N;  5EF6 A;  3ZQH A;  1YRN B;  3QKX A;  2KT0 A;  2H1K A;  3LOC A;  3CJD A;  1JUP A;  1PUF A;  2WV1 A;  1FIA A;  4DYQ A;  5M5X J;  3PO3 J;  3GBG A;  2E2J J;  1RPW A;  2Y2Z A;  4MFE A;  3HGY A;  2R5Y A;  3HOW J;  4HKU A;  4D7N A;  2G0E A;  3JRD A;  1VND A;  1ZR4 A;  4V2G A;  3E7Q A;  4GFK A;  1B8I B;  2ZCN A;  4M3G A;  2ZCM A;  1P7I A;  1D5Y A;  1ORK A;  3C2B A;  2LY9 A;  3ZQG A;  3WHC A;  2R0Q C;  3HDD A;  4M3F A;  4MFD A;  1WI3 A;  2NVQ J;  5HAW A;  3BTL A;  2NOG A;  3AQS A;  2ME0 A;  3JRB A;  1ZGW A;  3BJB A;  4BBR J;  3LHQ A;  5J1Y A;  1RET A;  1P7J A;  3BT9 A;  2WAQ N;  3KKD A;  1K61 A;  3CRJ A;  4S0H B;  1ETQ A;  3LSJ A;  2GFN A;  4GCL A;  1Z0X A;  1IGN A;  2YVH A;  3CMY A;  3EGQ A;  1XS9 A;  2VUM J;  1UMQ A;  2K40 A;  5E3M A;  5EG0 B;  5CW8 A;  1FTZ A;  4M3D A;  1XG1 A;  2FBQ A;  3ANG A;  2DG7 A;  3K7A J;  4A3D J;  2N8G A;  2D5V A;  3GTL J;  3A01 A;  4JKZ A;  5HOD A;  3BR2 A;  2LP0 A;  2AHQ A;  2HI3 A;  3VP5 A;  4HNV A;  2FJ1 A;  1LFB A;  2KDZ A;  3MKL A;  1U8B A;  3HTJ A;  4JNN A;  1H89 C;  2Q24 A;  1MSF C;  3PO2 J;  2MW8 A;  5GPA A;  1ZR2 A;  2QIB A;  1JJ8 C;  5F27 A;  2FX0 A;  2ZOY A;  5F08 A;  5IP6 A;  4NDL A;  2L7M P;  2YU9 J;  3VVZ A;  1UI5 A;  3OIO A;  1JUM A;  3VVX A;  3S1R J;  2Y9Z A;  3HIM A;  1SGM A;  2HOS A;  4L62 A;  2RAS A;  3QPS A;  2GM4 A;  3SJM A;  3UKG A;  4L5E A;  2NS7 A;  4ACI A;  3B6A A;  1QVT A;  2JWT A;  4QTR A;  3M3Y J;  3VVY A;  2YUS A;  4G12 A;  3QQA A;  4C3J J;  1ITY A;  1MBF A;  3M4O J;  2G7L A;  1MNM C;  3C07 A;  5EZH A;  3B81 A;  4FIS A;  4BY1 J;  2HYT A;  2P81 A;  3F1B A;  1DU0 A;  3NPI A;  2OPT A;  1FTT A;  3L1P A;  3IH4 A;  4FTH A;  3BNI A;  4I6Z A;  2GEN A;  2D6Y A;  2AO9 A;  3Q3S A;  3G1L A;  2E1O A;  1VFC A;  4UUS B;  3JRG A;  4M6V A;  3BR0 A;  5FKK A;  3NRG A;  2VI6 A;  1BA5 A;  2Y9Y A;  2R5Z B;  3CQZ J;  5FJ8 J;  2JA8 J;  3Q0W A;  3JRE A;  3HBL A;  3NXC A;  4MLO A;  5C44 J;  1TWG J;  3RQI A;  3V78 A;  1AU7 A;  3FIS A;  1MH3 A;  5IP9 J;  2DMP A;  2X9D A;  1ZTR A;  1FJL A;  2R93 J;  2CRG A;  4BBS J;  4B3A A;  3T6N A;  3E7L A;  4B1R A;  4JL3 A;  2ZCX A;  1LFU P;  4D5C A;  3RKQ A;  2DN0 A;  1IV6 A;  2O7T A;  5AQC A;  4C3I J;  4UUT A;  2HXI A;  4IHW A;  2HOA A;  1IDY A;  3JRF A;  1QVU A;  4BXX J;  5HBU A;  2DJN A;  3LNQ A;  3S5R A;  1U78 A;  5F0F A;  3RZD J;  3ON4 A;  1OJL A;  1JKP C;  4IHV A;  2L9R A;  1BJZ A;  3TP3 A;  2UXP A;  1HDP A;  2XPW A;  2L7F P;  5IYC J;  2JA6 J;  5CXG A;  4EEF G;  1MBE A;  1O4X A;  4A3I J;  3DPJ A;  2HKU A;  5D19 A;  3BG3 A;  5E3O A;  2VKE A;  1MBJ A;  5K7H A;  2LR8 A;  1JT6 A;  3O8H A;  5EG0 A;  3PPB A;  4FCY A;  4W97 A;  4M3E A;  1A5J A;  3COL A;  4A3E J;  4XID A;  1ETW A;  1T56 A;  1H8A C;  4GCT A;  3G1O A;  3MNL A;  3HTH A;  5FKN A;  1BW6 A;  1WGX A;  3G1M A;  4A69 C;  1B72 B;  1HOM A;  3IV5 A;  4A3B J;  1OCT C;  2M8G X;  2EZL A;  3RZO J;  2XSD C;  1U9N A;  2CJJ A;  3TP0 A;  2XPV A;  2PZ9 A;  1DU6 A;  3LSG A;  4XK4 A;  1EF4 A;  3B6C A;  2LD5 A;  2RAE A;  2LKX A;  3BR5 A;  3ANP A;  1ENH A;  3I4N J;  3JRI A;  1OFC X;  2XDN A;  1RKW A;  3QBM A;  2OI8 A;  3D1N I;  5FLV A;  2R7Z J;  4AC0 A;  2LTP A;  1F43 A;  2W53 A;  3OOU A;  2M2E A;  2X48 A;  1APL C;  2DG8 A;  3NNR A;  5J1R A;  1UI6 A;  2K9Q A;  3ZQC A;  1LE8 A;  4XRM A;  1ETK A;  1IJW C;  3S1Q J;  2O7O A;  2RHA A;  4QIW N;  3KKC A;  2CQX A;  1G2H A;  2PBX A;  5D1R A;  4J19 A;  2GLO A;  1ETY A;  2LK2 A;  1F36 A;  2K9N A;  1GV2 A;  1POG A;  2DMT A;  1RR7 A;  2MG4 A;  5GP9 A;  4C2M J;  1ZKG A;  3O8G A;  3G7R A;  2JA5 J;  5FHP A;  4D5F A;  1ZK8 A;  5EGO B;  2DA7 A;  4QSH A;  3LSP A;  2CUF A;  2ELK A;  2HYJ A;  3S2D J;  5DAJ A;  4UUS A;  3HTI A;  3MN2 A;  3A03 A;  2Y0S N;  5C4J J;  4D7M A;  2DA5 A;  3LJL A;  3HEF A;  2JN6 A;  2MSY A;  2EBI A;  2R5Z A;  5FKL A;  1QRY A;  5E3L A;  1MH4 A;  1WCM J;  3BG5 A;  3S14 J;  2Y30 A;  5EFY A;  3PAS A;  5IYD J;  1GVD A;  5FMP A;  3BQZ A;  1SAN A;  5GPC A;  5DS9 A;  3LWJ A;  3ZQF A;  2CU7 A;  1IG7 A;  3JRA A;  3BR3 A;  2UXU A;  4RDU A;  2WUI A;  2HXO A;  1JTX A;  2UXH A;  3VIB A;  4JX4 A;  1NK3 P;  3S16 J;  3BR6 A;  1FIP A;  1YRN A;  2E2I J;  2NP3 A;  3VW1 A;  2VKV A;  2DA6 A;  2MGQ A;  1JUS A;  1E3O C;  2LVS A;  1GUU A;  4FE4 A;  2QCO A;  2V57 A;  3P9T A;  5F04 A;  4AC6 A;  1ETX A;  4IHX A;  1K83 J;  3RH2 A;  1SFO J;  3VPR A;  4DW6 A;  3SFI A;  2M34 A;  3V6G A;  3GEU A;  3A02 A;  4JX6 A;  1GV5 A;  3SDG A;  5BNG A;  2K9S A;  5M5W J;  1X2M A;  1B8I A;  2E2H J;  5IOY A;  2UXO A;  4ME9 A;  2HDD A;  1RKT A;  3RD3 A;  5F0H A;  1GDT A;  2G7G A;  2M9H A;  2IAI A;  4M3B A;  3JRH A;  4B4C A;  1T33 A;  1I50 J;  4UDS A;  2TCT A;  1B72 A;  1Z77 A;  2WGB A;  4RBO A;  1CQT A;  1BL0 A;  3CCY A;  3CDL A;  5F1J A;  1VI0 A;  3HKZ N;  2DMN A;  2VPR A;  2EQR A;  3F0C A;  1HF0 A;  1XC5 A;  3K2A A;  3QPL A;  3W6V A;  4A3M J;  4MIM A;  4XIC A;  4A3F J;  3GTP J;  2ECC A;  5C4X J;  2XRL A;  2FQ4 A;  2JMW A;  1HCR A;  5D18 A;  2Y31 A;  3KZ9 A;  3HOY J;  1AKH B;  2NX4 A;  2XB0 X;  2QWT A;  3NAR A;  5M5Y J;  5HSZ A;  2JJ7 A;  2LLK A;  4IHY A;  5IP7 J;  1WPK A;  3GTM J;  3HOU J;  3PM1 A;  4MO7 A;  4C3H J;  3GTJ J;  4A3L J;  2JA7 J;  5K7F A;  4IEJ A;  5EDN A;  1Y1V J;  4CYC B;  5K7Z A;  2G3B A;  2GBY A;  1TWH J;  3VOX A;  3HTA A;  3BHQ A;  1ETV A;  2XGC A;  1HDD C;  3NAU A;  4DZJ A;  4Y52 J;  3IH3 A;  1TWC J;  4V2F A;  4DZP A;  4X6A J;  5FLM J;  1OCP A;  4PXI A;  5M3F J;  2ECB A;  3VOK A;  1Q1V A;  5CXI A;  5K58 A;  5EGO A;  2IEK A;  4GFL A;  3HB9 A;  2JK3 A;  2NVX J;  2G7S A;  3ZQI A;  3GTK J;  4AUX A;  3G56 A;  4A3K J;  3AQT A;  2QOP A;  1PUF B;  1GT0 C;  3EUP A;  3BCG A;  4XRS G;  1MBH A;  1UG2 A;  3S2H J;  1TWF J;  3FK6 A;  4A93 J;  5EZG A;  3OSF A;  1A6I A;  9ANT A;  3H0G J;  3KNW A;  4A3G J;  2DA2 A;  4NEL A;  1TC3 C;  2R5Y B;  2IU5 A;  3BRU A;  4MK6 A;  3GZI A;  1JKQ C;  4JX5 A;  5M3M J;  1UHS A;  4LOC A;  3JR9 A;  3ON2 A;  3FKI J;  1JTY A;  4NN1 A;  3IUV A;  1FEX A;  3VUQ A;  3BR1 A;  4A3J J;  3Q0V A;  2X6O A;  2PMZ N;  1W0U A;  5EYR A;  2OF7 A;  1R9T J;  2O9L A;  4Y7N J;  1NTC A;  1IDZ A;  2COB A;  1IC8 A;  3TW7 A;  4AF5 A;  3ZQL A;  1ETO A;  2YVE A;  2O8K A;  3BTI A;  3I4M J;  3S1N J;  3HE0 A;  2REK A;  1HLV A;  5JLW A;  1JGG A;  5H9T A;  2F07 A;  3LSR A;  1S7E A;  2ZOZ A;  1AHD P;  2L0K A;  3HOZ J;  2IBD A;  4DYC A;  1ZQ3 P;  3S15 J;  1MSE C;  1MBK A;  4BY7 J;  3MVP A;  5EEA A;  4KWA A;  5E3N A;  3ZOB A;  2DMQ A;  2EZI A;  1X2N A;  4X1E A;  2EZH A;  2OER A;  2HOT A;  3OSG A;  1LE8 B;  4I76 A;  4DYR A;  3DCF A;  1JT0 A;  3A01 B;  5FGL A;  5FKM A;  5C4Y A;  1QPI A;  2DA3 A;  2ME6 A;  3IH2 A;  5DTD A;  2H8R A;  3BTC A;  3JRC A;  1H88 C;  2ID3 A;  5J1U A;  3JSJ A;  3WHB A;  2GUH A;  2DA4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...