5GPAA

Structural analysis of fatty acid degradation regulator fadr from bacillus halodurans
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
193
structure length
189
Chain Sequence
b'KKKGPKYDQIIDAAVQVIAEHGYHQAQVSKIAKAAGVADGTIYLYFNNKEDVLISLFQEKMGRFVDKIRSQMNEATDVEEKLKILVNMHFKQLAADHKLAIVTQLELTELALKINEVLKGYLNLLDELLMEGKEKGYFFQELDTRLARQMIFGTLDEVVTNWVMKDCKYDLTALVKPVHQLLLGGLRHR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator (TetR/AcrR family)
publication title Structural basis of operator sites recognition and effector binding in the TetR family transcription regulator FadR.
pubmed doi rcsb
source organism Bacillus halodurans (strain atcc baa-125 / dsm 18197 / ferm 7344 / jcm 9153 / c-
molecule tags Transcription, dna binding protein
total genus 73
structure length 189
sequence length 193
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08359 TetR_C_4 YsiA-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 5gpaA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 5gpaA02
2VUMJ 1ENHA 1WCMJ 4B4CA 3HIMA 1VF9A 3AQSA 1MBGA 1BL0A 2HYTA 2R7ZJ 3KKCA 3VVZA 1GUUA 3O8HA 4CGRA 3TP0A 3SDGA 3I4NJ 2K9SA 3LHQA 5IOYA 4XICA 3VOKA 4A3DJ 3MKLA 2HOTA 4IHWA 1OCPA 4XIDA 4G12A 2ECBA 2X6OA 1JKRC 2UXHA 2WB1N 3BTIA 1ETVA 1FTTA 5E3LA 2KT0A 3S1NJ 4C3IJ 3TW7A 1NK3P 1D5YA 4XK4A 3M4OJ 2G3BA 3GZIA 3O60A 5FKKA 2COBA 3BNIA 2XDNA 1Q1VA 1FJLA 3V78A 2VKVA 1ORKA 2GLOA 2DMTA 3LSPA 3OSGA 3IH2A 1Z77A 2EZKA 3QBMA 4AC6A 3LOCA 2QF7A 2PBXA 1MBHA 4UUSB 2R93J 3HEFA 5EDNA 1RKTA 3TEDA 3A01A 3S14J 1ZQ3P 2D6YA 3B81A 5AQCA 4BKXA 5C4XJ 4JYKA 1ZR2A 3GEUA 2KDZA 1QRYA 3K7AJ 4MO7A 4BY1J 3COLA 2NVQJ 2RAEA 5M5WJ 3QPSA 3HTIA 2OPTA 3RZDJ 4A3JJ 1QVUA 3S17J 5FLMJ 3JRIA 2HOAA 2P81A 1Z0XA 1B72B 2M9HA 2O8KA 4A3FJ 3ZQLA 1PUFA 1JKOC 2O9LA 2DG7A 3BTJA 2LR8A 4ME9A 2HXIA 2DA3A 2NP5A 1LE8A 1H88C 1IV6A 4LOCA 2DN0A 1LFUP 2OI8A 2LVSA 1WH7A 2ZCXA 5CW8A 4NDLA 1BJZA 1SANA 5C4JJ 1GV5A 2R5YA 2GM4A 3BJBA 2QWTA 1OFCX 2XPVA 4RDUA 5EF6A 1VNDA 1R9TJ 3L1PA 1AKHA 3BR6A 5M3MJ 2CJJA 2UXUA 1GVDA 4AC0A 3G56A 4AUXA 3K2AA 2F07A 1UI6A 3FK6A 4C3JJ 3GTPJ 5C44J 3S2DJ 2RHAA 1Y1WJ 3HDDA 3QQAA 5EEAA 3FK7A 2MSYA 1A6IA 1T33A 4CYCA 1NK2P 2NX4A 2OERA 2GENA 2EH3A 4JP0A 4M6VA 1IDYA 3M3YJ 4ABZA 4A3MJ 1P7JA 3VP5A 3C2BA 3BQZA 2Y31A 2G7SA 3RZOJ 3A01B 2HYJA 4NELA 3ZQGA 4DW6A 1B8IA 1X58A 2FQ4A 2ZCMA 3UKGA 1HOMA 2LTPA 2NS7A 1MBFA 4X1EA 3FRQA 4W97A 2GBYA 5FKLA 4JX4A 3BG9A 5EGOB 3HOUJ 1IGNA 1S7EA 1CQTA 3BG3A 2X9DA 2ID6A 1JTXA 1HCRA 1I50J 3OSFA 2JA7J 2FD5A 3F1BA 1XG1A 5IP9J 5DAJA 1HF0A 3EUPA 1MBKA 1GDTA 1LE8B 1MSFC 2HXOA 2M2EA 4MK6A 1W0TA 3ANGA 4UUTA 1TWGJ 1UI5A 3ZQFA 3DPJA 1JUPA 2MG4A 3BR3A 4IHVA 4A3LJ 4JNNA 4GCLA 1BW6A 2L0KA 3NAUA 4V2GA 3LSJA 3Q0WA 1MSEC 2I10A 1ETOA 3ZQCA 3JRGA 2UXIA 3KZ9A 1TWHJ 3HOWJ 3A02A 2DJNA 4FTHA 2IBDA 4C3HJ 4NN1A 3JR9A 5D1RA 2DMNA 2HKUA 4GFLA 5EG0B 5J3LA 3S1RJ 3HOXJ 4Y52J 3KNWA 1P7IA 2Y2ZA 4RBOA 1BW5A 3LWJA 3G1LA 4MFEA 1WH5A 4BY7J 4QTRA 2LFBA 2CUEA 4XRSA 2HOSA 1EF4A 3S2HJ 2L7ZA 2DMUA 2XB5A 2ME6A 3GTMJ 3F0CA 4W1UA 1MBEA 1IG7A 1A5JA 2DA7A 1HDPA 1ETQA 2LLKA 3JREA 1XC5A 2G7LA 4IEJA 1ETKA 1IUFA 5BNGA 1AHDP 3BRUA 1JUMA 5GP9A 4C2MJ 3SFIA 2LK2A 4EEFG 1U8BA 3JSJA 4ICHA 4M3DA 4QIWN 5FGLA 4M3BA 2LP0A 3GTJJ 2JWTA 4A69C 5HAWA 3GTOJ 5FLVA 5HSZA 3HGGA 5C3EJ 3NRGA 1H89C 2EZHA 2K9QA 4M3FA 2Y9ZA 1RKWA 5J1UA 5CXIA 1UHSA 3LSRA 3PO3J 1Y1VJ 1I3QJ 1JJ6C 3S1MJ 1GT0C 2ZCNA 3JRFA 4GFBA 2R5ZA 1BA5A 2GUHA 2RASA 3JRDA 5IPAA 2E2HJ 2UXOA 5JLWA 2YU9J 3BHQA 3LNQA 3DEWA 5FKMA 2LY9A 2M8GX 3BR5A 4S0HB 2XGEA 3ZQIA 4HNVA 3MNLA 3GTQJ 2V57A 3HOVJ 1APLC 2Y0SN 5GPCA 3G1OA 5EFYA 3V6GA 1E3OC 3WHCA 5F08A 2YVHA 4YZEA 2JJ7A 1F43A 2VKEA 3Q0VA 3CRJA 3O8GA 1TWFJ 4FCYA 2CQQA 1ETXA 2TCTA 2E1OA 2ZOYA 3CDLA 1LFBA 4Y7NJ 3ON4A 2XPUA 3B6CA 3H0GJ 2G0EA 2FX0A 4FE4A 3IH4A 2L9RA 3HKZN 5JLXA 1IJWC 1YRNA 3RH2A 4I6ZA 3LJLA 1ZTRA 1WPKA 1FEXA 3Q3SA 1DU6A 1JGGA 2K9NA 2ZOZA 5FMPA 3BCGA 5M3FJ 2FJ1A 5IOZA 2JA8J 2O7TA 1HLVA 2JMWA 3T6NA 3OIOA 4FE7A 3Q0UA 3NPIA 3QPLA 5M5XJ 5F0CA 3RD3A 5H9TA 4A3IJ 1IDZA 5IP6A 3FKIJ 3BR0A 1MH4A 3VVYA 3GTKJ 1MH3A 2NS8A 3BQYA 3IV5A 2R5ZB 1PUFB 4A3GJ 1ETYA 2MW8A 1K61A 1ZK8A 2OF7A 5IYDJ 2HQ5A 4MXMA 5CXGA 5HBUA 4UDSA 1JUSA 3C07A 2NP3A 3H3VK 5EYRA 2GFNA 3VVXA 5F04A 3MN2A 1FIAA 3D1NI 3CWRA 5E3NA 2O7OA 3PPBA 2R5YB 1OCTC 1QVTA 5IYCJ 2H1KA 1AU7A 4AYBN 1I6HJ 3BR1A 5IYBJ 1AKHB 2ZB9A 3HTJA 1UG2A 1HDDC 2WGBA 3CJDA 1ZGWA 2LKXA 2IU5A 2VI6A 2DA6A 5M5YJ 3S16J 4A93J 2QOPA 2G7GA 3P9TA 2EQRA 4FISA 5E3MA 4J19A 2JN6A 2MGQA 2XPWA 4CYCB 5J1RA 3DCFA 3HBLA 3ZOBA 3ON2A 1SFOJ 2NVXJ 1WI3A 1JT0A 3QKXA 5K7HA 4GCKA 1SGMA 2ELKA 1K83J 1W0UA 4IHXA 2CU7A 2PZ9A 1O4XA 2AO9A 2DMPA 1B8IB 3MVPA 5F0FA 1DU0A 1B72A 2UXPA 3BTLA 1ZR4A 5FJ8J 1G2HA 3IUVA 1UMQA 2DA1A 4BBRJ 2W48A 3HOZJ 3HE0A 2HI3A 5J1YA 1U9OA 2WAQN 3ZQHA 2DG8A 4V2FA 3GTGJ 2FBQA 3S5RA 5DTDA 1RR7A 1ITYA 4M3EA 2JK3A 4BXXJ 2DA2A 3ANPA 1QPIA 4DZJA 4DYCA 5K7ZA 3VW0A 1FTZA 3JRBA 3IH3A 4DYQA 1MBJA 3HB9A 5K7FA 2R92J 3RQIA 3HOYJ 3VOXA 2E2IJ 3KKDA 3GTLJ 2EZLA 2HDDA 5DS9A 1JKQC 3E7QA 1TC3C 2E2JJ 3GBGA 3B6AA 5IP7J 4KWAA 3W6VA 2Y30A 4D5CA 2LD5A 5GPAA 2REKA 4JL3A 5D18A 1JKPC 1TWAJ 5F1JA 2CUFA 3A03A 2EZIA 5F27A 3TP3A 5EZGA 2DMQA 2EBIA 1FIPA 2XGDA 4A3CJ 1JT6A 2JA6J 3CCYA 2L7MP 3CQZJ 4D5FA 2JA5J 3LSGA 3FISA 2W53A 4X6AJ 3TW6A 5C4YA 4B3AA 5EGOA 1X2NA 1JJ8C 3HGYA 1VI0A 2ME0A 2ID3A 4JX6A 2AHQA 3G7RA 2K40A 4GCTA 1NTCA 3OOUA 5EZHA 5F0HA 2H8RA 5FKNA 1ZKGA 3PASA 3BG5A 1XS9A 3JRCA 1T56A 1ETWA 4A3BJ 3JRAA 1RETA 2Q24A 5FHPA 3VW1A 1H8AC 3G1MA 1TWCJ 3VW2A 4I76A 3NNRA 2CRGA 2DA5A 2XSDC 3EGQA 3NI7A 1MNMC 2WUIA 2R0QC 4MFDA 2QIBA 4ACIA 3PM1A 2NVYJ 3HM5A 4L5EA 3SJMA 5E3OA 1RESA 3JRHA 3I4MJ 4MIMA 2NVTJ 4A3EJ 2XGCA 3RKQA 2YUSA 2XRLA 2B63J 5EG0A 2XB0X 1VFCA 2TRTA 2CQXA 1U78A 5HODA 4D7NA 5K58A 1RPWA 2QKOA 1X2MA 2D5VA 3VIBA 5FKOA 4JX5A 4B1RA 3AQTA 2E19A 4QSHA 2DA4A 3CMYA 2YVEA 2M34A 1POGA 4MLOA 3PO2J 1IRZA 3VPRA 4PXIA 3E7LA 2WV1A 1U9NA 2PMZN 4GFKA 4XRMA 1WGXA 2L7FP 2VPRA 4M3GA 4UUSA 2QCOA 4IHYA 3BR2A 4AF5A 2ECCA 3S15J 4DYRA 3WHBA 4A3KJ 4D7MA 3FIWA 2X48A 1F36A 3S1QJ 2QTQA 2N8GA 2YS9A 2IEKA 4DZPA 3NARA 4XRSG 5D19A 1GV2A 2M0CA 1JTYA 3BTCA 1YRNB 4BBSJ 4HKUA 9ANTA 1OJLA 3HTHA 3VUQA 1IC8A 2DTZA 3HTAA 2Y9YA 3BT9A 2NOGA 2IAIA 4L62A 4JKZA 3NXCA
chains in the Genus database with same CATH superfamily
1E2XA 5HNHA 3HIMA 2BY3A 3AQSA 1MBGA 2KQRA 3VYSB 3VVZA 1MJBA 2JPCA 2OQRA 3LHQA 5IOYA 4XICA 4A3DJ 2B1EA 3M1CA 6PAXA 5HNFA 2UXHA 2FEZA 1K4SA 1A36A 2LY1A 4MTDA 4HDUA 4YFKF 3KP2A 1JI8A 1NK3P 4XK4A 4RLQA 3GZIA 3R4KA 5FKKA 2I5UA 3E6BA 2XDNA 2IS1A 5EJCA 2BOLA 2Q8KA 4KICA 2VKVA 1KA8A 3KEQA 2XROA 2KRCA 3I0TA 1FYLA 2H6BA 1MBHA 2D1HA 2Y75A 4BJ6C 3HSFA 3TEDA 3BG6A 2FE3A 2E1MC 5FO5A 4LLLA 3S14J 2HVQA 4Y3OA 3PQJA 4BKXA 5C4XJ 3QRFF 1R49A 2PLYA 4CSWA 3I64A 3GFJA 3F9KA 3QPSA 2M30A 1C0WA 3OYBA 1LJ9A 2KJBA 4A3JJ 4HG2A 4YIFA 3LFKA 3VFZA 3S17J 4D1QA 2R7WA 5DYMA 1D1AA 4BHPA 2E36A 2M9HA 1JKOC 2EFQA 3C7JA 3ZQLA 1PUFA 3V7RA 4RGRA 4ME9A 2XC7A 1N75A 2DA3A 1LE8A 1H88C 1IV6A 4LOCA 4MEXF 4ZYAA 3R60A 3K4JA 1O3RA 1N78A 2IP2A 5CW8A 2R5YA 3NRVA 1ZLKA 3FBNB 3EYYA 2O3FA 4EJWA 1VQPI 5EF6A 4A2UA 4G94A 3ABKH 4WIBA 1AKHA 2JSPA 3LAJA 4PUSA 4XOTA 1X1BA 2VODA 3SZTA 3S3OA 3GTPJ 4ESBA 3P5JA 3J81K 2GIVA 2MH9A 1OCCH 5EEAA 2ZJRF 1J2XA 2KP6A 4E70A 4L0YB 3OYNA 1JGSA 3ML6A 1BI0A 1IN5A 1T33A 2MSYA 1EV7A 2NX4A 2OERA 4F52A 2COMA 4M6VA 3BP8A 2MH2A 1P7JA 2ZO4A 5E79C 3BQZA 5J47A 1HKSA 5IT3A 1IXRC 2G7SA 4I0AA 2ZSIB 1B8IA 3P9IA 4OMZA 3KP5A 1HOMA 5CVIA 4X1EA 4GO1A 4DIQA 1FOWA 3FRQA 4W97A 5TISC 5FKLA 2R7QA 3BG9A 3HOUJ 4ZDLA 1IUYA 3OYDA 1EA3A 1JTXA 1T38A 4KUMA 2DFHA 2VBXA 2FD5A 1XG1A 4KYWA 5IP9J 3AKZA 3EUPA 3LWFA 1MBKA 1LE8B 1MSFC 2HXOA 4MK6A 3WTZA 4UUTA 1WRJA 2A2FX 3GF2A 4A5MA 1UI5A 3ESWB 3LSIA 4NQWA 4CDGA 5HS8A 2MG4A 3ZPLA 4AIKA 4GCLA 3OYFA 5K5OA 4BE2A 2XAQA 2K5CA 1BW6A 2I10A 1ETOA 3ZQCA 1WSUA 1V5EA 1F4KA 2P6SA 3TOBA 3HOWJ 4H0EA 2DJNA 3IL2A 1UELB 1BI2A 2F4IA 3GZ5A 3QOPA 2WY8Q 5B1AH 3CC7I 1SAXA 3JR9A 5D1RA 3I59A 1J0RA 3L09A 2KZVA 4EM2A 5J3LA 2M3AA 1XGMA 3TO6A 3BZCA 1T39A 1Z3YA 4RBOA 3DQVC 1BW5A 3LWJA 5LHGA 4QTRA 1QQIA 4XRSA 2P0WA 1RRJA 4Z6YA 5FLXK 2ZC2A 2DMUA 2ME6A 1O3QA 2L9VA 2DXIA 2K9LA 5TGTA 5JFRA 1LQ1A 3U21A 3RPUD 2K9MA 1ETQA 2VE8A 1XC5A 2E5NA 4KMFA 2G7LA 3L2QA 1IUFA 3DU6A 4HAMA 1TTYA 1XMXA 1HW5A 4C2MJ 2LK2A 3W2WA 2Q1ZB 2LP0A 4EATA 1XPXA 2V26A 3DP7A 2IGMA 2IJLA 3BJ6A 4HX4A 1FPQA 4M71A 3HUGB 5C3EJ 3S8PA 4ZYHA 4U9LA 3L00A 3FHNA 5CXIA 1UHSA 5DCMB 1Y1VJ 2KRFA 3BG7A 3S1MJ 2BBYA 2E1NA 3WODF 1IV8A 3HC7A 3JRFA 5EEHA 3FF5A 1SMYF 3F22A 3F6VA 3V8JA 2QENA 2R5ZA 2CGPA 5IPAA 3D0SA 3KZZA 4Z2YA 1D1CA 4FQGA 2YU9J 3D5RC 3TL4X 2KDOA 4LG0A 2DYRH 5IY5H 2FNAA 2HDWA 5FKMA 2LH9A 2LY9A 2M8GX 3BY6A 1BC7C 5E1XA 2DBBA 3KEYA 4CHUA 1NG7A 1R22A 1APLC 2Y0SN 5EFYA 4UUVA 2YVHA 1F43A 1SFXA 3N97A 2JVGA 3K1PA 3DKYA 2CQQA 3ZCOA 2TCTA 5EEGA 4DQ2A 1KU9A 4U0WA 4Y7NJ 3MZYA 3ON4A 3T8RA 3SQNA 2CV0A 1IN7A 2L3DA 2FX0A 2L9RA 3HKZN 3HOSA 1IJWC 1YRNA 2IGNA 4I6ZA 4Q4ZF 2ADUA 2WADA 3HOTA 2VLAA 1KYWA 2GOXB 1WPKA 3Q3SA 3GFLA 4CXFA 4ZJZA 3AG2H 2YX7A 5FMPA 4GYIA 1O7FA 2EV6A 3BCGA 4ESJA 5M3FJ 2AXLA 2WBMA 2HTJA 1VQ7I 4O3MA 1UB9A 4KMUX 4C2UA 1ON1A 2L7KA 5H20A 2ZNZA 5F0CA 1WFXA 2LSOA 1MMGA 1R5GA 2FSWA 3ASNH 4OD5A 3VVYA 2R5ZB 5TRDA 5HBUA 2OF7A 2QLZA 1ONVA 2E5ZA 3T0YA 3H3VK 2GFNA 3VVXA 3CWRA 3MN2A 5ICGA 4I0BA 2G9WA 2O7OA 4RB2C 1OCTC 5IYCJ 1B9MA 1OKRA 1R4MB 2EV5A 3COAC 1XTAA 2UZKA 2WB1A 4IZZA 4UV9A 5IYBJ 1FSHA 2EILH 1RC9A 1UG2A 2W57A 1KU3A 2CO5A 3PFYA 1HDDC 4E7IA 2VPLA 2F48A 2LKXA 1G3YA 3HRUA 5ED4A 4M6YA 2LNBA 3EUKL 1FOKA 3CJTB 3RYPA 1K7AA 4A93J 1FY7A 3RPQA 4FISA 1B59A 1X4OA 2M7AA 3CCMI 4BNCA 3DPUA 3MQ0A 3HBLA 3ON2A 2R4GA 2NVXJ 1UHMA 2JQ7A 1W0UA 5KAIC 2K86A 3H1CA 5B66C 1FBUA 1R1VA 2F5VA 5F0FA 2DT7B 2IS6A 3DKWA 1X1DA 3BTLA 5LEJA 1MD0A 3CCQI 2LC2A 3IUVA 1TQMA 3K8PC 3KEOA 1GXQA 1YJWI 1TQIA 1Z7UA 2DTRA 1HC8A 2V1DA 2XRNA 5J1YA 2VXDA 3GX4X 2W1OA 4V2FA 2F5DA 3MKZA 2NRAC 1BI1A 3GTGJ 2FBQA 2VQCA 2VXZA 4M3EA 2JK3A 5KVRA 4BXXJ 3RI4A 1QPIA 3SZGA 2XAHA 1I3AA 1RR8C 1FTZA 1VTNC 1XB4A 2A05A 3ISPA 3ABTA 2Y69H 4DYQA 3HB9A 2LBFA 5KNLA 1DPUA 3KKDA 3NWSA 2EZLA 1JKQC 1P2FA 3ROUA 5DV5A 2ZXJA 3LSKA 2VJJA 3WE2A 4CGZA 3OYAA 2Y30A 2VBYA 2Y0SA 1WVRA 4D5CA 1B6AA 4LMYA 3WTSC 1X19A 2LD5A 3K10A 3ZMZA 2ZMEA 1F1ZA 1G6NA 2V1XA 3KYCB 2DMQA 1W1WE 3AFHA 4ESFA 1JT6A 3K4LA 3E5XA 3K9TA 1W7PA 2UUZA 5F64A 4L9NA 4BEHB 4X6AJ 3HKZA 4B3AA 3CD6I 2VQGA 2WAFA 3QPTA 5DM6F 2FF4A 1X2NA 2ZSHB 1J7KA 4LLGF 2QEXI 4BQOA 2ME0A 1ZLJA 4JX6A 3G7RA 1N77A 3F8CA 2R7XA 1R1UA 1A04A 1ZKGA 3C18A 1IRGA 3BG5A 2EK5A 5B1BH 1T56A 2A3SA 4ITVA 4LB6B 2PBIA 5H2FC 3HHGA 5FHPA 2GA2A 2X6YA 4EQQA 2HYFA 1TWCJ 3OOPA 2GIZA 2F5EA 2JRMA 4HW0A 2CRGA 2HKOA 4IOCF 2DA5A 1YW9A 5J4VA 3QP5A 2P7VB 3FXJA 4PFPA 1H0MA 4N9IA 2B3WA 4LB5A 2OUMA 2WUIA 4MEYF 4MFDA 3GLLA 1PP8F 3PM1A 2NVYJ 3ZGKA 3DTEA 3H9GA 5LGNA 3BLYA 3ZRGA 3JRHA 3WTUC 2YU3A 2ZCWA 1OISA 4A3EJ 2YUSA 3PL8A 1YW7A 2XRLA 3O2PE 2B63J 5BOXA 3RKWA 4E7SA 2DOEA 2CQXA 3OYEA 5HODA 1U78A 1G59A 2O6GE 3OYLA 1RPWA 3H5AA 4AIDA 4XONA 5BPDA 2QBYA 1W7PB 3U9GA 5JVTA 3KETA 2M34A 1ZG3A 3MKYB 4L9VA 1RNLA 4PXIA 2DK5A 1XSVA 3QOEA 4V19K 4XRMA 3J80K 1VQ6I 2L7FP 3FX3A 3HRMA 4M3GA 3ZMSA 4UUSA 2QCOA 4NC6A 3E0JB 5CVJA 2Q2EA 3WHBA 2CUJA 4U0VA 1F36A 4ZZDA 2MD0A 2YS9A 2XUBA 4HKUA 3DKXA 2ZKZA 3R0AA 2VC1A 2OV7A 1BIAA 1SVOA 4Y13A 3HTHA 3V8LA 4YELA 3FXRA 2Y9YA 1R4NB 5AIPA 1ENHA 3P9KA 4B4CA 4BXFA 2R7ZJ 3PQKA 4IHTA 3DF8A 2DO7A 2E35A 3O8HA 1N25A 4AD9A 2BY0A 3I4NJ 3SFZA 1KQ8A 4LLNA 2HOTA 4IHWA 1OCPA 4XIDA 4G12A 3WG9A 1TT5B 4ENKA 2LDUA 4HOBA 3U1KA 2ZXWH 1IN4A 1FTTA 5E3LA 2KT0A 2A5WA 3S1NJ 4Y15A 3EUHA 3SZPA 2ZNYA 1FMVA 2RQPA 3O60A 2CV2A 4HSTA 3RYRA 1Q1VA 2H6CA 3EYIA 1ZN2A 1I1SA 3V78A 1QZEA 3HTSB 1OLTA 3M9AA 1VQMI 2GLOA 3KCCA 3GW2A 3OSGA 2ICWG 2EZKA 1HSJA 4P96A 4PSWA 4PK4A 2PBXA 4UUSB 3HEFA 3RQ4A 3TOAA 1O3TA 2WA0A 3MKWB 3G6EI 2Q2EB 3VOEA 3B81A 1A6QA 5B3SH 3DBHB 3E6DA 3TQNA 2DODA 3GEUA 2KDZA 3B73A 2J5OA 1QRYA 2HGCA 3MMYB 3COLA 1Y6IA 1OR7C 3VYTB 5D5VB 2FU4A 4IO9F 4LFUA 4HF0A 4QPOA 4C9YA 4XOPA 1MDMB 1T95A 4UVBA 1A31A 2HOEA 4G7ZF 2O8KA 2W25A 2O9LA 2ZJ2A 1R23A 3ONQA 1E3PA 2IW5A 2HXIA 2ZFUA 3TKYA 4XSZF 2DN0A 2HNHA 3WTXC 1LFUP 2OI8A 2LVSA 5E1ZB 2J5PA 1K6YA 4NDLA 1BJZA 1I39A 2CYYA 4WXHA 3LQRA 4RDUA 3I71A 1R6RA 2V9KA 3G3ZA 3DEEA 1USSA 5CVUA 3W2AA 2CW0F 2XKOA 4EJVA 4AIJA 2UXUA 4AC0A 4AUXA 3LAPA 2E71A 1YI2I 4UB8C 1UI6A 2Y48A 3ZP5A 3C2GA 3HPHA 5LEKA 2QKLB 3VSKA 1Y1WJ 3QQAA 3NWTA 3A4CA 5JHUA 1W7PD 5LHIA 1A6IA 4KIFA 2GENA 2EH3A 2FMYA 4JP0A 2F4MB 3T8TA 4A3MJ 3C2BA 5J40A 2Y31A 2P5LC 1CF7B 3VYRB 2EA2A 3KFWX 2KL4A 3DPTA 2CQNA 1X58A 2FQ4A 1FT9A 3FKJA 2ZCMA 1PVEA 2UV1A 2NS7A 5HLHA 2AQFA 3OMYA 4KIGA 4CH7A 4IRHA 2D1VA 2X1EA 2O8XA 1IGNA 4E6KG 3J81Z 4E7LA 1HW2A 2H8WA 2ID6A 3CUQB 3LA3A 3K4KA 4KFCA 3OSFA 2JA7J 2M8EA 3N05A 3CMEI 4NUBA 3FXKA 5DAJA 4NB5A 1GDTA 2IA0A 1P92A 3ANGA 2BY2A 2BHZA 4HRIA 1LKXA 1OYIA 3TO9A 4PJMA 3ZQFA 1Y39A 1JUPA 3BR3A 4JNNA 4UHTA 3DFGA 3JTHA 2NAZA 2XF7A 1LB2A 3K0LA 2L0KA 2FUG2 2VJIA 3NAUA 3Q9VA 1KU2A 1LNWA 2W84A 3W3CA 1MMDA 2WTEA 3JRGA 4E7HA 3KZ9A 1PYVA 4G6TB 5JR3A 3A02A 2EV0A 2ELHA 1D5VA 2O5RA 4U7DA 4C3HJ 5F1RA 3V7CA 4BHCA 4NN1A 4F91B 2H94A 1EKEA 2KFDA 3IWZA 3V7SA 5GTIC 1LPQA 1TP4A 4OWRB 1ZARA 2DMNA 5FB2A 2BHYA 3CJNA 4HF1A 3S1RJ 1XX5A 3IAS2 2PJRB 2Y2ZA 4MFEA 2LKSA 2VJ4A 3FXMA 2XAGA 1MIJA 2HOSA 2E60A 1EF4A 3OR1C 4DNCA 3WU1B 3FXLA 4W1UA 2DA7A 2PFBA 1BC8C 3M8FA 2HYGD 2CQKA 2R7SA 3LSMA 3BRUA 1FX7A 3DWLE 1E17A 5ICCA 2E34A 1U8BA 2LG4A 4ICHA 4Q5SF 2HZDA 1OCRH 3GFMA 3GTOJ 3IAM2 1ULYA 2NNYA 3K6GA 3HGGA 2HEOA 5CVVA 1H89C 2XASA 4M3FA 2IA1A 2Y9ZA 5J1UA 4MQ9F 5BPIA 3FM3A 4CCKA 5FLXZ 3PO3J 1USTA 1ERDA 2LY2A 1IN8A 3CZ6A 3M07A 2EWNA 3PFIA 3C2HA 3F3XA 2BXYA 4B47A 2RASA 2BZTA 1XMKA 2CFOA 4L9TA 1F9NA 1ZGAA 4KN4X 2NNNA 5JLWA 3HG9A 4ASNA 3LNQA 2RDPA 3DEWA 2PJPA 2LRDA 5BMZA 1FOYA 3GZNB 3F6OA 3D5SC 3CJRB 3HOVJ 4RB1A 1E3OC 3TDUC 2VOPA 5CYVA 1TLHB 2GQQA 3BCAA 3DTKA 1B4AA 4PFOA 3ZR8X 2O03A 2ZOYA 3RIRA 3E97A 1U5TA 2XPUA 1I27A 3E5QA 3ERED 3DV8A 2OTLI 1G8XA 3O3KA 1W4MA 3QODA 2JUCA 2W7NA 1Y8QB 1ZTRA 3I4PA 3W2VA 3VWBA 2Z2SB 4HF2A 1FSEA 4II3A 4LK0F 2BW3A 1J75A 4XKCA 4EJUA 1DUXC 1DU6A 1FYKA 1QPMA 3KLNA 2FBIA 3EUAA 2Z33A 2P6TA 2Z1DA 1X3WB 1R5HA 2CG4A 3L2VA 2L2OA 2JA8J 1HLVA 2JMWA 3H36A 3Q0UA 3FM5A 3QPLA 1WJDA 3TGNA 2JT1A 4RAFA 1IDZA 3GTKJ 1MH3A 2NS8A 3ZMTA 4A0ZA 3S93A 3IV5A 1PUFB 2RQQA 4A3GJ 3H35A 3RKXA 5IYDJ 1MNDA 5E8IA 2X4HA 2VBWA 3C07A 4CZCA 5GAEJ 2FNPA 3PNVA 5E3NA 3A2KA 4OIOF 2XSJC 3QAHA 4B48A 1VQ5I 4XLHA 1WKMA 2R5YB 3TMOA 4AYBN 2QM3A 3OY9A 2LREA 1ZREA 2P8TA 1AKHB 5DDGA 2DPDA 5L3BA 3CESA 4ZDOA 3I9V2 4XL9A 4JOMA 3CJDA 2JZYA 4S05A 3CF5F 1J09A 2A61A 5H6QA 3RKYA 3LMMA 4CCLA 2QOPA 2QQ8A 2BYVE 2EQRA 3W6KB 4KDPA 3P9TA 2PG4A 5CLSA 3IRRA 2XPWA 1KGSA 4ETSA 3DCFA 3CDHA 4YEJA 5J1RA 2EA4A 2M4KA 1SFOJ 1JT0A 3A0BC 5K7HA 3BWGA 2Z5UA 1SGMA 3BROA 2CU7A 3MAJA 4IQ4A 2EFPA 4WF2A 2BW3B 3OYGA 1B8IB 3QYEA 4ZYEA 1B72A 1OYYA 1GVJA 3VEPA 3ECHA 2IT0A 4EM0B 2P7CB 4FX0A 2W48A 1OYWA 4X0GA 3GFIA 2E7WA 2P5KA 2HI3A 4Y4RA 1X1AA 4J01A 1U9OA 3CC2I 1R58A 3L2WA 3S5RA 5CQEA 5DTDA 4XQFA 5JHFA 5D6FA 2ESHA 4PDKA 1O7LA 1W36D 1AOYA 1BJAA 1BM9A 2PEXA 2KJCA 4ENNA 4CYDA 1MBJA 2FBHA 3JAMK 3QU3A 3RQIA 4NQWB 3HOYJ 3MWMA 3I5UA 3A1YA 4PJLA 2CWEA 4IXAA 3CF2A 2E2JJ 3W6JB 4WCGA 1EH6A 1OCZH 5IP7J 4KWAA 1MNEA 1XCVA 2HQNA 4JL3A 5D18A 2K4JA 1XGSA 1H9GA 3CCEI 3IKVA 1U8RA 5F27A 1GHCA 4IRVA 4L5IA 3TP3A 3P7NA 2NXNB 2EBIA 1FIPA 4A3CJ 4EGYA 2M0MA 3S3MA 3AG3H 4UNOA 3GYHX 2Z9OA 1PJRA 4D5FA 3FXOA 2IS2A 3I59B 3U1DA 4P9UA 4OIQF 3TW6A 1IF1A 5EGOA 2FA5A 2B0LA 2FXAA 2VKDA 1JHHA 2Z99A 3CO6C 1Z67A 4IKFA 3HGYA 4BU2A 1H9TA 5D4RA 2ID3A 4BAYA 2FRHA 2CW7A 1OMIA 2OCCH 1R71A 2H8RA 1VQNI 3DPLC 2DCEA 3PASA 3FDYA 3JRCA 4E7ZA 4ZYGA 1MMNA 4A3BJ 1LUJB 1RETA 2XAJA 4XORA 1H8AC 4A5NA 3VW2A 2H09A 3OYMA 2MABA 4I76A 4BUPA 1R00A 5AONA 3GWZA 1FBSA 2R0QC 2QIBA 1RESA 1RZ4A 1ZRCA 2O61A 3WTYC 3CUQC 3ZQ7A 2MLKA 3FXUA 3VDXA 2XGCA 1YLFA 4NHJA 1NH3A 1MMSA 1SEUA 1DGWY 4G8XA 4BQNA 4RAGA 3LFUA 4I09A 4WXDA 5EG0A 1WQ2A 1VFCA 3IWFA 2HDCA 2XV4S 5K58A 3HXLA 1Z6RA 4PCQA 4FASD 3VIBA 5FKOA 4LG0B 4JX5A 4B1RA 4A12A 4LJZF 2OAZA 3KX2A 4N9HA 2DA4A 1W5TA 3PUFA 4N4OB 4YFNF 1POGA 1T98A 4MLOA 5LGTA 4D0PA 2C6YA 3BDDA 3PIOF 3KP4A 1U9NA 2PMZN 2OCEA 3WG7H 2ESNA 4IHYA 3BR2A 1KZHA 3S15J 4DYRA 4FHTA 1S3JA 5HLGA 4EV0A 4KA4A 1B1BA 2X48A 4P55A 3S1QJ 5E20A 2IEKA 1XMAA 2OC6A 5LBQA 2M0CA 2A07F 1SFEA 2Z3YA 1YRNB 4BBSJ 1VZ0A 9ANTA 2B7EA 4AU7A 1HA8A 3NEUA 2HFHA 3VUQA 2WY7Q 4PJNA 2DTZA 5KAFC 2IAIA 5HDGA 4L62A 2V9VA 2VUMJ 3J80Z 5GAHJ 4XLCA 2HYTA 3DLLF 3RJPA 2R7FA 4CGRA 4LIVA 4OU0A 3SDGA 2W24A 2K9SA 3VOKA 4ZH4F 4ZTJA 4R79A 4ZC3A 4BDYA 1JKRC 3J7YJ 1V3FA 3IP4B 1ETVA 3S32A 5HLTA 1RUOA 4C3IJ 1IAWA 2QQ9A 1D5YA 2G3BA 4GXOA 1FWZA 4F3QA 1DP7P 2R7VA 2XAFA 4RAZA 1FP2A 1ORKA 2JSCA 2RKHA 3KP7A 4FX4A 4BE1A 1Z77A 4DJAA 3QBMA 4XLNF 5HDKA 5L3EA 3LOCA 2QF7A 2ISYA 1RUNA 1HBXG 3OV8A 3V42A 1RKTA 3A01A 4UY8I 4XR6A 2ISZA 1Y56A 3J7ZI 4JYKA 1ZR2A 2IA2A 2NOJB 4MO7A 4BY1J 4XN3A 3HTIA 4EGZA 2OPTA 3QU6A 4WK8F 2HPMA 2R7UA 2GOMA 4KT6A 1W5CC 1QVUA 2UXNA 3F21A 2HOAA 2YVXA 3ABMH 5LRSA 1T2KA 1T8IA 3BTJA 3CMMA 2LR8A 5ILSA 3OS0A 2VN2A 1Z91A 2NP5A 5FGMA 2XGXA 4A0YA 1YIJI 2VC0A 2VT3A 4Y17A 1WH7A 3K1MA 1PDNC 4OD4A 1G3WA 1SANA 4F93B 5J6XA 2GM4A 2IPQX 5ICEA 4M6XA 3K70D 2XPVA 1VNDA 1R9TJ 2HVSA 3BR6A 4WXCA 1HKTA 1ZYRF 3HYIA 3IUOA 5GADJ 1GVDA 3WTTC 3OYIA 3G56A 1Z1DA 4PJJA 1M1EB 3WGIA 2DQLA 3FK6A 1IW7F 2LBFB 3RSNA 1OQYA 2A6HF 3REOA 4CCOA 5HOOA 1QA6A 5C44J 1P6RA 3S2DJ 1GXPA 2RHAA 4ANJA 3HDDA 3AG4H 2EJRA 4IJAA 3FK7A 1HW1A 3IC7A 2M5WA 1SVLA 3KYLA 4CYCA 1K78A 1NK2P 4HDVA 2ZMEB 3HSRA 4N0BA 2DT5A 1P4AA 3OWTA 4I01A 5J8FA 1HKQA 3TDZC 1D8KA 4CA0A 3A01B 4DW6A 4NELA 3GXOA 4AVPA 2LTPA 2CUZA 4O6JA 1QHHD 2R3SA 2A6TA 2DLLA 1D1BA 1S7EA 1T0FC 1YS6A 2JVHA 2X9DA 4ZDPA 3M8JA 1GLNA 3IKTA 1I50J 4E7JA 3F1BA 3K1NA 4BDZA 1YITI 1HF0A 1ACIA 4MTEA 4HX7A 3KE2A 2M2EA 1W0TA 1YX3A 1I5ZA 5D5XB 4DOZA 4IX7A 1TWGJ 3OYKA 4IHVA 3K4NA 2VOOA 1LDDA 2XHKA 3C3WA 3E6CC 4BQQA 2R7DA 3BZ6A 2BXZA 2QA4I 4V2GA 3ZN0A 1KONA 2GWRA 3LSJA 2RV8A 2ETHA 2PQ8A 3FHZA 1MSEC 2CMPA 2YSRA 4IVNA 1S5LC 2DU9A 2UXIA 3H5RA 4NBQA 3PJRA 2KHMA 2RREA 4RB0A 4CO8A 2RN7A 1S7AA 3M1EA 1MMAA 1YG2A 2F2EA 2R7OA 4XLAA 2RGVA 3PSFA 2ZXHA 4Y52J 1TW2A 1P7IA 2FMLA 5GTHC 3G1LA 1WH5A 4BY7J 2QBYB 1BN5A 4BQAA 2IGOA 3VB2A 4CZZA 1IZ1A 2L02A 5DCFA 2X6XA 5J8CA 3S2HJ 2L7ZA 4G9YA 2XB5A 1WHUA 3F0CA 4KN7X 1MBEA 2K3PA 3OIPA 3CCSI 3DLAA 2GXGA 2DK8A 2LLKA 2GZWA 4UVAA 3JREA 2EB7A 4IEJA 1ETKA 1AHDP 3AL0B 1JUMA 4EEFG 2MFZA 3KLOA 4M3DA 4QIWN 2M45A 1K4TA 1J59A 4C2MA 3OYJA 2JWTA 3GTJJ 4A69C 3CJQB 4RGUA 3G4SI 3U2RA 1VQ4I 3NRGA 2EZHA 2K9QA 2FOWA 2QSFX 2DFIA 3OL3A 3PUBA 1LEBA 4NC7A 1SAUA 2ZCNA 5FD5A 4GFBA 2KZGA 1BA5A 2GUHA 4I98B 3R6SA 2ZXIA 3CUOA 2H27A 4S04A 1V54H 1FOXA 1DPRA 4RM3A 3Q5FA 1S7OA 3J7AO 3RDIA 4S0HB 3PNYA 3ZQIA 4RB3C 4HNVA 2QSGX 5L3FA 3MNLA 3GTQJ 1BI3A 3I53A 5GPCA 1XSXA 1LDJA 3G1OA 1O3SA 4RGSA 1A35A 2X85A 5F08A 2F6CA 2JJ7A 4YZEA 2VKEA 3SEQA 3O8GA 3CRJA 4FCYA 1IRFA 2IGKA 1L3LA 1ETXA 5D5UB 2E1OA 5D6EA 2K02A 2IXSA 2OD5A 4XRFA 1TNSA 1UJ8A 1U6GA 2VE9A 3H0GJ 2G0EA 3CMAI 4ENJA 4FE4A 1QO0D 2EFOA 3QPHA 5J4YA 3LJLA 3RH2A 3LL7A 4OMYA 1NG6A 1D3YA 2L54A 4ZZLA 2X51A 1JGGA 1SD6A 2K9NA 4KJZA 3CCVI 2Q0OA 3EETA 4BHBA 1YJNI 3WU0A 3NQOA 3ZN1A 4MGRA 4RMNA 1YTYA 3T6NA 3OIOA 1QZYA 1KU7A 2D2WA 4A0XA 5M5XJ 5H9TA 3KIOA 1AA7A 5IP6A 1XDSA 2RNGA 2KIMA 2QSHX 3BR0A 4ZYDA 2GXAA 3G2BA 1YS7A 2L4AA 4XLEA 5A2QK 2WAEA 3BQYA 5K5RA 1ETYA 2MW8A 1RIOH 1ZK8A 1K61A 4MXMA 4UVCA 5CXGA 1PUEE 2MA3A 2VASA 1JUSA 3EDPA 4BXUA 1FZPB 2NP3A 4GGGA 5EYRA 5F04A 2STWA 1FIAA 3D1NI 1ZH5A 4ENMA 4R1HA 2DDBA 1KQ0A 2H1KA 1QVTA 1X3UA 4G7HF 4CCMA 4C2TA 4UB6C 3K69A 4OINF 3CTAA 2DT6A 1SVMA 2EINH 3HTJA 2MC4A 2WGBA 4QPQA 1ZGWA 2GA1A 2L5QA 5LD2C 2VI6A 2W4SA 1VQ9I 1S6LA 2OA4A 2JTVA 3KP6A 5M5YJ 1X3ZB 3SHFA 1YHQI 2RC4A 2P5VA 2R7RA 4J19A 4QWQA 2JN6A 3OIQA 1V5FA 1F5TA 1UAAA 3ZOBA 5LFAA 1G3SA 3L2UA 2XF5A 4A6DA 3QKXA 1YFHA 1TZLA 3ULQB 4GCKA 1K83J 5D5WB 3E5UA 1LFPA 2PZ9A 2DMPA 2K4BA 1SFUA 1DU0A 1ZR4A 5FJ8J 1G2HA 3S2WA 3SWHA 1S8NA 2QUFA 1UMQA 4XKBA 3HOZJ 4Q47A 1XCBA 3HE0A 3F8MA 1E3HA 1G4DA 2WAQN 4IF4A 2DG8A 3HHHA 4WX9A 2ZJQF 1RR7A 1LDKB 2W85A 3H5NA 4AWXB 5B5EC 3WTVC 1E0EA 3ZMUA 3ANPA 2FQ3A 1S29A 5K7ZA 4HX8A 3ELKA 3JRBA 2YR2A 1TL8A 2R92J 3F8NA 5LHHA 4JK1X 3BJAA 3SEZA 3JSPA 3OS1A 1BIBA 3GBGA 3ZXSA 3W6VA 3CCRI 2H1LA 3H9JA 1JKPC 5F1JA 3A03A 3JTGA 2A68F 2XGDA 3LA2A 4IOAF 4HSRA 5DUKA 2L7MP 2QVOA 4EVIA 3V4GA 4AM3A 3X2QH 1J5YA 1R7JA 1Z9CA 3LSGA 3FISA 5D8LB 3JAMZ 1RI7A 4B09A 1QZZA 1JJ8C 4HV6A 4RLFA 3BJOA 3HSEA 2Z16A 4E7KA 2LYCA 4GCTA 2K40A 4GYGA 2A69F 3OOUA 5DD8A 3SYTA 5IT9K 3FXQA 4DVYP 5EZHA 5F0HA 4HEA2 5FKNA 5L3DA 4U7BA 3L9FA 3PSIA 2MBFA 4PSXA 2PI0A 3H3ZA 3C1DA 4F92B 3JRAA 1XGOA 1YW8A 2BY1A 1P4WA 2VT2A 2ZMEC 3VW1A 4IPAA 3G1MA 4OIPF 3G71I 1T0FA 4CCJA 3EGQA 3HZJA 3M8EA 2BV6A 3VW0A 3NI7A 3I54A 3A0HC 4ACIA 4LGWA 5DD4A 4L5EA 1SD4A 4L5JA 4MIMA 4P5OA 1PP7U 2NVTJ 3GLXA 4B43A 1ZHFA 1OCOH 1BR4A 4AVZA 3JSOA 2E7XA 2XB0X 2DPUA 2DI3A 2TRTA 2LOOA 1BOBA 4D7NA 2DFEA 4L18B 5KK1A 3VSLA 1X2MA 3UNGC 1MKMA 5AIQA 2E19A 4QSHA 3D5LA 3F8BA 3CMYA 3QP6A 2M4GA 2OU2A 4G6QA 3MCZA 2VPRA 3CLOA 4RGXA 2DJIA 1D0YA 2KIFA 2ECCA 4JBAA 2HQRA 3BZKA 1Y8RB 4D7MA 3FIWA 2YX4A 1U5TB 3LA7A 2N8GA 4P9FA 3RCOA 1IN6A 4LG3A 4MHGA 4RA2A 3SDBA 1GV2A 1JTYA 1LEAA 3BTCA 2PX9A 3DU5A 3H92A 3HUGA 4GDFA 1OPCA 2WAQA 4M74A 3BPVA 2VL8A 3GCMA 4RM2A 2G7HA 5DCMA 1IC8A 3HTAA 2CQ7A 1UCRA 1P9QC 4CUGA 3DXJF 1SFKA 2M1BA 2ZY9A 1WCMJ 1STZA 5E8GA 1VF9A 2B9SA 1BL0A 4EJOA 2CW8A 3KKCA 1GUUA 3KPHA 1R1TA 1Z05A 3DBRB 3TP0A 1Z6TA 2OJED 3H9QA 3MKLA 2HTSA 4L9JA 1IXSB 2DDAA 2ECBA 2X6OA 3AL0C 2WB1N 1R5ID 3BTIA 4DGWB 4KISA 2DQRA 1OR7A 2JUGA 2MYSA 2KRHA 2A5YB 1UZCA 5DM7F 5D4SA 4I02A 4Y33A 2RVCA 3TW7A 5H6RA 4BJTA 3M4OJ 2CS3A 1SD5A 3BCBA 2COBA 3BNIA 3HJEA 2V6EA 2HPIA 3BC8A 2F5FA 4HYEA 1FJLA 3LSTA 3FMSA 1IRXA 1HXDA 1NHAA 4OIRF 1BR1A 4BL0B 2DMTA 3TBIA 3LSPA 1TBXA 3GMEA 1DDNA 3GZ6A 1XN7A 3IH2A 3HL2A 2FJI1 4AC6A 1FNNA 2DOAA 1XDUA 2R93J 1SC7A 5EDNA 2BEOA 2KIQA 4MNUA 4DBQA 2P4WA 1BOAA 2QQBA 1ZQ3P 1U3EM 2D6YA 2M87A 5AQCA 3CCUI 2K3FA 3K7AJ 4BGDA 1B9NA 2RAEA 2X6WA 5M5WJ 2NVQJ 2NYXA 4BYYA 1HQCA 5CQGA 2CV1A 3RZDJ 1ODDA 3E6MA 5KHDA 3EUHC 3PNTA 4IQJA 4KITB 2BVMA 2YPRA 5FLMJ 3JRIA 2P81A 1Z0XA 5FROA 4E4HA 2ZFWA 2OZUA 4A3FJ 1B72B 4HQEA 3E7QA 2DG7A 1EH7A 2XDVA 4EMSA 5FRMA 3AAFA 3K4MA 2KLOA 1T08B 3M7GA 4PGHA 1V55H 1BR2A 2ZCXA 3MFKA 1Z7LA 4HPQA 5C4JJ 1GV5A 5ILUA 3BJBA 2F5CA 3MEXA 2QWTA 1OFCX 3I58A 5HS9A 3LSHA 4NC8A 2BVLA 3L1PA 3HTUA 5M3MJ 5FD6A 2VIXA 2CJJA 3ASOH 3K2AA 4G6DA 4DBRA 5DUIA 4WWCA 2F07A 3NS4A 2V1NA 2HU9A 4M9XA 4C3JJ 2V1UA 1UG0A 2VQLA 2KIUA 1X1CA 2FBKA 4AYBA 3OL4A 1ZELA 5L3GA 4B3XA 1WWXA 3ECOA 4N4NB 2KISA 1IDYA 3F23A 3M3YJ 4LD5A 4ABZA 4B44A 2QYOA 3VP5A 4GCVA 4ON0A 2HYJA 3RZOJ 1QNTA 3ZQGA 4CCNA 3OYCA 2R7TA 4II2A 4IHSA 1KYZA 4YG2F 3UKGA 4AIHA 1IO2A 1MBFA 2STTA 4I7HA 2X1DA 1YX5A 2DAOA 2GBYA 4JX4A 3GUDA 4PJ0C 5EGOB 2L9SA 3FMQA 1YQAA 3TO7A 2WV0A 3HRTA 3BG3A 4M72A 3L2RA 1CQTA 3FZVA 5E1WA 1HCRA 3PIPF 1Y0UA 4U9NA 3OS2A 2TDXA 1FP1D 1Z21A 2VONA 2UXXA 2PMUA 1L0OC 3DTIA 5BS6A 1R36A 3DBLB 4O5VA 1O57A 3CP8A 3DPJA 4A3LJ 2Y0MA 2CSOA 2GAUA 3MD2A 2E1CA 2DOFA 2XF6A 3KYDB 3OR2C 4YRVA 2VKHA 2EFNA 5D8KB 3BPXA 3Q0WA 2REKA 1ZG5A 1D8JA 2JPBA 3T1BA 2VJ5A 2OTJI 1U2WA 3HRSA 1I1GA 1TWHJ 4FTHA 2IBDA 1D0XA 2A6EF 2DYSH 2QWWA 5HLIA 1S9HA 4BEHA 1EH8A 3I3LA 2HKUA 2FOKA 5EG0B 4GFLA 4XLFA 3HOXJ 3KNWA 2WWYA 1V5GA 4XLPF 2LFBA 2CUEA 1WI9A 3L7WA 1T6SA 4BJ5C 5GAGJ 4BE0A 1FYMA 1VQLI 3HPGA 3GTMJ 2LMDA 4JQFA 4QLCU 2QQAA 1W36C 1IG7A 2ZJPF 1A5JA 1HDPA 3ZMDA 3WU2C 2UWMA 4M73A 2HVRA 4PGGA 5BNGA 5GP9A 5HDNA 4LK1F 3SFIA 5E18F 3JSJA 5FGLA 3BOQA 4M3BA 1WJBA 4FT8A 5HAWA 3WTWC 4R8HA 1K6OA 2WC2A 5HS7A 5FLVA 5HSZA 1WJEA 3LQQA 1RKWA 4IL6C 4XSXF 3LSRA 1I3QJ 1JJ6C 4RAYA 1FC3A 1GT0C 1MZBA 4U87A 5FFXA 1TT0A 3ABUA 2D45A 1YJ9I 4F7ZA 3F8FA 3R0JA 1Y0NA 3JRDA 3J7AY 2E2HJ 5CJ9A 2UXOA 3FBIB 1YOVB 2E1MB 2HQAA 4U0YA 5JVGF 3BHQA 5F6FA 1TW3A 3L2CA 2V7FA 3CP2A 1QU3A 3MZHA 3BR5A 5K1YA 2XGEA 3AG1H 2HWVA 4BS9A 1QBJA 3SXYA 2XVCA 2V57A 2HS5A 3V6GA 4A6EA 1AWCA 3WGHA 3F72A 3WHCA 2HZTA 2ELJA 2I8DA 3Q0VA 5ERIA 1TNTA 1TWFJ 2V79A 3E3VA 1P4XA 4Q48A 3ERMA 3QWLA 2OBPA 3CDLA 1LFBA 4IRIA 5BQTA 3I56I 4XN0A 3GEZA 3B6CA 4HBLA 4XM3A 4HNTA 1QGPA 1WZ2A 1YE9A 3IH4A 4LIUA 5JLXA 2PMZA 2EFWA 1DP3A 4OAZA 1ZRDA 2EPFA 4OAYA 1ZG1A 1QHGA 3P9CA 1FEXA 3H3UA 3WE3A 2ZOZA 2FJ1A 3O6BB 5IOZA 3VODA 2O7TA 3FMRA 1K79A 1MJAA 1WJCA 4XMYA 2KKOA 3VYUB 4FE7A 5LRRA 3NPIA 3IHUA 3RD3A 2LF7A 3UR3C 4YIRX 4A3IJ 1EJ9A 3FKIJ 1MH4A 2W00A 1UFMA 4HNUA 4KIBA 1MGTA 2HQ5A 4RS8A 2V9PA 5FRNA 1XSDA 1U5TC 4GRIA 4UDSA 2L01A 1MJ9A 2K7LA 3PPBA 2QGUA 1G3TA 1AU7A 1I6HJ 3BR1A 2MLGA 3K4BA 2IS4A 2ZB9A 3GO5A 3FWEA 4H4KC 1V4RA 3V8KA 2DFFA 1KQ9A 2PMHA 2IU5A 3ABLH 4MQVA 4IRGA 2DA6A 4HLXA 5A2QZ 3S16J 1REPC 2G7GA 5E3MA 3CC4I 2MGQA 1K78B 4CYCB 2OZ6A 1WI3A 2BGCA 4BACA 5CVRA 1Q1HA 2ELKA 4IHXA 3G73A 2QZ8A 1MDMA 2IRFG 1O4XA 2AO9A 1CGPA 3MVPA 2XAUA 2HKXA 2UXPA 2GXBA 2KMUA 2KPMA 2MD5A 3CO7C 4HZFA 3KZYA 2DA1A 3RTRA 4BBRJ 2G7UA 2VB6A 3JW4A 5L3CA 3GVAA 2PN6A 3ZQHA 1SMTA 1ITYA 5DEQA 2DA2A 4I99C 4F55A 4DZJA 4DYCA 2QKMB 3CCJI 1JXSA 1X4PA 1ZGJA 1UHWA 3KZIC 2MC3A 5JI6A 1W5SA 3IH3A 4ZTFA 4KT5C 5K7FA 3ZQQA 3VOXA 2E2IJ 3GTLJ 3EQLF 3I55I 2CH0A 2HR3A 1FLIA 4M9ZA 4EM1A 5DS9A 1YO5C 2HDDA 2CFXA 4XNFA 1TC3C 3B6AA 4K2EA 5GPAA 5LGUA 2K27A 1TWAJ 2AXTC 2CUFA 1WJFA 5CKTA 2EZIA 5EZGA 1CF7A 4NNJA 3B02A 1BBYA 2W82A 2JA6J 3CCYA 3MZ8A 3CQZJ 1I6XA 5KCMA 2X0LA 3H0DA 4J00A 5K5QA 2JA5J 4TV7A 2W53A 1YYVA 5C4YA 3K2ZA 2K85A 3Q9SA 4LITA 1Z3XA 2EIMH 2EIJH 1MW7A 3CLQA 4CICA 1SD7A 1VI0A 3CUQA 4C30A 4D9JA 2AHQA 4I2OA 1NTCA 3K70C 3S3NA 1D0ZA 3OYHA 2ACJA 2NVUB 1TQPA 1XS9A 5ILVA 4B8XA 1ETWA 2X1CA 4OOIA 3CCLI 2AS5F 4BH9A 2Q24A 3IRQA 1FMWA 1ZAOA 3HIFA 1IXCA 2V6CA 4XKVA 2OQGA 3K4CA 5TJJA 1VQKI 3NNRA 2NS0A 1ON2A 2XSDC 3KP3A 3DEUA 3ZMVA 1X1PA 2F4OB 1MNMC 4EJTA 3QYBA 2PFVA 1VQOI 2L9NA 3HM5A 3SJMA 5E3OA 2IVMA 5IT9Z 3I4MJ 4P1WA 1WJ5A 1JHFA 2JRTA 2RNJA 2O0YA 2BE5F 3RKQA 4XKWA 2VBZA 3JCUC 1U0JA 5CPRB 1DGRM 3QYFA 2PJRA 2QKOA 2LF8A 4FETA 3R61A 1LVAA 2D5VA 2V4JC 4M9SA 1ZRFA 3N4MA 3EPZA 3AQTA 1FBQA 2XKPA 2YVEA 4YFXF 4HQMA 3WGGA 1JE8A 3PO2J 4G7OF 1IRZA 1DQUA 3VPRA 3E7LA 1LVKA 4U88A 2WV1A 1S72I 4GFKA 5FFZA 1WGXA 2AQEA 2VQHA 1XD7A 1WJAA 3CDIA 4AF5A 2EIKH 4HLYA 2ZBKA 3E1SA 4PZJA 4A3KJ 2M7BA 4XBFA 2JA2A 2XIGA 1HSTA 4UXNA 1VQ8I 2QTQA 1XGNA 2DW4A 4HA8A 3RPUA 4DZPA 3NARA 4XRSG 5D19A 4KNYA 1J9IA 5LLQA 4YIIA 1OJLA 5E17F 4HV5A 1YIOA 2L4MA 5ICFA 5HVQC 4L0ZB 4UV8A 2LKPA 2NOGA 3BT9A 3T5XA 3VTIA 4JKZA 3NXCA
chains in the Genus database with same CATH topology
2VUMJ 1ENHA 1WCMJ 4B4CA 3HIMA 1VF9A 3AQSA 1MBGA 1BL0A 2HYTA 2R7ZJ 3KKCA 3VVZA 1GUUA 3O8HA 4CGRA 3TP0A 3SDGA 3I4NJ 2K9SA 3LHQA 5IOYA 4XICA 3VOKA 4A3DJ 3MKLA 2HOTA 4IHWA 1OCPA 4XIDA 4G12A 2ECBA 2X6OA 1JKRC 2UXHA 2WB1N 3BTIA 1ETVA 1FTTA 5E3LA 2KT0A 3S1NJ 4C3IJ 3TW7A 1NK3P 1D5YA 4XK4A 3M4OJ 2G3BA 3GZIA 3O60A 5FKKA 2COBA 3BNIA 2XDNA 1Q1VA 1FJLA 3V78A 2VKVA 1ORKA 2GLOA 2DMTA 3LSPA 3OSGA 3IH2A 1Z77A 2EZKA 3QBMA 4AC6A 3LOCA 2QF7A 2PBXA 1MBHA 4UUSB 2R93J 3HEFA 5EDNA 1RKTA 3TEDA 3A01A 3S14J 1ZQ3P 2D6YA 3B81A 5AQCA 4BKXA 5C4XJ 4JYKA 1ZR2A 3GEUA 2KDZA 1QRYA 3K7AJ 4MO7A 4BY1J 3COLA 2NVQJ 2RAEA 5M5WJ 3QPSA 3HTIA 2OPTA 3RZDJ 4A3JJ 1QVUA 3S17J 5FLMJ 3JRIA 2HOAA 2P81A 1Z0XA 1B72B 2M9HA 2O8KA 4A3FJ 3ZQLA 1PUFA 1JKOC 2O9LA 2DG7A 3BTJA 2LR8A 4ME9A 2HXIA 2DA3A 2NP5A 1LE8A 1H88C 1IV6A 4LOCA 2DN0A 1LFUP 2OI8A 2LVSA 1WH7A 2ZCXA 5CW8A 4NDLA 1BJZA 1SANA 5C4JJ 1GV5A 2R5YA 2GM4A 3BJBA 2QWTA 1OFCX 2XPVA 4RDUA 5EF6A 1VNDA 1R9TJ 3L1PA 1AKHA 3BR6A 5M3MJ 2CJJA 2UXUA 1GVDA 4AC0A 3G56A 4AUXA 3K2AA 2F07A 1UI6A 3FK6A 4C3JJ 3GTPJ 5C44J 3S2DJ 2RHAA 1Y1WJ 3HDDA 3QQAA 5EEAA 3FK7A 2MSYA 1A6IA 1T33A 4CYCA 1NK2P 2NX4A 2OERA 2GENA 2EH3A 4JP0A 4M6VA 1IDYA 3M3YJ 4ABZA 4A3MJ 1P7JA 3VP5A 3C2BA 3BQZA 2Y31A 2G7SA 3RZOJ 3A01B 2HYJA 4NELA 3ZQGA 4DW6A 1B8IA 1X58A 2FQ4A 2ZCMA 3UKGA 1HOMA 2LTPA 2NS7A 1MBFA 4X1EA 3FRQA 4W97A 2GBYA 5FKLA 4JX4A 3BG9A 5EGOB 3HOUJ 1IGNA 1S7EA 1CQTA 3BG3A 2X9DA 2ID6A 1JTXA 1HCRA 1I50J 3OSFA 2JA7J 2FD5A 3F1BA 1XG1A 5IP9J 5DAJA 1HF0A 3EUPA 1MBKA 1GDTA 1LE8B 1MSFC 2HXOA 2M2EA 4MK6A 1W0TA 3ANGA 4UUTA 1TWGJ 1UI5A 3ZQFA 3DPJA 1JUPA 2MG4A 3BR3A 4IHVA 4A3LJ 4JNNA 4GCLA 1BW6A 2L0KA 3NAUA 4V2GA 3LSJA 3Q0WA 1MSEC 2I10A 1ETOA 3ZQCA 3JRGA 2UXIA 3KZ9A 1TWHJ 3HOWJ 3A02A 2DJNA 4FTHA 2IBDA 4C3HJ 4NN1A 3JR9A 5D1RA 2DMNA 2HKUA 4GFLA 5EG0B 5J3LA 3S1RJ 3HOXJ 4Y52J 3KNWA 1P7IA 2Y2ZA 4RBOA 1BW5A 3LWJA 3G1LA 4MFEA 1WH5A 4BY7J 4QTRA 2LFBA 2CUEA 4XRSA 2HOSA 1EF4A 3S2HJ 2L7ZA 2DMUA 2XB5A 2ME6A 3GTMJ 3F0CA 4W1UA 1MBEA 1IG7A 1A5JA 2DA7A 1HDPA 1ETQA 2LLKA 3JREA 1XC5A 2G7LA 4IEJA 1ETKA 1IUFA 5BNGA 1AHDP 3BRUA 1JUMA 5GP9A 4C2MJ 3SFIA 2LK2A 4EEFG 1U8BA 3JSJA 4ICHA 4M3DA 4QIWN 5FGLA 4M3BA 2LP0A 3GTJJ 2JWTA 4A69C 5HAWA 3GTOJ 5FLVA 5HSZA 3HGGA 5C3EJ 3NRGA 1H89C 2EZHA 2K9QA 4M3FA 2Y9ZA 1RKWA 5J1UA 5CXIA 1UHSA 3LSRA 3PO3J 1Y1VJ 1I3QJ 1JJ6C 3S1MJ 1GT0C 2ZCNA 3JRFA 4GFBA 2R5ZA 1BA5A 2GUHA 2RASA 3JRDA 5IPAA 2E2HJ 2UXOA 5JLWA 2YU9J 3BHQA 3LNQA 3DEWA 5FKMA 2LY9A 2M8GX 3BR5A 4S0HB 2XGEA 3ZQIA 4HNVA 3MNLA 3GTQJ 2V57A 3HOVJ 1APLC 2Y0SN 5GPCA 3G1OA 5EFYA 3V6GA 1E3OC 3WHCA 5F08A 2YVHA 4YZEA 2JJ7A 1F43A 2VKEA 3Q0VA 3CRJA 3O8GA 1TWFJ 4FCYA 2CQQA 1ETXA 2TCTA 2E1OA 2ZOYA 3CDLA 1LFBA 4Y7NJ 3ON4A 2XPUA 3B6CA 3H0GJ 2G0EA 2FX0A 4FE4A 3IH4A 2L9RA 3HKZN 5JLXA 1IJWC 1YRNA 3RH2A 4I6ZA 3LJLA 1ZTRA 1WPKA 1FEXA 3Q3SA 1DU6A 1JGGA 2K9NA 2ZOZA 5FMPA 3BCGA 5M3FJ 2FJ1A 5IOZA 2JA8J 2O7TA 1HLVA 2JMWA 3T6NA 3OIOA 4FE7A 3Q0UA 3NPIA 3QPLA 5M5XJ 5F0CA 3RD3A 5H9TA 4A3IJ 1IDZA 5IP6A 3FKIJ 3BR0A 1MH4A 3VVYA 3GTKJ 1MH3A 2NS8A 3BQYA 3IV5A 2R5ZB 1PUFB 4A3GJ 1ETYA 2MW8A 1K61A 1ZK8A 2OF7A 5IYDJ 2HQ5A 4MXMA 5CXGA 5HBUA 4UDSA 1JUSA 3C07A 2NP3A 3H3VK 5EYRA 2GFNA 3VVXA 5F04A 3MN2A 1FIAA 3D1NI 3CWRA 5E3NA 2O7OA 3PPBA 2R5YB 1OCTC 1QVTA 5IYCJ 2H1KA 1AU7A 4AYBN 1I6HJ 3BR1A 5IYBJ 1AKHB 2ZB9A 3HTJA 1UG2A 1HDDC 2WGBA 3CJDA 1ZGWA 2LKXA 2IU5A 2VI6A 2DA6A 5M5YJ 3S16J 4A93J 2QOPA 2G7GA 3P9TA 2EQRA 4FISA 5E3MA 4J19A 2JN6A 2MGQA 2XPWA 4CYCB 5J1RA 3DCFA 3HBLA 3ZOBA 3ON2A 1SFOJ 2NVXJ 1WI3A 1JT0A 3QKXA 5K7HA 4GCKA 1SGMA 2ELKA 1K83J 1W0UA 4IHXA 2CU7A 2PZ9A 1O4XA 2AO9A 2DMPA 1B8IB 3MVPA 5F0FA 1DU0A 1B72A 2UXPA 3BTLA 1ZR4A 5FJ8J 1G2HA 3IUVA 1UMQA 2DA1A 4BBRJ 2W48A 3HOZJ 3HE0A 2HI3A 5J1YA 1U9OA 2WAQN 3ZQHA 2DG8A 4V2FA 3GTGJ 2FBQA 3S5RA 5DTDA 1RR7A 1ITYA 4M3EA 2JK3A 4BXXJ 2DA2A 3ANPA 1QPIA 4DZJA 4DYCA 5K7ZA 3VW0A 1FTZA 3JRBA 3IH3A 4DYQA 1MBJA 3HB9A 5K7FA 2R92J 3RQIA 3HOYJ 3VOXA 2E2IJ 3KKDA 3GTLJ 2EZLA 2HDDA 5DS9A 1JKQC 3E7QA 1TC3C 2E2JJ 3GBGA 3B6AA 5IP7J 4KWAA 3W6VA 2Y30A 4D5CA 2LD5A 5GPAA 2REKA 4JL3A 5D18A 1JKPC 1TWAJ 5F1JA 2CUFA 3A03A 2EZIA 5F27A 3TP3A 5EZGA 2DMQA 2EBIA 1FIPA 2XGDA 4A3CJ 1JT6A 2JA6J 3CCYA 2L7MP 3CQZJ 4D5FA 2JA5J 3LSGA 3FISA 2W53A 4X6AJ 3TW6A 5C4YA 4B3AA 5EGOA 1X2NA 1JJ8C 3HGYA 1VI0A 2ME0A 2ID3A 4JX6A 2AHQA 3G7RA 2K40A 4GCTA 1NTCA 3OOUA 5EZHA 5F0HA 2H8RA 5FKNA 1ZKGA 3PASA 3BG5A 1XS9A 3JRCA 1T56A 1ETWA 4A3BJ 3JRAA 1RETA 2Q24A 5FHPA 3VW1A 1H8AC 3G1MA 1TWCJ 3VW2A 4I76A 3NNRA 2CRGA 2DA5A 2XSDC 3EGQA 3NI7A 1MNMC 2WUIA 2R0QC 4MFDA 2QIBA 4ACIA 3PM1A 2NVYJ 3HM5A 4L5EA 3SJMA 5E3OA 1RESA 3JRHA 3I4MJ 4MIMA 2NVTJ 4A3EJ 2XGCA 3RKQA 2YUSA 2XRLA 2B63J 5EG0A 2XB0X 1VFCA 2TRTA 2CQXA 1U78A 5HODA 4D7NA 5K58A 1RPWA 2QKOA 1X2MA 2D5VA 3VIBA 5FKOA 4JX5A 4B1RA 3AQTA 2E19A 4QSHA 2DA4A 3CMYA 2YVEA 2M34A 1POGA 4MLOA 3PO2J 1IRZA 3VPRA 4PXIA 3E7LA 2WV1A 1U9NA 2PMZN 4GFKA 4XRMA 1WGXA 2L7FP 2VPRA 4M3GA 4UUSA 2QCOA 4IHYA 3BR2A 4AF5A 2ECCA 3S15J 4DYRA 3WHBA 4A3KJ 4D7MA 3FIWA 2X48A 1F36A 3S1QJ 2QTQA 2N8GA 2YS9A 2IEKA 4DZPA 3NARA 4XRSG 5D19A 1GV2A 2M0CA 1JTYA 3BTCA 1YRNB 4BBSJ 4HKUA 9ANTA 1OJLA 3HTHA 3VUQA 1IC8A 2DTZA 3HTAA 2Y9YA 3BT9A 2NOGA 2IAIA 4L62A 4JKZA 3NXCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VUM J;  1ENH A;  1WCM J;  4B4C A;  3HIM A;  1VF9 A;  3AQS A;  1MBG A;  1BL0 A;  2HYT A;  2R7Z J;  3KKC A;  3VVZ A;  1GUU A;  3O8H A;  4CGR A;  3TP0 A;  3SDG A;  3I4N J;  2K9S A;  3LHQ A;  5IOY A;  4XIC A;  3VOK A;  4A3D J;  3MKL A;  2HOT A;  4IHW A;  1OCP A;  4XID A;  4G12 A;  2ECB A;  2X6O A;  1JKR C;  2UXH A;  2WB1 N;  3BTI A;  1ETV A;  1FTT A;  5E3L A;  2KT0 A;  3S1N J;  4C3I J;  3TW7 A;  1NK3 P;  1D5Y A;  4XK4 A;  3M4O J;  2G3B A;  3GZI A;  3O60 A;  5FKK A;  2COB A;  3BNI A;  2XDN A;  1Q1V A;  1FJL A;  3V78 A;  2VKV A;  1ORK A;  2GLO A;  2DMT A;  3LSP A;  3OSG A;  3IH2 A;  1Z77 A;  2EZK A;  3QBM A;  4AC6 A;  3LOC A;  2QF7 A;  2PBX A;  1MBH A;  4UUS B;  2R93 J;  3HEF A;  5EDN A;  1RKT A;  3TED A;  3A01 A;  3S14 J;  1ZQ3 P;  2D6Y A;  3B81 A;  5AQC A;  4BKX A;  5C4X J;  4JYK A;  1ZR2 A;  3GEU A;  2KDZ A;  1QRY A;  3K7A J;  4MO7 A;  4BY1 J;  3COL A;  2NVQ J;  2RAE A;  5M5W J;  3QPS A;  3HTI A;  2OPT A;  3RZD J;  4A3J J;  1QVU A;  3S17 J;  5FLM J;  3JRI A;  2HOA A;  2P81 A;  1Z0X A;  1B72 B;  2M9H A;  2O8K A;  4A3F J;  3ZQL A;  1PUF A;  1JKO C;  2O9L A;  2DG7 A;  3BTJ A;  2LR8 A;  4ME9 A;  2HXI A;  2DA3 A;  2NP5 A;  1LE8 A;  1H88 C;  1IV6 A;  4LOC A;  2DN0 A;  1LFU P;  2OI8 A;  2LVS A;  1WH7 A;  2ZCX A;  5CW8 A;  4NDL A;  1BJZ A;  1SAN A;  5C4J J;  1GV5 A;  2R5Y A;  2GM4 A;  3BJB A;  2QWT A;  1OFC X;  2XPV A;  4RDU A;  5EF6 A;  1VND A;  1R9T J;  3L1P A;  1AKH A;  3BR6 A;  5M3M J;  2CJJ A;  2UXU A;  1GVD A;  4AC0 A;  3G56 A;  4AUX A;  3K2A A;  2F07 A;  1UI6 A;  3FK6 A;  4C3J J;  3GTP J;  5C44 J;  3S2D J;  2RHA A;  1Y1W J;  3HDD A;  3QQA A;  5EEA A;  3FK7 A;  2MSY A;  1A6I A;  1T33 A;  4CYC A;  1NK2 P;  2NX4 A;  2OER A;  2GEN A;  2EH3 A;  4JP0 A;  4M6V A;  1IDY A;  3M3Y J;  4ABZ A;  4A3M J;  1P7J A;  3VP5 A;  3C2B A;  3BQZ A;  2Y31 A;  2G7S A;  3RZO J;  3A01 B;  2HYJ A;  4NEL A;  3ZQG A;  4DW6 A;  1B8I A;  1X58 A;  2FQ4 A;  2ZCM A;  3UKG A;  1HOM A;  2LTP A;  2NS7 A;  1MBF A;  4X1E A;  3FRQ A;  4W97 A;  2GBY A;  5FKL A;  4JX4 A;  3BG9 A;  5EGO B;  3HOU J;  1IGN A;  1S7E A;  1CQT A;  3BG3 A;  2X9D A;  2ID6 A;  1JTX A;  1HCR A;  1I50 J;  3OSF A;  2JA7 J;  2FD5 A;  3F1B A;  1XG1 A;  5IP9 J;  5DAJ A;  1HF0 A;  3EUP A;  1MBK A;  1GDT A;  1LE8 B;  1MSF C;  2HXO A;  2M2E A;  4MK6 A;  1W0T A;  3ANG A;  4UUT A;  1TWG J;  1UI5 A;  3ZQF A;  3DPJ A;  1JUP A;  2MG4 A;  3BR3 A;  4IHV A;  4A3L J;  4JNN A;  4GCL A;  1BW6 A;  2L0K A;  3NAU A;  4V2G A;  3LSJ A;  3Q0W A;  1MSE C;  2I10 A;  1ETO A;  3ZQC A;  3JRG A;  2UXI A;  3KZ9 A;  1TWH J;  3HOW J;  3A02 A;  2DJN A;  4FTH A;  2IBD A;  4C3H J;  4NN1 A;  3JR9 A;  5D1R A;  2DMN A;  2HKU A;  4GFL A;  5EG0 B;  5J3L A;  3S1R J;  3HOX J;  4Y52 J;  3KNW A;  1P7I A;  2Y2Z A;  4RBO A;  1BW5 A;  3LWJ A;  3G1L A;  4MFE A;  1WH5 A;  4BY7 J;  4QTR A;  2LFB A;  2CUE A;  4XRS A;  2HOS A;  1EF4 A;  3S2H J;  2L7Z A;  2DMU A;  2XB5 A;  2ME6 A;  3GTM J;  3F0C A;  4W1U A;  1MBE A;  1IG7 A;  1A5J A;  2DA7 A;  1HDP A;  1ETQ A;  2LLK A;  3JRE A;  1XC5 A;  2G7L A;  4IEJ A;  1ETK A;  1IUF A;  5BNG A;  1AHD P;  3BRU A;  1JUM A;  5GP9 A;  4C2M J;  3SFI A;  2LK2 A;  4EEF G;  1U8B A;  3JSJ A;  4ICH A;  4M3D A;  4QIW N;  5FGL A;  4M3B A;  2LP0 A;  3GTJ J;  2JWT A;  4A69 C;  5HAW A;  3GTO J;  5FLV A;  5HSZ A;  3HGG A;  5C3E J;  3NRG A;  1H89 C;  2EZH A;  2K9Q A;  4M3F A;  2Y9Z A;  1RKW A;  5J1U A;  5CXI A;  1UHS A;  3LSR A;  3PO3 J;  1Y1V J;  1I3Q J;  1JJ6 C;  3S1M J;  1GT0 C;  2ZCN A;  3JRF A;  4GFB A;  2R5Z A;  1BA5 A;  2GUH A;  2RAS A;  3JRD A;  5IPA A;  2E2H J;  2UXO A;  5JLW A;  2YU9 J;  3BHQ A;  3LNQ A;  3DEW A;  5FKM A;  2LY9 A;  2M8G X;  3BR5 A;  4S0H B;  2XGE A;  3ZQI A;  4HNV A;  3MNL A;  3GTQ J;  2V57 A;  3HOV J;  1APL C;  2Y0S N;  5GPC A;  3G1O A;  5EFY A;  3V6G A;  1E3O C;  3WHC A;  5F08 A;  2YVH A;  4YZE A;  2JJ7 A;  1F43 A;  2VKE A;  3Q0V A;  3CRJ A;  3O8G A;  1TWF J;  4FCY A;  2CQQ A;  1ETX A;  2TCT A;  2E1O A;  2ZOY A;  3CDL A;  1LFB A;  4Y7N J;  3ON4 A;  2XPU A;  3B6C A;  3H0G J;  2G0E A;  2FX0 A;  4FE4 A;  3IH4 A;  2L9R A;  3HKZ N;  5JLX A;  1IJW C;  1YRN A;  3RH2 A;  4I6Z A;  3LJL A;  1ZTR A;  1WPK A;  1FEX A;  3Q3S A;  1DU6 A;  1JGG A;  2K9N A;  2ZOZ A;  5FMP A;  3BCG A;  5M3F J;  2FJ1 A;  5IOZ A;  2JA8 J;  2O7T A;  1HLV A;  2JMW A;  3T6N A;  3OIO A;  4FE7 A;  3Q0U A;  3NPI A;  3QPL A;  5M5X J;  5F0C A;  3RD3 A;  5H9T A;  4A3I J;  1IDZ A;  5IP6 A;  3FKI J;  3BR0 A;  1MH4 A;  3VVY A;  3GTK J;  1MH3 A;  2NS8 A;  3BQY A;  3IV5 A;  2R5Z B;  1PUF B;  4A3G J;  1ETY A;  2MW8 A;  1K61 A;  1ZK8 A;  2OF7 A;  5IYD J;  2HQ5 A;  4MXM A;  5CXG A;  5HBU A;  4UDS A;  1JUS A;  3C07 A;  2NP3 A;  3H3V K;  5EYR A;  2GFN A;  3VVX A;  5F04 A;  3MN2 A;  1FIA A;  3D1N I;  3CWR A;  5E3N A;  2O7O A;  3PPB A;  2R5Y B;  1OCT C;  1QVT A;  5IYC J;  2H1K A;  1AU7 A;  4AYB N;  1I6H J;  3BR1 A;  5IYB J;  1AKH B;  2ZB9 A;  3HTJ A;  1UG2 A;  1HDD C;  2WGB A;  3CJD A;  1ZGW A;  2LKX A;  2IU5 A;  2VI6 A;  2DA6 A;  5M5Y J;  3S16 J;  4A93 J;  2QOP A;  2G7G A;  3P9T A;  2EQR A;  4FIS A;  5E3M A;  4J19 A;  2JN6 A;  2MGQ A;  2XPW A;  4CYC B;  5J1R A;  3DCF A;  3HBL A;  3ZOB A;  3ON2 A;  1SFO J;  2NVX J;  1WI3 A;  1JT0 A;  3QKX A;  5K7H A;  4GCK A;  1SGM A;  2ELK A;  1K83 J;  1W0U A;  4IHX A;  2CU7 A;  2PZ9 A;  1O4X A;  2AO9 A;  2DMP A;  1B8I B;  3MVP A;  5F0F A;  1DU0 A;  1B72 A;  2UXP A;  3BTL A;  1ZR4 A;  5FJ8 J;  1G2H A;  3IUV A;  1UMQ A;  2DA1 A;  4BBR J;  2W48 A;  3HOZ J;  3HE0 A;  2HI3 A;  5J1Y A;  1U9O A;  2WAQ N;  3ZQH A;  2DG8 A;  4V2F A;  3GTG J;  2FBQ A;  3S5R A;  5DTD A;  1RR7 A;  1ITY A;  4M3E A;  2JK3 A;  4BXX J;  2DA2 A;  3ANP A;  1QPI A;  4DZJ A;  4DYC A;  5K7Z A;  3VW0 A;  1FTZ A;  3JRB A;  3IH3 A;  4DYQ A;  1MBJ A;  3HB9 A;  5K7F A;  2R92 J;  3RQI A;  3HOY J;  3VOX A;  2E2I J;  3KKD A;  3GTL J;  2EZL A;  2HDD A;  5DS9 A;  1JKQ C;  3E7Q A;  1TC3 C;  2E2J J;  3GBG A;  3B6A A;  5IP7 J;  4KWA A;  3W6V A;  2Y30 A;  4D5C A;  2LD5 A;  5GPA A;  2REK A;  4JL3 A;  5D18 A;  1JKP C;  1TWA J;  5F1J A;  2CUF A;  3A03 A;  2EZI A;  5F27 A;  3TP3 A;  5EZG A;  2DMQ A;  2EBI A;  1FIP A;  2XGD A;  4A3C J;  1JT6 A;  2JA6 J;  3CCY A;  2L7M P;  3CQZ J;  4D5F A;  2JA5 J;  3LSG A;  3FIS A;  2W53 A;  4X6A J;  3TW6 A;  5C4Y A;  4B3A A;  5EGO A;  1X2N A;  1JJ8 C;  3HGY A;  1VI0 A;  2ME0 A;  2ID3 A;  4JX6 A;  2AHQ A;  3G7R A;  2K40 A;  4GCT A;  1NTC A;  3OOU A;  5EZH A;  5F0H A;  2H8R A;  5FKN A;  1ZKG A;  3PAS A;  3BG5 A;  1XS9 A;  3JRC A;  1T56 A;  1ETW A;  4A3B J;  3JRA A;  1RET A;  2Q24 A;  5FHP A;  3VW1 A;  1H8A C;  3G1M A;  1TWC J;  3VW2 A;  4I76 A;  3NNR A;  2CRG A;  2DA5 A;  2XSD C;  3EGQ A;  3NI7 A;  1MNM C;  2WUI A;  2R0Q C;  4MFD A;  2QIB A;  4ACI A;  3PM1 A;  2NVY J;  3HM5 A;  4L5E A;  3SJM A;  5E3O A;  1RES A;  3JRH A;  3I4M J;  4MIM A;  2NVT J;  4A3E J;  2XGC A;  3RKQ A;  2YUS A;  2XRL A;  2B63 J;  5EG0 A;  2XB0 X;  1VFC A;  2TRT A;  2CQX A;  1U78 A;  5HOD A;  4D7N A;  5K58 A;  1RPW A;  2QKO A;  1X2M A;  2D5V A;  3VIB A;  5FKO A;  4JX5 A;  4B1R A;  3AQT A;  2E19 A;  4QSH A;  2DA4 A;  3CMY A;  2YVE A;  2M34 A;  1POG A;  4MLO A;  3PO2 J;  1IRZ A;  3VPR A;  4PXI A;  3E7L A;  2WV1 A;  1U9N A;  2PMZ N;  4GFK A;  4XRM A;  1WGX A;  2L7F P;  2VPR A;  4M3G A;  4UUS A;  2QCO A;  4IHY A;  3BR2 A;  4AF5 A;  2ECC A;  3S15 J;  4DYR A;  3WHB A;  4A3K J;  4D7M A;  3FIW A;  2X48 A;  1F36 A;  3S1Q J;  2QTQ A;  2N8G A;  2YS9 A;  2IEK A;  4DZP A;  3NAR A;  4XRS G;  5D19 A;  1GV2 A;  2M0C A;  1JTY A;  3BTC A;  1YRN B;  4BBS J;  4HKU A;  9ANT A;  1OJL A;  3HTH A;  3VUQ A;  1IC8 A;  2DTZ A;  3HTA A;  2Y9Y A;  3BT9 A;  2NOG A;  2IAI A;  4L62 A;  4JKZ A;  3NXC A; 
#chains in the Genus database with same CATH topology
 1E2X A;  5HNH A;  3HIM A;  2BY3 A;  3AQS A;  1MBG A;  2KQR A;  3VYS B;  3VVZ A;  1MJB A;  2JPC A;  2OQR A;  3LHQ A;  5IOY A;  4XIC A;  4A3D J;  2B1E A;  3M1C A;  6PAX A;  5HNF A;  2UXH A;  2FEZ A;  1K4S A;  1A36 A;  2LY1 A;  4MTD A;  4HDU A;  4YFK F;  3KP2 A;  1JI8 A;  1NK3 P;  4XK4 A;  4RLQ A;  3GZI A;  3R4K A;  5FKK A;  2I5U A;  3E6B A;  2XDN A;  2IS1 A;  5EJC A;  2BOL A;  2Q8K A;  4KIC A;  2VKV A;  1KA8 A;  3KEQ A;  2XRO A;  2KRC A;  3I0T A;  1FYL A;  2H6B A;  1MBH A;  2D1H A;  2Y75 A;  4BJ6 C;  3HSF A;  3TED A;  3BG6 A;  2FE3 A;  2E1M C;  5FO5 A;  4LLL A;  3S14 J;  2HVQ A;  4Y3O A;  3PQJ A;  4BKX A;  5C4X J;  3QRF F;  1R49 A;  2PLY A;  4CSW A;  3I64 A;  3GFJ A;  3F9K A;  3QPS A;  2M30 A;  1C0W A;  3OYB A;  1LJ9 A;  2KJB A;  4A3J J;  4HG2 A;  4YIF A;  3LFK A;  3VFZ A;  3S17 J;  4D1Q A;  2R7W A;  5DYM A;  1D1A A;  4BHP A;  2E36 A;  2M9H A;  1JKO C;  2EFQ A;  3C7J A;  3ZQL A;  1PUF A;  3V7R A;  4RGR A;  4ME9 A;  2XC7 A;  1N75 A;  2DA3 A;  1LE8 A;  1H88 C;  1IV6 A;  4LOC A;  4MEX F;  4ZYA A;  3R60 A;  3K4J A;  1O3R A;  1N78 A;  2IP2 A;  5CW8 A;  2R5Y A;  3NRV A;  1ZLK A;  3FBN B;  3EYY A;  2O3F A;  4EJW A;  1VQP I;  5EF6 A;  4A2U A;  4G94 A;  3ABK H;  4WIB A;  1AKH A;  2JSP A;  3LAJ A;  4PUS A;  4XOT A;  1X1B A;  2VOD A;  3SZT A;  3S3O A;  3GTP J;  4ESB A;  3P5J A;  3J81 K;  2GIV A;  2MH9 A;  1OCC H;  5EEA A;  2ZJR F;  1J2X A;  2KP6 A;  4E70 A;  4L0Y B;  3OYN A;  1JGS A;  3ML6 A;  1BI0 A;  1IN5 A;  1T33 A;  2MSY A;  1EV7 A;  2NX4 A;  2OER A;  4F52 A;  2COM A;  4M6V A;  3BP8 A;  2MH2 A;  1P7J A;  2ZO4 A;  5E79 C;  3BQZ A;  5J47 A;  1HKS A;  5IT3 A;  1IXR C;  2G7S A;  4I0A A;  2ZSI B;  1B8I A;  3P9I A;  4OMZ A;  3KP5 A;  1HOM A;  5CVI A;  4X1E A;  4GO1 A;  4DIQ A;  1FOW A;  3FRQ A;  4W97 A;  5TIS C;  5FKL A;  2R7Q A;  3BG9 A;  3HOU J;  4ZDL A;  1IUY A;  3OYD A;  1EA3 A;  1JTX A;  1T38 A;  4KUM A;  2DFH A;  2VBX A;  2FD5 A;  1XG1 A;  4KYW A;  5IP9 J;  3AKZ A;  3EUP A;  3LWF A;  1MBK A;  1LE8 B;  1MSF C;  2HXO A;  4MK6 A;  3WTZ A;  4UUT A;  1WRJ A;  2A2F X;  3GF2 A;  4A5M A;  1UI5 A;  3ESW B;  3LSI A;  4NQW A;  4CDG A;  5HS8 A;  2MG4 A;  3ZPL A;  4AIK A;  4GCL A;  3OYF A;  5K5O A;  4BE2 A;  2XAQ A;  2K5C A;  1BW6 A;  2I10 A;  1ETO A;  3ZQC A;  1WSU A;  1V5E A;  1F4K A;  2P6S A;  3TOB A;  3HOW J;  4H0E A;  2DJN A;  3IL2 A;  1UEL B;  1BI2 A;  2F4I A;  3GZ5 A;  3QOP A;  2WY8 Q;  5B1A H;  3CC7 I;  1SAX A;  3JR9 A;  5D1R A;  3I59 A;  1J0R A;  3L09 A;  2KZV A;  4EM2 A;  5J3L A;  2M3A A;  1XGM A;  3TO6 A;  3BZC A;  1T39 A;  1Z3Y A;  4RBO A;  3DQV C;  1BW5 A;  3LWJ A;  5LHG A;  4QTR A;  1QQI A;  4XRS A;  2P0W A;  1RRJ A;  4Z6Y A;  5FLX K;  2ZC2 A;  2DMU A;  2ME6 A;  1O3Q A;  2L9V A;  2DXI A;  2K9L A;  5TGT A;  5JFR A;  1LQ1 A;  3U21 A;  3RPU D;  2K9M A;  1ETQ A;  2VE8 A;  1XC5 A;  2E5N A;  4KMF A;  2G7L A;  3L2Q A;  1IUF A;  3DU6 A;  4HAM A;  1TTY A;  1XMX A;  1HW5 A;  4C2M J;  2LK2 A;  3W2W A;  2Q1Z B;  2LP0 A;  4EAT A;  1XPX A;  2V26 A;  3DP7 A;  2IGM A;  2IJL A;  3BJ6 A;  4HX4 A;  1FPQ A;  4M71 A;  3HUG B;  5C3E J;  3S8P A;  4ZYH A;  4U9L A;  3L00 A;  3FHN A;  5CXI A;  1UHS A;  5DCM B;  1Y1V J;  2KRF A;  3BG7 A;  3S1M J;  2BBY A;  2E1N A;  3WOD F;  1IV8 A;  3HC7 A;  3JRF A;  5EEH A;  3FF5 A;  1SMY F;  3F22 A;  3F6V A;  3V8J A;  2QEN A;  2R5Z A;  2CGP A;  5IPA A;  3D0S A;  3KZZ A;  4Z2Y A;  1D1C A;  4FQG A;  2YU9 J;  3D5R C;  3TL4 X;  2KDO A;  4LG0 A;  2DYR H;  5IY5 H;  2FNA A;  2HDW A;  5FKM A;  2LH9 A;  2LY9 A;  2M8G X;  3BY6 A;  1BC7 C;  5E1X A;  2DBB A;  3KEY A;  4CHU A;  1NG7 A;  1R22 A;  1APL C;  2Y0S N;  5EFY A;  4UUV A;  2YVH A;  1F43 A;  1SFX A;  3N97 A;  2JVG A;  3K1P A;  3DKY A;  2CQQ A;  3ZCO A;  2TCT A;  5EEG A;  4DQ2 A;  1KU9 A;  4U0W A;  4Y7N J;  3MZY A;  3ON4 A;  3T8R A;  3SQN A;  2CV0 A;  1IN7 A;  2L3D A;  2FX0 A;  2L9R A;  3HKZ N;  3HOS A;  1IJW C;  1YRN A;  2IGN A;  4I6Z A;  4Q4Z F;  2ADU A;  2WAD A;  3HOT A;  2VLA A;  1KYW A;  2GOX B;  1WPK A;  3Q3S A;  3GFL A;  4CXF A;  4ZJZ A;  3AG2 H;  2YX7 A;  5FMP A;  4GYI A;  1O7F A;  2EV6 A;  3BCG A;  4ESJ A;  5M3F J;  2AXL A;  2WBM A;  2HTJ A;  1VQ7 I;  4O3M A;  1UB9 A;  4KMU X;  4C2U A;  1ON1 A;  2L7K A;  5H20 A;  2ZNZ A;  5F0C A;  1WFX A;  2LSO A;  1MMG A;  1R5G A;  2FSW A;  3ASN H;  4OD5 A;  3VVY A;  2R5Z B;  5TRD A;  5HBU A;  2OF7 A;  2QLZ A;  1ONV A;  2E5Z A;  3T0Y A;  3H3V K;  2GFN A;  3VVX A;  3CWR A;  3MN2 A;  5ICG A;  4I0B A;  2G9W A;  2O7O A;  4RB2 C;  1OCT C;  5IYC J;  1B9M A;  1OKR A;  1R4M B;  2EV5 A;  3COA C;  1XTA A;  2UZK A;  2WB1 A;  4IZZ A;  4UV9 A;  5IYB J;  1FSH A;  2EIL H;  1RC9 A;  1UG2 A;  2W57 A;  1KU3 A;  2CO5 A;  3PFY A;  1HDD C;  4E7I A;  2VPL A;  2F48 A;  2LKX A;  1G3Y A;  3HRU A;  5ED4 A;  4M6Y A;  2LNB A;  3EUK L;  1FOK A;  3CJT B;  3RYP A;  1K7A A;  4A93 J;  1FY7 A;  3RPQ A;  4FIS A;  1B59 A;  1X4O A;  2M7A A;  3CCM I;  4BNC A;  3DPU A;  3MQ0 A;  3HBL A;  3ON2 A;  2R4G A;  2NVX J;  1UHM A;  2JQ7 A;  1W0U A;  5KAI C;  2K86 A;  3H1C A;  5B66 C;  1FBU A;  1R1V A;  2F5V A;  5F0F A;  2DT7 B;  2IS6 A;  3DKW A;  1X1D A;  3BTL A;  5LEJ A;  1MD0 A;  3CCQ I;  2LC2 A;  3IUV A;  1TQM A;  3K8P C;  3KEO A;  1GXQ A;  1YJW I;  1TQI A;  1Z7U A;  2DTR A;  1HC8 A;  2V1D A;  2XRN A;  5J1Y A;  2VXD A;  3GX4 X;  2W1O A;  4V2F A;  2F5D A;  3MKZ A;  2NRA C;  1BI1 A;  3GTG J;  2FBQ A;  2VQC A;  2VXZ A;  4M3E A;  2JK3 A;  5KVR A;  4BXX J;  3RI4 A;  1QPI A;  3SZG A;  2XAH A;  1I3A A;  1RR8 C;  1FTZ A;  1VTN C;  1XB4 A;  2A05 A;  3ISP A;  3ABT A;  2Y69 H;  4DYQ A;  3HB9 A;  2LBF A;  5KNL A;  1DPU A;  3KKD A;  3NWS A;  2EZL A;  1JKQ C;  1P2F A;  3ROU A;  5DV5 A;  2ZXJ A;  3LSK A;  2VJJ A;  3WE2 A;  4CGZ A;  3OYA A;  2Y30 A;  2VBY A;  2Y0S A;  1WVR A;  4D5C A;  1B6A A;  4LMY A;  3WTS C;  1X19 A;  2LD5 A;  3K10 A;  3ZMZ A;  2ZME A;  1F1Z A;  1G6N A;  2V1X A;  3KYC B;  2DMQ A;  1W1W E;  3AFH A;  4ESF A;  1JT6 A;  3K4L A;  3E5X A;  3K9T A;  1W7P A;  2UUZ A;  5F64 A;  4L9N A;  4BEH B;  4X6A J;  3HKZ A;  4B3A A;  3CD6 I;  2VQG A;  2WAF A;  3QPT A;  5DM6 F;  2FF4 A;  1X2N A;  2ZSH B;  1J7K A;  4LLG F;  2QEX I;  4BQO A;  2ME0 A;  1ZLJ A;  4JX6 A;  3G7R A;  1N77 A;  3F8C A;  2R7X A;  1R1U A;  1A04 A;  1ZKG A;  3C18 A;  1IRG A;  3BG5 A;  2EK5 A;  5B1B H;  1T56 A;  2A3S A;  4ITV A;  4LB6 B;  2PBI A;  5H2F C;  3HHG A;  5FHP A;  2GA2 A;  2X6Y A;  4EQQ A;  2HYF A;  1TWC J;  3OOP A;  2GIZ A;  2F5E A;  2JRM A;  4HW0 A;  2CRG A;  2HKO A;  4IOC F;  2DA5 A;  1YW9 A;  5J4V A;  3QP5 A;  2P7V B;  3FXJ A;  4PFP A;  1H0M A;  4N9I A;  2B3W A;  4LB5 A;  2OUM A;  2WUI A;  4MEY F;  4MFD A;  3GLL A;  1PP8 F;  3PM1 A;  2NVY J;  3ZGK A;  3DTE A;  3H9G A;  5LGN A;  3BLY A;  3ZRG A;  3JRH A;  3WTU C;  2YU3 A;  2ZCW A;  1OIS A;  4A3E J;  2YUS A;  3PL8 A;  1YW7 A;  2XRL A;  3O2P E;  2B63 J;  5BOX A;  3RKW A;  4E7S A;  2DOE A;  2CQX A;  3OYE A;  5HOD A;  1U78 A;  1G59 A;  2O6G E;  3OYL A;  1RPW A;  3H5A A;  4AID A;  4XON A;  5BPD A;  2QBY A;  1W7P B;  3U9G A;  5JVT A;  3KET A;  2M34 A;  1ZG3 A;  3MKY B;  4L9V A;  1RNL A;  4PXI A;  2DK5 A;  1XSV A;  3QOE A;  4V19 K;  4XRM A;  3J80 K;  1VQ6 I;  2L7F P;  3FX3 A;  3HRM A;  4M3G A;  3ZMS A;  4UUS A;  2QCO A;  4NC6 A;  3E0J B;  5CVJ A;  2Q2E A;  3WHB A;  2CUJ A;  4U0V A;  1F36 A;  4ZZD A;  2MD0 A;  2YS9 A;  2XUB A;  4HKU A;  3DKX A;  2ZKZ A;  3R0A A;  2VC1 A;  2OV7 A;  1BIA A;  1SVO A;  4Y13 A;  3HTH A;  3V8L A;  4YEL A;  3FXR A;  2Y9Y A;  1R4N B;  5AIP A;  1ENH A;  3P9K A;  4B4C A;  4BXF A;  2R7Z J;  3PQK A;  4IHT A;  3DF8 A;  2DO7 A;  2E35 A;  3O8H A;  1N25 A;  4AD9 A;  2BY0 A;  3I4N J;  3SFZ A;  1KQ8 A;  4LLN A;  2HOT A;  4IHW A;  1OCP A;  4XID A;  4G12 A;  3WG9 A;  1TT5 B;  4ENK A;  2LDU A;  4HOB A;  3U1K A;  2ZXW H;  1IN4 A;  1FTT A;  5E3L A;  2KT0 A;  2A5W A;  3S1N J;  4Y15 A;  3EUH A;  3SZP A;  2ZNY A;  1FMV A;  2RQP A;  3O60 A;  2CV2 A;  4HST A;  3RYR A;  1Q1V A;  2H6C A;  3EYI A;  1ZN2 A;  1I1S A;  3V78 A;  1QZE A;  3HTS B;  1OLT A;  3M9A A;  1VQM I;  2GLO A;  3KCC A;  3GW2 A;  3OSG A;  2ICW G;  2EZK A;  1HSJ A;  4P96 A;  4PSW A;  4PK4 A;  2PBX A;  4UUS B;  3HEF A;  3RQ4 A;  3TOA A;  1O3T A;  2WA0 A;  3MKW B;  3G6E I;  2Q2E B;  3VOE A;  3B81 A;  1A6Q A;  5B3S H;  3DBH B;  3E6D A;  3TQN A;  2DOD A;  3GEU A;  2KDZ A;  3B73 A;  2J5O A;  1QRY A;  2HGC A;  3MMY B;  3COL A;  1Y6I A;  1OR7 C;  3VYT B;  5D5V B;  2FU4 A;  4IO9 F;  4LFU A;  4HF0 A;  4QPO A;  4C9Y A;  4XOP A;  1MDM B;  1T95 A;  4UVB A;  1A31 A;  2HOE A;  4G7Z F;  2O8K A;  2W25 A;  2O9L A;  2ZJ2 A;  1R23 A;  3ONQ A;  1E3P A;  2IW5 A;  2HXI A;  2ZFU A;  3TKY A;  4XSZ F;  2DN0 A;  2HNH A;  3WTX C;  1LFU P;  2OI8 A;  2LVS A;  5E1Z B;  2J5P A;  1K6Y A;  4NDL A;  1BJZ A;  1I39 A;  2CYY A;  4WXH A;  3LQR A;  4RDU A;  3I71 A;  1R6R A;  2V9K A;  3G3Z A;  3DEE A;  1USS A;  5CVU A;  3W2A A;  2CW0 F;  2XKO A;  4EJV A;  4AIJ A;  2UXU A;  4AC0 A;  4AUX A;  3LAP A;  2E71 A;  1YI2 I;  4UB8 C;  1UI6 A;  2Y48 A;  3ZP5 A;  3C2G A;  3HPH A;  5LEK A;  2QKL B;  3VSK A;  1Y1W J;  3QQA A;  3NWT A;  3A4C A;  5JHU A;  1W7P D;  5LHI A;  1A6I A;  4KIF A;  2GEN A;  2EH3 A;  2FMY A;  4JP0 A;  2F4M B;  3T8T A;  4A3M J;  3C2B A;  5J40 A;  2Y31 A;  2P5L C;  1CF7 B;  3VYR B;  2EA2 A;  3KFW X;  2KL4 A;  3DPT A;  2CQN A;  1X58 A;  2FQ4 A;  1FT9 A;  3FKJ A;  2ZCM A;  1PVE A;  2UV1 A;  2NS7 A;  5HLH A;  2AQF A;  3OMY A;  4KIG A;  4CH7 A;  4IRH A;  2D1V A;  2X1E A;  2O8X A;  1IGN A;  4E6K G;  3J81 Z;  4E7L A;  1HW2 A;  2H8W A;  2ID6 A;  3CUQ B;  3LA3 A;  3K4K A;  4KFC A;  3OSF A;  2JA7 J;  2M8E A;  3N05 A;  3CME I;  4NUB A;  3FXK A;  5DAJ A;  4NB5 A;  1GDT A;  2IA0 A;  1P92 A;  3ANG A;  2BY2 A;  2BHZ A;  4HRI A;  1LKX A;  1OYI A;  3TO9 A;  4PJM A;  3ZQF A;  1Y39 A;  1JUP A;  3BR3 A;  4JNN A;  4UHT A;  3DFG A;  3JTH A;  2NAZ A;  2XF7 A;  1LB2 A;  3K0L A;  2L0K A;  2FUG 2;  2VJI A;  3NAU A;  3Q9V A;  1KU2 A;  1LNW A;  2W84 A;  3W3C A;  1MMD A;  2WTE A;  3JRG A;  4E7H A;  3KZ9 A;  1PYV A;  4G6T B;  5JR3 A;  3A02 A;  2EV0 A;  2ELH A;  1D5V A;  2O5R A;  4U7D A;  4C3H J;  5F1R A;  3V7C A;  4BHC A;  4NN1 A;  4F91 B;  2H94 A;  1EKE A;  2KFD A;  3IWZ A;  3V7S A;  5GTI C;  1LPQ A;  1TP4 A;  4OWR B;  1ZAR A;  2DMN A;  5FB2 A;  2BHY A;  3CJN A;  4HF1 A;  3S1R J;  1XX5 A;  3IAS 2;  2PJR B;  2Y2Z A;  4MFE A;  2LKS A;  2VJ4 A;  3FXM A;  2XAG A;  1MIJ A;  2HOS A;  2E60 A;  1EF4 A;  3OR1 C;  4DNC A;  3WU1 B;  3FXL A;  4W1U A;  2DA7 A;  2PFB A;  1BC8 C;  3M8F A;  2HYG D;  2CQK A;  2R7S A;  3LSM A;  3BRU A;  1FX7 A;  3DWL E;  1E17 A;  5ICC A;  2E34 A;  1U8B A;  2LG4 A;  4ICH A;  4Q5S F;  2HZD A;  1OCR H;  3GFM A;  3GTO J;  3IAM 2;  1ULY A;  2NNY A;  3K6G A;  3HGG A;  2HEO A;  5CVV A;  1H89 C;  2XAS A;  4M3F A;  2IA1 A;  2Y9Z A;  5J1U A;  4MQ9 F;  5BPI A;  3FM3 A;  4CCK A;  5FLX Z;  3PO3 J;  1UST A;  1ERD A;  2LY2 A;  1IN8 A;  3CZ6 A;  3M07 A;  2EWN A;  3PFI A;  3C2H A;  3F3X A;  2BXY A;  4B47 A;  2RAS A;  2BZT A;  1XMK A;  2CFO A;  4L9T A;  1F9N A;  1ZGA A;  4KN4 X;  2NNN A;  5JLW A;  3HG9 A;  4ASN A;  3LNQ A;  2RDP A;  3DEW A;  2PJP A;  2LRD A;  5BMZ A;  1FOY A;  3GZN B;  3F6O A;  3D5S C;  3CJR B;  3HOV J;  4RB1 A;  1E3O C;  3TDU C;  2VOP A;  5CYV A;  1TLH B;  2GQQ A;  3BCA A;  3DTK A;  1B4A A;  4PFO A;  3ZR8 X;  2O03 A;  2ZOY A;  3RIR A;  3E97 A;  1U5T A;  2XPU A;  1I27 A;  3E5Q A;  3ERE D;  3DV8 A;  2OTL I;  1G8X A;  3O3K A;  1W4M A;  3QOD A;  2JUC A;  2W7N A;  1Y8Q B;  1ZTR A;  3I4P A;  3W2V A;  3VWB A;  2Z2S B;  4HF2 A;  1FSE A;  4II3 A;  4LK0 F;  2BW3 A;  1J75 A;  4XKC A;  4EJU A;  1DUX C;  1DU6 A;  1FYK A;  1QPM A;  3KLN A;  2FBI A;  3EUA A;  2Z33 A;  2P6T A;  2Z1D A;  1X3W B;  1R5H A;  2CG4 A;  3L2V A;  2L2O A;  2JA8 J;  1HLV A;  2JMW A;  3H36 A;  3Q0U A;  3FM5 A;  3QPL A;  1WJD A;  3TGN A;  2JT1 A;  4RAF A;  1IDZ A;  3GTK J;  1MH3 A;  2NS8 A;  3ZMT A;  4A0Z A;  3S93 A;  3IV5 A;  1PUF B;  2RQQ A;  4A3G J;  3H35 A;  3RKX A;  5IYD J;  1MND A;  5E8I A;  2X4H A;  2VBW A;  3C07 A;  4CZC A;  5GAE J;  2FNP A;  3PNV A;  5E3N A;  3A2K A;  4OIO F;  2XSJ C;  3QAH A;  4B48 A;  1VQ5 I;  4XLH A;  1WKM A;  2R5Y B;  3TMO A;  4AYB N;  2QM3 A;  3OY9 A;  2LRE A;  1ZRE A;  2P8T A;  1AKH B;  5DDG A;  2DPD A;  5L3B A;  3CES A;  4ZDO A;  3I9V 2;  4XL9 A;  4JOM A;  3CJD A;  2JZY A;  4S05 A;  3CF5 F;  1J09 A;  2A61 A;  5H6Q A;  3RKY A;  3LMM A;  4CCL A;  2QOP A;  2QQ8 A;  2BYV E;  2EQR A;  3W6K B;  4KDP A;  3P9T A;  2PG4 A;  5CLS A;  3IRR A;  2XPW A;  1KGS A;  4ETS A;  3DCF A;  3CDH A;  4YEJ A;  5J1R A;  2EA4 A;  2M4K A;  1SFO J;  1JT0 A;  3A0B C;  5K7H A;  3BWG A;  2Z5U A;  1SGM A;  3BRO A;  2CU7 A;  3MAJ A;  4IQ4 A;  2EFP A;  4WF2 A;  2BW3 B;  3OYG A;  1B8I B;  3QYE A;  4ZYE A;  1B72 A;  1OYY A;  1GVJ A;  3VEP A;  3ECH A;  2IT0 A;  4EM0 B;  2P7C B;  4FX0 A;  2W48 A;  1OYW A;  4X0G A;  3GFI A;  2E7W A;  2P5K A;  2HI3 A;  4Y4R A;  1X1A A;  4J01 A;  1U9O A;  3CC2 I;  1R58 A;  3L2W A;  3S5R A;  5CQE A;  5DTD A;  4XQF A;  5JHF A;  5D6F A;  2ESH A;  4PDK A;  1O7L A;  1W36 D;  1AOY A;  1BJA A;  1BM9 A;  2PEX A;  2KJC A;  4ENN A;  4CYD A;  1MBJ A;  2FBH A;  3JAM K;  3QU3 A;  3RQI A;  4NQW B;  3HOY J;  3MWM A;  3I5U A;  3A1Y A;  4PJL A;  2CWE A;  4IXA A;  3CF2 A;  2E2J J;  3W6J B;  4WCG A;  1EH6 A;  1OCZ H;  5IP7 J;  4KWA A;  1MNE A;  1XCV A;  2HQN A;  4JL3 A;  5D18 A;  2K4J A;  1XGS A;  1H9G A;  3CCE I;  3IKV A;  1U8R A;  5F27 A;  1GHC A;  4IRV A;  4L5I A;  3TP3 A;  3P7N A;  2NXN B;  2EBI A;  1FIP A;  4A3C J;  4EGY A;  2M0M A;  3S3M A;  3AG3 H;  4UNO A;  3GYH X;  2Z9O A;  1PJR A;  4D5F A;  3FXO A;  2IS2 A;  3I59 B;  3U1D A;  4P9U A;  4OIQ F;  3TW6 A;  1IF1 A;  5EGO A;  2FA5 A;  2B0L A;  2FXA A;  2VKD A;  1JHH A;  2Z99 A;  3CO6 C;  1Z67 A;  4IKF A;  3HGY A;  4BU2 A;  1H9T A;  5D4R A;  2ID3 A;  4BAY A;  2FRH A;  2CW7 A;  1OMI A;  2OCC H;  1R71 A;  2H8R A;  1VQN I;  3DPL C;  2DCE A;  3PAS A;  3FDY A;  3JRC A;  4E7Z A;  4ZYG A;  1MMN A;  4A3B J;  1LUJ B;  1RET A;  2XAJ A;  4XOR A;  1H8A C;  4A5N A;  3VW2 A;  2H09 A;  3OYM A;  2MAB A;  4I76 A;  4BUP A;  1R00 A;  5AON A;  3GWZ A;  1FBS A;  2R0Q C;  2QIB A;  1RES A;  1RZ4 A;  1ZRC A;  2O61 A;  3WTY C;  3CUQ C;  3ZQ7 A;  2MLK A;  3FXU A;  3VDX A;  2XGC A;  1YLF A;  4NHJ A;  1NH3 A;  1MMS A;  1SEU A;  1DGW Y;  4G8X A;  4BQN A;  4RAG A;  3LFU A;  4I09 A;  4WXD A;  5EG0 A;  1WQ2 A;  1VFC A;  3IWF A;  2HDC A;  2XV4 S;  5K58 A;  3HXL A;  1Z6R A;  4PCQ A;  4FAS D;  3VIB A;  5FKO A;  4LG0 B;  4JX5 A;  4B1R A;  4A12 A;  4LJZ F;  2OAZ A;  3KX2 A;  4N9H A;  2DA4 A;  1W5T A;  3PUF A;  4N4O B;  4YFN F;  1POG A;  1T98 A;  4MLO A;  5LGT A;  4D0P A;  2C6Y A;  3BDD A;  3PIO F;  3KP4 A;  1U9N A;  2PMZ N;  2OCE A;  3WG7 H;  2ESN A;  4IHY A;  3BR2 A;  1KZH A;  3S15 J;  4DYR A;  4FHT A;  1S3J A;  5HLG A;  4EV0 A;  4KA4 A;  1B1B A;  2X48 A;  4P55 A;  3S1Q J;  5E20 A;  2IEK A;  1XMA A;  2OC6 A;  5LBQ A;  2M0C A;  2A07 F;  1SFE A;  2Z3Y A;  1YRN B;  4BBS J;  1VZ0 A;  9ANT A;  2B7E A;  4AU7 A;  1HA8 A;  3NEU A;  2HFH A;  3VUQ A;  2WY7 Q;  4PJN A;  2DTZ A;  5KAF C;  2IAI A;  5HDG A;  4L62 A;  2V9V A;  2VUM J;  3J80 Z;  5GAH J;  4XLC A;  2HYT A;  3DLL F;  3RJP A;  2R7F A;  4CGR A;  4LIV A;  4OU0 A;  3SDG A;  2W24 A;  2K9S A;  3VOK A;  4ZH4 F;  4ZTJ A;  4R79 A;  4ZC3 A;  4BDY A;  1JKR C;  3J7Y J;  1V3F A;  3IP4 B;  1ETV A;  3S32 A;  5HLT A;  1RUO A;  4C3I J;  1IAW A;  2QQ9 A;  1D5Y A;  2G3B A;  4GXO A;  1FWZ A;  4F3Q A;  1DP7 P;  2R7V A;  2XAF A;  4RAZ A;  1FP2 A;  1ORK A;  2JSC A;  2RKH A;  3KP7 A;  4FX4 A;  4BE1 A;  1Z77 A;  4DJA A;  3QBM A;  4XLN F;  5HDK A;  5L3E A;  3LOC A;  2QF7 A;  2ISY A;  1RUN A;  1HBX G;  3OV8 A;  3V42 A;  1RKT A;  3A01 A;  4UY8 I;  4XR6 A;  2ISZ A;  1Y56 A;  3J7Z I;  4JYK A;  1ZR2 A;  2IA2 A;  2NOJ B;  4MO7 A;  4BY1 J;  4XN3 A;  3HTI A;  4EGZ A;  2OPT A;  3QU6 A;  4WK8 F;  2HPM A;  2R7U A;  2GOM A;  4KT6 A;  1W5C C;  1QVU A;  2UXN A;  3F21 A;  2HOA A;  2YVX A;  3ABM H;  5LRS A;  1T2K A;  1T8I A;  3BTJ A;  3CMM A;  2LR8 A;  5ILS A;  3OS0 A;  2VN2 A;  1Z91 A;  2NP5 A;  5FGM A;  2XGX A;  4A0Y A;  1YIJ I;  2VC0 A;  2VT3 A;  4Y17 A;  1WH7 A;  3K1M A;  1PDN C;  4OD4 A;  1G3W A;  1SAN A;  4F93 B;  5J6X A;  2GM4 A;  2IPQ X;  5ICE A;  4M6X A;  3K70 D;  2XPV A;  1VND A;  1R9T J;  2HVS A;  3BR6 A;  4WXC A;  1HKT A;  1ZYR F;  3HYI A;  3IUO A;  5GAD J;  1GVD A;  3WTT C;  3OYI A;  3G56 A;  1Z1D A;  4PJJ A;  1M1E B;  3WGI A;  2DQL A;  3FK6 A;  1IW7 F;  2LBF B;  3RSN A;  1OQY A;  2A6H F;  3REO A;  4CCO A;  5HOO A;  1QA6 A;  5C44 J;  1P6R A;  3S2D J;  1GXP A;  2RHA A;  4ANJ A;  3HDD A;  3AG4 H;  2EJR A;  4IJA A;  3FK7 A;  1HW1 A;  3IC7 A;  2M5W A;  1SVL A;  3KYL A;  4CYC A;  1K78 A;  1NK2 P;  4HDV A;  2ZME B;  3HSR A;  4N0B A;  2DT5 A;  1P4A A;  3OWT A;  4I01 A;  5J8F A;  1HKQ A;  3TDZ C;  1D8K A;  4CA0 A;  3A01 B;  4DW6 A;  4NEL A;  3GXO A;  4AVP A;  2LTP A;  2CUZ A;  4O6J A;  1QHH D;  2R3S A;  2A6T A;  2DLL A;  1D1B A;  1S7E A;  1T0F C;  1YS6 A;  2JVH A;  2X9D A;  4ZDP A;  3M8J A;  1GLN A;  3IKT A;  1I50 J;  4E7J A;  3F1B A;  3K1N A;  4BDZ A;  1YIT I;  1HF0 A;  1ACI A;  4MTE A;  4HX7 A;  3KE2 A;  2M2E A;  1W0T A;  1YX3 A;  1I5Z A;  5D5X B;  4DOZ A;  4IX7 A;  1TWG J;  3OYK A;  4IHV A;  3K4N A;  2VOO A;  1LDD A;  2XHK A;  3C3W A;  3E6C C;  4BQQ A;  2R7D A;  3BZ6 A;  2BXZ A;  2QA4 I;  4V2G A;  3ZN0 A;  1KON A;  2GWR A;  3LSJ A;  2RV8 A;  2ETH A;  2PQ8 A;  3FHZ A;  1MSE C;  2CMP A;  2YSR A;  4IVN A;  1S5L C;  2DU9 A;  2UXI A;  3H5R A;  4NBQ A;  3PJR A;  2KHM A;  2RRE A;  4RB0 A;  4CO8 A;  2RN7 A;  1S7A A;  3M1E A;  1MMA A;  1YG2 A;  2F2E A;  2R7O A;  4XLA A;  2RGV A;  3PSF A;  2ZXH A;  4Y52 J;  1TW2 A;  1P7I A;  2FML A;  5GTH C;  3G1L A;  1WH5 A;  4BY7 J;  2QBY B;  1BN5 A;  4BQA A;  2IGO A;  3VB2 A;  4CZZ A;  1IZ1 A;  2L02 A;  5DCF A;  2X6X A;  5J8C A;  3S2H J;  2L7Z A;  4G9Y A;  2XB5 A;  1WHU A;  3F0C A;  4KN7 X;  1MBE A;  2K3P A;  3OIP A;  3CCS I;  3DLA A;  2GXG A;  2DK8 A;  2LLK A;  2GZW A;  4UVA A;  3JRE A;  2EB7 A;  4IEJ A;  1ETK A;  1AHD P;  3AL0 B;  1JUM A;  4EEF G;  2MFZ A;  3KLO A;  4M3D A;  4QIW N;  2M45 A;  1K4T A;  1J59 A;  4C2M A;  3OYJ A;  2JWT A;  3GTJ J;  4A69 C;  3CJQ B;  4RGU A;  3G4S I;  3U2R A;  1VQ4 I;  3NRG A;  2EZH A;  2K9Q A;  2FOW A;  2QSF X;  2DFI A;  3OL3 A;  3PUB A;  1LEB A;  4NC7 A;  1SAU A;  2ZCN A;  5FD5 A;  4GFB A;  2KZG A;  1BA5 A;  2GUH A;  4I98 B;  3R6S A;  2ZXI A;  3CUO A;  2H27 A;  4S04 A;  1V54 H;  1FOX A;  1DPR A;  4RM3 A;  3Q5F A;  1S7O A;  3J7A O;  3RDI A;  4S0H B;  3PNY A;  3ZQI A;  4RB3 C;  4HNV A;  2QSG X;  5L3F A;  3MNL A;  3GTQ J;  1BI3 A;  3I53 A;  5GPC A;  1XSX A;  1LDJ A;  3G1O A;  1O3S A;  4RGS A;  1A35 A;  2X85 A;  5F08 A;  2F6C A;  2JJ7 A;  4YZE A;  2VKE A;  3SEQ A;  3O8G A;  3CRJ A;  4FCY A;  1IRF A;  2IGK A;  1L3L A;  1ETX A;  5D5U B;  2E1O A;  5D6E A;  2K02 A;  2IXS A;  2OD5 A;  4XRF A;  1TNS A;  1UJ8 A;  1U6G A;  2VE9 A;  3H0G J;  2G0E A;  3CMA I;  4ENJ A;  4FE4 A;  1QO0 D;  2EFO A;  3QPH A;  5J4Y A;  3LJL A;  3RH2 A;  3LL7 A;  4OMY A;  1NG6 A;  1D3Y A;  2L54 A;  4ZZL A;  2X51 A;  1JGG A;  1SD6 A;  2K9N A;  4KJZ A;  3CCV I;  2Q0O A;  3EET A;  4BHB A;  1YJN I;  3WU0 A;  3NQO A;  3ZN1 A;  4MGR A;  4RMN A;  1YTY A;  3T6N A;  3OIO A;  1QZY A;  1KU7 A;  2D2W A;  4A0X A;  5M5X J;  5H9T A;  3KIO A;  1AA7 A;  5IP6 A;  1XDS A;  2RNG A;  2KIM A;  2QSH X;  3BR0 A;  4ZYD A;  2GXA A;  3G2B A;  1YS7 A;  2L4A A;  4XLE A;  5A2Q K;  2WAE A;  3BQY A;  5K5R A;  1ETY A;  2MW8 A;  1RIO H;  1ZK8 A;  1K61 A;  4MXM A;  4UVC A;  5CXG A;  1PUE E;  2MA3 A;  2VAS A;  1JUS A;  3EDP A;  4BXU A;  1FZP B;  2NP3 A;  4GGG A;  5EYR A;  5F04 A;  2STW A;  1FIA A;  3D1N I;  1ZH5 A;  4ENM A;  4R1H A;  2DDB A;  1KQ0 A;  2H1K A;  1QVT A;  1X3U A;  4G7H F;  4CCM A;  4C2T A;  4UB6 C;  3K69 A;  4OIN F;  3CTA A;  2DT6 A;  1SVM A;  2EIN H;  3HTJ A;  2MC4 A;  2WGB A;  4QPQ A;  1ZGW A;  2GA1 A;  2L5Q A;  5LD2 C;  2VI6 A;  2W4S A;  1VQ9 I;  1S6L A;  2OA4 A;  2JTV A;  3KP6 A;  5M5Y J;  1X3Z B;  3SHF A;  1YHQ I;  2RC4 A;  2P5V A;  2R7R A;  4J19 A;  4QWQ A;  2JN6 A;  3OIQ A;  1V5F A;  1F5T A;  1UAA A;  3ZOB A;  5LFA A;  1G3S A;  3L2U A;  2XF5 A;  4A6D A;  3QKX A;  1YFH A;  1TZL A;  3ULQ B;  4GCK A;  1K83 J;  5D5W B;  3E5U A;  1LFP A;  2PZ9 A;  2DMP A;  2K4B A;  1SFU A;  1DU0 A;  1ZR4 A;  5FJ8 J;  1G2H A;  3S2W A;  3SWH A;  1S8N A;  2QUF A;  1UMQ A;  4XKB A;  3HOZ J;  4Q47 A;  1XCB A;  3HE0 A;  3F8M A;  1E3H A;  1G4D A;  2WAQ N;  4IF4 A;  2DG8 A;  3HHH A;  4WX9 A;  2ZJQ F;  1RR7 A;  1LDK B;  2W85 A;  3H5N A;  4AWX B;  5B5E C;  3WTV C;  1E0E A;  3ZMU A;  3ANP A;  2FQ3 A;  1S29 A;  5K7Z A;  4HX8 A;  3ELK A;  3JRB A;  2YR2 A;  1TL8 A;  2R92 J;  3F8N A;  5LHH A;  4JK1 X;  3BJA A;  3SEZ A;  3JSP A;  3OS1 A;  1BIB A;  3GBG A;  3ZXS A;  3W6V A;  3CCR I;  2H1L A;  3H9J A;  1JKP C;  5F1J A;  3A03 A;  3JTG A;  2A68 F;  2XGD A;  3LA2 A;  4IOA F;  4HSR A;  5DUK A;  2L7M P;  2QVO A;  4EVI A;  3V4G A;  4AM3 A;  3X2Q H;  1J5Y A;  1R7J A;  1Z9C A;  3LSG A;  3FIS A;  5D8L B;  3JAM Z;  1RI7 A;  4B09 A;  1QZZ A;  1JJ8 C;  4HV6 A;  4RLF A;  3BJO A;  3HSE A;  2Z16 A;  4E7K A;  2LYC A;  4GCT A;  2K40 A;  4GYG A;  2A69 F;  3OOU A;  5DD8 A;  3SYT A;  5IT9 K;  3FXQ A;  4DVY P;  5EZH A;  5F0H A;  4HEA 2;  5FKN A;  5L3D A;  4U7B A;  3L9F A;  3PSI A;  2MBF A;  4PSX A;  2PI0 A;  3H3Z A;  3C1D A;  4F92 B;  3JRA A;  1XGO A;  1YW8 A;  2BY1 A;  1P4W A;  2VT2 A;  2ZME C;  3VW1 A;  4IPA A;  3G1M A;  4OIP F;  3G71 I;  1T0F A;  4CCJ A;  3EGQ A;  3HZJ A;  3M8E A;  2BV6 A;  3VW0 A;  3NI7 A;  3I54 A;  3A0H C;  4ACI A;  4LGW A;  5DD4 A;  4L5E A;  1SD4 A;  4L5J A;  4MIM A;  4P5O A;  1PP7 U;  2NVT J;  3GLX A;  4B43 A;  1ZHF A;  1OCO H;  1BR4 A;  4AVZ A;  3JSO A;  2E7X A;  2XB0 X;  2DPU A;  2DI3 A;  2TRT A;  2LOO A;  1BOB A;  4D7N A;  2DFE A;  4L18 B;  5KK1 A;  3VSL A;  1X2M A;  3UNG C;  1MKM A;  5AIQ A;  2E19 A;  4QSH A;  3D5L A;  3F8B A;  3CMY A;  3QP6 A;  2M4G A;  2OU2 A;  4G6Q A;  3MCZ A;  2VPR A;  3CLO A;  4RGX A;  2DJI A;  1D0Y A;  2KIF A;  2ECC A;  4JBA A;  2HQR A;  3BZK A;  1Y8R B;  4D7M A;  3FIW A;  2YX4 A;  1U5T B;  3LA7 A;  2N8G A;  4P9F A;  3RCO A;  1IN6 A;  4LG3 A;  4MHG A;  4RA2 A;  3SDB A;  1GV2 A;  1JTY A;  1LEA A;  3BTC A;  2PX9 A;  3DU5 A;  3H92 A;  3HUG A;  4GDF A;  1OPC A;  2WAQ A;  4M74 A;  3BPV A;  2VL8 A;  3GCM A;  4RM2 A;  2G7H A;  5DCM A;  1IC8 A;  3HTA A;  2CQ7 A;  1UCR A;  1P9Q C;  4CUG A;  3DXJ F;  1SFK A;  2M1B A;  2ZY9 A;  1WCM J;  1STZ A;  5E8G A;  1VF9 A;  2B9S A;  1BL0 A;  4EJO A;  2CW8 A;  3KKC A;  1GUU A;  3KPH A;  1R1T A;  1Z05 A;  3DBR B;  3TP0 A;  1Z6T A;  2OJE D;  3H9Q A;  3MKL A;  2HTS A;  4L9J A;  1IXS B;  2DDA A;  2ECB A;  2X6O A;  3AL0 C;  2WB1 N;  1R5I D;  3BTI A;  4DGW B;  4KIS A;  2DQR A;  1OR7 A;  2JUG A;  2MYS A;  2KRH A;  2A5Y B;  1UZC A;  5DM7 F;  5D4S A;  4I02 A;  4Y33 A;  2RVC A;  3TW7 A;  5H6R A;  4BJT A;  3M4O J;  2CS3 A;  1SD5 A;  3BCB A;  2COB A;  3BNI A;  3HJE A;  2V6E A;  2HPI A;  3BC8 A;  2F5F A;  4HYE A;  1FJL A;  3LST A;  3FMS A;  1IRX A;  1HXD A;  1NHA A;  4OIR F;  1BR1 A;  4BL0 B;  2DMT A;  3TBI A;  3LSP A;  1TBX A;  3GME A;  1DDN A;  3GZ6 A;  1XN7 A;  3IH2 A;  3HL2 A;  2FJI 1;  4AC6 A;  1FNN A;  2DOA A;  1XDU A;  2R93 J;  1SC7 A;  5EDN A;  2BEO A;  2KIQ A;  4MNU A;  4DBQ A;  2P4W A;  1BOA A;  2QQB A;  1ZQ3 P;  1U3E M;  2D6Y A;  2M87 A;  5AQC A;  3CCU I;  2K3F A;  3K7A J;  4BGD A;  1B9N A;  2RAE A;  2X6W A;  5M5W J;  2NVQ J;  2NYX A;  4BYY A;  1HQC A;  5CQG A;  2CV1 A;  3RZD J;  1ODD A;  3E6M A;  5KHD A;  3EUH C;  3PNT A;  4IQJ A;  4KIT B;  2BVM A;  2YPR A;  5FLM J;  3JRI A;  2P81 A;  1Z0X A;  5FRO A;  4E4H A;  2ZFW A;  2OZU A;  4A3F J;  1B72 B;  4HQE A;  3E7Q A;  2DG7 A;  1EH7 A;  2XDV A;  4EMS A;  5FRM A;  3AAF A;  3K4M A;  2KLO A;  1T08 B;  3M7G A;  4PGH A;  1V55 H;  1BR2 A;  2ZCX A;  3MFK A;  1Z7L A;  4HPQ A;  5C4J J;  1GV5 A;  5ILU A;  3BJB A;  2F5C A;  3MEX A;  2QWT A;  1OFC X;  3I58 A;  5HS9 A;  3LSH A;  4NC8 A;  2BVL A;  3L1P A;  3HTU A;  5M3M J;  5FD6 A;  2VIX A;  2CJJ A;  3ASO H;  3K2A A;  4G6D A;  4DBR A;  5DUI A;  4WWC A;  2F07 A;  3NS4 A;  2V1N A;  2HU9 A;  4M9X A;  4C3J J;  2V1U A;  1UG0 A;  2VQL A;  2KIU A;  1X1C A;  2FBK A;  4AYB A;  3OL4 A;  1ZEL A;  5L3G A;  4B3X A;  1WWX A;  3ECO A;  4N4N B;  2KIS A;  1IDY A;  3F23 A;  3M3Y J;  4LD5 A;  4ABZ A;  4B44 A;  2QYO A;  3VP5 A;  4GCV A;  4ON0 A;  2HYJ A;  3RZO J;  1QNT A;  3ZQG A;  4CCN A;  3OYC A;  2R7T A;  4II2 A;  4IHS A;  1KYZ A;  4YG2 F;  3UKG A;  4AIH A;  1IO2 A;  1MBF A;  2STT A;  4I7H A;  2X1D A;  1YX5 A;  2DAO A;  2GBY A;  4JX4 A;  3GUD A;  4PJ0 C;  5EGO B;  2L9S A;  3FMQ A;  1YQA A;  3TO7 A;  2WV0 A;  3HRT A;  3BG3 A;  4M72 A;  3L2R A;  1CQT A;  3FZV A;  5E1W A;  1HCR A;  3PIP F;  1Y0U A;  4U9N A;  3OS2 A;  2TDX A;  1FP1 D;  1Z21 A;  2VON A;  2UXX A;  2PMU A;  1L0O C;  3DTI A;  5BS6 A;  1R36 A;  3DBL B;  4O5V A;  1O57 A;  3CP8 A;  3DPJ A;  4A3L J;  2Y0M A;  2CSO A;  2GAU A;  3MD2 A;  2E1C A;  2DOF A;  2XF6 A;  3KYD B;  3OR2 C;  4YRV A;  2VKH A;  2EFN A;  5D8K B;  3BPX A;  3Q0W A;  2REK A;  1ZG5 A;  1D8J A;  2JPB A;  3T1B A;  2VJ5 A;  2OTJ I;  1U2W A;  3HRS A;  1I1G A;  1TWH J;  4FTH A;  2IBD A;  1D0X A;  2A6E F;  2DYS H;  2QWW A;  5HLI A;  1S9H A;  4BEH A;  1EH8 A;  3I3L A;  2HKU A;  2FOK A;  5EG0 B;  4GFL A;  4XLF A;  3HOX J;  3KNW A;  2WWY A;  1V5G A;  4XLP F;  2LFB A;  2CUE A;  1WI9 A;  3L7W A;  1T6S A;  4BJ5 C;  5GAG J;  4BE0 A;  1FYM A;  1VQL I;  3HPG A;  3GTM J;  2LMD A;  4JQF A;  4QLC U;  2QQA A;  1W36 C;  1IG7 A;  2ZJP F;  1A5J A;  1HDP A;  3ZMD A;  3WU2 C;  2UWM A;  4M73 A;  2HVR A;  4PGG A;  5BNG A;  5GP9 A;  5HDN A;  4LK1 F;  3SFI A;  5E18 F;  3JSJ A;  5FGL A;  3BOQ A;  4M3B A;  1WJB A;  4FT8 A;  5HAW A;  3WTW C;  4R8H A;  1K6O A;  2WC2 A;  5HS7 A;  5FLV A;  5HSZ A;  1WJE A;  3LQQ A;  1RKW A;  4IL6 C;  4XSX F;  3LSR A;  1I3Q J;  1JJ6 C;  4RAY A;  1FC3 A;  1GT0 C;  1MZB A;  4U87 A;  5FFX A;  1TT0 A;  3ABU A;  2D45 A;  1YJ9 I;  4F7Z A;  3F8F A;  3R0J A;  1Y0N A;  3JRD A;  3J7A Y;  2E2H J;  5CJ9 A;  2UXO A;  3FBI B;  1YOV B;  2E1M B;  2HQA A;  4U0Y A;  5JVG F;  3BHQ A;  5F6F A;  1TW3 A;  3L2C A;  2V7F A;  3CP2 A;  1QU3 A;  3MZH A;  3BR5 A;  5K1Y A;  2XGE A;  3AG1 H;  2HWV A;  4BS9 A;  1QBJ A;  3SXY A;  2XVC A;  2V57 A;  2HS5 A;  3V6G A;  4A6E A;  1AWC A;  3WGH A;  3F72 A;  3WHC A;  2HZT A;  2ELJ A;  2I8D A;  3Q0V A;  5ERI A;  1TNT A;  1TWF J;  2V79 A;  3E3V A;  1P4X A;  4Q48 A;  3ERM A;  3QWL A;  2OBP A;  3CDL A;  1LFB A;  4IRI A;  5BQT A;  3I56 I;  4XN0 A;  3GEZ A;  3B6C A;  4HBL A;  4XM3 A;  4HNT A;  1QGP A;  1WZ2 A;  1YE9 A;  3IH4 A;  4LIU A;  5JLX A;  2PMZ A;  2EFW A;  1DP3 A;  4OAZ A;  1ZRD A;  2EPF A;  4OAY A;  1ZG1 A;  1QHG A;  3P9C A;  1FEX A;  3H3U A;  3WE3 A;  2ZOZ A;  2FJ1 A;  3O6B B;  5IOZ A;  3VOD A;  2O7T A;  3FMR A;  1K79 A;  1MJA A;  1WJC A;  4XMY A;  2KKO A;  3VYU B;  4FE7 A;  5LRR A;  3NPI A;  3IHU A;  3RD3 A;  2LF7 A;  3UR3 C;  4YIR X;  4A3I J;  1EJ9 A;  3FKI J;  1MH4 A;  2W00 A;  1UFM A;  4HNU A;  4KIB A;  1MGT A;  2HQ5 A;  4RS8 A;  2V9P A;  5FRN A;  1XSD A;  1U5T C;  4GRI A;  4UDS A;  2L01 A;  1MJ9 A;  2K7L A;  3PPB A;  2QGU A;  1G3T A;  1AU7 A;  1I6H J;  3BR1 A;  2MLG A;  3K4B A;  2IS4 A;  2ZB9 A;  3GO5 A;  3FWE A;  4H4K C;  1V4R A;  3V8K A;  2DFF A;  1KQ9 A;  2PMH A;  2IU5 A;  3ABL H;  4MQV A;  4IRG A;  2DA6 A;  4HLX A;  5A2Q Z;  3S16 J;  1REP C;  2G7G A;  5E3M A;  3CC4 I;  2MGQ A;  1K78 B;  4CYC B;  2OZ6 A;  1WI3 A;  2BGC A;  4BAC A;  5CVR A;  1Q1H A;  2ELK A;  4IHX A;  3G73 A;  2QZ8 A;  1MDM A;  2IRF G;  1O4X A;  2AO9 A;  1CGP A;  3MVP A;  2XAU A;  2HKX A;  2UXP A;  2GXB A;  2KMU A;  2KPM A;  2MD5 A;  3CO7 C;  4HZF A;  3KZY A;  2DA1 A;  3RTR A;  4BBR J;  2G7U A;  2VB6 A;  3JW4 A;  5L3C A;  3GVA A;  2PN6 A;  3ZQH A;  1SMT A;  1ITY A;  5DEQ A;  2DA2 A;  4I99 C;  4F55 A;  4DZJ A;  4DYC A;  2QKM B;  3CCJ I;  1JXS A;  1X4P A;  1ZGJ A;  1UHW A;  3KZI C;  2MC3 A;  5JI6 A;  1W5S A;  3IH3 A;  4ZTF A;  4KT5 C;  5K7F A;  3ZQQ A;  3VOX A;  2E2I J;  3GTL J;  3EQL F;  3I55 I;  2CH0 A;  2HR3 A;  1FLI A;  4M9Z A;  4EM1 A;  5DS9 A;  1YO5 C;  2HDD A;  2CFX A;  4XNF A;  1TC3 C;  3B6A A;  4K2E A;  5GPA A;  5LGU A;  2K27 A;  1TWA J;  2AXT C;  2CUF A;  1WJF A;  5CKT A;  2EZI A;  5EZG A;  1CF7 A;  4NNJ A;  3B02 A;  1BBY A;  2W82 A;  2JA6 J;  3CCY A;  3MZ8 A;  3CQZ J;  1I6X A;  5KCM A;  2X0L A;  3H0D A;  4J00 A;  5K5Q A;  2JA5 J;  4TV7 A;  2W53 A;  1YYV A;  5C4Y A;  3K2Z A;  2K85 A;  3Q9S A;  4LIT A;  1Z3X A;  2EIM H;  2EIJ H;  1MW7 A;  3CLQ A;  4CIC A;  1SD7 A;  1VI0 A;  3CUQ A;  4C30 A;  4D9J A;  2AHQ A;  4I2O A;  1NTC A;  3K70 C;  3S3N A;  1D0Z A;  3OYH A;  2ACJ A;  2NVU B;  1TQP A;  1XS9 A;  5ILV A;  4B8X A;  1ETW A;  2X1C A;  4OOI A;  3CCL I;  2AS5 F;  4BH9 A;  2Q24 A;  3IRQ A;  1FMW A;  1ZAO A;  3HIF A;  1IXC A;  2V6C A;  4XKV A;  2OQG A;  3K4C A;  5TJJ A;  1VQK I;  3NNR A;  2NS0 A;  1ON2 A;  2XSD C;  3KP3 A;  3DEU A;  3ZMV A;  1X1P A;  2F4O B;  1MNM C;  4EJT A;  3QYB A;  2PFV A;  1VQO I;  2L9N A;  3HM5 A;  3SJM A;  5E3O A;  2IVM A;  5IT9 Z;  3I4M J;  4P1W A;  1WJ5 A;  1JHF A;  2JRT A;  2RNJ A;  2O0Y A;  2BE5 F;  3RKQ A;  4XKW A;  2VBZ A;  3JCU C;  1U0J A;  5CPR B;  1DGR M;  3QYF A;  2PJR A;  2QKO A;  2LF8 A;  4FET A;  3R61 A;  1LVA A;  2D5V A;  2V4J C;  4M9S A;  1ZRF A;  3N4M A;  3EPZ A;  3AQT A;  1FBQ A;  2XKP A;  2YVE A;  4YFX F;  4HQM A;  3WGG A;  1JE8 A;  3PO2 J;  4G7O F;  1IRZ A;  1DQU A;  3VPR A;  3E7L A;  1LVK A;  4U88 A;  2WV1 A;  1S72 I;  4GFK A;  5FFZ A;  1WGX A;  2AQE A;  2VQH A;  1XD7 A;  1WJA A;  3CDI A;  4AF5 A;  2EIK H;  4HLY A;  2ZBK A;  3E1S A;  4PZJ A;  4A3K J;  2M7B A;  4XBF A;  2JA2 A;  2XIG A;  1HST A;  4UXN A;  1VQ8 I;  2QTQ A;  1XGN A;  2DW4 A;  4HA8 A;  3RPU A;  4DZP A;  3NAR A;  4XRS G;  5D19 A;  4KNY A;  1J9I A;  5LLQ A;  4YII A;  1OJL A;  5E17 F;  4HV5 A;  1YIO A;  2L4M A;  5ICF A;  5HVQ C;  4L0Z B;  4UV8 A;  2LKP A;  2NOG A;  3BT9 A;  3T5X A;  3VTI A;  4JKZ A;  3NXC A; 
#chains in the Genus database with same CATH homology
 2VUM J;  1ENH A;  1WCM J;  4B4C A;  3HIM A;  1VF9 A;  3AQS A;  1MBG A;  1BL0 A;  2HYT A;  2R7Z J;  3KKC A;  3VVZ A;  1GUU A;  3O8H A;  4CGR A;  3TP0 A;  3SDG A;  3I4N J;  2K9S A;  3LHQ A;  5IOY A;  4XIC A;  3VOK A;  4A3D J;  3MKL A;  2HOT A;  4IHW A;  1OCP A;  4XID A;  4G12 A;  2ECB A;  2X6O A;  1JKR C;  2UXH A;  2WB1 N;  3BTI A;  1ETV A;  1FTT A;  5E3L A;  2KT0 A;  3S1N J;  4C3I J;  3TW7 A;  1NK3 P;  1D5Y A;  4XK4 A;  3M4O J;  2G3B A;  3GZI A;  3O60 A;  5FKK A;  2COB A;  3BNI A;  2XDN A;  1Q1V A;  1FJL A;  3V78 A;  2VKV A;  1ORK A;  2GLO A;  2DMT A;  3LSP A;  3OSG A;  3IH2 A;  1Z77 A;  2EZK A;  3QBM A;  4AC6 A;  3LOC A;  2QF7 A;  2PBX A;  1MBH A;  4UUS B;  2R93 J;  3HEF A;  5EDN A;  1RKT A;  3TED A;  3A01 A;  3S14 J;  1ZQ3 P;  2D6Y A;  3B81 A;  5AQC A;  4BKX A;  5C4X J;  4JYK A;  1ZR2 A;  3GEU A;  2KDZ A;  1QRY A;  3K7A J;  4MO7 A;  4BY1 J;  3COL A;  2NVQ J;  2RAE A;  5M5W J;  3QPS A;  3HTI A;  2OPT A;  3RZD J;  4A3J J;  1QVU A;  3S17 J;  5FLM J;  3JRI A;  2HOA A;  2P81 A;  1Z0X A;  1B72 B;  2M9H A;  2O8K A;  4A3F J;  3ZQL A;  1PUF A;  1JKO C;  2O9L A;  2DG7 A;  3BTJ A;  2LR8 A;  4ME9 A;  2HXI A;  2DA3 A;  2NP5 A;  1LE8 A;  1H88 C;  1IV6 A;  4LOC A;  2DN0 A;  1LFU P;  2OI8 A;  2LVS A;  1WH7 A;  2ZCX A;  5CW8 A;  4NDL A;  1BJZ A;  1SAN A;  5C4J J;  1GV5 A;  2R5Y A;  2GM4 A;  3BJB A;  2QWT A;  1OFC X;  2XPV A;  4RDU A;  5EF6 A;  1VND A;  1R9T J;  3L1P A;  1AKH A;  3BR6 A;  5M3M J;  2CJJ A;  2UXU A;  1GVD A;  4AC0 A;  3G56 A;  4AUX A;  3K2A A;  2F07 A;  1UI6 A;  3FK6 A;  4C3J J;  3GTP J;  5C44 J;  3S2D J;  2RHA A;  1Y1W J;  3HDD A;  3QQA A;  5EEA A;  3FK7 A;  2MSY A;  1A6I A;  1T33 A;  4CYC A;  1NK2 P;  2NX4 A;  2OER A;  2GEN A;  2EH3 A;  4JP0 A;  4M6V A;  1IDY A;  3M3Y J;  4ABZ A;  4A3M J;  1P7J A;  3VP5 A;  3C2B A;  3BQZ A;  2Y31 A;  2G7S A;  3RZO J;  3A01 B;  2HYJ A;  4NEL A;  3ZQG A;  4DW6 A;  1B8I A;  1X58 A;  2FQ4 A;  2ZCM A;  3UKG A;  1HOM A;  2LTP A;  2NS7 A;  1MBF A;  4X1E A;  3FRQ A;  4W97 A;  2GBY A;  5FKL A;  4JX4 A;  3BG9 A;  5EGO B;  3HOU J;  1IGN A;  1S7E A;  1CQT A;  3BG3 A;  2X9D A;  2ID6 A;  1JTX A;  1HCR A;  1I50 J;  3OSF A;  2JA7 J;  2FD5 A;  3F1B A;  1XG1 A;  5IP9 J;  5DAJ A;  1HF0 A;  3EUP A;  1MBK A;  1GDT A;  1LE8 B;  1MSF C;  2HXO A;  2M2E A;  4MK6 A;  1W0T A;  3ANG A;  4UUT A;  1TWG J;  1UI5 A;  3ZQF A;  3DPJ A;  1JUP A;  2MG4 A;  3BR3 A;  4IHV A;  4A3L J;  4JNN A;  4GCL A;  1BW6 A;  2L0K A;  3NAU A;  4V2G A;  3LSJ A;  3Q0W A;  1MSE C;  2I10 A;  1ETO A;  3ZQC A;  3JRG A;  2UXI A;  3KZ9 A;  1TWH J;  3HOW J;  3A02 A;  2DJN A;  4FTH A;  2IBD A;  4C3H J;  4NN1 A;  3JR9 A;  5D1R A;  2DMN A;  2HKU A;  4GFL A;  5EG0 B;  5J3L A;  3S1R J;  3HOX J;  4Y52 J;  3KNW A;  1P7I A;  2Y2Z A;  4RBO A;  1BW5 A;  3LWJ A;  3G1L A;  4MFE A;  1WH5 A;  4BY7 J;  4QTR A;  2LFB A;  2CUE A;  4XRS A;  2HOS A;  1EF4 A;  3S2H J;  2L7Z A;  2DMU A;  2XB5 A;  2ME6 A;  3GTM J;  3F0C A;  4W1U A;  1MBE A;  1IG7 A;  1A5J A;  2DA7 A;  1HDP A;  1ETQ A;  2LLK A;  3JRE A;  1XC5 A;  2G7L A;  4IEJ A;  1ETK A;  1IUF A;  5BNG A;  1AHD P;  3BRU A;  1JUM A;  5GP9 A;  4C2M J;  3SFI A;  2LK2 A;  4EEF G;  1U8B A;  3JSJ A;  4ICH A;  4M3D A;  4QIW N;  5FGL A;  4M3B A;  2LP0 A;  3GTJ J;  2JWT A;  4A69 C;  5HAW A;  3GTO J;  5FLV A;  5HSZ A;  3HGG A;  5C3E J;  3NRG A;  1H89 C;  2EZH A;  2K9Q A;  4M3F A;  2Y9Z A;  1RKW A;  5J1U A;  5CXI A;  1UHS A;  3LSR A;  3PO3 J;  1Y1V J;  1I3Q J;  1JJ6 C;  3S1M J;  1GT0 C;  2ZCN A;  3JRF A;  4GFB A;  2R5Z A;  1BA5 A;  2GUH A;  2RAS A;  3JRD A;  5IPA A;  2E2H J;  2UXO A;  5JLW A;  2YU9 J;  3BHQ A;  3LNQ A;  3DEW A;  5FKM A;  2LY9 A;  2M8G X;  3BR5 A;  4S0H B;  2XGE A;  3ZQI A;  4HNV A;  3MNL A;  3GTQ J;  2V57 A;  3HOV J;  1APL C;  2Y0S N;  5GPC A;  3G1O A;  5EFY A;  3V6G A;  1E3O C;  3WHC A;  5F08 A;  2YVH A;  4YZE A;  2JJ7 A;  1F43 A;  2VKE A;  3Q0V A;  3CRJ A;  3O8G A;  1TWF J;  4FCY A;  2CQQ A;  1ETX A;  2TCT A;  2E1O A;  2ZOY A;  3CDL A;  1LFB A;  4Y7N J;  3ON4 A;  2XPU A;  3B6C A;  3H0G J;  2G0E A;  2FX0 A;  4FE4 A;  3IH4 A;  2L9R A;  3HKZ N;  5JLX A;  1IJW C;  1YRN A;  3RH2 A;  4I6Z A;  3LJL A;  1ZTR A;  1WPK A;  1FEX A;  3Q3S A;  1DU6 A;  1JGG A;  2K9N A;  2ZOZ A;  5FMP A;  3BCG A;  5M3F J;  2FJ1 A;  5IOZ A;  2JA8 J;  2O7T A;  1HLV A;  2JMW A;  3T6N A;  3OIO A;  4FE7 A;  3Q0U A;  3NPI A;  3QPL A;  5M5X J;  5F0C A;  3RD3 A;  5H9T A;  4A3I J;  1IDZ A;  5IP6 A;  3FKI J;  3BR0 A;  1MH4 A;  3VVY A;  3GTK J;  1MH3 A;  2NS8 A;  3BQY A;  3IV5 A;  2R5Z B;  1PUF B;  4A3G J;  1ETY A;  2MW8 A;  1K61 A;  1ZK8 A;  2OF7 A;  5IYD J;  2HQ5 A;  4MXM A;  5CXG A;  5HBU A;  4UDS A;  1JUS A;  3C07 A;  2NP3 A;  3H3V K;  5EYR A;  2GFN A;  3VVX A;  5F04 A;  3MN2 A;  1FIA A;  3D1N I;  3CWR A;  5E3N A;  2O7O A;  3PPB A;  2R5Y B;  1OCT C;  1QVT A;  5IYC J;  2H1K A;  1AU7 A;  4AYB N;  1I6H J;  3BR1 A;  5IYB J;  1AKH B;  2ZB9 A;  3HTJ A;  1UG2 A;  1HDD C;  2WGB A;  3CJD A;  1ZGW A;  2LKX A;  2IU5 A;  2VI6 A;  2DA6 A;  5M5Y J;  3S16 J;  4A93 J;  2QOP A;  2G7G A;  3P9T A;  2EQR A;  4FIS A;  5E3M A;  4J19 A;  2JN6 A;  2MGQ A;  2XPW A;  4CYC B;  5J1R A;  3DCF A;  3HBL A;  3ZOB A;  3ON2 A;  1SFO J;  2NVX J;  1WI3 A;  1JT0 A;  3QKX A;  5K7H A;  4GCK A;  1SGM A;  2ELK A;  1K83 J;  1W0U A;  4IHX A;  2CU7 A;  2PZ9 A;  1O4X A;  2AO9 A;  2DMP A;  1B8I B;  3MVP A;  5F0F A;  1DU0 A;  1B72 A;  2UXP A;  3BTL A;  1ZR4 A;  5FJ8 J;  1G2H A;  3IUV A;  1UMQ A;  2DA1 A;  4BBR J;  2W48 A;  3HOZ J;  3HE0 A;  2HI3 A;  5J1Y A;  1U9O A;  2WAQ N;  3ZQH A;  2DG8 A;  4V2F A;  3GTG J;  2FBQ A;  3S5R A;  5DTD A;  1RR7 A;  1ITY A;  4M3E A;  2JK3 A;  4BXX J;  2DA2 A;  3ANP A;  1QPI A;  4DZJ A;  4DYC A;  5K7Z A;  3VW0 A;  1FTZ A;  3JRB A;  3IH3 A;  4DYQ A;  1MBJ A;  3HB9 A;  5K7F A;  2R92 J;  3RQI A;  3HOY J;  3VOX A;  2E2I J;  3KKD A;  3GTL J;  2EZL A;  2HDD A;  5DS9 A;  1JKQ C;  3E7Q A;  1TC3 C;  2E2J J;  3GBG A;  3B6A A;  5IP7 J;  4KWA A;  3W6V A;  2Y30 A;  4D5C A;  2LD5 A;  5GPA A;  2REK A;  4JL3 A;  5D18 A;  1JKP C;  1TWA J;  5F1J A;  2CUF A;  3A03 A;  2EZI A;  5F27 A;  3TP3 A;  5EZG A;  2DMQ A;  2EBI A;  1FIP A;  2XGD A;  4A3C J;  1JT6 A;  2JA6 J;  3CCY A;  2L7M P;  3CQZ J;  4D5F A;  2JA5 J;  3LSG A;  3FIS A;  2W53 A;  4X6A J;  3TW6 A;  5C4Y A;  4B3A A;  5EGO A;  1X2N A;  1JJ8 C;  3HGY A;  1VI0 A;  2ME0 A;  2ID3 A;  4JX6 A;  2AHQ A;  3G7R A;  2K40 A;  4GCT A;  1NTC A;  3OOU A;  5EZH A;  5F0H A;  2H8R A;  5FKN A;  1ZKG A;  3PAS A;  3BG5 A;  1XS9 A;  3JRC A;  1T56 A;  1ETW A;  4A3B J;  3JRA A;  1RET A;  2Q24 A;  5FHP A;  3VW1 A;  1H8A C;  3G1M A;  1TWC J;  3VW2 A;  4I76 A;  3NNR A;  2CRG A;  2DA5 A;  2XSD C;  3EGQ A;  3NI7 A;  1MNM C;  2WUI A;  2R0Q C;  4MFD A;  2QIB A;  4ACI A;  3PM1 A;  2NVY J;  3HM5 A;  4L5E A;  3SJM A;  5E3O A;  1RES A;  3JRH A;  3I4M J;  4MIM A;  2NVT J;  4A3E J;  2XGC A;  3RKQ A;  2YUS A;  2XRL A;  2B63 J;  5EG0 A;  2XB0 X;  1VFC A;  2TRT A;  2CQX A;  1U78 A;  5HOD A;  4D7N A;  5K58 A;  1RPW A;  2QKO A;  1X2M A;  2D5V A;  3VIB A;  5FKO A;  4JX5 A;  4B1R A;  3AQT A;  2E19 A;  4QSH A;  2DA4 A;  3CMY A;  2YVE A;  2M34 A;  1POG A;  4MLO A;  3PO2 J;  1IRZ A;  3VPR A;  4PXI A;  3E7L A;  2WV1 A;  1U9N A;  2PMZ N;  4GFK A;  4XRM A;  1WGX A;  2L7F P;  2VPR A;  4M3G A;  4UUS A;  2QCO A;  4IHY A;  3BR2 A;  4AF5 A;  2ECC A;  3S15 J;  4DYR A;  3WHB A;  4A3K J;  4D7M A;  3FIW A;  2X48 A;  1F36 A;  3S1Q J;  2QTQ A;  2N8G A;  2YS9 A;  2IEK A;  4DZP A;  3NAR A;  4XRS G;  5D19 A;  1GV2 A;  2M0C A;  1JTY A;  3BTC A;  1YRN B;  4BBS J;  4HKU A;  9ANT A;  1OJL A;  3HTH A;  3VUQ A;  1IC8 A;  2DTZ A;  3HTA A;  2Y9Y A;  3BT9 A;  2NOG A;  2IAI A;  4L62 A;  4JKZ A;  3NXC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...