5GQSA

Nmr based solution structure of pts system, galactitol-specific iib component from methicillin resistant staphylococcus aureus
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
92
structure length
92
Chain Sequence
MKQVLVACGAGIATSTVVNNAIEEMAKEHNIKVDIKQIKITEVGPYEDTADLLVTTAMTKKEYKFPVINARNFLTGIGIEETKQQILTELQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR based solution structure of PTS system, galactitol-specific IIB component from methicillin resistant Staphylococcus aureus
rcsb
source organism Staphylococcus aureus
molecule tags Transport protein
molecule keywords PTS galactitol transporter subunit IIB
total genus 13
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2016-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02302 PTS_IIB PTS system, Lactose/Cellobiose specific IIB subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5gqsA00
1NY5A 1BDJA 1YK1A 2PUAA 2CWDA 2OQRA 3HDGA 4FE4A 3TX6A 1DZ3A 3BILA 5EWMA 1EWKA 1JWLA 1SXIA 1FFGA 4NQRA 4HNQA 3RVNA 4EUKA 2B1JA 3CHYA 3FMVA 1DRJA 3O2JA 5B3JA 1JFTA 5IUNC 3DLBA 3H1FA 5GQSA 3H6GA 3SQNA 4H60A 3KHTA 3OQOA 4OATA 4YWHA 5TPZA 4MR9B 3GWGA 4IF4A 2PUEA 3GYBA 4JASB 1I3CA 3T8YA 2FEPA 2QVGA 2JBAA 2FQWA 5JNSA 2JBAB 4F11A 1JBEA 3MF4A 2E4YA 1JF8A 5DKFA 3JTEA 2JRLA 5GOTA 1PNTA 5TQ0A 3O1HB 1U04A 2FMKA 2QZJA 3C3WA 4W5OA 3F73A 3H5OA 3M9XA 1XHEA 3OMXA 1DBQA 4YCSA 5B3JC 4N0PA 5IUJC 3TB6A 3A0RB 2FKAA 4KREA 1D5WA 3O75A 2OENG 4HYEA 1A04A 2HSGA 2VUHB 4XAQA 1DRKA 4MLDA 5F64A 4XARA 4OLBA 3RVRA 1F4VA 2ZAYA 1CEYA 1ZH4A 3HDVA 1RXIA 1TVMA 4IRXA 4OTZA 1BVHA 3SNKA 3R0JA 4LDZA 4XASA 4RU1A 2VK2A 5TE9A 1EWVA 4RKRA 3CG4A 1APBA 4N76A 4RWEA 3EGCA 4EVRA 4RK0A 4RY0A 1Z2EA 4D6XA 1S8NA 6ABPA 2I6FA 1Z26A 2VUIB 1D2AA 3EDCA 3O74A 4WWHA 4S04A 1EAYA 5KWSA 3GA5A 4M88A 5FWXA 5IX8A 3O1IC 2HJ9A 4XLTA 4E7PA 3SG0A 3H5WA 3P9YA 5FBKA 3D02A 1FQWA 1RNLA 3M9WA 1M5TA 3MQ4A 1JDNA 2NZUG 1YMVA 4EVSA 4MQFA 1USKA 2P4UA 4Q6WA 5TPWB 1DCKA 3GBPA 4PICA 2CHFA 5D2CA 2FEKA 2FLWA 3LFTA 5EWMB 2L19A 2ZWMA 4F3TA 3OO0A 1ZHHA 4PEVA 4RK7A 1OXBB 1QO0D 4O1HA 2QV0A 3OO1A 3DGFC 1DC8A 4MRMB 5KQLA 4B09A 1JYEA 3H75A 4IMIB 5KC9A 3HS3A 4MR8A 3F6PA 2PL9A 2IOYA 4MR8B 3MA0A 2JB9A 1D1PA 4RXUA 5BR1A 1KRXA 1URPA 3BREA 3H6HA 4G86A 1GCGA 3LMKA 5ED4A 2PLNA 3GL9A 4JAVC 2TMYA 1MAVA 3JVIA 4KMRA 2PUCA 5EWLA 4LE2A 3LUGA 4LDAA 2WY2D 1QP7A 1MB3A 1MB0A 2DRIA 3N0XA 4JOQA 2H3HA 2R25B 5JS1A 2ID9A 2IKSA 3RVQA 3KLOA 1P6UA 4OLAA 4YGXB 1LBHA 3A0UA 5TQ0B 4ZPJA 2RJOA 4DQDA 4P1ZA 1ZAYA 4RXTA 4MYRA 3KYJB 5BRJA 4H3HB 3UUGA 3E61A 3RVJA 4ML3A 1XWWA 1TLFA 1BA2A 3OLVA 1GUDA 4XFKA 4TLLB 4JP1A 1MVOA 2L18A 3Q7RA 1JDPA 1C0EA 3QLVC 2QXYA 3OLZA 4LE0A 3QLUC 5DTEA 3UK0A 1U0SY 4JB0A 4Q7EA 2O20A 3HVRA 2LIVA 4G0XA 4MR7A 2Q5CA 2PL1A 1Z12A 4KK3A 3F7NA 4WXEA 3IP6A 1EFAA 1ZVVA 1Y1LA 5IEBA 1NXWA 1QKKA 2GI4A 3D8UA 3FGZA 1DCMA 4RK4A 1DBWA 5CNKA 5IC5A 3BBLA 4NCBA 4N47A 1ZN2A 4JB2A 3TO5A 1BDIA 1F51E 3E3MA 5KI6A 4UHKA 2CHEA 4GNRA 4H3KB 3C6QA 3H5VA 4Y9TA 3CNBA 1E6KA 3CG0A 2GWRA 4MQEB 3JY6A 2IDMA 5JS2A 3OQMA 4RY8A 4YLEA 4O5AA 3OLWA 5C5CA 1RXEA 4RY9A 3LUDA 2PE5A 4Z99A 5FBHA 1NTRA 2FQXA 5JNWA 1ABFA 1DCFA 3S99A 1U2QA 4TMYA 4Z4CA 3CFYA 2MSKA 2KYRA 2YHBA 1NXTA 4OBBA 1K66A 3KJXA 3TMYA 2YHAA 3NNDA 4YO7A 1SD5A 3QLTA 3RVSA 3HCWA 4KZKA 3HV2A 2IPNA 3VNAA 3FFWA 2RJNA 2V0NA 4W5RA 4Z4GA 1P2FA 1DJMA 2R48A 2NT4A 4Z4IA 3HXMA 1EWTA 2QVCA 1FFWA 3IPCA 3O2SB 2MSLA 3LOPA 3G85A 4G0YA 1DC7A 4MS4A 5T7BA 1QP4A 2CD7A 3QEMB 1HEYA 4NICA 2PAFA 5KQGA 1E2BA 4F8JA 5IEJA 3OM0A 3OLYA 1AB6A 4F06A 1LJUA 5HM6A 3RQIA 3NHZA 2E4VA 2P9HA 5I4CA 3ILHA 2HPHA 1SRRA 3QK7A 1L5YA 4JA2A 3SY8A 3NBMA 1UDRA 3FDFA 1PEYA 5TQ2A 4Z4EA 3QX9A 3LUJA 2AYXA 2PMCA 2JCGA 5KQMA 4NCAA 2WWVD 1A0OA 5IUKC 3NNNA 4MS1B 2PJUA 2MYUA 4N03A 1JFVA 1RZRA 3HEBA 3GBVA 1NXSA 2FMIA 3RVPA 4ETNA 4Z4HA 4RDCA 5HSGA 1YS6A 3O21A 3N8IA 3FFTA 4MRMA 1H9CA 3N75A 3RVKA 5DCLA 2FQYA 3JPWA 4ETIA 1JHZA 4IGAA 1M5UA 3G1WA 3T38A 5C5EA 1JLKA 3EQ2A 2WRZA 4W5NA 3MIZA 1SXGA 5KQPA 3N0RA 3SM9A 3GRCA 4EYOA 3LUAA 4G0QA 3T6KA 3HJFA 2RDMA 4G0PA 4MPTA 4ZMRA 3Q7SA 3C97A 2QR3A 3IP9A 2X7XA 2QSJA 4KK4A 1QMPA 1YS7A 4Q6BA 4QPJC 4WT7A 5CNJA 1LBIA 1ZGGA 4RK1A 2FXIA 4Z9AA 2FEWB 4PZ0A 4ETMA 1A2OA 3FFXA 3I09A 4G0MA 2PUDA 1M2EA 1ZY2A 1VKRA 2WJAA 4Z9BA 4LE1A 4RK5A 4TLMB 1YVUA 1ZH2A 1KGSA 3URMA 3Q9SA 4LX8A 4N41A 1CYEA 3I5AA 3TD9A 4DADA 4L85A 1JL3A 3NHMA 5T3YA 1PEAA 1RPJA 1YIOA 3A3KA 5CHYA 1KMIY 1Z2DA 2LPMA 1MIHA 1SXHA 4HNRA 1W9HA 3H5IA 3ILYA 1DBPA 4IMJB 4LZLA 4EY3A 2A9OA 1TM2A 3OLXA 3GV0A 1GCAA 2R47A 1JH9A 4ZYLA 1ZGZA 3Q7TA 1QQBA 1Z18A 1ZITA 4MS3A 2FTKE 8ABPA 5FWXB 2L17A 2LUOA 4RXMA 4KVFA 3UKJA 4EGSA 2BGGA 2FVYA 4EYQA 1JYFA 1BAPA 1C4WA 1YMUA 3EAFA 1Z25A 2GX6A 1W25A 2RGYA 1EHCA 4YP9A 1ZDMA 2JVJA 4QYWA 3KG2A 3C3KA 3HSYA 5TPWA 3EJWA 2A9QA 1YK0A 4KNYA 1Z16A 4KV7A 3CLKA 3IPAA 4YRZA 1QO0A 4N0QA 4F12A 1NATA 3CRNA 3O1JC 2W42A 1DP4A 3HO1A 3B2NA 4LRQA 4W5TA 6CHYA 3T95A 2F8TA 4KQCA 2HQBA 1TMYA 3QX8A 2H0AA 4G0ZA 3I42A 3HM9A 2M1ZA 2VYCA 2FN9A 2J48A 5IULC 2JVIA 1NXXA 1B00A 3H5LA 2WJWA 2FLKA 2IPLA 2LBPA 2IPAB 1FFSA 3H1GA 4MGEA 5EWLB 2MSWA 2NT3A 4WUTA 1J56A 1U2PA 2IYNA 4RK6A 4RS3A 4RKQA 2LP4Y 4YV7A 3MMNA 9ABPA 3IP5A 5JNVA 1T34A 3L49A 1QP0A 3EULA 3QEMA 4XXHA 3H1EA 2NZVG 3LTEA 4RV5A 1E6MA 1L5ZA 4YS6A 3H5TA 4PYRA 2M98A 2E4XA 2E4UA 1JX6A 3OM1A 1PUXA 4FE7A 4GPAA 2MYPA 4KPYA 1BDHA 3IP7A 5TQJA 3MM4A 1AB5A 7ABPA 5JNUA 1E6LA 1LJLA 2PKXA 3JS5A 3N53A 1D1QA 5TQ2B 4KFCA 3KS9A 4W5QA 2PUFA 1Z17A 1ZESA 3C3MA 1K68A 4P98A 1P8AA 4CBVA 1NXVA 1WETA 2F8SA 1GLGA 4MS1A 1NXPA 3QLVA 1KRWA 3Q41A 4E7OA 3OQNA 4QICA 1XHFA 3EODA 3GT7A 4G97A 4MR7B 4EYGA 3F6CA 1ISRA 2L2QA 3DGEC 3CS3A 3KTOA 5PNTA 4G0OA 4DN6A 4S05A 2E4WA 5TPZD 2N9UA 5CNIA 3ROTA 3NNSA 2A9PA 5FWYB 4FB4A 5FWYA 1USIA 1P6QA 1VRVA 2R4QA 1FSPA 2JVKA 5JNTA 3LKVA 4MAAA 4MS3B 3N0WA 2NUBA 3KSMA 3KYIB 4MR9A 4NV3A 1YTUA 2FMHA 3CTPA 3OMWA 3W9SA 2PUBA 1D4ZA 4RSMA 5CNMA 4MLCA 3QEKA 1Z13A 2XDYA 3CZ5A 2FMFA 4ZMSA 1PNRA 4L4UA 2WMYA 2MYNA 4MQFB 1R8JA 1USGA 2WB4A 4EVQA 1TJYA 4IILA 3CKMA 4MQEA 1ABEA 3KCNA 2JK1A 1VPWA 3I45A 3L6UA 4QYMA 5HQJA 1U8TA 2MYTA 3HK2A 2E4ZA 3LUHA 3O2QB 3VNBA 5E3JA 1DG9A 3EQZA 2HQOA 3DZDA 4D74A 3QLUA 3IDOA 1LK0A 3Q15C 2GKGA 2IPMA 4TN5A 1IIBA 3LUKA 3QELA 3RVOA 2QW1A 4EYKA 1OXKB 3HZHA 3QELB 3ROFA 4Z0NA 3KKEA 4KQ9A 2FN8A 2QU7A 3KLNA 2A9RA 3LKBA 3BRQA 1NXOA 3CU5A 1QQAA 3CZCA 3HUTA 1PHRA 3LUCA 3N6VA 2ID7A 1JFSA 2FW0A 5HKOA 4HNSA 3DBIA 3LUFA 1Z15A 4OG2A 1VLZA 4WXMA 3RVLA 5KC8A 3SAJA 2FSPA 3HUUA 3JVDA 4MS4B 5DLEA 3RH0A 5EWJA 3BRSA 4PE5B 5EWJB 4ZJPA 1QPZA 1RZRD 3K9CA 3K4HA 5DGCA 5BQ3A 3M6MD 3DLHA 2B4AA 2GBPA 2AYZA 1QNLA 1GUBA 1CHNA 4Z4FA 1M2FA 3RVMA 4UHJA 2PUGA 1ISSA 4RZSA 4YR7A 5ABPA 5BRAA 4KRFA 4O1IA 3JPYA 5IBQA 4WZZA 4D6YA 5JNRA 3MYYA 3A10A 2HQRA
chains in the Genus database with same CATH superfamily
1NY5A 1X13A 2WBLC 3GGDA 2CWDA 2ZQYA 1YRWA 1CZHA 3DHYA 3N6XA 5LXTA 3L8EA 4E2ZA 2MINB 2IS6A 1H4VB 2XT6A 3FCEA 3OTHA 2ROQA 1SHJA 3OTWA 3HU1A 1PYDA 1NWHA 2IY9A 1ULSA 1JB1A 2GYWA 3FMVA 4JQZA 4GU5A 3W5CA 5JI2E 1U8FO 5EQTA 3E9CA 1T9DA 1QKJA 3VGPA 2G25A 4DPMA 3MVEA 2IXEA 3G88A 2C5AA 3VDRA 4GG1A 2PDAA 1M66A 2YBEA 2BISA 4REQB 1BH6A 4TTRA 4IDPA 3SBEA 4G0VA 1R4ZA 4AICA 1BS9A 5CDTA 4C4ZA 5DEIA 1CQZA 1TEVA 2Z04A 5EFOA 2FQWA 3H5NA 3T15A 2CEKA 4ARBA 3KEOA 2YV2A 3O0TA 1ZJ4A 3B3QA 4NBSA 3U48A 2RIRA 3D2LA 4EO7A 4YAWA 5BR4A 2CJWB 2C61A 1NAHA 4QDUA 3ZE0B 3RIGA 5HQ3A 2CMFA 1P2BA 2WWWA 1KP2A 1UKYA 5F3RA 2W5UA 1PNTA 4AZWA 4J0GA 1MQAA 4U02A 2C07A 3KZ1E 3IT2A 5ICFA 1L8OA 5HZKA 4BGUA 4MUAA 1Z8DA 1LDNA 4YCSA 3OMXA 5B3JC 1XGKA 4J07A 4TUYF 1BXGB 2XZOA 3GLUA 1QF7A 2CNWD 4DR1B 5DI3B 2KPOA 2QV7A 2RH8A 3BWYA 3HY3A 1WUYA 3L7NA 3PXGA 4ZYZA 3DDNA 2O8EA 2OO5C 3KC2A 2HO5A 5CFOA 3QPVA 5IKMA 1AUPA 2EBFX 1HQCA 3AR3A 4NH4A 1KORA 4RJJA 1LTKA 1T3ZA 4X0EA 1PSZA 4PG8A 2D7DA 3AU8A 5BN4B 4PY2A 4EG1A 3T7EA 2R66A 1J0DA 1OT3A 2BBTA 1Y1KE 1HQKA 2R97A 3JQ9A 4RK0A 5K3AA 1HL7A 1JPUA 2Q1SA 1OXUA 1Z26A 2D59A 3ZGXA 3FPHA 2H4JA 1OZ0A 3TLEA 5FWDA 5KSZA 3ET5A 3IB6A 3BJMA 4BLWA 2EQAA 4HDKB 2EATA 4IDQA 1Q57A 4JKYA 1HK7A 1ZCBA 1SULA 2G76A 1MJFA 3P9YA 2YC2C 3LW8A 2JLQA 4Q1DA 4R2XA 6REQB 4QU5A 1PJBA 1IJEA 2ZRDA 2DFKB 4XDGA 3TB4A 5A3JA 5F5NA 1NBMD 5TPWB 3OU7A 1THTA 1K4MA 2IHVA 4N8SA 1WIWA 4Q16A 2P9CA 4HFMA 4FYYA 4PICA 2GK7A 1EE9A 4DA8A 4YRKA 1DHTA 1HH4A 2Q5OA 4HAVA 1GFZA 5ES4B 3F4LA 2J6CA 2XMZA 4O1HA 5IVPA 3IEMA 2WFMA 4J0FA 3S2YA 1IHUA 4GR5A 2Q99A 4K9NA 4R68A 3DL2A 2YV5A 4JBGA 4YCCA 3QBEA 5KC9A 2QSZA 4RIIA 1W9MA 3ABSB 4Q3NA 1R6UA 3C87A 1PL0A 4U2CA 3G5MA 2QGNA 3ZKWA 5JY6A 1KSFX 4M9UA 3QPAA 1QG6A 3FTPA 2B7LA 4XUDA 4OLFA 3LHKA 3I2GA 3BG5A 2HBQA 2O5VA 2PXAA 4BNWA 2DG2A 3A37A 5KVAA 4YRQA 2J67A 1AZTA 3BMQA 2ZJOA 5LP6C 1JG7A 4IIHA 4DQLA 1HE5A 2VJPA 1G8AA 5BN5A 5BY2A 4O2BB 4KGXA 2B8NA 3KQTA 3WK6A 3OZUA 2ZG6A 2LZ0A 4AUKA 1JEDA 3A9CA 3BXGA 5TQ0B 3F47A 1AUOA 2VCYA 1R4MB 1JBKA 1UC4B 2EL7A 2P2CA 2XOKA 1Q3HA 4RKWA 2OBYA 2QZ4A 4P1ZA 2BUBA 3D4PA 3TFOA 1ZAYA 2GJKA 1PO7A 4KL8S 4TYMA 4B80A 2UVPA 1R6VA 1NW4A 3INTA 1U0RA 3CT4A 3TAHA 4TV8F 4F46A 1U3UA 1FVXA 2UYYA 2ZYVX 4YRMA 3FI0A 4BFSA 4ZQFA 2D5AA 3A05A 4JR2A 1XRJA 3EG9B 3P2JA 4FWIB 2X9LA 4NKRA 4NEHB 1DDOA 1PAUA 3QLUC 4HGPA 4Q4DA 1GLNA 2V6IA 3VZQA 5HRAA 3IO3A 2H2IA 2B7BA 4E11A 1CF2O 1O9HA 3K94A 4LV6A 2ZB7A 1QIGA 4OH1A 4TS3A 4FZ5A 5G0VA 2XYGA 3PHBE 4IHQA 4RH0A 1IVNA 1T0IA 3DEJA 2GCIA 3QENA 1QKKA 1P4HA 3UM9A 1HI9A 2VT3A 3UGJA 4A2PA 1UBTS 3QHPA 1ZW1A 2G63A 3QVXA 4N47A 4IH1A 5CX1A 2DJ5A 4K1XA 2NO6A 4MARA 2O2CA 4HDKA 4G3XA 2ZE8A 1GRQA 4JH0A 4PC1A 4RLQA 1QUEA 2CHEA 4GNRA 1GZ6A 2P4QA 4H3KB 4LSMA 4DNOA 3W5BA 3MT8A 2ZJAA 1DB3A 3H4IA 3VC3A 4C14A 5I5EA 2YHSA 1E6KA 3FNHA 4R69A 1E1QD 4DCNA 1KMNA 4DMFA 2QYOA 4I0WB 1UOEA 4WKPA 3U5TA 5A3RA 3KT0A 3T99A 4TL8A 2JFFA 2XUPA 3L93A 5AHRA 2IXGA 3R6GA 5BW5A 2HADA 3HCCA 5DBOA 1SA0B 5D85A 2X1MA 2VQDA 2PKQP 5CCEA 5BSFA 3D8BA 4GRIA 4NBRA 4ERNA 4Y30A 3VOSA 3FCYA 2G80A 1UC5B 1ABFA 3FE2A 3ZWKA 3TL6A 1EIWA 1Y5MA 4MV0A 1OROA 1KXJA 1E4EB 1S9DA 3NX4A 4BNJA 3P0JA 1MRSA 4LOLA 3ORQA 4J7XA 3WA7A 5JASA 2IVZA 1V5GA 2XE7A 4X6UA 5KKCA 1NW7A 2RJNA 2GN4A 2PZ8A 2IELA 3PEYA 1AN0A 2OSBA 2ODQA 4Z4GA 4S2EA 3TM4A 1G60A 2BP7A 1EWTA 1LC3A 3G9ZA 3RS4A 4F9FA 3KYBA 4Q82A 4AXBA 4Z54A 1WZEA 1D0SA 1FSGA 4K86A 1IMJA 2ZBEA 3I6ZA 1KIMA 4KXMA 1T5TA 2P75A 3PRYA 1GG9A 4YJHB 4Y2GA 1Q3KA 4GMKA 4TXHA 1ZPDA 4XYEA 2IHJA 3A4NA 2W71A 4KQ6A 1E2BA 1PQUA 1ZOOA 3AUJB 4GPBA 5JSUA 2VDNB 2QTGA 1PJ4A 2P9HA 4M0PA 2H3EA 3BXEA 3DVAB 2QRUA 3OF2A 1W94A 3SY8A 4GP6A 4FS3A 4GS5A 3QVUA 2QL6A 4HRVA 3FDFA 4I5IA 4WAUA 5GOZA 3UICA 2Z4SA 1CXZA 2PMCA 1O96B 4K3UA 4NOKA 2QN3A 1UBOS 3OI7A 2J9YB 4NENA 5LQAA 1HT2E 2IGTA 1MUUA 4KDCA 4NDZA 4AO6A 3LT1A 4M2LA 3F97A 3O4HA 2JI9A 2VJNA 4IDFA 3IV7A 3Q9UA 4KXVA 3FSEA 5H5JA 3WRXC 1N78A 5E7MA 2KX7A 3OA2A 2C7BA 1N75A 2CDRA 2EZTA 1QYIA 1GIAA 4FLFA 4J0JA 4XWYA 1TI7A 1VSUA 4PLYA 5COBA 1U7DA 3DKVA 1GILA 2WNSA 1XRRA 3DAHA 1M5UA 4JBHA 4P54A 2HHHB 5C5EA 1V45E 5CX1B 4LYAA 4D0GA 3BHMA 1Y1PA 2XNDD 3R77A 1M2VB 2BFMA 4F45A 4FNOA 1EDDA 1A8SA 1IY8A 2OBLA 3GRCA 3L0OA 4CI9A 3IJEB 2QYHA 4UU1A 1JMVA 3IMEA 5FUVA 2HV8A 5HW0A 2JI6A 4XB1A 2P30A 2I99A 2XQJA 2Z3WA 2X4DA 2ZIFA 4KFTA 5B30A 3NPMA 3TLAA 4X8OA 2QQ0A 1XRLA 5TDHA 1IONA 1J1IA 2F3PA 1AKNA 3IE1A 3IULA 3CGWA 3S1AA 3AOEC 3ZK8A 1S2NA 4V2UA 4XYMA 3VDXA 1BVRA 3HYTA 1V7QA 4DUGA 1WD7A 2C4UA 2J3LA 4NG5A 1A2OA 5H9WA 2GHTA 2I2FA 3HH8A 1E59A 1M1YA 1VKRA 3HDQA 4ALIA 4LE1A 2Q3MA 2HJVA 2PUVA 4NQZA 2YASA 1JHDA 3BN3A 3EDQA 1ZUNA 2OCDA 1OAAA 1Q74A 3ENNA 2V0CA 1NW5A 5D3QA 3UMBA 3C43A 4UBLA 3NHRA 3W8FA 5JNLA 1Z2PX 1E20A 1PQPA 5JJKA 2HMWA 1E6CA 1IZYA 5KIAA 2XB4A 1GAWA 3ZCPA 1XKLA 4FHFA 1VDZA 4L16A 3U16A 1FMTA 2VPXA 2FP4B 1Z2DA 4UQOA 4A5SA 5ADUS 4YCDA 1SXHA 2HHCA 4U3JA 1MVNA 1W4AA 3C7CB 4J2OA 2QAGA 3PDJA 1VG1A 2WZQA 4RGQA 1HNXB 1DBPA 1ZAKA 4IMJB 4P5DA 4Y6RA 1US8B 1BD4A 4RIEA 2X2OA 1SCUA 3HN6A 5A7FA 4PSKA 1QHGA 3WY9A 3AZPA 3L6BA 3PFNA 3UMCA 2Z83A 2FUG6 1TT7A 4TTQA 5IXYA 1QR2A 2YRWA 2FTKE 3KDAA 4AI6A 3UJHA 1E3SA 3PDUA 1TNDA 3IVCA 4PSVA 5JZMA 1KKLA 2REQA 3M1LA 4HRAA 2H8KA 4RENA 1C81A 3MRSA 1YMUA 2BKVA 2WUEA 1K75A 4HGZA 3L46A 3OH8A 4HAOA 1J97A 2AN1A 2GX6A 4FFMA 5DT9A 3NUGA 1YUBA 3RRZA 1AF7A 2CNBA 4IGFA 1ZDMA 4D44A 1EWQA 4A2QA 1L4NA 1R0SA 5CA0F 2GZ1A 2BWJA 2RD2A 1C14A 1YR8A 2EKQA 5CFNA 1TMOA 4D46A 4RSGA 5IKOA 2A9QA 3AU9A 1WU8A 3TRDA 1ZRNA 2HZBA 3AKDA 1O4WA 3TEMA 1M10A 3IPAA 4X3OA 4LFAB 1YO6A 1C3OB 4LIPD 4Y9DA 2QZPA 1FP4B 4JGIA 3C16C 3CRNA 3GLIE 2VYNA 4UOQA 1Z5GA 1ZH0A 4ARSA 2Q62A 4L7QA 4RVSA 3WTCA 3ZN2A 1CEQA 2O52A 1V11A 3QX8A 2J5KA 1CUYA 1BC5A 2GWHA 3KEGA 4WOBA 4CM1A 6LDHA 4Y8VA 2WIDA 3CNLA 4H17A 4IQ4A 5KNDD 3AERB 4EO9A 5JYEA 2X1LA 3OU6A 3OIFA 3PCXA 3KFXA 1PLKA 1J56A 3CZ9A 4EY4A 3HJHA 4HWTA 4N49A 4H08A 2IP1A 4PGMA 4FR2A 3ZCQA 1OMOA 2BCJQ 4OSEA 2HPVA 4GD3Q 3L49A 4X54A 4GYYA 5FLEX 4ALKA 5EJ5A 1MJGM 2XA9A 1IUOA 1EUCA 4PYRA 1I7NA 1PWHA 2AMVA 3WYAA 3WYDA 5AKXA 4TSKA 3E3NA 1U1FA 5AM1A 4QKQA 1E6LA 2DPHA 5BOVA 3ZWQA 4F86A 2BSQA 1NJGA 3E9QA 2IUUA 4RZ2A 2HUPA 4MEAA 1MHTA 4UTZA 4B3CA 1H65A 4JYAB 3EGDB 1DJMA 2GVNA 3GQBA 3M7IA 3OPXA 4XYGA 3WB2A 5EJAA 2C7VA 4QO7A 4EFNA 1V6SA 3IUYA 2WIBA 2E4AA 4JQYA 5FUYA 4FGZA 4Y1EA 1KMHB 1A2BA 1M54A 4G97A 2BTOA 1QAOA 3WKCA 4GOLD 3HMQA 5E38A 2JCYA 4DN6A 1CTQA 1AZWA 1Z45A 3PNSA 2VP2A 3NNSA 1CDEA 1M33A 3PRHA 2JI8A 2P40A 5M3BA 4ZI3A 5AW1A 1L3IA 2VH5R 2B8EA 1FSPA 4FQ8A 3KR2A 2H1SA 2QPOA 1UWVA 2E89A 4B0OA 5FPYA 1UKCA 2CKDA 3R0QA 2ZYHA 3AJDA 1PIWA 4XIGS 3ZU4A 1B0ZA 2BBSA 3H16A 2BHRA 1V5FA 2VIIA 4NXNB 1XKXA 1U9CA 3CEAA 3TZBA 1MZPA 1MAUA 1YJ5A 1D4ZA 1CX9B 1K8RA 3GGSA 1E2LA 4N3CA 3PGJA 4H1HA 4ZI7F 1AS3A 3FOAA 4LV8B 4BQSA 1O0BA 4QBIA 1A4RA 1X92A 2UXDB 1WKVA 2CSUA 3IHLA 2OLKA 2WK1A 4YFYA 3DDCA 1G7RA 3NM4A 3SPXA 1D0VA 3TI9A 1LA2A 2LWIA 2OE2A 1HV8A 3ANXA 4LI3X 1QIHA 2OB2A 3JQAB 4XGKA 3RB8A 1HTBA 1E3IA 5EIFA 2A0UA 2V8OA 4LJLA 5ALUA 1TPYA 1YCDA 1GZUA 1K08A 3VTAA 2GSWA 1B6SA 3HFJA 1ML4A 1U28C 3WNCA 1MTZA 4U1RA 2IS1A 3UAVA 2RI6A 3PXEA 2N1BA 3H2GA 3GRZA 5CXUA 4ZT4A 4A9AA 3TKAA 2AWNA 3IAS1 4G01B 1U2DA 3SFZA 3ZWMA 2BBOA 4EHHA 2HMYB 3JSXA 4ANFA 3G0DA 3O8OA 5CEJA 2V54A 1ID1A 2VAVA 3LBFA 5B7GA 3CX8A 1AV6A 3HBJA 3VR2D 3O4IA 2H07A 2G67A 2VUUA 2QSYA 4XRRA 4F1JA 5JROA 5KTYA 4UREA 2X6RA 4HLQB 4L5AA 5EWJB 1XPRA 4LECA 4D7AA 4WVFA 3RC3A 2WKRA 5ALKA 1X7GA 2VPYA 1R4AA 4AIIA 3GCZA 4I3GA 1ZBQA 1T9GS 2R65A 3SLGA 3ZS8A 3ZWDA 4DCPA 5F7XA 3DEYX 5K0JA 3ZVNA 3KK0A 2FWRA 4TLEA 4JMLA 1ORWA 3K8ZA 4ZODA 1T5HX 1XVUA 2FSSA 1QIEA 3AI7A 1GRRA 4C4AA 1GGFA 1T4GA 2QMHA 5FT9A 1TCUA 2XE8A 3QVMA 4GT1A 4GSLA 1DMRA 1R6XA 5EWMA 4DLXA 3T41A 1DFIA 1BXRA 2XGMA 4UDXX 2WINI 2Z58A 1EG2A 1T5IA 2OAP1 3AXTA 3B1ZA 3KQWA 4HNQA 4LNUB 3KJEA 2GZDA 5ITZB 4IIJA 1XEAA 4E31A 2QG4A 2ZBGA 3BFJA 4B3XA 1BMFA 3BWCA 4HJXA 2R9VA 5JDIA 5KU1A 3R8FA 4UXIA 1XA3A 5JAQA 2QRNA 4BVLA 4LX0A 2EKLA 1QC5B 4M7WA 4WE3A 5LKRA 1NV9A 2QQFA 3LY8A 4UMFA 4OATA 1EGHA 1KOFA 3GN2A 1H69A 3GWGA 3KOUA 3K5HA 2C4TA 5EXDA 3OCJA 2GM9A 1Q7CA 3C3AA 1Z37A 1ZJ6A 4YMIA 3NDJA 4Y6QA 2FWJA 4L5CA 4U7JA 5HDQA 3NYRA 3C8ZA 4COOA 2QIPA 1VL8A 2YDYA 2I7CA 3AYXB 1KO8A 3FAKA 1ZRMA 3G49A 4IFBA 1JHAA 4TS9A 4AG3A 3VAAA 4BO8A 1H4SA 1K1EA 4DG8A 1Q1AA 3STHA 2CMGA 3KQPA 4JBXA 1T36A 2QGFA 3LFUA 2B61A 3COVA 1UDCA 2PD3A 5ESXA 1JF8A 2A1UB 4OQNA 1BD3A 2R1TB 4RGVA 4TM7A 2R44A 5BW6B 3DB2A 5FPSA 1V1JA 3S1AB 2H7XA 2GBCA 3FTNA 5IABA 1RXWA 3CKKA 2NVBA 3H5OA 2JCBA 3WLHA 2P2LA 1DJQA 1QHXA 3A1TA 1D2RA 1X7WA 2ISSD 2G07A 4D4IA 4ZJYA 2VYQA 3U09A 4HPWA 2XD4A 2IH4A 1RC1A 1PSDA 2JBHA 2RGWA 4GZMA 2BEUA 1P5FA 3PIDA 3W79A 4JN6B 3S0JA 5BT8A 2PV0A 2FAXA 1N9KA 2TMKA 3OQVA 4H59A 4JI8B 2PR7A 1BVHA 4C3VA 1BN7A 3BIJA 1XMPA 4NL4H 1G8SA 2FFAA 3EZGA 1SXJE 2BGUA 3DM9B 3KXDA 5JCJA 2NO1A 3V8NA 4WEQA 1J09A 3PXDA 4Q3DA 2G88A 4H4CA 3SR3A 3OUUA 4KXXA 3P9QA 2ZTMA 3OOYA 3VPAA 2ZI6A 4B7ZA 2X40A 2R7NA 4Q12A 2HU2A 2PX4A 4DLZA 3EDMA 1UODA 2EZ4A 2HD4A 3FR8A 5DW0A 2DLCX 5EKSA 4BQNA 4UHFA 5HOEA 1F06A 3Q7EA 3ZGVA 2P2ZA 5LJIA 5ULLA 5DISB 2X5NA 2HJ9A 2AKAB 1RKUA 2AJ8A 2I78A 4H7HA 4MV3A 1FQWA 1OZFA 3FOWA 5T8KA 5J9FA 2X0DA 4L75A 4S1VA 5JXWA 5E7JA 5DYNA 3WK7A 3V48A 2DBRA 4OJTA 4ZRMA 5GADl 1V8DA 2ZZKA 3FUWA 4PWZA 5HA5A 1K0UA 4XEUA 1HSOA 1LDEA 1DQZA 4S2UA 5CA0B 2PJRA 4RPHA 1M34E 3LLSA 2RMKA 1FMJA 3EXIA 3HA5A 4RSRA 5KMGB 1NW6A 3T1VA 3C8HA 2SKEA 4IMIB 4W8HA 2J0SA 5SICE 5IZCC 1W52X 2JZCA 3MGAA 4ZVLA 4AJOA 1Q14A 2X0IA 1PYOA 1PKEA 3CH5A 1FUEA 1KZHA 4ZFNA 5KYYA 2AG5A 1V4VA 1EUZA 1URPA 1VYHA 3U56A 3VR6H 2R7MA 3TBKA 3UWPA 4A91A 2BL4A 1HO3A 1SKAA 2CFSA 2A2ZA 3F8SA 3GRPA 3RT7A 1NDQA 4BNXA 1RLOA 1L7QA 2FRXA 4M89A 4ZZ2A 3ENWA 3ONWA 3QEJA 1NVGA 4UE2A 1TZBA 2D5BA 4O2BF 1MB0A 3Q85A 1DELA 2GZ2A 3TR6A 2CY0A 4GIBA 1U9IA 3P19A 1KE1A 2ID9A 1H2HA 5JUWA 1XXLA 3ZU6A 5IHXA 2HK8A 4MOWA 2AB0A 4PGFA 5MDHA 4YRNA 2F62A 3PQ8A 1UWKA 1UWCA 3OFVA 1EUCB 1RP7A 4QUDA 5I7EA 2E7ZA 2PQ6A 3HCFA 4FHEA 4P3KA 4RXTA 1ETUA 4ARVA 4X3PA 2HY7A 2E3JA 1GPYA 5SZHB 3HDHA 4IIJF 1I7PA 1QGAA 1LQTA 2OCKA 3ITNA 4K6MA 5JECA 2A30A 3SEFA 1HDZA 2OM6A 5KYKA 1R27A 1YU9A 3DCYA 2C2BA 5DBFA 3L43A 3ROZA 4D25A 4EG4A 5JQGB 1DS6A 3A9TA 3VPBA 3DKRA 3QXSA 5JJCA 3RDPA 1RYHA 4H7IA 1F60A 5LD2B 3AQIA 3H1AA 1E0SA 3K0BA 2H2FA 3F74A 1I2ZA 4RPLA 5D6OA 2R6AA 1YZYA 2X4IA 3F7NA 3D4BA 1BU8A 2C3UA 2LXNA 1BX3A 2D1QA 2WYUA 5KCZA 3ML1A 1GNLA 1E3WB 2JS7A 4U2FA 3BT7A 1E96A 1E5VA 4RGBA 3UQYS 4IX9A 3VHLB 2PQ0A 4CMAA 5BV7A 4JWKA 5IC5A 1UJ5A 1NJ2A 5GVRA 3KKMA 2AMFA 5I9TA 1SCQA 1YVDA 3S7ZA 2Y77A 1AO3A 1IEWA 4FYWA 4WI1A 5KI6A 4CIXA 3E5HA 2Q2WA 3EZ2A 1U3FA 4XM0A 5KVQA 4BWVA 2CMKA 4Y9TA 1N7JA 3BXZA 2EEPA 5IDVA 1J0AA 2ZDQA 4DHEA 4F38A 4QL3A 3HU5A 3U37A 4BHTA 3LBAA 1QOPB 2QTLA 2MCFA 3TH5A 4DJFC 5AVVA 2D5IA 4LWZA 2Z8ZA 4AKHA 4MUYA 1GQ2A 2VUTA 5AJVB 4J75A 5LUBA 4GMFA 2C1EA 4O5AA 4EJMA 4OREX 1NT4A 3HYSA 1YE8A 3OA0A 3LIPA 4IGIA 3LBNA 4X94A 3P9IA 5AIAA 5B58C 5BV8A 2BTEA 2YZKA 1F2VA 4D42A 4KDFA 3S99A 4Z4CA 2HGZA 4X64B 5J4YA 1T1SA 2YXNA 1QH1B 3ASZA 2QK4A 5D7BA 4EH1A 5HWSA 3HKEA 3LWZA 1EHIA 4UTRA 2NNWB 1CVIA 2VLBA 1N2BA 3I6YA 3PJRA 2Y1XA 4Y2JA 5JQWA 4ZQEA 9LDBA 3O7MA 4W5RA 1HFKA 1IWPB 2OCIA 4QARA 2X4LA 3EQ7A 4YJ3A 1K5PA 2ZXFA 3HCPA 2RBGA 4QRDA 1TUGA 2QJRA 2YRFA 5C51B 1DQYA 4FGUA 4NJMA 2PUHA 3IEKA 3BC1A 2ZUSA 3QEMB 2P3QA 4IMRA 4NNOA 4CMEC 1XZAA 1KI7A 4F8JA 4GOJA 4F1KA 2WW8A 1C3JA 4OHWA 1ZD1A 4CWAA 1JIKA 3PUZA 2Z1NA 4LA4A 2HKIA 1SHUX 4U39A 4JA2A 4OQ4A 4WDRA 1W8IA 2PWAA 3GG2A 2O3JA 2EFYA 5A5FA 2NZWA 1ZGAA 2VK8A 4WBSA 2AI3A 3BH0A 4N8DA 3WDMA 4DUPA 1H85A 2A88A 1W96A 1N2IA 3EARA 5G40A 3ZY6A 5LU8A 3K1AB 2ICAA 5B6IA 4TYNA 4HQOA 4R1TA 1F8YA 5FULA 3CEJA 4PYOA 3X1WA 4A15A 1HGXA 1I2AA 4Z4HA 1FJGB 3OT5A 3TIGA 5DXAA 2WAXA 1CIPA 5D1HA 1RYZA 1I80A 3JQRA 1O5OA 5LYYA 3ESYA 1KMMA 4AZ0A 3H19A 2X0FA 3QJ5A 1LJ8A 4HDRB 3O4FA 1B8VA 2DF8A 2IFTA 3DLIA 1XCGB 4CEJA 7YASA 2C1XA 2XQIA 3B1JA 3JQGA 3VR5A 4PLTA 4AROA 4MWDA 1GZ7A 1NVDA 4C1BA 2WLSA 4CGYA 3COJA 4MUHA 1YZFA 1OWNA 5AR1A 4BQIA 1GEEA 3W78A 3RYFA 1N2CB 3IV9A 4A2WA 3G2MA 4KQFA 2WM8A 3EIUA 4IXNA 2BFCB 4XWTA 5J1SB 2OV3A 3A1DA 3MGBA 1AM4D 5KDLA 5IH7A 1A1SA 2VZLA 5EZ5A 1T4BA 5TB5A 1Y1SA 4D8TA 4UNQA 5JYDA 1R9NA 2DWCA 2G5CA 3ZJYA 1Y4AE 3HA3A 3C5EA 1RXVA 1KI9A 1TCAA 2O8BB 2X14A 1K88A 3GLRA 3UHFA 1FRFS 2C42A 3JQEA 3O0DA 2XECA 3NVDA 2AK3A 3A6FA 1QRSA 4V1CA 4HMOA 1P80A 1RXYA 3WGGA 1G3MA 3WP1B 3AEQA 1UOPA 4GPD1 4Q02A 2H1OA 2C98A 4R8RA 1H23A 3M6UA 4ONEA 1L4LA 2YY5A 4RO0A 2I54A 4KSCA 5KS2A 4ZZ3A 1IVSA 1VI5A 2PUJA 3EIEA 3RPEA 4HNAA 3U9LA 3ZBTA 5CB6A 1IZ8A 3QWAA 1CYEA 3FGPA 3R5FA 4MINA 1R18A 4GWGA 1JL3A 1N9ZA 3BSSA 5T3YA 5BSHA 1W4RA 2VSXA 5I7WA 1XTBA 5L6LB 4R5HA 3NBUA 2QAGB 3PNYA 1P29A 2WHPB 4ENSA 3QPUA 3WE7A 4OQDA 1E5LA 3ELUA 4QQKA 4UHHA 2BM9A 1DO0A 1TC1A 1A2KC 4FQ7A 2VJKA 3L5OA 4C4PA 4B3HA 2M9MA 2Q3BA 1ZGZA 2I29A 1UT8A 4DV2B 3RU3A 4TM8A 3EGWA 4RVGA 4N9WA 1E9CA 3U7HB 2LUOA 4JB8A 3RS5A 4QFBA 4I8XA 2BD0A 1NJ5A 2II6A 2QLJA 1QHSA 4H6VA 4KLRA 4U2BA 4N54A 3QA3E 5DNEA 5IVIA 3UWOA 3EAFA 3TW6A 4PXSA 4RV9A 2OVBA 4YP6A 3WV4A 4AM8A 4BUZA 4TYYA 3JRXA 1O6BA 1TB4A 2IYZA 3GDWA 4JYBA 3RRBA 1P2TA 3SKYA 2YYYA 2XJ9A 2W43A 1IK4A 4ISBA 4M8SA 3VR4D 2IZOA 1CUAA 2GILA 5LA6F 1R3DA 1TC2A 3ICOA 1VKZA 3C3DA 3P0EA 5EP3A 1WMDA 4MJLA 4ZAVA 1CF9A 5DMXA 2CL0X 3HJTA 3ADBA 1HX7A 3AFNA 4WW0A 2F3QA 1E4EA 1NBWB 4D9MA 1FX0A 4UBKA 4W5TA 2CUTA 3UJDA 3ZTWA 3K9GA 1LBEA 4IO0A 4C30A 1JAHA 1J9ZA 1E2IA 2QG9A 5EKUA 4RA6B 5HQTA 5CVDA 3NATA 1GGHA 3KXPA 5A9RA 1WZUA 4JL5A 4CQLB 2W8BB 3VNRA 4JI1B 3EPKA 1U2PA 4M8NE 2R79A 3O8LA 3UEOA 3F9RA 4REOA 2EU8A 2WIKA 2G1KA 3QMVA 4BBAA 1Y5IA 4G8DA 1N8SA 1ZGHA 5BNZA 3WRYC 3R9WA 2XADA 4UOZA 1OTYA 3F5FA 3IOMA 3WP0A 8ATCA 3RJMA 4QOJA 3PFBA 1MD9A 4EHIA 3C0KA 2I3AA 2CLLB 2AFHE 2MYPA 3HLKA 3STYA 3PHLA 4AMZA 2YL2A 3R23A 1J8YF 1ZA2A 3WWCA 2VC2B 4BMDA 3BZWA 5L3RA 2W2VA 3TCNA 2EFHB 4UDYX 4W5QA 1ZESA 3DWIA 1FLDA 4F7DA 1G8PA 5IM4F 1T2NA 3FSRA 2ZITA 3IBCA 3VHRA 4F4JA 1GLGA 5FTKA 4BLPA 4HNAB 4JP8A 1G20A 1YHNA 1F9EA 2Z5FA 4AW9A 3GMTA 4PCLA 4BJ5A 1TKCA 1QFMA 3GT7A 5TV2A 3FYTA 4MR7B 3QUSA 5DBHX 2IIQA 3U3JA 2VTBA 3ZGZA 5HIKA 1SBHA 7MHTA 4YUAA 5ECWA 3ROTA 3WLQA 3C7KA 2J3DA 3ASUA 5DNCA 1KSHA 5FPPA 4QFDA 3DBHA 2DT8A 3D54D 2VXOA 3GA0A 3RLIA 4TV8A 1NJ6A 3GC6A 4U0JA 4Z2AA 3SDBA 5DT2A 1ZK0A 1BWQA 5IANA 3KOOA 1BFUA 4CQMB 3FFBA 2FOLA 1P62B 3GRKA 3NO4A 5C8VA 2PS3A 1BQ4A 5IK2D 5CBPA 5SZIA 3A11A 3E3AA 2P6OA 3ZCTA 2QROA 2EX4A 2NYAA 1Z13A 2WOJA 4FYHA 4NZYA 1JQ3A 3RAPR 3ZDRA 4A1OA 4EQZA 2QLLA 4Z49A 1HE8B 2FRVA 1R8JA 1D6SA 4IFTA 4P5PA 4EY6A 2E5LB 4ND2A 3B2EA 3IIMA 1XDWA 3QX7A 4FI3F 2QRJA 1WDTA 4QTZA 4GKBA 4E1VA 1NF9A 3RS8A 1Q7EA 3D3JA 2E4ZA 2DKNA 2V3WA 5E3JA 4ETWA 4LZJA 5SZJA 3C2QA 5IT4A 3CH7A 1SU8A 1XMSA 2HSEA 3AW8A 2OCYC 5TVKA 2QJOA 1Z2OX 4C76A 3WQBA 5JLJA 4U7DA 3A8TA 3RVOA 3EPHA 2EWMA 4I4NA 3QELB 3RTBA 4C0XA 5THQA 1KPIA 2XMDA 5FQOA 1OLUA 2D7CA 2IE8A 3K6KA 2GZHA 3FKQA 3KLNA 2VRCD 1K6EA 3AETB 2OPHA 2A5FA 1H2YA 3GUVA 5JXIA 1ZU4A 5IT0A 3RO7A 1JFSA 2YWDA 3RVDA 3HGMA 4RQTA 2OP0A 4S35A 4JI2B 3UV7A 4R1MA 3NHWA 1PT5A 1D1SA 1K3FA 2FR0A 2Q7OE 2OG1A 2AC7A 2WWFA 4GI1A 4HUTA 4DR4B 4IHKA 5B6JA 4WUVA 3KSAC 1TKBA 3KVYA 5J2UA 2QD5A 3O92A 5CFQA 3AHEA 3AK4A 5ECDA 3DLHA 3OZCA 3QEOA 1TRHA 3I9OA 4UMVA 5E1MA 2IV2X 4RTMA 5H3HA 2I2XB 3G8BA 4IQFA 4N6NA 4W4TA 3GARA 2IITA 4X3CA 5LZ9A 4BY9E 1SHZA 1YHZA 1G5QA 2NPFA 3FLAA 1Y6QA 4DSAA 1XPJA 3JAWB 1NC1A 2Y71A 3UFXB 5I4KA 4LCEA 1YK1A 1U2RA 2H6EA 2Q4DA 3REFA 2GM5A 2QVXX 1S8FA 1XCLA 3JQ6A 3LKZA 3PQ7A 4Y1FA 1DZ3A 2P4EA 1A8HA 2JD1A 2WWTA 4YJGA 1M6NA 1N5DA 2RJ3A 4LNUA 2GDZA 4X7BA 3RSCA 4V3CA 1YBHA 2B1JA 4IXTA 3SJ7A 3WGLA 3UMJA 1FP4A 2BFOA 5TEVA 4BASA 2O7NA 4YRGA 1VL2A 3R76A 4CRWB 1Z62A 2BZ1A 1ILWA 4FFDA 4IIBA 3I9FA 1K5DA 2NQ2C 2YJTD 1G63A 3NKVA 2H11A 2JLVA 2PQ2A 1N4AA 3VO8A 3LQ1A 4KN6A 2YFKA 1ESDA 4L0DA 1P2SA 1PZMA 1Y3AA 4RZIA 2NW6A 5BSVA 3QBTA 1DU4A 1Q0HA 2O3SA 4TYPA 3RSFA 4ZVTA 2NQ8A 2QNIA 2QLMA 4H4DA 1JA9A 4TVBA 3WJ2A 5L40A 3A3YA 3TK1A 2CCKA 1KOJA 1AD2A 1E1MA 1SQ6A 2LIPA 4OQQA 3MAGA 3GJXC 5J5CA 4BIIA 4FDLA 4FCCA 2CJWA 1IH8A 3DTVA 1DI0A 3DUWA 2BMDA 3RS2A 3C3WA 4W5OA 1ZEJA 1U5BB 3MTBA 1FFDA 2W22A 4FYIA 5IUJC 2OWEA 4Q4JA 4AQYB 3BZBA 3O2NA 3OQHA 1RQLA 2J5QA 1RI2A 2GNOA 2GPTA 1WUHS 1Z2NX 1FYDA 2CC2A 2PJDA 1GGKA 2PMDA 3FUCA 1MIOB 5F64A 3P0HA 5IASA 2G9QA 3HYCA 5K8LA 4KC0A 1R5NA 5SYAA 1AHHA 3WBJA 3MELA 3V7WA 4TWIA 2X41A 2A57A 1VPVA 3QF7A 4BB5A 1FMLA 2MSNA 2ORVA 3TNDA 2VWPA 1L7AA 3EVAA 3EWAA 3JATB 4ITVA 4Q9DA 1QIIA 4B75A 5A0VA 4KYIB 3FZGA 3VC7A 2W6MA 4V0SA 4ZOEA 2RHBA 3F3YA 3M3HA 2YVQA 3U4HA 5KNBH 3BHJA 3EISA 1EUDB 1XCOA 3L40A 2HGSA 3EOZA 1L5KA 1A4UA 2UUAB 3E58A 4KYTA 1T8SA 4N3NA 4L95C 3Q8KA 1WWKA 2FGKA 2ALJA 2HIMA 3M6VA 1A72A 1E4OA 2MSCB 3H5RA 3Q98A 2VYFA 5E4TA 2WD8A 4GOXA 4QYTA 4ENPA 1KAHA 3OPYI 2YV3A 4JEUA 1QAQA 4FMCF 2FW6A 3E18A 2C3OA 1IE3A 2P9YA 1RLTA 3NXKA 1BOOA 2IW3A 1O89A 4KNWA 4CFZA 2JIZD 2OYCA 4Q1VA 1S1CA 1XZLA 1NOKA 1G291 3DBRB 4R2HA 2BONA 2FDRA 1DC8A 4HX5A 2H5JA 2HJWA 5EP2A 4B09A 1ZKDA 3LT0A 3FPKA 1ML3A 3BOSA 1Q12A 4COKA 2O3RA 3CF0A 2R5NA 2PWYA 1TCBA 3LX6A 3PBKA 4TWJA 4KR9A 1NF2A 1KE2A 1Y4ZA 3NEPX 3LMKA 3FD8A 2R8EA 3SS8A 3SZMA 2FWAA 2H1FA 1YA4A 3IEPA 3RBVA 5ED4A 2BZ0A 2EKZA 1MAVA 3G6KA 2WD7B 2W8BA 4P3YA 4PO1A 3ZXIA 4R7TA 5CITA 3ZW9A 2XWBF 2NSDA 5A4IS 4NCHA 2IYFA 3AV3A 1BE0A 1NNI1 4ZP1A 5L4SA 2WSMA 2WJVA 2D1TA 3M4JA 2C94A 4TROA 3DNPA 4NTZA 3R7AA 1P6UA 2JF0A 3IPYA 1XZPA 4ZT7A 3ZHZA 1R8SA 4U7TB 1W93A 5DE3A 2X9QA 4ZOAA 5TS2A 1T0PA 4NBWA 1BHQ1 1NRIA 2PWBA 2Z5LA 3PNMA 1D03A 4NR0A 4YIHA 1M1ZA 1RCUA 1HMYA 1S5PA 2ATCA 2COKA 1J90A 3KUXA 4PNZA 1T2FA 3R24A 1R00A 1M67A 2PU7A 3CXRA 4IUDS 4QUAA 1P1CA 4RANA 1JDPA 1Z5WA 3QLVC 1PS8A 4FS8A 1I6WA 3AUKA 3AY3A 3HVJA 3QRWA 3G5AA 2Z57A 3AL2A 5KYTA 1C30A 3G2PA 3OAAD 4G0XA 4MR7A 4DILA 1LV8A 3K6RA 3VZBA 1TTHA 1KDRA 4YMGA 4TMWA 3UQZA 4HWSA 3HZZA 1RRGA 5HEKA 2ORWA 1WCV1 4AJ4A 1Y4DE 2IODA 4RTSA 4BMXA 4ZCRA 4JP5A 2GEUA 1R0CA 3DNMA 4LBYA 1GJRA 3IGFA 4X20B 4POAA 2FQQA 3STUA 3PNBA 1FYXA 1P73A 1SC3A 1W0KD 1T9CA 1J2EA 3R5HA 3SYNA 3KXLA 2BGIA 3K09C 1LNQA 1VLLA 2GR9A 2O8NA 1U6KA 3DJYA 3UJ7A 4KRXA 4IEEA 1B2RA 1GWNA 1B16A 1PBNA 1PX0A 2HEGA 2BM0A 2OL4A 1D3AA 2H2AA 2IYPA 2WSBA 4WXHA 4A82A 3KTAA 4IFEA 2HWXA 1QS0B 4C43A 1W5TA 4JLNA 3U7EB 3UJNA 4C7JA 3WBBA 4KPFC 1RACA 1S7GA 3ON5A 4C4RA 4ZYTA 3PS9A 3C3JA 2IYYA 1BCSA 4GPIB 4YRSA 2HRZA 2ST1A 4M8IA 1U8ZA 2I1WA 2ZT7A 4HDAA 3L4JA 3ZNPA 3F6BX 4TPKA 3B12A 1HOXA 1ZCJA 4XYBA 4Q7KA 1H0RA 1ENPA 4QOFA 1SD5A 4XX0B 3RVSA 3HCWA 1BGXT 3SEZA 5AOAA 2HAEA 3STWA 4DIEA 3I0NA 1NI4B 1G38A 1Z6AA 5BYJA 1QHEA 1CUWA 5BWNA 2ZRFA 3QY0A 3FUVA 2R48A 4OXXA 1BHO1 2C3PA 3GFVA 3VI3B 4KG7A 3DVRX 2QX6A 1DUSA 4NJMB 2B30A 3L4BA 4PONA 1PW5A 4MUGA 1RWQA 4GM1A 4QDXA 5CTAA 2CD7A 2UZ1A 3PNKA 5FO1A 3T0IA 5MGBA 2PAFA 1JEQA 2F2TA 4FMBB 4MI1A 3A1VA 1JMYA 1NP3A 1X0XA 4NZOA 3GEMA 1C4KA 2W2LA 3DMGA 4LDNA 4YX9A 4IH9A 3VYWA 1XA4A 1UZMA 2BEWB 1MJHA 3THWA 5I4CA 2WWRA 4N5MA 2QJWA 3K0EA 3VH1A 1UDRA 1XCBA 4BVFA 1E3LA 1NFFA 4JU9A 1TAUA 3HNOA 3AIKA 1M6WA 1LNZA 2XMSA 1X3LA 2G1UA 5KNDA 2V7VA 1CQPA 4PNHA 1JIJA 3UFXA 1MCZA 3OURA 2IYWA 3D81A 1GKLA 4YJGB 1CSEE 1S3GA 1KFJB 2AA3A 2FZKA 2XITA 3WGZA 4B3IA 4CN9A 3C1AA 1GZ3A 2QORA 2O6LA 2AI2A 2WTBA 2ES4A 2JGRA 2ZT8A 1IHPA 1Z0AA 3AP1A 4FOOA 1C3EA 2Q9CA 1YA8A 4LKOA 4PIPA 4EMTA 4ZDKA 5EN4A 2VRCA 3M81A 3DHWC 4HUJA 4QYXA 1Q7GA 3SCZA 3NWEA 3ZHXA 4D8YA 1IN4A 2RBKA 3MIZA 2ZCVA 1T4CB 1N7GA 1C41A 1ACJA 3N0RA 2QPLA 3N8GA 4OHYA 5ALZA 4HNTA 1UBKS 4EYOA 1KIAA 1ES9A 2C58A 4G0PA 5CEEA 2FZ5A 2UV8A 2BFCA 1G21E 4IHJF 4EHKA 4D81A 1EP9A 1K6JA 2DY1A 2GD0A 3OZ7A 1OFVA 4ECAA 3DAYA 5FPQA 3FYCA 1NBME 2LTAA 2JCSA 2Z2ZA 2ZSBA 3IP9A 5I7HA 5K45A 3VXKA 3VC2A 1N6PA 1LK7A 3FLBA 2Q5HA 4KK4A 4QPJC 3V4PB 1DEXA 3AR8A 2OAGA 5KSPA 1OZGA 3GW8A 1JQKA 2MHCA 4HCJA 3I09A 4MGHA 2PUDA 4C5BA 1G1MA 4LK3A 2XCSB 2IQIA 3KHSA 3ETHA 1M2OA 2CKMA 2VQ6A 2P11A 3CWCA 2C96A 5F7JA 1CNFA 1Z7EA 4Y2SA 3IDSA 4DSZA 3GJYA 1XVAA 3BERA 2F7SA 1FFCA 3Q9SA 1O0CA 3NBQA 3CYFA 2WVHA 1V2HE 2OKCA 3E7WA 4BBZA 3GFTA 1AHIA 1NIJA 3GVHA 4TWBA 3THYA 1Y8AA 2BAGA 1KMIY 2DCUA 1IJFA 3PUKA 2KLBA 3R5SA 5CLQA 1VHDA 5BW8A 5KQSA 4TV9B 2WHPA 1W9HA 5IDWA 1KK1A 4QBGB 4QRHA 2NZXA 2X5OA 4HD8A 3V8QA 4EY3A 2DPGA 3PKJA 1NN0A 2QF7A 2ESRA 5F73A 4WESA 4OYRA 1KP9A 4FJ0A 3T61A 2C7QA 1SXJB 3AR5A 2KS6A 2QTTA 2ZJFA 2NP7A 3PP8A 5BQPA 3F3MA 3IX7A 4HN9A 1HPLA 5FLKA 5DYGA 1H8ED 3FHCB 4TQUS 2C7RA 4YP5A 3G6WA 5KYXA 2PX5A 3EZYA 4QDZA 4FT4A 4I50A 5LQRA 5C8XA 2J8ZA 2WWYA 3KWFA 3RHTA 2GF9A 4G26A 2QZ9A 3ZDZB 5A02A 3WGUA 1JHRA 3MTGA 3LG2A 4LHVA 2QAGC 4DKJA 1OA1A 4R71A 1VJGA 2APJA 3KSZO 3WB0A 4R1OA 1QO0A 2DCMA 1FFHA 5TX7A 1FX0B 3UK6A 3E7FA 3LL4A 1DP4A 3PYXA 3C5HA 1S6YA 3V6LA 1TMYA 2MSEB 2R5FA 2H0AA 2WF9A 4G0ZA 4MYHA 1OC4A 3FVQA 5FI3A 1DOAA 4O0MA 1SUEA 2BUCA 4IIGA 4Y9RA 2XKKA 3EAQA 3K0AB 1DAKA 5EJ7A 5K0NA 1H9BA 1VRCA 5K0FA 5B3LA 4V0LA 1ND6A 3WNZA 4KQWA 2I7DA 1TYCA 5JT1A 3U1BA 1RWWA 1VSTA 2OXRA 2P1ZA 2ZBFA 3DDWA 3FCXA 2PKRA 3GROA 4BMSA 2JFNA 1RDFA 4D3XA 1T34A 2VSNA 2ZTLA 1QP0A 1ZI6A 2EF0A 3QEMA 3MJDA 1Q7BA 3L1VA 4BV3A 2BFNA 1NRJB 1R4MA 4QWWA 8OHMA 4HLDA 3BD8A 4KPYA 2F59A 1YBFA 4Q21A 4CYMA 4B47A 1T2DA 2PZBA 2ZUVA 2YY6A 3R5KA 2WWGA 2B5VA 2Q45A 5FNVA 2ZJ5A 4YRIA 5K0SA 3FJOA 3EW9A 1CY2A 4PYKA 1K68A 4P98A 2AG6A 1AA6A 3EQ9A 3QWIA 4WY2A 3LPAA 4A36A 5L3QB 4YPFA 2Q9UA 2AEMA 1TIKA 2QSUA 3ZOZA 3LGAA 4XUGB 2FUCA 4FFVA 5JXJA 1U8YA 3BIWA 1L7BA 1GTSA 3GAZA 4E7OA 4W9MC 4FZ3A 4OQPA 3ZDQA 3OZRA 1L5FA 5HIMA 2OWDA 3E9DA 4WZBE 2ONKA 5L45A 1OWOA 1MDBA 2IT1A 4OFZA 4KP7A 4UVHA 3V1TC 1YRBA 3AUAA 3RWOA 3DUFB 1NC3A 4OQYA 5FWYB 4KQIA 4EFDA 1QG2A 4UNSA 1AHPA 3RASA 2Y3IA 4BO2A 4R3UC 3UVEA 4X41A 2CB9A 2CHVA 4MAAA 5IN5A 3CBQA 3KSMA 5B7QA 4ESVA 3ZJ4A 1T1EA 4J1QA 4FYXA 3ZCSA 4KUGA 3ZWOA 4URVR 5KOJB 1PGOA 1CB0A 4FPXA 1BJKA 3TW8B 3EY9A 2EFGA 3FI9A 1P0CA 2XA2A 2K5UA 1B6TA 2IXFA 2PTHA 5SY4A 1JA1A 1UBGA 2HLHA 1QVVA 1KEZA 2PEZA 4QOGA 4ACAA 5GTDA 5JDCA 4AYTA 1ZI8A 2HH9A 4RD1A 2B5WA 5LQCA 4QG3A 1QS0A 5AW6A 1N25A 3AF6A 1MNQA 4BFLA 3PC2A 2AX3A 3DE0X 4LFCB 1IQRA 4LJKA 3V7FA 2WKPA 1XTQA 2HQOA 1E32A 2FJ0A 2R7KA 1LK0A 3TQIA 5COAA 3D59A 5HFJA 3CBGA 3ZR4B 1KY5A 3DLAA 2RK4A 4YYZA 4TTAA 1UBRS 3OHMA 4HNUA 3PC4A 2FPRA 1OFIA 1JDTA 3EHDA 4HRXA 4II2A 3MGCA 1JLMA 5H8WA 2X8JA 2VXCA 1BZYA 2YYAA 4FFSA 4YR9A 1W36C 3PNLA 4GPTA 1KDOA 4PGAA 2OGZA 4P7BA 4DMHA 1NFRA 2DQ4A 5KTRA 2GOYA 1U2ZA 5DNYB 1ORVA 4L3WA 1X6VA 4BBJA 4LTMA 4DJJA 1Q83A 2QMUA 2P9JA 2DKFA 4MA0A 4E5PA 1CU1A 1W1IA 2F6RA 4YJHA 3H2BA 3FZYA 5T3UA 2LDBA 1ISIA 4AS3A 1MXFA 3J81A 5T67A 3A6ZA 4WECA 1IYZA 1JEQB 1L5HB 2QD3A 4FGLA 4L51A 4HS4A 4IXDA 4JD5A 1O4VA 3H04A 3K9LA 3FOEC 3IQEA 4KXLA 3NEYA 4C3ZA 1PHPA 2JFGA 3BSYA 2NVWA 2O4CA 2Z9BA 3WLSA 4ALJA 3ZCXA 1CY4A 2ZJ4A 1X7HA 4HLCA 5BRAA 4DDTA 3AUFA 1ZZEA 5IBQA 5E6UA 5JNRA 4G5FA 1NUQA 1WZNA 3A1UA 4B17A 1TKAA 4NWIA 5L3QA 4XR4A 4DCVA 3UMGA 3AY6A 5CLHA 3BL8A 3E1GA 3LT4A 1E0JA 4PZDA 5G0WA 3B3FA 3FM9A 1FBNA 3OAAA 1XZNA 4RM3A 5ALJA 1OYVA 2ZJ2A 3FWKA 4PXYA 1TM7E 2CJXA 2Q46A 2P65A 4HH1A 4KXFB 1D6MA 4MWTA 5EJIA 1TM5E 3IODA 2WHQA 4YASA 2ECOA 1XTTA 3RV3A 2H1VA 4WKCA 5K3SA 1G3QA 4P4SA 4Z4EA 3GLSA 4M7OA 2V45A 1GU1A 1GSHA 3ZKWB 1BMDA 2SECE 1SM4A 3CPSA 4LDQA 1DBSA 1RIFA 2PEYA 4MR9B 1D1TA 3CW2A 1E6UA 3K5IA 1J8VA 2XZDA 4F8EA 1E1KA 4CQLA 3FTCA 4OD0A 5G41A 4D41A 2WM3A 5JPDA 3A9WA 4M87A 3T7TA 3D6NB 5AVSA 1U9JA 1GN9A 3C1OA 3FXAA 3O91A 2FEAA 3QYJA 2GEFA 4RNCA 3HNPA 3V9AA 1QCYA 1W581 4JELA 4CQJA 4F11A 2P3LA 1W88B 2B1QA 4L78A 4BQPA 2G5PA 1NKSA 2NXNA 2PUWA 2PXXA 1OGIA 1ZQ1A 3CH6A 3HFRA 1MAAA 3BWBA 3MF4A 2RB5A 1TIBA 3CZPA 1GGMA 3K1ZA 2WJHA 1KDZA 5DVZA 3U7GA 4AZTA 1XIVA 1RFGE 3UUWA 2F3UA 2WTMA 3ESXA 1NGSA 1W2HA 2GEJA 4UW9A 2WUDA 3OP1A 4HVLA 1G19A 1CJVC 1C3VA 4EGCB 3KR9A 1A98A 3ASVA 5EESA 1YB2A 2XGSA 5DTQA 4ZD6A 1MIOA 1OX5A 2VZ0A 1IDOA 1X7WB 3OIYA 3PQ5A 4KR0A 4P80A 4XD7D 3RGWS 2VBCA 3ZGNA 3ER8A 3MSXA 4XDZA 4OKSA 5HF6A 2R1VA 4HVTA 2XTMA 3D43A 5A9TA 5LQNA 1H2BA 4B3SB 3WLJA 2ZRIA 1R1DA 1ULAA 2C0CA 4WKBA 2ZI3A 3SNKA 3WRWA 5LKAA 2ZSEA 4B7AA 4MHTA 8MHTA 4ARCA 2L0XA 2V59A 3EBOA 3RSQA 1C8BA 5ALSA 4IIUA 2G4LA 3U5ZB 1T3LA 1MU0A 1UAYA 3LC0A 4G9BA 4NE7A 3U4CA 1MBZA 521PA 4DCUA 4QTYA 5I9BA 1YL5A 2BMVA 2NGRA 5IZ4A 2Y0CA 2GLTA 5KREA 1PE0A 4Q7LA 2J87A 1ILEA 3RANA 1N8KA 3MC1A 3P32A 4QGGA 1OLXB 4RESA 3GEIA 4DMUB 2WKWA 4FD3A 2VP5A 1MX1A 3WGTA 5FWXA 1M0SA 1V0JA 3DL7A 5IX8A 4Q9KA 4QDKA 1C0IA 2FPLA 5T41A 3GH1A 2JH3A 4XIYA 3UXHA 2VHTA 2YICA 4RZ3A 1KQGA 4XX1A 1OX6A 1XG5A 2BH2A 1M2NA 5HPYB 4B3MB 4EVSA 1FRVA 1IB6A 2C3MA 3C8UA 1QYVA 4Q6WA 1RPZA 1KI6A 3S29A 3INGA 2V74B 4W1SA 1D2MA 2NZ2A 1UKBA 5LNK6 4NAUA 3PEWA 2IVFA 1O9GA 2CW5A 2V4UA 3H86A 1ZKMA 4I9HA 3WMFA 2ECQA 4PEVA 3KWJA 1OWPA 1JXQA 3G7UA 3SX2A 1UXOA 4OX9Y 1QHNA 1U65A 2PN1A 3KQQA 4X84A 4HV4A 2PQMA 1J8MF 2A5JA 1IN6A 2PSFA 2ORYA 5KCMA 1XO1A 4Z7NB 3ETEA 3GFBA 3MA0A 2VDVE 1BO6A 3DTYA 3GPIA 3L4SO 4BVAA 4LMRA 4BX8A 4G86A 2ZJYA 3AR4A 4CFYA 3H0EA 3OX1A 4CM3A 1VL6A 5JFGA 1XNHA 4ZREA 1IQUA 1AH2A 2VHVA 1E77A 3K0AA 5FTJA 2EERA 4OK6A 4QATA 3HCDA 4J1TA 3IFSA 1PK8A 1PJZA 3IJPA 3N1UA 3MTDA 1VZ2A 2LR0A 5HBGA 4RM2A 16PKA 5CJ2A 3VISA 3VHQA 3WI7A 3HSKA 3BJEA 2P5YA 4GL2A 1OBOA 2OBNA 4F3CA 4RQUA 1M8FA 3WK9A 2VDKB 4GGPA 4OAPA 2V7UA 2O2DA 2ENUA 3PEUA 5I9SA 1OBFO 4ZT3A 1FP1D 2YJ4A 3S2EA 3DE1X 1ONNA 2Y0BA 5EI5A 3WL7A 5C34B 3JVVA 2RI0A 2UZIR 3K70D 1XWWA 4RAQA 4G1UC 2GN9A 2C7OA 1PTJA 1PR5A 1YR7A 2AUTA 3LOQA 3UXMA 3FY4A 3JWGA 3M70A 1PR1A 2XA1A 3HA2A 3Q7RA 4L76A 1UQRA 2BJHA 3LH5A 4NENB 3USZA 2D3TA 5IM4A 4H7FA 2FE4A 1OR8A 3I0MA 3AV0B 3HEAA 2VPQA 3AKZA 3QE4A 1JH8A 4YP0A 3BJIC 2QLFA 2N42A 4A7PA 1O6ZA 1PT7A 2JH9A 1OBCA 1WMSA 2JAQA 2FWNA 3V1UA 2ZS8A 4P4NA 5G0SA 3TINA 1D9XA 3L3BA 2V6GA 2CXRA 4GOND 2I4OA 4ZIRB 1YB5A 1QTQA 2CVZA 2H63A 1DCMA 3D8UA 4P3OA 4BZQA 2AJDA 4QVKA 5TSDA 1UPUA 1K27A 4WN9A 2Q49A 2IIBA 3B38A 2WMNB 3H9UA 4PLFA 1F6DA 1OX4B 3E3MA 1N2SA 4HFRA 4WZBA 4HG2A 3RAEC 3QKUA 4PG7A 4P82A 2HXGA 2PVPA 4ZALA 3WADA 2VPWA 3VU9A 5H3LA 1N36B 1L9KA 1E7MA 1WUTA 4K3VA 3G59A 1L5VA 5FJIA 3AH8A 3TMAA 4DMGA 1V9SA 2EJVA 4FKMA 3KSRA 4V3BA 4LZPA 2HRCA 3R7FA 1RVDA 2ZWPA 4F9TA 2ZUDA 4B3DA 1HDRA 2RHHA 1JLSA 4ZVSA 1JDUA 3GAFA 4MQLA 2W4MA 3HCRA 4RY9A 3THXA 2PE5A 3SJUA 2VWHA 4O4JB 3KZNA 3OIVA 2DU8A 2KYRA 4FIZA 1DAGA 4LPKA 1SGWA 3T5BA 3DH0A 3UBMA 2C9YA 1G4UR 3S44A 2PH1A 3TCXB 1E3DA 1EFPA 1MW8X 4EG8A 4E5MA 5JCPA 4KFUA 4OHFA 1SURA 4G9EA 4PHFA 2XRZA 4B3GA 3CZMA 3PGA1 5G2OA 5AKIA 1EAMA 3DBLB 3VKVA 3ZHBA 5I7UA 1Y8ZA 1A9OA 1L4HA 4B3JA 3ILXA 4JBWA 3TLBA 3GUCA 3ECAA 1CUXA 4OHXA 5GP1A 2AVDA 1UOOA 2P9FA 4HDSA 1EUYA 1ESNA 2Q6TA 3NZEA 1E9RA 1J4AA 4G0YA 1VE3A 3UAYA 1JA0A 1B8UA 3MK31 2YTZA 3FWHA 2JHAA 2GQ0A 1JQDA 2FB9A 1YXMA 1N92A 3WAGA 2XOXA 4DA9A 1AB6A 4K0KB 1LJUA 2CBGA 5D00A 4C01A 1R6DA 2WHEA 1GN8A 4GGMX 2VT6A 1RJWA 4GMHA 5DWVA 2NYVA 2O59A 3B7GA 4LGYA 3H3JA 1P9LA 3DKIA 3M83A 3OZXA 1XZCA 4DDMA 5FUMA 3H3XA 3PUJA 4QJ3A 4RTJA 1OC2A 3H99A 2WWVD 2IYUA 3G7NA 3ROKA 1Q0UA 4EJSC 3RIHA 4N03A 3IDAA 2GTPA 3I1FA 3I6QA 3QUAA 4R2WA 3LYLA 3UF0A 1ZXXA 1WUIS 3RKSA 1P44A 4I1OA 1JAZA 4P2GA 3F78A 2X6QA 2WFAA 3NJ4A 3U40A 2XVAA 2GBIA 2JZNA 3PFIA 3QE3A 3DMPA 1CF4A 4KMSA 4LOKA 2NU6A 3BJRA 3LDUA 3AVPA 3AI1A 3BWXA 3C3BA 1N5LA 2EQBA 5EJGA 4YQEA 3G2QA 5YASA 4MHOA 2WRZA 13PKA 1ZM7A 4B6PA 4W5NA 5LP1A 1Y1RA 3B1VA 4IEFB 1ISFA 1E1YA 1ZX1A 3O9VA 2CL5A 2WD7A 4MV1A 4YDHB 5A7GA 5KKNB 5JSFA 4LXUA 3P2KA 4G5GA 5IT5A 1I30A 5TRTA 3HVHA 3NI2A 3UC9A 5HKKA 2CLHB 2SBTA 1JEAA 1XK6A 4OQZA 3U4AA 4EAQA 1JG4A 3EXFA 4DV5B 1JG6A 2CCGA 3HKCA 2NZ8A 4GM4A 1UEXC 3LHIA 2DUUA 4I55B 5J4LA 4C21A 4PU0A 5DLPA 4WK4B 3FJYA 2DFLA 5A05A 2BEVB 3UG7A 4Z1MD 3KR1A 3P8ZA 3QVSA 2WVJA 3ZJTA 4XQGA 1QK3A 2D1FA 2JAWA 4A0HA 1E5DA 4TX1A 2A58A 3S6JA 3QA9A 4ITRC 3W5SA 4D8XA 1GQQA 1WXWA 3A70A 1X1CA 3Q2IA 4Y2TA 1I1HA 5HCUA 3GGJA 4RK5A 1ISJA 2W6ZA 3RAJA 3QUTA 4BCBA 2FUKA 5INTA 1F0PA 1EX6A 2A33A 4QG7A 1TD1A 1KEPA 2EW8A 1I7QB 2EYQA 1Z6XA 1L7PA 2UYOA 3DBLA 3ETLA 3I5AA 4TTSA 3FOFC 5A4MS 3GO4A 2VJBA 3HXLA 3K6JA 1IAVA 3GNQA 4QSMA 3ZWYA 1E60A 1RPJA 2V7EA 3PQ6A 1ZYUA 3Q3EA 4I36A 4RQBA 5CHYA 3SC3A 1TZMA 1ULTA 1G4HA 2Y67A 4ZEVA 4C3OB 4JJZA 1PZNA 1V2GA 4G8JA 5U4XA 4X61A 2C9DA 2P9TA 1KJ9A 4R1LA 5JALA 1XTJA 3SM3A 3STXA 4HDNB 1O77A 2ACKA 2V9ZA 3MJVA 3R3JA 3W2TA 2H57A 2VPTA 2PLFA 4UTPA 3Q7TA 1T8YA 1I2MA 2HMTA 1ZM3A 2ZRCA 3ZH9B 4AWAA 1R37A 2BKXA 5DN6D 4PO3X 2RAVA 2XF8A 3LWBA 4KO4S 3L8FA 2OZLA 1J5XA 1JYFA 1W59A 3IAUA 2OFOA 3RTCA 1SVMA 1FNCA 4ZCTA 2P6UA 1FNDA 1QV7A 1JKFA 1E92A 2HPAA 3AM5A 5IDXA 3N2KA 1F2UA 4R0NA 4RVNA 2WWXA 3MPOA 1NYRA 2JVJA 2GPBA 3N7TA 5EVCA 2GZAA 3WX0A 3DW1X 3BWVA 1J33A 5LQDA 3PXUA 2I7VA 1IY9A 2IIPA 2FWMX 2D2IA 2AR7A 2Y2UA 3EJWA 3W2EA 1LRKA 1RCTE 2O2SA 3QW2A 5EY5B 5C80A 5TT0A 1Y9ZA 3FFAA 1XF1A 1UMCB 4LQLA 3NYIA 4M98A 1XTVA 1UBUS 4URZR 4WFKA 5EJ2A 4UEOA 4CKEB 5JRJA 2W42A 1RYYA 4HLNA 2OOSA 2D06A 2JKYA 2HQBA 2QNRA 3H6KA 4DQUA 1I3KA 5AI8A 3OETA 4XX0A 1SG0A 2JGMA 4OUDB 1ZUIA 4YDSA 2LCIA 4QXQA 4YALA 1JSRA 5IYZA 5KPJA 2JVIA 4TRJA 2I6GA 5H3CA 1AKWA 2DHCA 2EBWA 2WUVA 3OZEA 3S4YA 3UATA 2WM2A 4K8OA 1AKQA 4QYSA 1JQEA 4NHEA 1X70A 5DW3A 2E0IA 5A4JA 4RC9A 4C3UA 1MN6A 3OU2A 1PQWA 3Q7QA 4FIDA 1U8CB 4U0KA 1TYDE 5JD6A 1UBEA 1OCEA 2X22A 2AV6A 3WG9A 4XEHA 1EQ2A 2YNMA 3OBIA 2DAPA 2VTEA 3QBDA 1FVOA 3L0ZA 4LV5B 3WMRA 5M2QA 2ZUFA 3JYOA 3PGKA 3Q8MA 1XZKA 1ZD4A 1NYQA 3OJLA 4XFDA 3IP7A 1UT5A 4H4EA 4M0KA 1P0MA 2OC4A 3C5CA 4RNDB 1LJLA 2QIOA 4LF7B 3S8YA 2XLBA 3Q2KA 4H31A 4HYQA 4M1OA 4UTXA 5DI3A 3VH2A 3QEBZ 3R0XA 3W6OA 1QVRA 1FFXA 2ZJBA 1YGYA 4QPZA 2EG9A 4OJYA 5JO0A 1WETA 3R9XB 4MQ4A 3VPXA 5B4UA 4U5XA 3JYLA 2DECA 1XV5A 3Q41A 4C6TA 3CPHA 1YJCA 2R751 1E1QA 3IB3A 2O8VA 4Q0MA 2C4VA 1GG2A 3B1XA 3F6CA 1XZMA 5J1TB 1QU3A 3CS3A 2QG6A 4MV6A 3VYVA 4FEEA 1O5IA 3EWIA 4ZICA 1AUXA 5AI4A 5JC8A 2YJZA 4UM9D 2N9UA 4LMPA 3SJAA 3WL5A 2IYXA 3O8QA 4WY5A 1L1RA 3HLTA 1ZR4A 4CF6A 1V3VA 1FVFA 4LPSA 1JHPA 1LPMA 1HDGO 2I33A 5JNTA 1Y6ZA 4Y2YA 5FWNA 4ESHA 2UUBB 4MS3B 5IMSA 3KYIB 4PM4A 2FMHA 3SIXA 1SVWA 5E4JA 5EJ8A 5AXBA 1NQTA 2VSQA 5CNMA 1H2RS 3A58B 3GZJA 1JYSA 5A3QA 5KJEA 3NVMB 1F8XA 2YWJA 4OFWA 4ZCQA 1YFKA 3UMMA 4Z8XA 4BOYA 2EZ9A 4NU0A 3E05A 3T1TA 3LYHA 5HKAA 3OE7A 1XMVA 4BNUA 2XMRA 2ZJ6A 4CCAA 1U5AA 3GRVA 5EMNA 4GYKA 4RTPA 2JA2A 4M9QA 4I6EA 1Z0FA 4XH9B 4F7WA 1H8EA 3TLXA 1VJRA 2PS9A 1OB5A 1Y34E 3DZCA 3VSDA 1J06A 5C5DA 4YXWD 2WSYB 1Q0RA 3ER6A 4JDUA 4D9EA 3D9QX 4A6XA 3VM6A 1WVMA 2A84A 3QEAZ 3KJIA 1LBTA 3BEDA 3NKLA 4JIGA 5AHWA 5PGMA 3ROFA 1IOZA 2OHGA 4P22A 4P83A 5LU9A 1EDZA 3E8SA 2WM9B 3FZNA 3V5NA 5IF9A 2PZJA 3WLOA 3KAQA 4MYTA 1TMKA 5DWDA 4CE6A 1B76A 2HYDA 1P5HA 3CZCA 3HLYA 4ND5A 4WD3A 1WRBA 3N6VA 5EEHA 5JVDF 1TMGE 4F4IA 5F4BA 3Q7PA 1KWGA 3LUFA 3OQJA 2I3ZA 3PPVA 3E84A 2VHZA 3O84A 1LZLA 3R4CA 1I51A 2GKOA 3AJRA 2IV3A 3RVBA 3LP5A 5GVSA 5HHTA 5DRYA 4ZJPA 2HCTA 4EMUA 4RKFA 2FWIA 2X13A 4HEJA 1R9GA 3GDGA 1K7XB 2VOEA 5DTIA 1ODTC 1BVYF 3SIRA 3T3PB 4JEMA 3B36A 5ITWA 2ZSFA 1D4AA 2XMGA 3BL6A 2QRMA 2WG0A 4YR7A 3ZY3A 1RWKA 4D6YA 2I8LA 2REBA 3E48A 4BYGA 4RDXA 3EG9A 3VSCA 2PCLA 5C1IA 1E1RD 2YZMA 3ONFA 4WLEA 3RNOA 4DTIA 3FPBA 5IHPA 2PT6A 2EKPA 4FE4A 3CO0S 2GETA 1TIPA 3EQ8A 3PFFA 4C03A 4EIWA 5KJ6A 1EWKA 5EIOA 1FY2A 1XB2A 4O8CA 1VP3A 4TRRA 1SHTX 3CHYA 4K9DA 2QT1A 5TC4A 1I3MA 4TKVA 1ECLA 3K32A 3O2JA 4DV7B 3V7UA 2IV7A 3CINA 3I4FA 1F3OA 4QEDA 5GQSA 4S24A 2PZFA 3S2UA 4ZT2A 3L7DA 2ZQZA 1ETHA 2ZCJA 2GLXA 1H5UA 5JU6A 1X2BA 2Q0SA 4JI4B 1F9AA 4PPGA 4R7ZA 2R00A 4IGKA 3S27A 3WB1A 4G0NA 1RM0A 5DN6A 1GTG1 1JXOA 3NRJA 4B71A 4J0HA 4XGNA 1SJ9A 4GECA 3WYNA 3E7XA 3B7PA 4YRPA 3NBAA 4BVGA 1NG9A 2WSIA 4J6FA 2NACA 1M5RA 1Z0ZA 4UM9B 1AGRA 2ZSUA 4WJZA 1Z4QA 2J3KA 1U04A 2YV1A 2NXEA 4LMAA 3RT1A 5C1BA 5ALTA 1GT91 4LFBB 1VCMA 4JC8A 4IVRA 4Q3BA 1SUIA 2O06A 3RSZA 1D5WA 1QCCA 1QV9A 2UYGA 2YJNA 1NUAA 2AHOA 1QJ4A 2ZAMA 3MQFA 4WH0A 2V5UA 1NUPA 2P9QA 3PYLA 1DV1A 5FBVB 2DHRA 5MN4A 3CCCA 3CM0A 3N2NA 3P2EA 1FA9A 1Q17A 4XD2A 4UU0A 1QO9A 4AJJA 5JQGA 1ULHA 5KZMB 2RC6A 1B4DA 3F7OA 3F5MA 3LXRA 4Q34A 4ZRDA 3GT4A 5EE9A 1PNOA 4EJ6A 4ZVQA 4D0RA 4RU1A 4Y2PA 1CC1S 2VK2A 4L9SA 2GK6A 3EXG2 4CF3A 1EWVA 3GNSA 1DT3A 3JATA 3UKOA 3LPDA 4EBBA 5M04A 3BE4A 4JOCA 5DOZA 5H4GA 3OIDA 1GCOA 1L5WA 1YC5A 3HP4A 1I8TA 2IZ0A 2P5UA 1Z3IX 4KWIA 5GJWC 1TJPB 3W8RA 5EUCA 3DHEA 2JCVA 6ABPA 1Y80A 4H6WA 4NZZA 5B5SA 3BCSA 1GAEO 1V4BA 3S1SA 4OHCA 2GEVA 1ZK3A 1AQYA 3GHHA 1RPNA 3U7JA 3BTSA 1QRTA 4WLNA 3IPXA 4D2IA 4OGLA 1HM5A 3HC7A 3MT7A 2FJPA 5GONF 1PJ8A 1S3IA 2YZ2A 2ZR9A 3OE7D 4V0KA 4LF6B 4KIWA 5JCXA 3PJFA 3C8MA 3OJ0A 1TD9A 2FSFA 2IEIA 1NP6A 4WX2B 3A6HA 4WOPA 2LCFA 5EIAA 4UZSA 1PL6A 3E53A 2J4FA 2H2WA 2V6FA 4E5NA 1G17A 1JTEA 2JFYA 1XMQB 4F3TA 1XD2A 3GFOA 4IJWA 3L06A 1WG8A 3R3YA 3EA0A 3ULKA 4N5IX 3BE5A 1KVTA 2XODA 2XOKD 3BTOA 1YR1A 4ZOQI 2ASVA 4OI4A 3S7TA 3SYMA 1KEEB 1MAHA 1KGDA 2F43A 3DULA 4MCAA 1RHMA 4N5NA 2ZTUA 5EHQA 2OXIA 4JSRA 1OFGA 3RIEA 1XVTA 3GL9A 2BR4A 1SU4A 1R7RA 1BHSA 2CGEA 1SVLA 2WE8A 3WHLA 4JVSB 1WBDA 2RHRA 1PFKA 3EFOB 4EW6A 1JFFB 2W8ZA 3ZGYA 5MF6A 4IRUB 2H3HA 3UN1A 1N6KA 3OEED 1ZOPA 5KVSA 1NQWA 1DJLA 4P81A 5DHQA 1QH8B 1RPAA 2OHIA 2BEKA 4JYPA 3R6WA 4XGRA 5DTRA 1L7EA 3K0FA 3VZCA 3X43A 4B9EA 3ICEA 4POOA 2DY0A 3A0UA 4F91B 4AFNA 4W7HA 5IJZA 3DWEX 4MPPA 5AK6A 1OF1A 3EGIA 4DAOA 2XY4A 1GFIA 5IBRA 4P36A 4ML3A 2B21A 1PLLA 4B8ZA 4K6GA 3KQHA 1X1AA 3V3KA 1J39A 4M1SA 5E6UB 3KZMA 3PDCA 4CLXA 3O9MA 3WLAA 2RK3A 4OXKA 2JNWA 4ICIA 1G20B 1QF9A 1JXAA 3EVEA 5TARA 5JWOA 3PEVA 2ISCA 4EI8A 1JHQA 3G8YA 4RF5A 5D86A 3UK0A 2WIFA 4JB0A 2BH9A 5HJ2A 3HVRA 1ZIXA 4C2UA 2IYLD 4GVPA 4IV0A 4KK3A 1X8XA 2RGDA 3NHJA 3L84A 3MIIA 2P2NA 4Y0AA 4EHDA 5L3VA 5DF1A 4RKYA 4MXDA 1IOLA 1GV1A 1XMJA 4J0IA 1D4OA 3MBOA 1X7YB 4RSHA 4S0XA 2RSLA 4XOUA 4ZHQF 1NJ1A 3Q9NA 2QX9A 4YJ2B 4MKFA 3UPUA 3HUEA 4EL0A 4N12A 2CFRA 3L7IA 3MWDA 2JI7A 3LW7A 2FZGA 4S3MA 1R50A 4FFNA 1SQGA 5FTMA 4YV0A 1X74A 3SYTA 3C6QA 1DFGA 4CQNA 4QBTA 2Q2OA 3BJZA 3RRXA 2Z2YA 3ZUGA 2UYHA 1GLVA 4JJAA 4YUWA 4KQMA 5B3KA 5CLGA 1WSAA 3UV3A 2FUEA 2AE2A 4OU5A 2OZPA 3C4VA 1NHGA 1Y9DA 2B25A 4BQOA 4EFKA 1O5TA 3JY6A 2HJHA 3AOEA 1XLUA 4A23A 2XX3A 4WIAA 2AL7A 4GDMA 4K46A 1JU4A 4CL8A 1T3SA 1JLLA 1A5ZA 3JYNA 4G85A 1CJMA 3O4GA 4C4TA 1GY8A 3OJCA 2JFVA 1G7CA 2M6LA 1VCHA 4ND6A 5FL3A 4WNYA 3EDOA 1MC4A 2NYUA 3NNDA 2EF1A 4IJMA 3GVXA 3TOXA 5K0ZA 1E2FA 1TQ6A 3QWBA 4NMHA 2JLSA 1ZP6A 1E8MA 3UJ6A 1ISHA 4MO2A 1X94A 2FW8A 3OG9A 3R2JA 1FUIA 3FCAA 5GZ1A 4UTVA 3WQQA 3J7AC 4B3RB 1T9ZA 1JV2B 1ZS9A 2JIMA 3A1NA 1SPBS 3V34A 2IBSA 4B83A 1QP4A 4JVNA