5GQSA

Nmr based solution structure of pts system, galactitol-specific iib component from methicillin resistant staphylococcus aureus
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
92
structure length
92
Chain Sequence
MKQVLVACGAGIATSTVVNNAIEEMAKEHNIKVDIKQIKITEVGPYEDTADLLVTTAMTKKEYKFPVINARNFLTGIGIEETKQQILTELQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR based solution structure of PTS system, galactitol-specific IIB component from methicillin resistant Staphylococcus aureus
rcsb
source organism Staphylococcus aureus
molecule tags Transport protein
molecule keywords PTS galactitol transporter subunit IIB
total genus 13
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2016-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02302 PTS_IIB PTS system, Lactose/Cellobiose specific IIB subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5gqsA00
2FMHA 2PKXA 2PLNA 3CG4A 4G0YA 4QICA 4MYRA 3QEMA 2W42A 1ZAYA 1DRJA 4YR7A 5FWXB 3DZDA 1F4VA 2LUOA 4MGEA 1Y1LA 2B4AA 4LX8A 2QVCA 2RJOA 2PUGA 4RK6A 4H60A 5JS1A 2LIVA 4XFKA 1JFSA 4KPYA 4TLMB 1ZY2A 3TO5A 4W5RA 4RXUA 3OM0A 4YP9A 1TLFA 4Z4CA 4N41A 1MVOA 2IKSA 1ZGGA 4MLDA 3QEMB 5E3JA 4IILA 5KQMA 3HSYA 3KLOA 4WWHA 3O1JC 1JWLA 3KLNA 3H5TA 5IUJC 3C97A 4Y9TA 1VLZA 1BA2A 2YHAA 2E4VA 3CNBA 2CWDA 5DTEA 2HQBA 1EAYA 4LDZA 5FWYB 3EAFA 3N75A 4OATA 3CLKA 4G0ZA 5IULC 5C5CA 4MR7A 5KC8A 2A9RA 1USKA 2H3HA 2FMKA 4F06A 4MQFB 3ILYA 4UHKA 2L2QA 1M5TA 2YHBA 2ID7A 1VRVA 4JB0A 4E7PA 1SXIA 3H5VA 4P98A 4MAAA 3MA0A 1ZESA 2A9OA 3EULA 4WXMA 3UUGA 5JNSA 4Z4HA 3SAJA 3SY8A 4YGXB 1YIOA 2CD7A 2PL1A 2R4QA 2VUHB 1D1QA 3RQIA 5KWSA 2FQYA 4F8JA 1NXTA 1M2FA 1PUXA 3FFTA 4IMIB 4JP1A 3RVQA 2PUDA 2KYRA 4D6YA 3OLZA 3Q7TA 3F7NA 4N0QA 4ETNA 5ED4A 2MYUA 4MR7B 3QLUA 8ABPA 3QLVC 3MQ4A 3FMVA 4MQFA 3L49A 1JYFA 3T38A 3HUTA 3F6PA 3FFWA 4IF4A 3JY6A 2PUEA 1W9HA 2FSPA 5TPWB 1ABEA 1DC8A 3RVPA 2GI4A 1FFWA 5EWMB 4D6XA 2MYNA 2L17A 4OLBA 5TQ2B 5HSGA 4MQEB 4FB4A 2FLKA 1A0OA 1DP4A 1YK0A 4O1HA 1E2BA 2GWRA 3LUDA 3HXMA 4EYQA 3IP5A 3HS3A 3EDCA 3IPAA 3Q41A 2FQWA 1PEYA 3N0WA 1P6UA 4W5TA 5KQGA 3H1EA 1QKKA 3R0JA 4EY3A 4Z9AA 1SXHA 5TPWA 3LUJA 1XWWA 3S99A 1F51E 1QO0D 3N6VA 3HVRA 1ABFA 3GYBA 3RVNA 4EYKA 1Z13A 2CHEA 4MQEA 3O2QB 3I45A 5IBQA 4NCAA 1GCGA 3KS9A 4RY9A 3N8IA 3LOPA 1SRRA 3KSMA 4OLAA 2P4UA 3OMXA 3FFXA 1B00A 4WZZA 1P8AA 3ROFA 1BDJA 5JS2A 4Q7EA 1DZ3A 3H5WA 3JPWA 6ABPA 3E61A 2M98A 2E4XA 4LE2A 2OENG 3OO0A 3Q7RA 5JNWA 4KV7A 3RVJA 1M2EA 2NT4A 1URPA 1A2OA 4F12A 2CHFA 1QNLA 4G0OA 3CKMA 1YMUA 3M9XA 1U8TA 3KYIB 1CYEA 1K68A 3Q9SA 2Q5CA 1RNLA 1ZN2A 3KCNA 4Z9BA 4Z4GA 2HSGA 5FBKA 4XASA 4JAVC 4XAQA 1YK1A 3GBVA 3P9YA 3RVMA 2R48A 3CRNA 3UK0A 3NHZA 5PNTA 4DN6A 4N76A 4FE7A 1DBQA 3IPCA 4YRZA 1MB3A 3QLVA 4NV3A 1FFSA 4G97A 1YTUA 1TM2A 3BRQA 3OLVA 4KNYA 5HKOA 2FQXA 4Z4FA 5CNIA 5T7BA 5EWLA 1D1PA 3JVIA 4RK4A 4TLLB 1PHRA 1PNTA 2JB9A 5FBHA 5B3JA 1PEAA 1JH9A 5HQJA 5CNKA 1Z18A 2WJAA 1SXGA 3I42A 4OG2A 2QU7A 4P1ZA 3T95A 4JA2A 1U2QA 4W5OA 4B09A 2HQRA 4ZMRA 2FN8A 2LP4Y 5IUNC 4XXHA 3LUGA 2PJUA 3C3WA 3GBPA 1RXEA 1ZDMA 4G0MA 3O74A 4W5QA 3K4HA 3O75A 5JNRA 3KHTA 5TQ2A 2A9PA 3F6CA 1PNRA 5EWLB 1GUBA 3LUCA 3DLHA 3W9SA 1DCKA 4KFCA 4PEVA 1ISSA 4HYEA 1QP0A 1JBEA 3FGZA 1RZRA 3IDOA 2OQRA 1ZH4A 2DRIA 3QELA 4EUKA 3H75A 2WRZA 2PE5A 3BILA 2B1JA 5TQ0B 1CHNA 1P2FA 3VNBA 5KQLA 3HV2A 3RVKA 4MPTA 3SG0A 3RVRA 1QPZA 2HJ9A 4LE1A 2F8SA 1Z26A 2WMYA 3O1HB 2MYPA 3OLYA 2R25B 4MS4A 1Z15A 4LZLA 1LJUA 2ZAYA 4ML3A 5TPZA 4HNQA 4QYMA 2MSLA 2QV0A 3M9WA 4MR9A 2RDMA 3A0UA 1ZHHA 3OLWA 4KK3A 5TQ0A 3RVSA 5B3JC 3KKEA 3HJFA 1KRWA 3QLTA 1Z12A 5DCLA 3RVOA 2IYNA 2ZWMA 3HM9A 3H6HA 4ZPJA 1LBHA 4KK4A 2WB4A 5DKFA 1TMYA 5D2CA 4MS4B 3N53A 4G0XA 4NQRA 1D2AA 4MS3B 4RK0A 3H5OA 4G0PA 2VUIB 2N9UA 1FQWA 1GUDA 2L19A 4KVFA 3TMYA 4HNRA 5BR1A 4MR8A 4OTZA 2IDMA 4EGSA 3L6UA 2R47A 4N0PA 1KGSA 3LFTA 3GWGA 1JLKA 3A0RB 1NY5A 3NNSA 1T34A 1JF8A 4LE0A 3D8UA 2WWVD 2F8TA 2TMYA 3A10A 3C3KA 1E6MA 1ZITA 3TD9A 4MLCA 2JVKA 4JASB 1TVMA 1NXWA 2QXYA 3KYJB 3FDFA 3LUKA 4TMYA 2AYZA 1BVHA 3ILHA 5IC5A 1ISRA 3Q15C 2X7XA 3SQNA 4CBVA 4OBBA 5GOTA 3I09A 3CFYA 1DRKA 4DADA 4ZMSA 2LPMA 3LUAA 4GNRA 4S05A 1Z2DA 3O1IC 4RXMA 4KRFA 1RXIA 4YLEA 3BREA 1M5UA 4F3TA 2FLWA 2QW1A 3N0RA 1ZH2A 2WJWA 3T6KA 5I4CA 3G85A 4RY0A 4XLTA 3EGCA 1NXSA 1JL3A 1NXXA 3LUHA 4IGAA 1USGA 5F64A 2MYTA 1DCMA 1APBA 5KI6A 1SD5A 2FEKA 1U2PA 4YWHA 2NZVG 5CNJA 3QELB 3C6QA 2IPMA 3GA5A 1OXKB 3QX8A 3ROTA 1QP7A 2E4ZA 1DBWA 2JRLA 4IRXA 3SM9A 1TJYA 2IOYA 4RZSA 2FTKE 3N0XA 1NXPA 1Z16A 1GCAA 1NTRA 2NT3A 3NBMA 3LTEA 1FFGA 4GPAA 2JCGA 4QPJC 4YO7A 3CU5A 1L5ZA 2A9QA 4M88A 4QYWA 1EWVA 1QMPA 3CHYA 5CNMA 4RV5A 4W5NA 2QR3A 3JVDA 3CG0A 4RU1A 2FW0A 3OQOA 4LDAA 1EHCA 3HZHA 4MR9B 4ZYLA 3H6GA 1Z17A 4EVRA 2PUBA 4KZKA 3CS3A 2VYCA 4JOQA 4YS6A 1OXBB 1ZVVA 4RKQA 3URMA 2PL9A 6CHYA 4YCSA 1YS6A 2FMIA 3TX6A 1KMIY 2IPAB 4Q6WA 1JFVA 2JVIA 3GV0A 4RKRA 4MS3A 2MSKA 1LJLA 2O20A 3MM4A 3RVLA 1AB6A 5BQ3A 1QP4A 1MB0A 1BDHA 4D74A 9ABPA 1I3CA 2GX6A 3B2NA 3QEKA 4MR8B 5IEBA 5TPZD 3VNAA 1USIA 3LKVA 1IIBA 4Z0NA 5TQJA 4WXEA 3HCWA 2HPHA 2QZJA 1JYEA 3QX9A 2FVYA 3JPYA 4MS1A 3UKJA 2E4YA 2LBPA 3K9CA 2FXIA 2J48A 3H1GA 3EQ2A 2PUAA 2P9HA 5KQPA 4ETIA 3HDVA 1L5YA 4RK1A 3MMNA 4MRMB 3DGFC 1JX6A 3JTEA 2E4UA 3OM1A 2I6FA 2GBPA 4RS3A 2PUCA 3BBLA 4EYGA 5IEJA 3F73A 4EVQA 4G86A 1DC7A 3CTPA 4O1IA 1YMVA 4MS1B 2VK2A 1NATA 4PE5B 1YVUA 3MIZA 3KTOA 4UHJA 1EWTA 3IP7A 3D02A 4YV7A 5C5EA 3QK7A 3EODA 3M6MD 4N47A 5IX8A 4KREA 1CEYA 1JHZA 2M1ZA 1NXOA 1DJMA 5IUKC 4RDCA 3LMKA 3GL9A 5CHYA 1A04A 2GKGA 1DBPA 2JBAA 1H9CA 1JDPA 3EQZA 4PYRA 5DGCA 3LUFA 3DLBA 1LBIA 2FKAA 1C0EA 1S8NA 1VKRA 4RXTA 5FWXA 5HM6A 4N03A 4RY8A 1RZRD 1HEYA 3KJXA 3OQNA 1BDIA 3H1FA 4ZJPA 4WT7A 3GRCA 3NHMA 2PMCA 2FN9A 3EJWA 2AYXA 4IMJB 4DQDA 3JS5A 1DG9A 1D4ZA 3H5LA 4L4UA 1GLGA 1QQAA 2ID9A 1RPJA 4EVSA 3RH0A 2RGYA 3HK2A 2JBAB 2XDYA 4F11A 1KRXA 4S04A 3SNKA 3GT7A 1Z25A 1AB5A 5BRJA 5BRAA 2FEWB 3OQMA 3OMWA 1VPWA 5ABPA 1XHFA 3HUUA 3MF4A 3OO1A 3NNNA 5JNVA 4KMRA 4JB2A 5DLEA 4Q6BA 4H3KB 5FWYA 1EFAA 1UDRA 2HQOA 1E6KA 1WETA 3HO1A 4HNSA 5JNUA 2E4WA 4RK5A 2QSJA 3BRSA 3HEBA 3E3MA 3O2SB 1E6LA 5T3YA 2FEPA 2WY2D 4H3HB 3G1WA 3LKBA 4G0QA 4Z4EA 4Z4IA 4Z99A 2JVJA 1MIHA 4TN5A 4L85A 3Q7SA 4FE4A 3A3KA 1QQBA 5GQSA 2FMFA 3DGEC 5TE9A 5KC9A 4PZ0A 1Z2EA 4ETMA 5EWJB 4E7OA 1BAPA 1U04A 4RWEA 4NCBA 4KQ9A 1YS7A 2JK1A 3T8YA 3IP6A 1P6QA 3DBIA 4XARA 1ZGZA 3O2JA 4LRQA 1NXVA 1D5WA 1R8JA 1FSPA 3QLUC 4NICA 2IPLA 2NZUG 3I5AA 1W25A 2IPNA 1K66A 4MRMA 4PICA 1XHEA 2QVGA 4RK7A 3CZCA 2H0AA 5EWMA 3MYYA 3HDGA 5EWJA 5JNTA 1J56A 2PAFA 4O5AA 4KQCA 3O21A 2V0NA 1LK0A 3OLXA 1U0SY 4RSMA 4EYOA 1EWKA 1QO0A 2MSWA 4WUTA 3CZ5A 2PUFA 1C4WA 2RJNA 3C3MA 3NNDA 3KG2A 3IP9A 1JFTA 2BGGA 1DCFA 3TB6A 2NUBA 7ABPA 1MAVA 2L18A 1JDNA 3H5IA
chains in the Genus database with same CATH superfamily
2VKQA 3KZ1E 1WS6A 4HRXA 2AMJA 3D3KA 4HEA6 3JQ8A 3TQQA 2YY5A 2W42A 3QVOA 3PZBA 3DZDA 3DTVB 1GP2A 2DWCA 2J08A 3QVMA 1NBME 4HVAA 1GA4A 1Y1RA 2EBHX 1R8SA 4A8TA 4E4TA 5JCPA 5HIMA 1ECLA 4FCCA 1UOQA 2YS6A 2R3SA 2FGJA 3GPDG 2D2FA 4EGCB 3BJRA 4H16A 4HAXA 4RK6A 3IHWA 2HNKA 5CBPA 1ZG3A 5KVCA 3LBYA 2V7GA 4G8JA 4BFUA 4TUYA 1MDBA 1ZIPA 2XE6A 3ZQJA 1VXOA 4YJ2F 4LCEA 2YBEA 4WOCA 4ZK2A 2ODNA 3A1FA 3JZIA 4DCTA 3EEYA 1E3LA 3FJ1A 2GF2A 2G04A 2TECE 2VJMB 1J24A 4P6VF 2W6NA 4ZCLA 4EGJA 3DOUA 2JCBA 5MGNA 3EZYA 1XMQB 2ZS8A 2BR5A 1MUUA 3H5TA 3KLBA 4LG1A 4WA7A 1P29A 3A9WA 2ZS9A 1OSNA 5F3DA 4A03A 1WXHA 2ZJYA 3CE6A 2XB2A 13PKA 1NIJA 2YVLA 3MRTA 1H5UA 1SOAA 1CDOA 1WUIS 1U3DA 3QWAA 3UICA 5K0NA 1NOIA 3GUYA 1JZTA 2ZOSA 3N75A 3NWJA 1QK4A 1W29A 4K9SA 1V3UA 2OXRA 2DVMA 2BEUA 3FZYA 1E1DA 5K0FA 2FMKA 3LPCA 3GARA 3ZZ1A 4LOAA 2EKQA 5JCZA 1DEAA 4L4XA 4EP1A 2JLXA 2WIGA 2GARA 2R6AA 3FJYA 3PQ6A 4UCWA 4TLDA 4A0FA 4I6EA 4G1CA 1XJWA 1UBRS 3R0XA 4LTDA 3EULA 3UUGA 1U0HC 1P1BA 4WTOA 1JAXA 3O8QB 3LSTA 3ZDBA 1T8SA 1U0NA 1F2DA 1IHPA 3OSZA 4K3VA 3T9AA 2CMHA 4UHCA 4IIJA 4IMIB 2BV3A 3DUFA 5L7TA 3R3JA 3UY4A 3V5NA 2XLCA 4UBJA 1TZJA 8ABPA 2K7FA 4MYTA 3V6LA 3EPLA 3MQ4A 3KOOA 1HYQA 1W5EA 1IE3A 1ZZEA 3FUXA 1ADFA 3NUGA 3DOCA 4Y9RA 1N0WA 4NV0A 5IN5A 5FTJA 2XUPA 1HE4A 2G09A 3AERB 4EK9A 1YTLA 2QJFA 3H9EO 3OQBA 4LRTB 1GDTA 4JD5A 3PDJA 3WY9A 3J81k 2C7OA 3C48A 1DKUA 4HI0E 1ADCA 1HX7A 1U5BA 2Y67A 2YZ2A 1MJGM 5ERYA 3PNBA 1Z07A 3RRBA 1A5ZA 1YK0A 3JU3A 4ZVNA 1SAYA 4HH1A 3CWCA 4MQMA 4YDQA 5GIPE 1G8SA 1Y63A 4YONB 3EXEA 3NO4A 4KIJA 4M0MA 3IP5A 3IDFA 1B2LA 4ARZB 3WSTA 1GKKA 4UEJA 3UA3A 1DMRA 2FEXA 3L3BA 3QG5A 1DJNA 1AD2A 1IN7A 1SBYA 1XZ8A 2CBXA 1E2PA 3CRMA 1GLNA 1XVVA 2NPIA 3EUFA 5EA2A 2GK3A 4EB3A 1TCUA 2HWWA 3D2LA 3L46A 4ITRC 2BKVA 4JJKA 1K92A 3A7DA 1BDBA 4IS3A 4N7RA 3V8MA 4DPLA 4DUGA 4EYKA 4F38A 2J6HA 2NU9A 3LQ4A 3B6IA 1Y4UA 2FPPB 3D9QX 1T3HA 1GPAA 3DZ8A 3MGBA 3MLBA 1CQJB 4A16A 4LJ9A 2FF7A 5KWEA 1ODSA 1YUMA 4DNOA 1XKQA 3WB0A 4MA0A 6ABPA 3BIWA 4HBGA 1MX1A 1JQLB 2PWAA 5TEWA 3KB8A 2HGSA 3AHCA 5C9ZA 3N2NA 3TLGA 2HYDA 2XYHA 3CRRA 4PONA 2J0UA 3QE0A 3RVJA 3M4YA 4AP6A 4RDHA 1RYEA 3BULA 4EI9A 1UPTA 1URPA 3DQPA 2I9PA 3D4OA 3B5EA 1U8TA 1K8RA 1QCDA 2VDMB 2VF2A 1HRKA 1YU6A 5BYKA 1TRKA 1PR2A 2IELA 3DAYA 4MPDA 1REQB 3KPUA 3H11A 1TZ2A 5FBKA 5BXQC 2CMFA 4B7ZA 4PV7A 3U1VA 4W82A 3CF4G 5FTMA 4D0NA 2WILA 2Q1YA 4XRGA 8AT1A 3IP3A 1TUBA 2G06A 1CF9A 2NTVA 2QMHA 1B23P 2O8EA 1GPBA 2IYSA 1AQ6A 1N0UA 3OD5A 3AEQA 3EDOA 1E2LA 3AFOA 3HQ4O 4L8YA 3K1ZA 4XYGA 3LL4A 4DMFA 1F3LA 1EBBA 5TB5A 3ZHYA 1S2IA 1RAGA 2YR0A 3T3NA 1D1PA 2IUUA 2ACVA 2NZJA 3Q6NA 3ZK8A 4TLLB 2JB9A 5B3JA 2X1VA 1KL7A 3V2IA 1E94E 3S0JA 2C92A 1Z18A 3DD1A 3ZHBA 2WSMA 3U6BA 4NNPA 3E7FA 2EFYA 3EDMA 4ZQEA 2I7CA 3D7KA 1SXPA 1OJLA 3BHIA 3WLHA 1OHHA 4F1WA 3W8FA 1IJEA 1GGFA 5FBQB 2YWCA 2P2NA 1CUIA 4ZOCA 2IU3A 1RXEA 1J7KA 4Q4AB 2QUAA 1SD1A 1OYYA 2PRYA 5JDCA 2O8BB 2AFHB 1RYYA 4JHLA 5K8VA 3BFXA 2GM5A 1CQWA 2R85A 1NVMB 2QJWA 2J6BA 3H84A 3G9TA 1EVEA 1RZRA 4C6TB 1QHHA 1V6AA 1VMAA 2XT0A 4J1QA 1EGQA 3UZUA 1SBIA 1ZD1A 2IYTA 4NOKA 4YRQA 1JHMA 1TRHA 2X5NA 1UWCA 2DTXA 3U49A 4TTTS 4DJAA 3BSSA 1IY9A 1KVQA 3OURA 1BMDA 4PRYA 4AYWA 4AX4A 2EKLA 2V03A 2PLWA 2E9SA 1DIHA 3SQMA 1R6BX 3IGFA 1MMFB 3UAWA 1LQUA 2P8JA 4UTZA 4Y2YA 1G7CA 4LJ5A 1Z26A 3FUWA 3AJ8A 1J8YF 3PE6A 4QOSA 4MQUA 4TV9F 1N92A 3H2YA 1TTTA 1NVDA 3UANA 4OXXA 1Z15A 4LZLA 4BNGA 3M4NA 1KFKB 1Y8ZA 1HKHA 3NBYC 1THMA 4CLDA 4MEJA 2NZYA 1ODJA 1UBUS 1G41A 3C3YA 4R83A 3VBCA 4FEGA 5CT4A 1IN1A 3AF0A 1YZKA 4CKXA 3WK8A 4N01A 1TA0A 1KRWA 1SQFA 3O8OA 4J07A 5DCLA 5HTOA 2QP4A 2VXBA 3BMNB 3FVTA 4O25A 3OTWA 4XIJA 4F4DA 2NG1A 4UTXA 3IQFA 2B4QA 5CB4A 5D2CA 2HUNA 2W2KA 5FBRB 3LHKA 4OBWA 2Z2IA 1LX6A 3OC0A 1DQNA 1MFZA 4M76B 4X65B 2G28A 4LECA 3K0CA 5JCJA 4ZI2A 4PBRA 2CE7A 1V7ZA 2ZYWX 1T3LA 4W63A 2ZUFA 3DCYA 5IF3A 1EB8A 1F48A 3OQ1A 5B7PA 3V1UA 1PGJA 3VHLB 3IOMA 5LXTB 5E6UB 3ETGA 4GM0A 1JLKA 3CB2A 2ZBUA 4WK2B 5IJ0B 4BQPA 3AETA 4KE7A 3HYLA 2PT5A 1OIXA 5J4LA 1NF9A 1JEQA 2MMGA 3A4MA 3IT1A 2BF7A 4JUFA 2YFYA 4MVJG 5D8DA 4TT3D 2LDBA 4B3DA 1CT9A 4ZVOA 4ZIRA 3FY4A 1RLTA 1ZR4A 2R5WA 3NW9A 2ZWAA 3SQNA 3OLQA 1G20A 1L1QA 4RLSA 1NDHA 3D1JA 1T1JA 4XKJA 4Q19A 3RYIA 3RC3A 4Z3OA 4G5OA 5CK4A 3ZCXA 4WLFA 3WL8A 1GQYA 5BNIA 3VR3A 5F98A 1XLTA 4GEGA 4MVJD 4GBMA 4M0CA 3FKJA 4ER7A 1SURA 2PGNA 4RZXA 3VYSB 4BB9A 1DAPA 2AGVA 5AM5A 4AZWA 3FX2A 1JSLA 1X0XA 2PGJA 1SU4A 2N46A 3G5LA 4G1FA 2XD9A 3I2KA 3LUHA 2C07A 1DPGA 1F8GA 1I7LA 1APBA 2ODAA 3EDYA 5CEFA 4V0RA 4BAGA 5EJAA 4EQ6A 5M7EA 2GA9A 2IX3A 4CMEC 2XNSA 3V7WA 4IJ5A 2C54A 4GICA 1LLUA 3EA5A 4K6FA 4AN4A 4XLZA 4CMJA 2OB1A 2NUAA 1DX4A 3ENNA 3UJBA 5LOVF 1OYWA 3D5TA 5FIUA 1H69A 2P2DA 2A0WA 1CJBA 1YJQA 2BHNA 3DWGA 2BFBB 3KSRA 3ZDZB 4W5NA 3K32A 1I2ZA 3T4XA 1V5EA 1U98A 2HCBA 4AN0A 4ER6A 4J7XA 2OHGA 2GEKA 2FWMX 4LDAA 4Q4CA 1ZVQA 1TYEB 1P6XA 1CR1A 1RKQA 4IICA 1WMFA 3WKDA 4BFSA 2QUJA 3BCRA 4ZYLA 3L4KA 1JLRA 1R2QA 1HTBA 1PW7A 1M1YB 1S02A 3BJIC 2WJ6A 4GMDA 1TTQB 3L92A 2VA9A 2YIMA 3P2EA 1FFHA 1T9KA 2AI1A 2I8CA 4YRDA 3U9TA 3EG5A 2IH2A 2CHVA 2OILA 1A71A 4NYMR 3PQ5A 4UFOA 1ZBQA 3IIJA 1NMEA 4JOQA 2A1UB 2HEGA 4UQPA 3FBTA 4NESA 4O4JF 3JQBC 4NU0A 4DQXA 5HR5A 2PL9A 3KAPA 3RYCB 3FPSA 2IUYA 2YXEA 3RS5A 4ERXA 5DN6D 1LLCA 3DL2A 4KQXA 1CFJA 4D82A 1CNMA 3AVVA 1R4MA 3GV0A 4QAQA 2AJBA 1GDHA 1GILA 2O20A 4GQBA 4LMAA 4PIVA 1DTWB 1UAAA 1G8FA 3ITKA 4LSWA 1JPJA 1TGYA 3ZDFA 3INGA 3LRTA 5KYKA 2UAGA 3A1CA 4LF6B 2WTMA 2IS1A 3KC2A 2IYRA 2IIVA 2OM2A 2HBYA 2GO7A 5L3SA 2OYRA 1Y9EA 4BE4A 4HWPA 5IANA 3UV7A 4WLUA 4Z0HO 5IBCA 1SY7A 3PNVA 1KJNA 4R1OA 4BZZA 4UBLA 2LKDA 3G1TA 2I03A 1JYSA 3PLRA 1C3JA 1XWIA 2PIAA 3OOWA 3DPUA 4YBZA 2IS2A 3I12A 1SVLA 4ESHA 4OGWA 2HU5A 3SZOA 5K9ZA 2A58A 4UCXA 1OBVA 1U2EA 2XCOA 4OM8A 3D0KA 4HSGA 1JEDA 2NVOA 2YDYA 3FCAA 4HPJB 4XSVA 2GM9A 5BT8A 1PT9A 3KKPA 3F73A 2ZITA 1OTYA 2EJVA 2GHIA 4UPDA 4KQGA 1NATA 3DNMA 3F96A 3RAPR 3VYRB 4D57A 5FP0A 2GXUA 3IP7A 3LAWA 3GFFA 3L18A 4R40A 3QP9A 1BRMA 5CFPA 3HCEA 3TE6A 1F06A 1P60A 2G83A 4JDUA 4PYRA 3LDFA 4CMKA 3E1KA 4MKFA 2BHSA 3THSA 3TG8A 1QH8A 1Q44A 3P2OA 3OQNA 2V5VA 4NBVA 3VJMA 2FP4A 3FLEA 1KYYA 1KEVA 1YJ5A 4NPCA 1QRDA 1GYPA 3EJWA 2UZ1B 4L9WA 5DM70 3IV7A 2G1KA 3IAS6 1KO8A 4ROTA 1Y42X 3U7RA 1QJCA 2X42A 3I83A 2A5GA 3FRHA 1NBHA 3F4LA 1OBFO 4C0QC 3R0QA 1KDVA 2ROQA 1Y8QB 3NHAA 4UM8B 1CP3A 3DLAA 5BN5A 5CDGA 5DGIA 1RWNA 4R05A 5B1IA 5EEGA 3MBKA 1YGPA 2ZB4A 2X4DA 3Q0TA 4DXAA 2QUIA 3PWSA 3OE4A 2HTFA 2FUNB 4H6VA 1I9GA 3ORFA 3G8YA 2HOQA 3GDGA 1BVUA 4GWGA 5BQOA 1NJ8A 3QI7A 4XFJA 3RE1A 5BRAA 3WS7A 4ZHQA 2R6JA 2IYEA 1PNQA 3OO1A 1Y8CA 3RYTC 2IXTA 2Q3JA 1FYVA 3UOAB 3E9CA 4Q6BA 1YXMA 5CT9A 5IAEA 2HT1A 3M6XA 1U28C 1XR3A 4B5LA 4LQLA 5C2JB 4BX8A 3MWGA 1VPVA 2C03A 2NO0A 1NSYA 2V55B 5HMMA 2UUAB 2DR2A 1SHLA 3D6JA 4V0LA 1UKBA 521PA 3SJBA 1JUDA 3A3KA 1QQBA 1GNLA 3INRA 2Q8PA 3CLSC 3MUOA 4FI3F 2HX1A 1OZ0A 5EHIA 5ER6A 5THQA 1I2AA 1SB9A 5FJIA 3T3MB 1OXMA 2JCSA 3F3KA 1HSOA 3ZZMA 3PJGA 3QKRB 5BR8B 1U04A 2R6FA 2PZMA 3DLIA 4BTLA 2F6RA 4L9AA 3F3SA 3ZV7A 5BN4A 1P80A 3JWHA 3F8TA 3MQFA 4J1SA 1P6QA 4UVIA 2FFQA 3GLRA 5FR2A 1OBCA 5FUBA 2VI5A 3A4VA 3K09A 3O2JA 1UZMA 3GG2A 4M8LA 3EE6A 5TS3A 1PJQA 3FROA 3OUTA 1HYEA 2AN9A 1VMDA 4GECA 3PITA 3RRFA 4BMZA 4Z6KA 1NR1A 4ARIA 1LLFA 2GILA 3FCSB 1FDWA 3I5AA 3INYA 3ZGLA 4ID3A 4YUVA 4U7HA 3EFOB 2CZQA 4P53A 3HDGA 5JPCA 5K2OA 1R0XA 1Z7GA 2ZVDA 1R3DA 2DULA 2HREA 5KSPA 3AG6A 2ZLBA 1EXDA 4G1BA 3AB8A 2P3QA 2IODA 1X86B 2IH5A 4L9RA 4HZUA 3EMBA 1V8FA 2MHCA 1AQYA 4ITUA 4BO4A 5JO0A 1TMOA 2PXHA 1MO5A 2PKXA 2PWZA 1IBRA 2BDUA 4F8EA 1OLXA 3KQVA 5P8WA 1Q0UA 4B2YA 1L7VC 1EHIA 1P0PA 3REQB 2GPBA 3TJRA 5DNUA 1JN0A 1IXKA 2X2FA 3WWDA 4G8BA 3KDSE 4WESA 4A36A 3D4BA 1VKZA 4QEKA 1JXAA 4OYRA 1HLFA 3L5KA 1GAQA 5CDUA 5JS1A 1DG1G 3M81A 1E6WA 2D0OB 5H0IA 2AH5A 4WOKA 5DNEA 3DC2A 2JHGA 4JOCA 4H1HA 5FFMA 5K03A 4PSDA 4IJWA 4YHHB 3E82A 4MSUA 5DMXA 2BMFA 1VPDA 3ZHQA 3H9JA 1K5HA 1XBTA 4OQNA 2RK6A 5HK9A 1I80A 1UQTA 1JIVA 2XRFA 3RSCA 1NAHA 3JQFC 5EG5A 3BGVA 3SHTA 2XQKA 4MI9A 5JSHA 1R0SA 4FEEA 5EJ4A 5BV0A 3WGKA 4RZ2A 4B2LA 1TZMA 4GPIB 3KSBC 5TGTA 2QWXA 4LISA 3TNLA 2X8BA 3D54D 4AZ0A 2CSUA 4Q5IA 1OHHD 1Q20A 2FFRA 1UKCA 5A0TA 1I0ZA 1L6RA 3S7ZA 2QNRA 3UAXA 4LJ7A 1UPUA 5KNDH 5GM1A 1I4LD 1TT7A 5AK5A 2BM9A 4NZOA 3N7AA 5B12A 4PYMA 4JVSB 4RKWA 1P81A 4H6WA 2WWGA 3I1FA 4FYXA 5E1MA 4JFAA 1M6HA 1M5RA 4LF9B 2Y27A 4KN6A 3SY8A 7YASA 1W0CA 4WK0B 2R4QA 1AHIA 2VUHB 5JHHB 3HKEB 1E4EA 2A5JA 3PQCA 1PUXA 1RLIA 2Z0MA 4JL8A 1NBAA 3D8SA 3K0CC 3V7UA 4EYSA 3WJ2A 5K20A 3GBSA 5CJ2A 2WTAA 3GCGA 5EESA 1PV2A 3UMJA 4BB6A 2VEOA 3GJQA 3FZQA 2P90A 4EF4A 1YULA 1UWVA 1VKNA 2QBYA 4INZA 3FFWA 3HA7A 1V1RB 2H11A 3JY6A 4XDYA 1IDN1 2A5DA 2ZYIA 4IQ4A 4YYZA 3VAAA 4RJLA 3LWNA 4K28A 1LUAA 2L17A 4GG1A 1O9HA 2WJGA 1H4SA 5K01A 1YZ3A 1G17A 1KMQA 1WXFA 5DNCA 2QY9A 5HX7A 2AFIA 3PDIB 3N7UA 4G5QA 1VJCA 4B8ZA 4RV4A 3T9CA 3KOXA 4DOMA 3AINA 3ZIUA 2CFRA 2VRWA 2GOYA 3VNQA 1XKTA 1E7SA 2QK4A 4W5TA 1P6UA 1VYHA 1XA4A 4XH9B 5JDCC 3CJQA 5KNLA 1DAEA 2OUKA 3JYNA 4M60A 1LDYA 1RKBA 3ZY3A 4BO6A 1X9GA 5EN4A 4YUYA 1FRQA 5KU1A 2BAGA 2W2MA 3RANA 4UOEA 1HLDA 2CHEA 1JHQA 2WJVA 3I45A 3HVUA 4IFIA 4V3CA 1MIOB 1M2KA 6ADHA 1E1KA 1L7QA 2EEPA 1K98A 1TKBA 2P1DA 4C7OB 3KD2A 1DNPA 1G7SA 5K3BA 2RC5A 1GKYA 2DETA 4NBSA 1FYDA 1UOPA 3KZCA 2FSHA 3AUFA 4XLLA 3JPWA 4Q37A 4BLPA 1TCAA 1D09A 2YNMC 1KC1A 2E4XA 2MT9A 3N74A 5AW9A 4FNOA 1O5TA 2V7VA 3OO0A 2FR0A 5A7HA 3S2SA 3A05A 2B4TO 3ANSA 1Q16A 4TRMA 5EUMA 1D6NA 2M6RA 3GP5A 3OP1A 3EW9A 5CDHA 3L41A 1E9BA 1L7PA 2GQ0A 1YCGA 4KW7A 5JI3E 5F77A 2Q7XA 1A9XA 4BNJA 1T91A 3M9XA 3O2NA 1QIDA 2UZ0A 3UUFA 3L4BA 5FAKA 5HRCA 3C4JA 3RBZA 2VUSA 4X1YA 5A1TA 3Q9SA 4E2FA 1QC5B 2GEFA 4Z9BA 4AO6A 2Q9AA 2WF8A 2DQ4A 3P97A 3WMEA 2A7QA 1HYGA 3TB4A 3UJDA 1XAGA 2G8NA 2ZBVA 3FGNA 1SXJC 1QE5A 3BIFA 2O8FA 4BNFA 3GR6A 4MGZR 1E9DA 4NV3A 2OCXA 5SICE 3E18A 3MB5A 1U6IA 1SKMA 3LXXA 4HDOB 4LWPA 1ORVA 5E8RA 3THWA 2HA0A 2QJTA 4L4SA 4ZRDA 4UQLA 1GUZA 4G5HA 3PEUA 2DHQA 1VBFA 2Q5JA 4FQ5A 5FBHA 4A6EA 4IF6A 3UCFA 2DPMA 2PLFA 3FSGD 5F7ZA 1CUGA 3B1JA 1DHTA 4PPFA 4P1ZA 4F85A 4HNUA 4MULA 1U2QA 5ALWA 5JDIC 3OAAA 4KB5A 2QS9A 4MKXA 2FN8A 3LQ1A 1Q95A 5TRTA 3A9UA 4RS4A 4EJSC 5JAPA 1S3GA 2C2KA 2AZXA 2QDXA 1QONA 2YC2C 3LD9A 3RYHB 3RTDA 3W5VA 1PE0A 1JA9A 4QOEA 3AHDA 1X38A 3VOTA 3SHQA 1DIOB 1OFTA 3RU7A 2D7JA 4G89A 3A9RA 1QB8A 1LDMA 3EOBI 4Q1DA 3E6AA 1DCKA 1YAJA 2H1VA 2OEPA 4JC4A 4BZWA 4DRXB 3LIIA 3FGZA 3QV1A 4FJ0A 1Y81A 1TCBA 1ZH4A 2DRIA 1DUSA 2HK7A 3ZIDA 1YFZA 2F1IA 4MPRA 2ZM5A 2CNDA 2EFEB 1TF2A 2TMDA 2BM1A 1TPYA 3L6EA 3NH9A 4CKYA 4KR6A 1R5OA 2PFSA 2QTCA 3AZPA 4I2VA 2JANA 1QBGA 3GD7A 4K3UA 4KIWA 3R8XA 3ZHUA 1YFLA 2INGX 2QXUA 2XTAA 4DG8A 1PEDA 4NR0A 1AHHA 3OOJA 4NK4A 4N1AA 3TGWA 1G64A 4D99A 4D25A 3E27A 1HDRA 1Y7TA 4R2WA 3T9FA 2FJ0A 5IBRA 3LLCA 3LPAA 4QUBA 3GZNB 3AW9A 2Z9BA 4DMUB 3AUSA 2X7JA 4II3A 5I9SA 2A7XA 1ZI6A 1QXSA 1GZ3A 3A37A 2AG6A 2WAXA 2F3UA 2IZOA 3F47A 2XVAA 2QU8A 5LQDA 1U1CA 4ZI7A 4X7BA 4IINA 2NVUA 2NO7A 1OX6A 1DRUA 1ZU4A 2YTZA 3CC8A 1UZUA 1XCLA 3F8SA 4HGYA 3DPSA 3Q11A 3H6HA 3TVYA 3NHFA 4HP8A 4F9EA 4MITA 5HFNA 1HLPA 4F5WA 4ND5A 5JATA 3IIMA 1NQWA 3IT2A 2FPOA 3E3AA 4CM9A 4BV8A 1PJ2A 1Q1BA 1CEXA 2NUPB 3N5KA 3CF4A 4PHGA 2RKWA 5B4TA 1FQWA 2JD1A 2Z4SA 2Z98A 4B3JA 4DYVA 4H7JA 4NNOA 5BP7A 1EFLA 3SC2A 3T61A 2W83A 4BVAA 2JD0A 4EB8A 3U09A 3KKLA 4DV0B 2Y6UA 2X1MA 2VYVD 3SDSA 2AV6A 2UYYA 4YYEA 4DA0A 3GLVA 4TX1A 1Z83A 1KSJA 3VU8A 2QROA 2Y1FA 3D8UA 5FD8A 3KQQA 2OXEA 1T5SA 5ECGC 5J1TB 5JMPA 4BWFB 4C43A 5ITZB 3K0KA 1NPDA 2VNJA 5K4AA 1GPDG 1Z5PA 4L28A 1E0KA 4EG6A 1DAHA 4FZVA 1T5OA 2DU8A 3NTOA 3PGVA 4NDZA 5JSYA 4BVFA 4I5DA 4RIEA 2I2WA 5SY9A 1A50B 1PBTA 3A9TA 4MVJP 4OBBA 1O0BA 3PC3A 1N7HA 5JMWA 4ZDKA 4KQ1A 4M1SA 1RQ2A 4NZ9A 4KVGA 4J7AA 4LXXA 5KOJB 2XUJA 3SEQA 3N39C 4J4BA 3BF8A 1NJSA 5I4CA 4Z51A 6YASA 2JFHA 1LBEA 4HPWA 1KEKA 2BLLA 5JAMA 3BXOA 3ONWA 3ZVKA 4XVQA 1J99A 3NVAA 1AXRA 5DGDA 1BGXT 5HIJA 1UDBA 3HLKA 3RS9A 3FGOA 1EXMA 2BKEA 2Z8YM 3NDJA 4IGEA 1F12A 2ZYSA 1DDOA 4OP3A 5BW4A 5B7GA 2FLVA 2H8GA 1UEJA 3C16C 3HG7A 1IQUA 1W30A 3L8CA 4QJ5A 4ALMA 5HQTA 4IRXA 1B42A 2XCQA 4GBGA 1XNQB 3ZU4A 1XVTA 2HDHA 3BXFA 4RM2A 5C53B 2HXSA 5C5IA 4B44A 2NZ8A 2JAXA 2OT3B 2F9MA 2NM0A 3D3WB 4UXHA 2YFHA 5K0LA 3GUZA 4WLOA 3PHLA 1D6JA 2A9QA 3OEED 4M88A 3Q3HA 4H15A 3S1SA 2H4WA 1D0VA 4M36A 3GP8A 5DT9A 3CG0A 1QS0A 3IKLA 4GMFA 4ARVA 1Z6TA 4JEMA 2B83A 4QOFA 4TGLA 1EHCA 3D6AA 3A3PA 4ZWNA 4DIDA 4H7IA 1ND5A 4BS9A 2IYPA 3GHYA 2EKBA 1NR5A 2ZIFA 4F3CA 1IMJA 1I5OA 1YB1A 3HDYA 3NHYA 2AKEA 5ICMA 5DYNA 4B4WA 4E09A 2IU6A 1YZGA 2QLFA 3D4PA 2YIVX 3L7AA 2GS9A 1V11A 2HMYB 3H19A 1FDSA 3FF1A 4H35A 4H9GA 2IPAB 1EFPA 2PQ6A 4IIJF 4OGLA 3GEGA 3THRA 2MU1A 2DFNA 1G0NA 2JGLA 4UULA 4CCWA 1XTRA 5JD5A 2J41A 1EUQA 3KAQA 3EPPA 4L5IA 2SKEA 2PJRA 3QEKA 4AMYA 1QVVA 1Z0FA 3B89A 2NPOA 3OTIA 1XMOB 2WA2A 4G41A 2Q6TA 2BMDA 1XFAA 3VUFA 3WC4A 2QN1A 4OREX 4QUKA 1U1DA 2BFEB 3IUSA 1B76A 4TWRA 4D4MA 1FYXA 3MCAA 2VCEA 1GXSA 2NPFA 3MUFA 5EE1A 1D4FA 3SLGA 1JKXA 1LD3A 3JQFA 3UW3A 4IO0A 4F2HA 1Z35A 1SJ9A 2F43A 3D0QA 1CUYA 3SX0A 1GLVA 2EZ8A 1GRCA 3JAKA 4FFBA 5FORA 1XXHA 1DJQA 2X4LA 5REQA 2VO1A 1A96A 2G80A 2XTZA 2OXIA 1HSZA 1A82A 1T6ZA 2IZ1A 3P9XA 3G9ZA 4ICIA 3PWKA 3FUVA 3M9LA 3ROPA 3C6MA 5IMSA 5TT1A 5BNZA 5K0TA 2O8DA 2Q6IA 3E8SA 1NJ1A 1TC1A 3DVAB 4LK3A 4I0WB 4A3SA 4DWJA 2P40A 2YDXA 1SUWA 2F1HA 4Y1EA 3T0GA 1SIUA 2EG5A 3OA2A 4BNTA 5IN4A 3DMRA 1ZK1A 1XCJA 2OGTA 1ZI8A 4TV8F 4KNVA 2O8NA 3PIRA 1WDTA 1FX0A 3BGWA 1RRMA 1G5PA 3VH2A 4ENVA 3OT1B 3OUUA 1G4AE 4KXYA 3NHKA 3RIYA 4DQLA 2HV9A 2C8KA 2IHZA 4J3NA 1QAMA 3PK0A 4O5OA 4B35A 1DBPA 4RLQA 2XB4A 3DLBA 3LUFA 2EWMA 5CM9C 5AQEA 5FLXA 2H59A 1PWYE 3PX3A 4IDNA 4JOSA 4MW6A 4NU8X 3ZWAA 3OTQA 2GCOB 4EY6A 1RRCA 3QZUA 4N48A 3X43A 3A6PC 4B87A 5KAPA 3K6KA 1BCRB 3MRXA 1SC6A 4M0KA 4DLSA 2HMSA 1E64A 1TADA 2FN9A 5L4LA 3PDCA 2GZ1A 3ZKAA 4JV5B 2GWHA 1TM7E 1S4MA 2SNIE 3OFJA 2PMBA 3PXDA 1IVNA 2I76A 2DC1A 2DUWA 1Z4OA 1N6OA 2K87A 3L01A 2EIXA 2CV2A 2UYCA 1SN7A 1XNRB 1ZD5A 4IM7A 1W2WB 3R20A 4NE7A 4AG6A 5BSKA 2QRPA 2XDYA 2FXVA 4FMPA 4HDCA 4XR9A 4EG5A 3T7DA 1YRBA 1NPTO 3HBFA 4NJOA 1YE8A 2Z3VA 4DLAA 4EGQA 5LQCA 3PNKA 3IAFA 1NBMA 4ZQHA 4PBTA 2ZYHA 1K8XB 5DNAA 5LNK1 5TJHA 1ILEA 4MRSA 2WZCA 4PPYA 1NQTA 5D7NA 4DDWA 5CH3A 1PVDA 4B1FA 3KSUA 1T3SA 3GLSA 4G8CA 1BE8A 4V2IA 4X6YA 1BHQ1 1ECGA 4KL8S 4OHPA 1XOIA 2HMVA 4O2AB 1E6KA 1RWPA 4U7PB 1PR4A 1RAHA 1WMDA 2GBCA 3EUEA 4UM5A 4YT8A 1LCIA 1NYQA 5CCEA 2YNMA 1QRRA 1QAOA 3EPKA 1Y8RA 1JR3E 2R751 1INLA 2FPGA 1LRJA 3H0EA 5SZKB 3LIPA 3QHAA 4FE4A 3UJ6A 4QU5A 5HVNA 5A4MS 2IH4A 1JFFA 1CVIA 2JGMA 5LQMA 3BWCA 3FWHA 2EXXA 3DV0B 3NIDB 3PX7A 5CH5A 1P5FA 4JLJA 2FRVA 2GJ9A 5ALQA 3EQ7A 3GAZA 5EKXA 2ECOA 4DIUA 3WJAA 4LJYA 1BKDR 2YWHA 3BWYA 3F7TA 3AR4A 2ZPAA 3MOIA 3GVCA 3AKZA 2PRJA 3AONB 4G5RA 4FCWA 3PT5A 4QTZA 3QLUC 5DZSA 3GNTA 2ZEJA 1XSEA 2J30A 5H70A 2NZUG 2V9ZA 1TIBA 2QRJA 2WZBA 3C98A 5D1NA 1X8KA 1LGYA 1OZHA 2HLHA 1WVMA 1XHEA 2PG3A 2QVGA 3R24A 1NR7A 4ZT5A 4DLRA 5LKRA 5EWMA 2DQZA 3VX4A 4DUZB 1P2SA 3EF3A 4JB3A 1G66A 3ETEA 4RJ2A 3OZBA 1JDSA 4O5AA 2GAFA 3O21A 4KQCA 4RGVA 5F2KA 3VV3A 3C70A 3CW2A 3HBAA 1QX3A 3ZXSA 2G5PA 1LS6A 2BTOA 2MSWA 3VZRA 1G8MA 3CZ5A 1I1NA 2LW7A 3ZCTA 4RHEA 4W8HA 1G8KA 1K7XB 2ACKA 3IP9A 1SCNE 4WCVA 3RIXA 3VR2D 3W06A 1IVYA 5K6AA 2VTBA 3X1KA 5JJLA 4YO8A 4FYJA 2FMHA 1IH8A 1WF3A 3ROEA 4K9QA 4X00A 4IZIA 3A1DA 4B47A 3PHCA 2HJVA 4R3UC 1A8IA 4MGEA 2HTEA 1ILWA 4WZBB 4JWTA 5IWCA 2ZTLA 3KPJA 3Q4GA 3RFXA 3ADBA 4JQYA 1DIGA 2H54A 4EHAA 4PX5A 4EWLA 1S8AA 4TS9A 4DLWA 5FWNA 2EYQA 4ZEXA 5B6PA 2I6TA 4G1UC 2AI3A 2W6CX 4EFMA 2O7SA 2VF7A 3CPJB 4LZPA 1TOAA 2A1TR 3P0FA 4XOIA 5EIAA 1WHTA 4YCNA 1JV2B 4MV0A 5DBOA 3M8KA 4UUAA 5ECDA 5AVXA 1T4DA 1RPTA 2A59A 2JFZA 2RJ3A 1L5MA 3MWEB 3PNLA 3TZKA 3WZ2A 4I2NA 1E0SA 4B4UA 1W4BA 3NJRA 1R00A 2XCUA 2CHQA 4TTJA 5G02A 5G41A 1OH6A 3MYRA 1J20A 1UOOA 2ZUCA 4Y2XA 3JARA 4AY2A 3VNRA 3OUZA 2AJDA 2JFGA 2UZAA 4BP9A 2FWIA 1UMKA 3CLKA 4O8ZA 3AKCA 3PXXA 4K9NA 4X1KA 4BMOB 1KEZA 1YRQA 2FWRA 2W6PA 4FHCA 1WMAA 4LTNA 1T3TA 3JQ6A 2C1ZA 2ZT7A 1K4KA 4WNYA 4CMBA 4YUAA 3VC1A 4EENA 1R0WA 2P9EA 2GZHA 1E2DA 1ANKA 2VYNA 2YCLA 3P9SA 3C39A 1ZESA 1CS4C 2PK3A 3L8FA 3SSNA 5F35A 4F60A 4QXMA 3AVUA 2EERA 1IM8A 4RTMA 2ZBDA 2J3MA 4BNDA 4RTNA 1NRIA 1E7YA 1KI3A 2LGJA 2V3WA 3FPLA 3IX7A 4F8JA 5FH9A 1PG2A 1YBMA 1X92A 2FK7A 3K53A 1I2MA 1S9DA 1VPEA 2J3QA 4LOLA 3WNBA 3ZHXA 3ZWOA 2NP6A 4IY1A 4XVHA 1QLHA 2PUJA 3QGMA 4H1VA 5HUQA 3CW9A 2FHPA 3KO8A 2YV4A 3LGSA 1OA1A 1A5AB 1YZHA 1O6BA 5DXAA 4X41A 3NANA 2YWDA 4KOEC 4CTKA 4BCBA 4C6HA 3KFVA 3SC6A 1ENPA 2CLLB 3MS7A 1EP9A 1FS5A 4M89A 3ZXUB 3HXQA 2Y1XA 4B76A 3BK1A 1V6CA 4OJTA 3V97A 1N6RA 3RI3A 3MCVA 1ITZA 3B38A 4ZXFA 5AD1A 4BY9E 4HRVA 2TMGA 5GJVC 5EP2A 3HC7A 3VZCA 3Q2IA 2YRFA 3L1JA 4UKDA 1ISGA 3NWBA 2Q1TA 2A88A 2VS1A 1VHTA 3LO8A 3ANLA 3D4LA 3X1YA 1QZZA 3K35A 1T0JB 3R0JA 1EFTA 1UBTS 4JZYA 5EXXA 2HSEA 1G19A 5EKTA 4I6JA 4QPDA 3N6VA 3OBBA 4ZA2A 1SA0B 1KQNA 1J2TA 4MQBA 1B1CA 2BCJQ 3OZEA 1MJ5A 2QEQA 3WGHA 1S3SA 1ZVKA 4MWGA 2I78A 4AJIA 5IDQA 3AI7A 2I6GA 3NOQA 2DPHA 3ORHA 4MINA 3ROFA 1O4WA 1DZ3A 4CMHA 2ZUWA 3WRXC 5C8YA 2V45A 3VDQA 3WX0A 2ZRGA 2I4RA 5SYNA 3EHEA 5J4VA 5MFPA 4YJGA 3MSCA 1W0JD 1MC4A 3IQWA 1CUWA 4OYHA 4LY3A 2QD4A 5A6VA 2WICA 4DCOA 4RD6A 3OHMA 2NU8B 1Z2NX 2VJNA 3KQMA 3HFRA 3VSEA 2NQ8A 3I6ZA 3DO8A 3R40A 3C2QA 5DHQA 4IXDA 2COUA 3RRNA 3JQAD 3EX7C 3KYIB 2AC7A 2AEJA 3MFQA 2ZXUA 2LTAA 1K68A 1JXQA 2ESRA 3WAJA 2VDLB 1AKEA 1GCIA 1Z2AA 4DN6A 3M7IA 3MD0A 4G01B 3MS2A 4N3BA 3RT1A 3D7RA 3IPCA 1M10A 4HN9A 2P5SA 3WYDA 4AC9A 4B48A 1MB3A 3S2UA 5T8KC 4Y2PA 4AXXA 1WBDA 4C03A 2FSFA 2UZIR 1LWNA 1XQVA 4PLGA 2JLAA 3GFVA 4WXPA 4NRDA 1MAHA 5IZCC 2WU4A 2OK7A 3G49A 3QVGB 2D1SA 3SE7A 1WSDA 1A8PA 2PX5A 2VZ0A 3M5PA 5FFFA 3WK5A 4BKRA 1BGVA 4DQKA 3BSFA 3TSYA 3UW1A 2Q1UA 4MKIA 3WYBA 4M99A 3H0KA 4HK4A 5U4QA 5I9MA 5KDLA 1NX9A 4CR7A 2Q5QA 1HFKA 3A2NA 3Q7IA 5E4FA 4PPNA 3ZXYA 2XGJA 3OZWA 4RMGA 3LGXA 4Q4HA 2QQ0A 2FWBA 4LYFA 2OO5C 2O05A 3VR6D 4CV0A 2YWBA 3AM3A 4I50A 4PFQA 2ORYA 4EMSA 4MLZA 3H9QA 3RGGA 3NWEA 4G0MA 4DRZA 2FOIA 5CLGA 2ICAA 4Q1VA 2G9VA 3KHTA 2F4NA 4PC7A 3SNHA 4KGDA 1V7PC 1Z06A 2VSNA 3TW8B 2KB0A 1Z5ZA 4GKBA 4ZP1A 1RHKA 4E32A 5IKEA 5KDOA 1ORDA 4HX5A 1JBEA 5MF6A 4IOJA 1KJYA 1HH4A 2VT6A 1S8OA 3Q88A 1W59A 3KEFA 4OU4A 3RLIA 5AQ1A 1MW9X 3H8SA 2ATIA 2VHEA 1KDRA 2Z5FA 3DT8A 1Y1TA 3GG9A 5LWHA 2NMVA 2XQVA 4A0GA 2C83A 1G8HA 1WO8A 2NYRA 1RMQA 3PKZA 4MJXA 3TLAA 1H1TA 3GDFA 4PZPA 3PGJA 1DXQA 2C4NA 1R64A 4BQSA 2HDOA 1OIVA 3MRSA 2AXQA 4CODB 1J5PA 2F8SA 1CY1A 2RG1A 5AJHA 3ZJ5A 2WR8A 2VHWA 5AK4A 4HZIA 5JAUA 1COWD 4M38A 2WWYA 1AZTA 3COWA 3PE3A 2P11A 3JCZA 4XPIA 1IHUA 2YY6A 3M82A 3I5MA 4H0NA 4FFOA 4HB2A 4WCFB 1R5JA 3WADA 3LW7A 2QV0A 3V1MA 1F9AA 2RAFA 4MR9A 3W77A 4BYMA 4QU9A 3A0UA 4BP1A 4EYEA 3HWWA 4QBTA 1TYBE 4I3GA 4YA6A 3TQIA 1ONSA 1VIAA 2WLTA 2YJTD 2Z57A 1YA4A 2GD0A 4KFSA 4M3NA 5FOVA 4DFDA 3HJFA 3IR7A 5AKXA 2PRZA 4ZEVA 4I5FA 1JKJB 1Y80A 2NU7B 4PC2A 3L84A 4FD3A 1E7RA 4ARUA 1B0ZA 2WVJA 4RLHA 4WN9B 3JQBA 2DOKA 2X86A 3QTBA 3AY0A 2IYOA 5JROA 2QVBA 1H23A 1G3UA 4RK0A 4AS2A 1PW5A 1N7GA 3FLAA 1QHYA 3L1UA 3TMYA 4RENA 5CRIA 4M1ZA 4R7TA 4GLLA 3PQ7A 3G0GA 4V02A 4R1NA 2QGNA 1HWYA 1OBHA 3KELA 2R47A 3LXMA 1U3FA 5EJ6A 3R7WB 1X7YA 1E7MA 5FPKA 2I1QA 1RJDA 2QYOA 5KMGA 3U60B 5HJ5A 4OX9Y 2SCUB 4DYHA 1PX0A 2F8TA 2CLSA 4OF4A 3HO6A 3ZD6A 3DULA 2ZRAA 4OKSA 4QXOA 2H1WA 1WUKS 5GINE 3KYJB 2HHCA 1WU7A 4EZIA 4TQGA 3IUQA 2IFTA 4URHA 3ER6A 1T0HB 3BGOS 3U1BA 2GBLC 5HS6A 5TY0A 1KKUA 3IC5A 4C4XA 5EUBA 4KDRA 3RG8A 5B1EA 3A11A 5EE5B 5CB8A 2FP3A 5LYJB 2A1TS 1UC9A 1FQKA 2MSDB 1F2VA 2QZ9A 4QT0A 2ZJ8A 4R8VA 3AT1A 4U63A 3RUDA 3EXFA 5JXJA 4QECA 2FR8A 4JLMA 4N49A 4LJ8A 3FUTA 3SZLA 3T6KA 4EAQA 2IDKA 1Z0AA 1MGPA 3C6BA 2BGKA 3C0KA 1NXSA 1ZAKA 2WV9A 3ZQKA 4IFTA 5DWDA 3V8NA 4Y1GA 3HEAA 3I9LA 1NN0A 2ZJOA 2Q6OA 2QRZA 2OD7A 2CB9A 2JAOA 2QPTA 3GCXA 4GYJA 2OPHA 1ESMA 2W98A 1KQPA 1T26A 4D3ZA 1V0JA 1S7GA 4M7PA 2PJZA 1ZCAA 2EKDA 4CI0B 2H5IA 2NXWA 3HFSA 3TCKA 1F17A 5ALYA 3NIBA 4PX3A 2R8ZA 4UM9B 3BUSA 4KI0A 3KQNA 3JQ7A 1RRFA 3PHIA 4FK8A 5LLSA 5BPHA 4TKVB 2VP3A 3EC1A 4W1QA 4IJ6A 3GJ4A 3NM5A 4XIGS 4YP1A 3G5UA 4GOKA 1XMJA 3CUSA 1M72A 2QRNA 4LYEA 3UH0A 3VKFA 2H4YA 2V7WA 4XYMA 3VUEA 1IEQA 1NP6A 1B16A 3IR6A 1MAAA 1SBTA 4F2PA 2B9EA 4PCLA 4N0DA 4TQUS 4UM7A 2ZT8A 3V2UA 1I4EB 2WIBA 1NW8A 2ZE7A 3FNQA 4PLVA 1NW6A 1ZVVA 4HN2A 1J8VA 3GJ6A 3WICA 2VXYA 4OJKA 1DQZA 2G72A 2PQMA 3GLKA 2ZGVA 1Z6ZA 3TFQA 3EXHA 3GCDA 3MK31 5T41A 2Z2JA 3GEEA 4TMWA 1HEIA 4JS0A 3GRPA 3LP8A 5K8JB 2W2LD 2VBFA 5F2OA 3VKVA 1Q7GA 4URXR 3G3EA 2WP0A 3TVTA 1B6SA 1AMUA 4MV5A 4A82A 3OZRA 4QDJA 1ZNYA 2VT3A 4TQ9A 4Z0NA 3BVPA 2RSLA 4GZ5A 3HCWA 4RE5A 2DH5A 2A30A 1U8AA 2QZJA 1VLMA 2GZAA 4R9UC 3PNOA 2WMNB 4KGZA 1KFBB 3HL0A 3DHWC 4UUNA 1DIBA 4J0GA 3CW8X 3OX3A 3ZQ4A 5JZOA 2R8RA 2PQ2A 2R1VB 2R0QC 3GEIA 4Y2TA 3ZK7A 3PUZA 3S29A 1VIYA 2XMRA 3OPNA 3ITDA 5DO9A 3FDXA 5DYWA 2O3UA 4L02A 2CVFA 2E4UA 1OZGA 2I6FA 2GBPA 1UFRA 2NSYA 3K9NA 3OP4A 4NMLA 3BBLA 4XWAA 1NU8A 1M34A 4Q3BA 4EYGA 3HDHA 1KE2A 3FB4A 5FTKA 3GEMA 4EMUA 4HFJA 3HVKA 2PX4A 4L8LA 1IEXA 4G9GA 2Q8NA 3Q5GA 5DWQA 3V80A 3PP8A 4ZYTA 5EY5B 1WQ1R 1YVUA 1YE5A 2VJLA 2BISA 2N75A 3IB6A 1Y3BE 3M6MD 3HEMA 4OQXA 2HF2A 5EEHA 1GTL1 1UP6A 5F7JA 4I5IA 2VHQA 4FOTA 4LOHA 3GL9A 4CLRA 2GKGA 5U9CA 2J4DA 3IUYA 3RT9A 3GX1A 1ST2A 5CUQA 1DHRA 1R66A 3SJAA 1R18A 2JJ1D 1P9OA 4B40A 5BUCA 2C2ZA 4S1NA 1YF3A 1FFXB 1C1DB 2PQ0A 3BJMA 4UMVA 4XEUA 3FAKA 3TKYA 2YV5A 3BC1A 2QX6A 3GW8A 3UFBA 1S0UA 3HMKA 1J49A 2BI7A 3I58A 1MNAA 2DPXA 3NATA 4IMJB 3UGJA 2DWOA 1Y1SA 3EGDA 3Q98A 3A14A 5IAJA 2B9VA 1J2EA 1GLGA 1JAZA 3DEYX 1XN4A 2ID9A 3ONDA 3ZW7A 2AK3A 4EVSA 1YOVA 3WNDA 1P1RA 3MBIA 4YAUA 3DOIA 5HKKA 2PCLA 2KW5A 2IYAA 2D4HA 3PGXA 2H51A 3R6LA 1JJVA 3ENWA 4HEQA 3JZDA 1H0KA 5SZJA 3X1WA 3OQIA 4DCSA 5KSWB 4GAEA 2HRCA 4WA8A 4HLUC 1BQEA 1S2GA 3HJAA 2P9YA 1A95A 5BO5A 2Z83A 1IBCA 1VYUA 2GVZC 4FFVA 1II8A 4MUJA 3DXXA 1Y3HA 3OSUA 4KMRA 1C50A 1HRDA 5EZYB 5CVTA 2IEZA 2PTGA 3AGQA 2RKOA 2B6HA 5HZKA 1EFAA 3RHFA 1VSBA 1P45A 2HXYA 1VLLA 2PMFA 3EMKA 3HV0A 3IQIX 3JZAA 4RK5A 4TXMA 4AAYA 4W5JA 1W2HA 4U0JA 1RKVA 3OWXA 2RGWA 4IVNA 2VXCA 3K1AB 4OQEA 3WGYA 1OYOA 1YOBA 2DBQA 4TN5A 2XHZA 5AT1A 4HYQA 4WLEA 5LP6A 5JR3A 3QSGA 3KR1A 4CEHB 2OWDA 4OMUA 1AOXA 1CR6A 4LQCA 4URYR 1K97A 3QXJA 1YA8A 3S2IA 3VZQA 2YRWA 2FQQA 4NCBA 1CC1S 1ZCJA 3R5KA 1IXZA 3B78A 4R5HA 4D79A 3KXIA 4D9JA 1QLJA 3P94A 1VL8A 5TS2A 2XPCA 5AVYA 4M46A 4JI8B 1ZK2A 1K3UB 3QE9Y 4XD2A 1Z0KA 4UQOA 2JGRA 2D5CA 4EPRA 1YMQA 1VLVA 3LKZA 4RULA 1NVFA 1P1HA 4ZPXA 4E94A 3C8DA 3DO5A 4Z1MD 2IHNA 5IWAB 5BV7A 4DR2B 1P0QA 4WOBA 3DKVA 2UVPA 1ZP6A 3NCTA 4I19A 3TE7A 4DGSA 4EJSA 1ZRHA 4OXRA 3R9WA 2X58A 1EQAA 2WFZA 2ZRKA 4ZVTA 1EWKA 3KJNA 3ZHTA 1R4NA 4WGFA 4E22A 4R71A 3I8XA 3CXUA 1Z3IX 4J0CA 4GS5A 1RWXA 3TMAA 1A7KA 2N47A 3MPUA 1VJ0A 2WSLA 3DVSX 3HACA 4Y9TA 3U9LA 1Z08A 4BFLA 3SWWA 3MGGA 4B8WA 2F9LA 2B2CA 4ZDWA 4F1JA 3T5PA 2D1RA 3UQYS 2QUKA 4CUKA 3WHPA 3AJ9A 1CS0B 4JLPA 4MW0A 4QQKA 1N9KA 1XLUA 4RELA 3OE5A 3K0SA 4J0FA 3MT9A 4KZPA 5HF6A 1YA6A 1CJKC 2P4EA 1PYGA 3CH7A 2CB0A 3MBOA 2VDNB 3K8YA 3DL7A 4I99A 3DXFA 4KACA 1P4RA 3DXYA 5AM0A 4CKZA 1K7SN 4RACA 2OQ2A 2VBIA 2VDWA 2Z30A 4R16A 1UK8A 3SU8A 4WY8A 1HZZA 1P1IA 3EQ9A 4C1NA 2Z5GA 3D6VA 1FBTA 1TJPB 3OETA 1FSFA 1L5HA 1NDUA 4DLYA 2J3LA 3OM0A 3JYLA 1M0EA 3UM9A 1T1SA 1TEVA 1QG4A 1ETHA 4ZYWA 1IHDA 1ZU5A 2ADMA 4ZOLF 5J63A 4YI5A 4AIIA 5E3JA 2H2DA 5AO9A 2OORC 3OU7A 5LZ8A 1JEJA 4AUNA 4AZTA 4BO1A 3EGXA 4ZZ2A 3U3KA 1QPBA 3KBBA 3TCXB 4RTKA 1FTSA 1T3GA 5LMUB 1PL6A 3QYJA 1VGVA 3GT0A 3CX8A 3EAFA 3HNPA 4FW8A 4MRRA 3UO8B 2AI2A 1EX9A 1N5MA 2A9RA 1W88A 1T1EA 4HH0A 5DI3A 2CXUA 4UHKA 4AW9A 3O9VA 4A2QA 3HKCB 3WGMA 3OKCA 1DO0A 2YHBA 5T4HA 1RJ9A 1SCDA 3UGKA 3L8DA 1E1LA 3BMQB 1PJ8A 2ES4A 3OEHD 4WXMA 1KGDA 4B7AA 4D8TA 1SVWA 1WW8A 4LK2A 3H83A 2VJCA 2KHZA 4KBYA 4QDOA 1ULSA 3BH6A 4WGGA 3RQIA 1TQ2A 4GYKA 4QA9A 1JEYB 4DF3A 2HQ1A 3U3OA 4ZCMA 1NBEA 3CZ4A 4NOJA 2VAPA 1QFYA 3OLZA 2J5BA 2MIIA 3TVDA 1HE3A 5T8KA 1NVBA 1PZNA 3DM9B 2O2DA 3L8HA 2QN7A 1MH1A 2OBXA 3MG9A 1E2JA 3I3OA 4L2IA 5EPUA 5ECYA 2Y1WA 2G1PA 4XWTA 2VBCA 2YX1A 4PNEA 1QPGA 2MYNA 3B82A 3BL8A 4KYIB 3HRIA 1U3GA 3E03A 4BP8A 2RGUA 3GU3A 1G5IA 3EIHA 3L02A 4FNGA 4HMOA 5K0BA 1T5DX 1ZJ4A 2GWRA 3WRVA 3LUDA 2O1WA 5H82A 1UBSB 3LP6A 4MZDA 4U7GA 4BNIA 2VK4A 5FOXA 3HS3A 4EYQA 2WB2A 2X6RA 4U00A 5IG2A 1WDMA 2EV9A 1IOVA 4JLNA 2BTEA 3A6JA 4RVOA 5JAZA 4DV2B 1A7JA 5IJXA 2CNWD 3ZHOA 4B6RA 4YR9A 1IBMB 4Z9AA 1SXHA 4IJVA 2ZJ3A 3NP9A 4XCVA 4HQ6A 1AHPA 5T6MA 1EEXB 5C51B 4J90A 3Q5EA 5IBQA 3G68A 1KY2A 4RX1A 2GKSA 5JAIA 3ZU5A 4KO3S 1DRVA 1IWPB 1M74A 3CLUD 1P8AA 4Y2UA 5J2TA 2W7TA 4Q7EA 5KOHB 1G4UR 1QIHA 4CQLB 2GSDA 1KI2A 3KVOA 1DDGA 3U7IA 3W3AA 4EUHA 3V34A 4MK4A 4P7GA 2FW9A 3AR2A 3UV3A 3VKGA 3MEQA 2ZSAA 1U0RA 4XD7D 3ED5A 2C04A 5JVDF 1IRXA 1W4RA 2WKWA 2QG9A 2YXPX 4RMHA 1A2OA 1Z29A 4R01A 1T4CB 4WBSA 1KAGA 1G9SA 2AQIA 3S27A 4BBZA 4EKGA 5JZVA 4ZT7A 1RI5A 1YMUA 3TNYA 1X1EA 4R8LA 3WHKA 4A8HA 4O6VA 2BHRA 4I4TA 3FPBA 1WZIA 2FWJA 4ENSA 4C2TA 2YUIA 1O9BA 1LFDB 4D8YA 4JXKA 5AKEA 1R5BA 2JIOA 4KKXB 4PN3A 2P75A 4J6EA 4RIIA 4DABA 3OIYA 1C3EA 4DY4A 1YK1A 2WWTA 2V1UA 4R31A 3K1TA 2IZZA 4FT2A 4HDQB 5F12A 1C7JA 1IN4A 4ZALA 1EQ2A 2QV7A 1Q0SA 3HR4A 3I6BA 4N7BA 3G7UA 3NEYA 1M9NA 3AR3A 3IUJA 3O7MA 1RQGA 1X1TA 3PUXA 3AF4A 4LA4A 1TM2A 1O96A 1LTQA 4TTAA 2AVDA 5ENZA 5TARA 2FQXA 2PRIA 1CQIA 2VSXA 3EVBA 1JQDA 4JR0A 5CNIA 5AM2A 5EIEA 1HPLA 2P3SA 2XB9A 2ZW9A 4LZWA 2YY7A 4KXFB 1PZXA 4HLCA 1SKBA 1MXFA 3ORSA 4F2DA 4L8FA 1PJBA 2ZUSA 1DUIA 1RXSA 4YAFA 4W5OA 2MWMA 5L4SA 1QR2A 1DAMA 5J2UB 4QAJA 4WE3A 4NE2A 1UT6A 2IXBA 2PJUA 2GBIA 4K6KA 4X0EA 5A5FA 2DT8A 1OLUB 3ZHSA 2XOXA 4N6GA 5JBNA 3EXIB 2UUOA 4WDQA 1OWLA 3O74A 4K9PA 1MT3A 2CC2A 3M6AA 5FPHA 2O2GA 1YJAA 5KHAA 1EA7A 1R4AA 5EWLB 1VKOA 3EF1A 1ORTA 1SUDA 1QKJA 3B9BA 3N2KB 3EEBA 1B0AA 5IVPA 1SHJA 1ZCBA 1AX9A 4YY3B 4LXQA 4CN8A 1ADBA 1YL7A 3KEOA 3STWA 1GD1O 2OO7A 4GDMA 3CVUA 3NWOA 3OBIA 4OXIA 4FXOA 3P4XA 4TTRA 5H4HA 3K0FA 1RWMA 4RAOA 4QTXA 2O1EA 4BN5A 5A9RA 4FC6A 5LP6C 1RM3A 3L0PA 3I04A 2NQ2C 4IIYA 1HO3A 3ZX5A 2WMYA 4A8PA 3QFHA 4RQBA 2V7PA 2IIBA 2PU5A 5CBKA 2BGUA 1WJGA 1CUZA 1L5VA 1A5SB 2BFMA 4R8RA 4CMIA 2G88A 1LJUA 5B64A 4DJTA 5C4MA 1HKUA 5IDWA 1SZPA 4B74A 1CSEE 3IKJA 3TLCA 5A3JA 4GI1A 2DKNA 2AN1A 1ADJA 2B6NA 2R7AA 4ND6A 3HBLA 1C9DB 3IBGA 3ZGYA 2FMTA 2W5UA 1NP7A 2PZAA 1OLOA 1GG5A 1W52X 4N0MA 4INJA 3HM9A 4LDPA 1IIRA 1RFGE 3MTBA 5DLYA 3M2TA 3LWBA 3PC2A 2CVHA 3N53A 1F5NA 4FUQA 1PJ3A 4I1YA 3IOEA 4QUIA 1DT3A 4RPGA 2KI5A 1TYCA 4ES6A 3DSRA 1GGMA 3D3JA 4HN4B 4I55F 5JYCA 4KVFA 4QLBA 4JLDA 5ALVA 4Q15A 2DR0A 4IDQA 8MHTA 1EPUA 1L3CA 1XK7A 2I2FA 4QUEA 1JG7A 2PM8A 1JAHA 5DGTA 1FFAA 4LBYA 1IUOA 4OBEA 1XRNA 3HYTA 4A73A 3RABA 3C1AA 1T2FA 4I8IA 4JSYA 3RO7A 1SBCA 4YCJA 3VDRA 1JJAA 1FMLA 1DEKA 3KT6A 2XGOA 1ZITA 3CWZA 4FINA 5COAA 5TJ9A 1KK0A 2WU1A 2EZUA 3L7CA 1YCFA 2EZTA 1AE1A 2G25A 3GJYA 4DVJA 4NFSA 2Q4RA 5EJEA 4OQYA 4PCAA 5ULLA 3C6YA 1MO2A 3EUWA 3W3AH 2ZE6A 3QUTA 3W0LB 3B1KA 5CXUA 5GGYA 1DWPA 2LPMA 4MTLA 2M32A 1KK2A 4TV8A 5ENVA 4DREA 3VKWA 1A7AA 1ZM4A 2QD3A 2YCBA 3LOUA 4FFDA 4CNQA 4BN4A 1AKTA 4OEHA 3CYFA 3A31A 4CMEA 1ZEMA 4F6CA 1HQCA 2DHDA 2E5WA 2EQAA 2IVZA 3QXCA 3R3WA 4E03A 5L8VA 2OPBA 2O7QA 4CIAA 1N1MA 3I0NA 5TMPA 3M5CA 1ZFNA 2IGTA 3G0OA 5CK5A 2C5BA 2PRKA 2I0FA 1Z28A 4RMIA 4MROA 4QPCA 2WJ3A 2O2YA 4H17A 2FEKA 5FF9A 1EVKA 3A3NA 2M6LA 1H9AA 4HB3A 3TAHA 4V1CI 5IT0A 4FIZA 3HKBA 4ZCQA 4D3DA 4V0SA 5KIAA 5FBWB 1ULZA 1PQ4A 2PWYA 4KFRA 1J21A 2QXTA 3HN2A 3JQEA 3PVSA 3WQQA 3S8MA 2IOYA 5CFRA 1NLYA 3LF1A 1JECA 1QU3A 1MQ9A 1FRVA 2IXAA 4A1OA 4WY2A 3T7TA 1H94A 2W4IA 1FFGA 4AURA 4OHMA 4GIBA 2JH3A 1JQKA 2FUKA 5K0SA 4MIKA 1QMPA 1TNDA 1YAHA 3CHYA 3FF4A 2A8YA 3SMVA 4C22A 4YRSA 3JYOA 3AEKB 5LR6A 3DR3A 2P30A 2HA5A 3QF7A 4G81A 1RQNA 3RJ5A 4HGOA 1O97C 4JENA 4F86A 2QRMA 3HWSA 1RCFA 4DV4B 2I99A 2V4ZA 4GKAA 4OAQA 2O2CA 2JJQA 1ZJZA 1CHDA 2R1UA 4HYYA 1UEIA 3RJZA 3I92A 1KI8A 4UU0A 3H2IA 4Q3LA 4X8MA 1NGSA 2CY0A 1D0SA 2A0FA 4Q1CA 3ET4A 1Q17A 4IKPA 3LUBA 1BDMA 2GRJA 2Y1EA 1U3VA 4NOLA 1DOZA 4Z0TA 4AJLA 4EB0A 4DMRA 1Z0UA 5JEEA 2XBUA 4GX0A 1PWHA 2VAMA 4JBYA 4KWEA 4PSCA 2CT8A 2WEKA 4OMCA 1W36D 3W8DA 2ISCA 4MS3A 1SCUB 1TCCA 1VMEA 4XGIA 1A69A 2W6IA 1X74A 5BSVA 1QCYA 2HB6A 3EIOA 3PPXA 1L4EA 2D74A 4P4LA 1Z9BA 5EXEA 1BDHA 3HP4A 3V1YA 3WQBA 3CZPA 5CW2A 3L82B 1NVGA 3WZLA 2FPMA 3Q9UA 4FBGA 2VTKA 3P27A 4K05A 1NWCA 2C5LA 4PGHA 5BORA 3NOOA 1GNQA 1RDFA 5TMBA 1P4JA 1SIBE 1ZSYA 1YR2A 5LWQA 3FVRA 2AR9A 3STYA 1SWVA 3AXSA 1V2GA 2FXIA 3I9FA 5GTDA 4O4IA 3X3HA 4BLVA 2A5YB 2PS9A 3B6JA 3P2JA 5TVGA 1BX1A 2JI8A 1WXQA 1Q11A 1U1EA 2HFJA 2Z9DA 3C3AA 3K0AB 1A1SA 3SR4A 5LMNB 1GCOA 4QYXA 4LGYA 5HKAA 3AIKA 3LQFA 4GVPA 2GJ8A 2Q5EA 3A6EA 4M1QA 2ZQZA 1T8PA 1IPHA 1JT2A 1L9KA 1OXVA 4M0EA 2O3SA 3UK2A 4D3FA 4JGGA 3J81A 4YXWD 4LDNA 4OGFA 5BUSA 2EHDA 2JCYA 4EJFA 3GP3A 2Q5FA 1EWTA 1NUAA 1NDQA 4WPGA 1EWRA 1J9ZA 2QHXA 4BV9A 4I4IA 4IAOA 3KB6A 1KVSA 2IYFA 4O4HA 4BNVA 1Z47A 1K27A 2GEBA 4GRIA 1XD2B 4C87A 1N6LA 3HWX1 4X1IA 4YT5A 2PMDA 2YHIB 2Q4TA 4I1UA 2K7ZA 3B5IA 4PGAA 4DYDA 3U6KA 1Z5WA 4RLFA 3K8ZA 4GI7A 4P3XA 1MAWA 3M5WA 1V39A 3T1YB 3MTAA 1QZTA 4DQDA 1C81A 1Z8DA 5KJ6A 1X1DA 2D4AA 3B1YA 3FDJA 3V55A 2PGLA 2W2VA 1TAUA 2XRZA 1K8QA 4GL4A 3WWCA 4M0FA 1SFRA 5AM1A 2KPOA 5EIOA 1KR2A 3HGTA 3PUVA 6PFKA 5JG7A 2VJMA 4DM3A 2YUTA 3DZGA 4JI1B 3X2FA 1V1JA 3BWMA 1AB5A 2O06A 2PO5A 5K3DA 1YR9A 4KV9A 4RCYA 3WQHA 1G21A 3GF4A 3MF4A 2JLZA 2ZKLA 1QGUA 4GE0A 3MAJA 3V4OA 2FSUA 3PFBA 1NYTA 5JALA 4QJBA 1RHUA 3CPHA 3IERA 4BGDA 3OQJA 2G9ZA 4S1TA 1H2AS 4OQLA 4DRYA 3QU9A 5E1DA 1R37A 5K2MA 1KE1A 4W8OA 4P81A 3X2EA 1KYVA 2PY6A 3OVMA 2F3PA 4L50A 4GXQA 3IEXA 1QHIA 2DHEA 1ZBDA 2FB9A 1FNDA 3TWOA 3E9DA 1MIHA 5DCYA 4EG7A 3L4JA 5AUPB 4GYWA 1DT5A 4I9UA 2FMFA 1NVWQ 1W48A 4N0EA 2PXAA 2JKVA 3QMPA 4ASUD 4HV4A 2FU5C 1E9VA 4TXLA 2OCYC 2G08A 1XIVA 3GNLA 3HJHA 1M2OB 1K88A 2VT7A 1U5CA 3O8QA 1QHXA 5EWJB 3W5CA 1GADO 3AU9A 3IP6A 2W43A 4OYLA 3DBIA 3NYWA 4BTVA 1ZGZA 1N8SA 1LBSA 2WF5A 1FDUA 2R84A 4A4DA 2BR3A 2O8VA 2AQHA 3PF8A 4TV9A 2R5NA 1D6SA 3NTLA 1GGJA 1RZUA 1SOUA 3ZTTA 1JLHA 5JYEA 2OMEA 1TMKA 3QITA 4RFSA 4ZKDA 1QHFA 2M9MA 1X7WB 4UAJA 2RH5A 4V0ME 1U5BB 1SWWA 1XTKA 3CSSA 5F9HA 4WERA 4RA6B 4DT1B 3WVNA 5EHGA 3FOZA 1RI3A 4RVDA 3DJFA 4AY5A 3IAHA 2IOFK 1GPJA 5B7NA 1T0BA 2ISSD 2J5XA 4MB2A 2FWNA 7ABPA 2OKCA 4YHBA 1LWOA 4ARZA 1A4UA 1DFIA 3E9EA 3IUNA 4KWTA 4QICA 4PO1A 3MWFA 5A3SA 3KXPA 3A2LA 3QEMA 5D01A 2ZI3A 4BEVA 2J7PA 3HGQA 3QNMA 1ZL0A 3HA5A 4JWKA 4RJJA 1CVRA 2VZEA 3DLPX 3RJ9A 2WM9B 4AJ1A 3A3OA 2YZKA 3CH5A 3UTCA 2VAVA 4MDYA 2B4AA 1ZH8A 4QBHA 2DFDA 1SC9A 3T35A 4S12A 2HL6A 5KNCA 1W2GA 1YZVA 4DM4A 4LC9A 4ACBA 4QPPA 4DZTA 4KPYA 4K1XA 2QSZA 1D5CA 2RB5A 1P0MA 1CQJA 1PDWA 1AUQA 1US8A 4RXUA 2TS1A 3WGUA 4N41A 4KIFA 1NVTA 2PVPA 5DHUA 1AK9A 1GG8A 1NUPA 5EJIA 1VJGA 2YL2A 2FVXA 3KYCA 4CU2A 3OICA 3Q9NA 4MGKR 2FX2A 4OGGA 1Z7BA 2QENA 3RAEC 1X1AA 3D6UA 1UZLA 3DBRB 4MVJI 3CNHA 5AK6A 3LX8A 3CVWA 4D97A 1OAOC 1GKUB 3U7QA 4E5DA 2BBTA 2F8MA 2R8BA 4GZ6A 2FPXA 3MJRA 4YK7A 1HNZB 5CAEA 1LDEA 4F93B 4EY8A 2JAUA 3CEJA 1QYRA 2RK4A 1I51A 1YWGO 1D9XA 3F46A 4MEAA 3ZEIA 1XZAA 5MN6A 2RHLA 3GY0A 1REQA 2A3NA 3H11B 3L7DA 3ND5A 1YRAA 3QQ5A 4G0ZA 4GU5A 4MR7A 4NMXB 2OFXA 1EZ1A 2OQVA 3TJMA 3D8BA 2AOTA 4HXYA 3U0VA 2BJVA 2ASVA 2JZNA 4MQFB 2YOFA 2YXBA 1E5QA 1ZD4A 2HBRA 2P9JA 4JIGA 3KQTA 1DLIA 1JHUA 1Q0HA 3AEQB 3NS7A 2Q3CA 1P5HA 1Y3CE 4MCJA 3RV4A 1TE2A 8ATCA 3B85A 3GRRA 4Z4HA 2W2OA 3COJA 3DL0A 5HEKA 2PL1A 2ZPUA 3SC3A 5H7XA 3WZMA 1D1QA 4D41A 4QHTA 1OWMA 1XVUA 3B2EA 3ROGA 4CTMA 4YUXA 4ZDIA 5PGMA 1BH6A 4WNCA 4R1MA 5T7BA 1G8JA 4P3OA 3SM3A 3S1AA 4I46A 5IK2A 1BWSA 2FRDA 4UU1A 4DV7B 4HEJA 1SH7A 3CEAA 3NM6B 4P4SA 3WG9A 3HYRA 1AA9A 4ID9A 1T15A 2DWPA 2VP6A 5TGDA 4N5LA 3BFKA 1W9HA 1VYTA 2MMCA 2NWQA 4LY6A 5CR9A 5TPWB 1L5NA 3ZE9A 2Y0EA 3LY8A 1EAMA 4OQDA 4Q4AA 3ZYZA 1I7NA 1UANA 1WU8A 3CSUA 3RB8A 2Y2VA 1QF6A 4O33A 1HF3A 1UADA 5CD9A 4MQEB 5I48A 4MPJA 1R9NA 4GQAA 5BN3A 5K8TA 3EG9A 2CJXA 4O1HA 2A0XA 4WZAE 4AWXA 1MABA 3Q8XB 4PIMA 4DIFA 4IIBA 3AESA 3L7YA 3DWIA 3L7NA 3CO0S 3U5ZB 3PDWA 2YXLA 3V9AA 1V37A 1S2OA 3EVTA 1GQOA 3OQPA 3W8EA 1W49A 1H2ZA 2OAEA 1H9BA 2PBZA 4ND3A 1LDGA 2PYZA 1PAUA 4NBRA 4PYLA 2HZ7A 2QN9A 4ZAXA 1XA3A 2JIZA 4HXGA 4J9VA 3FOWA 4L8VA 4MVJH 4F0JA 4UTPA 4V24A 3SJZA 3U16A 1T6NA 3EQ6A 3LVQE 3OKFA 1JGTA 1E69A 4HNVA 4DQVA 3I0ZA 1HETA 1N2BA 3SICE 2BFDA 6LDHA 1RADA 1R6TA 1YBFA 3WJ1A 3P5BA 4OLAA 1UPXA 2DKFA 3BX1A 1E9RA 4HZGA 3AIOA 2BSXA 3FA2A 1P9WA 4I9NA 2VDRB 4POOA 3T7KA 3A7EA 3Q7RA 1JSCA 1MEEA 4E5YA 1AU9A 5BWBA 5KCZA 2P4HX 3A58B 1OV6A 4F1KA 3ZE8A 1U2GC 3F5SA 1VHLA 4MWEA 2BGWA 2NT4A 1XDWA 1WW2A 3VH1A 2Q3HA 5CB4B 1KTIA 4NBUA 3DBLA 1R6UA 2GN6A 3TLJA 2OKGA 2E82A 3TL2A 3C3DA 3I6IA 1ZM3A 2AXPA 1YT5A 5HF5A 1XZLA 4QODA 1P1CA 2DERA 3OCYA 4UMDA 5HJEA 1ZN2A 1CERA 4GGOA 3UYKA 4F9TA 1DAFA 2BY4A 3KQWA 2C9ZA 2YQ4A 2AMYA 3OJCA 2JGDB 2P2CA 3EZXA 2CN1A 4HYTA 4FE7A 1KVTA 1R10A 3FDZA 2REOA 5BOSA 1L7NA 3QBDA 4P38A 3W4IA 1Z2PX 1ZWKA 5JANA 4JP5A 3VR5A 2Q5IA 1R27A 3B6MA 3NPAA 5IW8A 1XJ0A 5JD3A 1NIPA 2PPVA 1FLNA 1JEQB 1XGKA 1E0AA 2V7UA 3ELDA 2ERXA 4IZ6A 3V7NA 4CFZA 1VIDA 1XNJA 3GFQA 4JLAA 4BUCA 4ZIRB 2W0MA 1KIAA 4BRWA 5BWOA 4R2XA 4PS0A 1Z34A 3KV1A 3E1SA 1VIMA 2R1ZA 2QRGA 5FPPA 5JYDA 4Q7KA 3ROKA 4C2BA 1BCSA 2HJWA 1OR8A 3RYIB 3U17A 4ZMRA 3O95A 1TO6A 4PQYA 3VPGA 3TIXB 3IPLA 4YV2A 2QMOA 1ZMOA 1FDVA 1VI6A 3L6OO 4OI1A 4CR6A 4BFVA 2QL5A 2WTUA 1E2HA 1X7ZB 1FIUA 4V2UA 4XQ9A 5FQOA 3T5TA 2YXDA 1YBAA 2PWPA 3JVEA 1FW8A 1MCZA 2XMDA 2KJQA 3LX5A 2BOVA 3EJ6A 1GZVA 1GKIA 2MJLA 4U8HA 2VJBA 4GVLA 3U4GA 1PYOA 2JHAA 1NG9A 2DFVA 4CTNA 1QAQA 3F9CA 3TRHA 3M4ZA 1QHGA 2WRZA 4ZCIA 6Q21A 2B34A 4Q9DA 4R9VA 1CHNA 1WY5A 2O2HA 1MC8A 2WU3A 3NIFB 1E8MA 1RP1A 4M87A 1PFKA 3QSYA 1P9RA 1SD2A 2E89A 3JAWB 1OH8A 2NUAB 5B7QA 5JAQA 3WOHA 5HCNA 6AT1A 1W36C 4LN1A 5YASA 3WI7A 2MYPA 3OLYA 4RHUA 1L5KA 2BFBA 2VNHA 4BB0A 3ML1A 2VOEA 4NHEA 1F2TA 1V5GA 2CSXA 2HF9A 1T5LA 3CN9A 4RVFA 3HBNA 4A92A 5LVAA 1PS8A 5AVOA 2XT9A 3RVSA 4C76A 5BR7A 4MCHA 3WMRA 1DS6A 1VP9A 1KAEA 2ZRJA 2IU0A 1KI9A 3QLTA 1XU9A 2AFHE 1JR2A 2ZIZA 2PSHA 1WAMA 5F1YA 5FWAA 3J7TA 5ER9A 5G3ZA 1VG8A 5IABA 5LP1A 3N76A 3ZEAA 2J0EA 4OQFA 1ZSNA 5ALFA 1JG1A 3C8ZA 5L95A 3HXOA 1NY6A 4Q1FA 7MDHA 4G0XA 1U8CB 4BFTA 1R4MB 4HMPA 4KITB 3VQTA 1AN0A 1Z56C 2BZGA 4WKBA 1X1SA 1YH3A 3BXZA 2SBTA 4Y6OA 3S2YA 4EHLA 3KOMA 5HOQA 1C8VB 1SULA 4E21A 1PZEA 3KXDA 2ZB2A 5L9AA 3GJSA 5CA1F 4D0GA 2QUHA 4J0KA 5L3SB