5GRJH

Crystal structure of human pd-l1 with monoclonal antibody avelumab
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
118
structure length
118
Chain Sequence
EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYIMMWVRQAPGKGLEWVSSIYPSGGITFYADTVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARIKLGTVTTVDYWGQGTLVTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords avelumab H chain
publication title Structural basis of anti-PD-L1 monoclonal antibody avelumab for tumor therapy.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 23
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2016-08-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5grjH00
3V4UL 5EA0L 4H26A 1ZEAH 4AMKH 3RWGB 2FX7L 3CDCA 5J1TC 1PG7L 4RX4D 3O3DB 5EZLB 4F7CA 5B3NA 5L7XL 4I0PC 3VXOB 1YEEL 3HI6L 1YN6B 3GIZL 4JFPA 4PP1C 1CDIA 3SGJA 3OB0K 2ZUQC 1S8DB 2DM4A 1U8HB 3KLAA 2PUQT 3SKNB 3FRUA 3INUL 1MIEL 5D7IE 2VH5H 5MENB 2HFFA 3MLZL 4TSCL 1KCUL 4K7PH 4NKDA 1VADB 1MH5A 2YUZA 2X4SB 1AQKH 1CCZA 1IGMH 1X7QB 1FNSL 4KJWD 2ZUTA 2YA1A 5DQJB 1A2YA 2F19L 3O9WC 3H3PH 4OZGE 4KHXL 2EH7L 3K46A 1DLFH 4PBXA 4QOKB 5GQBA 4ZUUA 5ADPL 4HLZH 4OZHA 2KH2B 3ARWA 5EBGA 2V2XA 3LZFH 2DLGA 3MMEB 2CQVA 2F74A 1WIOA 2SEBB 1NANI 1HYSC 5DA0B 3ARDA 4P3DA 4HIEB 4XVUC 2XA3A 1CGYA 4JM4H 5I8EA 1BIIB 2FNBA 4QHMB 2I9TA 3SO3C 3S96A 2VNCA 1OPGH 4ISVA 1KPUB 1MPAL 5EU6B 5B8CB 2A6IA 5J11B 5T1LA 3BJLA 1N2RB 4B7IA 3QUXA 3GSQA 1AO7A 5KS9F 4LDEB 1T03L 1N59B 2ZG2A 4IJ3B 2DI9A 4XBPA 3WXWH 3JV4B 4R97C 2YWZA 4MNQE 1IQDA 1RFDL 4V2BA 2XACC 3BEVB 4HXAH 2E7BA 3QFJB 2OJZH 4NWTL 4NRZA 2DMCA 1MRDH 3MACH 5DUMH 5E9DA 3T65A 3VXRA 4NQXB 1LEIB 4U1GC 3AB0C 1XZ0A 5E4EB 1OAUH 3G5VB 1GIGL 3L3DB 3QIBB 1LE5A 4Y2DD 2A9MH 4PIRF 5DC0A 2A74B 2OI9C 4U6HA 3BP4B 5BJTA 4O51B 5SWSA 5KBNC 1S7XA 2MFNA 1MJ8L 1P7KA 2PR4H 1NSNL 2VXTH 4MNQD 2Z8WC 2BVYA 1J1PH 4JKLA 4L3EE 2FEEL 2HKFH 1MI5D 4W70A 5DJDA 4JFFB 1VFAB 1S7QB 2HJKA 4G6MH 2OL3H 3NH7H 2FRGP 4E41D 2WV3A 1NC4B 4NPYB 4Z77B 3SKOA 3WS6A 1EIBA 2FHCA 4RCAA 2IAMA 2XG4A 3PE9A 1FO0B 2R69L 4RMRA 3P4NB 3LHPL 3PIQA 3VXUE 1EGJH 2R0KH 4CAGA 2CKBL 4ZAKC 5C7XL 5CJQH 4JB9H 2APVA 2J3SA 4KVCL 1MIML 4Q9CA 4L3ED 4CW1B 5E1AA 1AXTH 4G6KH 3I3EA 1B6UA 3ARED 4Q9RH 5F9OH 1U92B 1WWBX 3GZKA 1UXSB 2QADD 4PJ5A 4QCIB 4LSRL 1CLZH 4M02A 4PPTA 2D31A 4PJBE 1XR9A 5HHXL 4U3XA 2ICCA 4NJAL 2FDBP 5C6PB 3PABA 3VXUD 2NY2D 4LKCB 3JWOL 1IBGL 1ZVHA 5EWIH 4YDKL 4YXHL 5CP3A 3CK0L 4ZODA 5D1XD 1Q0YL 3GUTB 1MFCH 4U05A 5E1HB 3RVVD 4L8SB 3LMJL 1B4JH 2VDMH 2FHBA 3E0GA 3LEVH 4F37F 1AFVH 2L7JA 2HVKB 1IC1A 4BH8B 5M94B 1A4KB 3HMWH 1WAAA 3MNZA 2VLME 1U8PA 4X4ZA 3L3KB 4ZO6A 4UU9A 3T8XB 5EU4B 2O5YH 3B5GA 4HIXL 1MFEL 3L5JA 1K8DA 3S36H 1MCJA 1PD6A 3R8QA 3C5SA 5GRZA 5GGRB 4XWOD 2OTUB 1HHKA 4HFWA 4RGNE 1WTGT 2BRRL 3O4LB 4DKDC 4I18C 5DGQA 4QRUA 3WDHA 1AY1H 3D2UA 3KYKL 1N5AA 3R1GL 1RZKH 5HHOB 3RI5K 4JO1L 2IPTH 2HG5B 1NEUA 4LHJB 4G43A 1BX2B 2DS4A 3PP4L 4U1JA 5D7LD 4WU7B 3QHTC 2BSRB 3PNWA 4NO2A 1CFNB 1HXMA 4RWYH 5F6IB 4Z8FH 5FDYA 1JWUB 4JGJA 1CLCA 3P4MA 1FGNL 3SDYL 3QAZC 3MA7B 4AM0B 4P2RA 3DOSA 1PW3A 1BF8A 1G6RH 3U30C 5LG1A 3VWJB 1YEKH 1OWWA 4KV5E 1NFDE 3B8YA 3WN5C 4XCFH 1A7RH 5D8JH 1MHHB 2OMNA 4DVBA 3MRNA 3HA0A 1SVZA 3WFEL 3SPVA 4X80L 1FNGA 1AE6L 1FYHB 2CLVB 2X09A 5D1ZC 2GITB 4ZFFA 2BSSA 2ZNXA 3B3IB 4NN6C 3EYOA 1YYLH 5CD3A 1R24B 1TETL 2YBRB 4P9ML 1NGQL 5F9WB 2P8LB 3V6OE 2VERN 4R7DB 1BVLB 1E6OH 3ZHDA 3FAWA 2JTDA 5HYJB 1S9KC 3GM0A 4GKZB 5LCVH 2ZUSA 5F88B 3CVHH 4LK4A 3P40A 4NBXB 4BH7B 3JXAA 2C4XA 4YDIH 1XEDA 3HMXL 3LB6C 2ZNWA 1F8TL 3QUYB 4Y4FA 4NNYB 3CUPB 2VDLH 4TSAH 3GSWB 5A1AA 1F4HA 1KIRA 1YN7A 5D71H 4PLNC 1YEGL 1FE8H 4JJ5B 4E5XB 3DO3A 3FOLA 4GRLB 4NUGH 1MHCB 3S8WA 1I9EA 3JTSA 3VFWB 1MRCL 3DNKA 3VJ6B 4UINL 3SCMA 5IW6B 1MY7A 1ZHKA 3DVNA 2MCPL 5MHSE 3H8NA 4M8QB 1JYNA 3D85B 2VE6B 3ARUA 1T83C 4RMQA 1R3KB 3BKCL 3C5ZC 3MV01 2WLYA 1EXUA 4F7MA 4R4BB 5LGHH 2WWMC 5KVFH 4W6WB 2PXYA 4HWEH 4LEOB 3GJFH 3HE7C 1HOCB 3TIEA 3D0LA 4A6YA 5ESVB 2DQHH 4NC1C 3B6SA 3UPAA 3SGEI 4NSKA 5C09A 1QKZL 5ADOL 1BBDH 2FH8A 1NAKH 1LEGA 1N5YH 2Z31A 5IEKB 4NUJA 2R1XA 5C3LD 2EYRA 1ORSB 3MRHB 4O9HL 5IOPB 4R2GC 3P0VL 5GS0D 1C16A 3A6OA 5KSBE 1IT9L 4I3RH 4EVNB 4UILL 4GMTL 3S3JA 2X4OB 1WT5A 2C4FT 3HE6B 4G5ZL 1BZ7A 1JF1B 4RGOL 2VUOA 4XNQB 5JLZA 4GKOA 3EDEA 2AJZA 5BRZA 4L3CA 5IB1B 2OXHA 1QZ1A 2JIXD 3RHWF 1XR8A 3O2VH 3L3IB 5EO1A 4KUCF 3UROR 5I8OH 4M1GL 4QTHA 5C9JA 5DJ0B 4UOW0 1LO2L 1Q9LB 3QUMH 1AIFB 1KCRH 1DFBL 3BUTA 4OD1L 5HXMA 5K9JH 4JKPL 4KH2A 5J12B 1I9RH 4WUUA 5FUOH 1U8NB 4OM0L 3G08B 1OM3H 1FH5H 5TE6H 5C0EB 5EZIL 3UBXB 4AQOA 5HVHC 2FLBT 1BFVL 4HKJA 3TYFA 3X17A 1JRHI 4ETQA 2CXGA 4WW2F 5K59F 1Q1JL 1UM6H 1QR1B 5C0IB 2IPKA 3QEUA 4PYHA 1FFQA 1J8HD 3SE9H 4UUJB 2Q8BL 3OHXB 3WJJA 4TVPE 1H5BC 3O2DA 4L1HA 1F90H 2IFFL 3T4AB 2E9WA 1G9EA 3MV9D 3X3GH 5BO1L 4FZEL 1CD9B 2ZCHL 1BEYH 1IM3B 1S9XB 3GMOA 2LVCA 3CX2A 4KAQL 4JO3H 3KPRB 3DYPA 2GIYA 3M1BB 3V79C 3EO0B 4N5ED 1UWXH 4PJ5E 4ZQKA 4DZBB 4Z7WB 1FNFA 4IRSB 4TVPD 4PJDA 5D7SH 1H3PH 3MOBH 1T2JA 4O02L 4U2YA 4ZS6C 3EZJB 8FABA 1C5DB 1QUNA 1D5ZA 2ADFH 3MLTA 3BSZL 4KK8C 3LQMA 3CZFA 1NCCH 2H45A 1EJOH 1ZKAA 3S35H 1IC5H 2HMID 4DUWA 2J2ZA 2BMKB 2XT1B 3RA7L 2GJZA 3MJ7B 4WI8A 3CGTA 1T20B 4OB5L 3G6DH 5FB8B 2X4QA 4XNXL 4JQXC 3UTOA 2Q86B 1TNMA 4GAGH 3D9AH 3TBWA 5FA3A 5H94A 1HEZA 3VFNB 4HXBL 4RFEB 5ACZA 4WW1B 4LSUH 4BFEA 3AC0A 2E9BA 1ZLVK 3SJVE 4IOIA 5DLML 1A3RH 3U82B 5IR1A 3I2CL 3DX7A 3WL9A 4MAYA 1NANH 4LVOC 3NCYP 3TN0A 4E9LA 1KELH 1G7IB 1F4XH 5IQ9A 3O11A 2D7TH 2HJLB 5TF1H 4HS3A 4MB5A 1JWMB 2XY2A 3PQYA 4D0BA 1QRNA 3SJVD 2WINB 4NYLA 4I48A 1P6AB 2VL5B 4RIRB 5SWZA 4CN1A 5GZNC 4ZSOB 4GRWH 4PGBA 2DTMH 4CVXA 5JMRA 4B50A 2DDQH 3D3VB 2BNQA 2R56L 3LV3B 4M5ZL 5F6HJ 3C6LB 2AV7A 4G7VH 4PY7A 1QR4A 4WW2C 3WKMH 3F5WB 1T7VA 2HH0L 4PLOB 2K1MA 4L4VD 2OBGA 1XGRB 2CMRH 2OL3B 1JTPA 4ELKB 5I1KH 5IG7B 1E28A 1PBYA 3ZKXC 5HJ3A 4IRZL 5CD5D 4NZTL 5D72H 4OAWB 3RX5A 4P2QE 3VFMA 1GCFA 1I9JL 4MXVF 1OARH 4Y89A 3VXNB 4KROB 3ZT6A 5INCB 4O2FB 1GVIA 4HX1B 3C87A 2ZG1A 1HH9B 1F3JB 1CDHA 5E6IC 1KV3A 1OAYH 1UB6A 2EYTB 1ZT4B 3RPIB 3W11D 5EZOL 1TPXC 3QEQB 5IROC 3G9AB 3U4BH 2GAZB 1FLTX 3VDBA 5E56A 4U1SA 1LO0L 3MODL 4P2QD 4FABL 4X0KA 2VLKE 1WVZA 1BFOA 3RJQB 1VHPA 1U91B 1CDBA 1N64H 1I4FA 1WF5A 3BMWA 1UM5L 4HT1L 4IHOB 5DFVD 1FCGA 1U3HA 4BKLB 4D9RE 3ARRA 1R5IB 4P2OD 4XCNA 1X5GA 1YUHB 2A73B 2AEPH 3CH8A 3TM6A 1MHEB 2YK1L 2V9QA 4TRPH 1AKJA 4M62H 4JPWL 3PWLA 3EYVA 1ZS8A 2NW2B 2YSSA 3T0DA 4PTTA 3S34L 1CG9A 3OB0H 4XCYB 5E95B 2DYPA 1SEQL 3KAAA 4M5YL 4D9RD 5EU7C 1YPZA 1I8LA 4NO5B 1IGTA 2PYEE 1TJHL 1IKNC 3ARFC 3S37L 1NFKA 4I0PB 3OX8B 1BQSA 1F3DH 1I1AC 2HN7A 3UPRB 1U8QA 4I3SL 3BQUB 4MJ5B 3KPSB 5IMMB 2ZUQB 4U4BA 3QXWA 4YHYB 4ZG1A 2LTQC 3H3BC 3RL1A 3UTSA 3ZKMC 2GSIB 3FQWA 2V5RA 1F6AB 4RISH 4X6CE 1JJUA 5K9QG 1Z9MA 5ACLA 4Y16C 4IDJL 4X7TA 1G6RB 2KL6A 4K3JL 3QUZC 2QR0A 5BOPA 3N9GL 4AEIH 2FWOB 2B5IC 1XF2B 2BNUA 4ZO8A 1JGEB 3L3JA 4MAUH 3HI5H 3O9WB 4KZDH 4JCLA 4IRJC 3MCKB 3S9DB 4HJ0D 4HWBA 4HZLB 4U1HA 3L3GA 2L0DA 4OZIF 1R3IL 4OKDA 2VLJB 4W68A 3V5DA 5ESQA 5C1MB 3STZA 2EDXA 1ITBB 1G7MA 5L9DH 3L5WB 1A8JH 4QHNA 2QHLA 3EFDL 2VIRA 3CVHB 4PJ9A 5C0DA 4QRSA 4CJ0A 3SO3B 3WFZA 3R06B 1BD2A 4LLQA 1EV2E 4NZJA 3QDJA 1GAFL 2VXSL 5JQHC 1YNTA 4J3VA 3RTQD 3ARGC 3N1GC 4FFYH 1CFQA 3RNQB 1DE4B 4JN2A 1QFUL 3MLVH 43CAB 1YEIH 4WVRA 4JRXE 1I1FA 2MHAB 2Y1VA 3L95A 15C8H 3EUUA 4N9GA 1E6JL 1FRGH 3AB0B 4U1GB 4U31A 1I1RA 1KC5L 5FO7A 3NTCL 4EI6A 4HMDA 5D2NA 4UBDC 1NQBA 3BYTA 1T0NB 2OI9B 2FECL 5ABDE 3NGBC 3VD3A 1RJZB 2X5PA 4HUMB 3GSOB 3BIKB 2VDQH 3CFEB 4PGEA 3EYUH 4PG2C 1OP9A 1MVUA 1X9QA 4JRXD 4CN6A 3GJFB 1UZ6E 5DJ2A 4NHUA 4LSSL 1IARB 3EJYD 1KEGH 1FSKC 1V7NL 3WUZA 2OJEA 1KN2L 4TNWF 3HRZA 3NABH 2DQTH 1BREA 3MV7E 1T6WA 3OJ2C 3H9YA 1DBJL 5IV2B 8CGTA 3O6FA 3PXJA 5L0QC 1L6ZA 3WXVL 2H8PB 3T0EA 5IM7A 3LQZA 5IJVA 5E7BA 1ZGLA 4IIQC 2YUWA 1U6AH 3WFBH 1F42A 4YR6B 3DBXA 1VPOL 4XPBL 4K07A 5ETUA 3MV7D 1BZQK 3LRGA 4MXQC 1KNOA 3UJIH 2W91A 4L9LA 4M4RA 1KIPA 1A5FH 5I6XB 1TZGH 5IFJB 4K3GA 1AQDA 1GGCL 1N8ZB 1J88A 1OAZH 4L1DA 3RAJL 4MSWB 5DHXB 2A6DA 5B4MD 2GK0B 5F6HI 3PQYE 3QUMB 1ZTXH 2NR6D 1KENH 2IQAA 5C0AA 4PJHE 1R5WA 4PLKD 3DHMA 4LSVH 5GISL 5DYOB 4HUVA 2GT9A 5CUSH 2QKIA 3KYOA 4EXPX 1D6EB 3TF7C 1AHWA 3K74B 4PV8B 5CZKA 3SDAC 1HH6A 2A83A 4QTIL 2BXYA 3FAXA 3DVGB 5I1EL 3TO4D 5L2KA 4P9HL 4WJ5A 3CU1A 3L9RA 5I16B 2I9LB 4DKAA 4PREB 2H32B 2K7PA 3NA9L 5CJXC 1JRHH 2F53B 1MJ7H 4PJFE 4UV4L 2VWEC 4JFYA 4QEGA 3QXDB 3GSXB 3P4OB 4HJJH 3X14B 1KYOJ 5KS9B 4F58H 4OT1H 1YMME 4YFLI 5J06A 2EDQA 5I2IA 4HJGB 1KN4L 4IS6B 4U7SA 3DETD 5HHVH 4Y1AA 3B5TA 1GGUA 1QLRA 2FJGB 3QAZB 2Y72A 5CWSA 4XP5H 4OFIA 2YMXL 3P3YA 5D2LF 1YQVL 3LY6A 3AXLA 3U30B 4OGAD 1HSAB 3PWVB 5CBAB 3PV6A 1RU9H 3WN5B 5H2BB 3RVWC 3VFTA 2R1WB 4XRCA 1YMMD 5F7MC 1HQRA 4M1CC 1P1ZB 5JW4M 3N50A 1DL7H 2DQFA 4LAJH 4H88H 2AQ1A 2M8XA 3O3DA 5GRVL 4P4KD 3Q2CA 3AFLA 3VGFA 1PLGH 4YHIA 1HHGA 1ZVYA 25C8H 1HSBB 1QBBA 4QHUA 1IGYA 1YN6A 1DANU 1MCFA 4HBCH 2FB4L 1T21A 1LK3L 3LH2L 4O5LH 1S8DA 1U8HA 1MCSA 3SKNA 5A40E 1AC6A 3QDGA 2R39A 2PF6A 1LD9B 5MENA 3SDDD 3ZKSD 4P23C 1NL0H 5T1KB 5C0CA 3A67L 3GMRA 1FNEB 5ITFB 3UYRH 3S3PA 2DQCL 1X7QA 1QQDB 2X4PB 5L8KB 1CLYL 4XHQA 2NXZC 4QXUH 3CXDL 3BRGC 3C8HA 4OCSL 3BHBA 5DMGC 3BZFB 4AIZA 3VXMB 3QH3A 1I7ZA 2GTWA 1E4WH 1NGPL 2UY7A 5D7IF 4TUOB 4KRNA 3MREA 3C9NB 2DBLH 3TH3T 4XAKE 1QLFA 4RMUA 2SEBA 4GRWB 3ULSA 1ND0A 1ACYH 5I18L 2HTKC 2QSCH 2IQ9H 3OTTA 3HUJF 3VXSD 4OLVH 2Z4QA 4OZGF 4R4FL 2NY4C 4K7PL 3HE7B 3UBXG 1JZ6A 2V7NB 5DJ8B 2BY1A 4U1KB 3RWHB 1CD8A 1IGML 4Z95H 4XAKD 3GSNH 3MR9B 3TBYB 4FXKB 4W6XB 4QXWA 3U4AA 3HZYB 3ZTNH 3QFJA 1WBXB 4M1DH 5IB4A 4AZ8A 3RDTC 3RY5A 1UJTA 1UVQA 2BOCB 2XTJE 5JUEH 1LEIA 5GGQH 4YHNA 2AXGB 3G5VA 3I6GA 3L3DA 3LZFL 1JHTB 3ZYIA 4LCCC 5I1CH 1G9ML 4JFXB 4ERSL 1D9KC 3BP4A 4MD4B 3H9SB 4O51A 1IM9A 1ZXQA 4KKCD 3PWPB 3ROLB 2VZ3A 1ES0A 2R0ZH 5I1GH 2W60B 2W07A 4LVNC 5GZOC 1HILB 1GPOH 4ZFZA 4L4TD 4I2XB 4J4PA 3FT3B 1NC4A 5A16A 5B38A 5E08H 5SWQB 4GBXA 5HGGS 2EDRA 3IRPX 4U6XB 3UEZA 4JRYA 1F11B 4MQXC 1A4JA 4KI5E 4GW1A 2LAAA 3WXWL 5FHAL 1QFWL 5HVHB 1UCTA 3RZCD 2OJZL 3EGSB 4NQDB 3VCLB 1HHJB 1MRDL 1NCDL 4LIQL 1MCEA 5DUML 4BELD 4CW1A 2APXA 4HH8A 4PRPA 1RUAL 3FB6A 5CJOH 5GGVY 1U92A 4QCIA 4G9FA 1OAUL 1EFXB 2BVQB 1O5DT 4Q0XH 4LDLB 3IVKB 3MV8E 3E6HA 1LP9E 4MJID 5C2BH 1J87A 4JZOB 1NMAH 2CR6A 2XYCA 2E9JA 4MLIA 4F37K 2X7LA 5HGAB 4KI5D 1H5BB 2BOBA 4LKCA 2PR4L 3U9UB 4KDTC 1I75A 2VXTL 5EBLA 4LEXH 1J1PL 1JL8A 3Q1SH 2KZ1B 2DM2A 4WHDA 2DIBA 4G6ML 3W0WE 1CFVH 4KJWC 3LRHA 3NH7L 3FT4B 1RZGB 3M8OH 4OGYL 4RDQF 5EIVA 3ZHLA 2HLAB 4YHLH 4BH8A 3H9HA 4G6AD 3GMQB 3RWJA 2ICWJ 2R0KL 2OTPA 4NZRH 4JB9L 3IYLW 3GHBL 5EU4A 4H20H 1NBZB 3WBDA 1QSFB 4KKLD 3FO1B 1H3VA 1CI5A 3NCJL 1Q9WB 2BCKA 4OF3A 2E7HA 5GGRA 4NC0B 3IU3B 3CXHJ 4A6YL 5FFLA 3PG2A 3PHOB 4OM1L 5BS0E 3O4LA 4Z5RA 4WFEE 5IT2H 1NC2B 5C0BA 1IL1B 4AENB 4BSVA 4HGKC 2G5RA 5KZCB 3DO7B 1GOGA 5DEFB 1BX2A 5IB3A 4NQTA 4DEPC 3BD3A 4CDHA 3AS1A 3X12B 1T7YA 4ONHB 1MFCL 3N1MC 3BGMB 1JGLH 3FFDB 2VDML 1JWUA 5HPMA 1CD1B 1FDLH 3LEVL 1P69B 5BS0D 1AFVL 4AM0A 1WFNA 3HZVA 2BX5A 4WFED 4XC3H 3K4ZA 3VWJA 4LLWA 3AGVA 3IDJB 2PYFA 2XWTB 5E5MA 4XX1G 4Y2DC 3QDME 1MHHA 4GAFB 4LVOB 4U7MA 5DRWB 4PBWD 3FO9A 2EC9T 2J12B 2AQ2A 2ADGB 5K9OA 5HD8D 3LPGA 5KSVB 1YNKH 4PS4H 1EH9A 1SY6A 1XIWD 3MSPA 2VXUL 5SV4A 1G7PB 5EOQL 1R24A 4PRHE 2YBRA 2P5EE 1ZWIB 3P9LB 2F54B 3U2SB 1S7UB 4XC1L 1RZKL 4PJ8D 5T5NF 4EUPH 3KPQA 1LO3H 5HYJA 1K4CA 1OSZB 1DBKL 1BHGA 4BH7A 2FL5B 3JUYA 4KV5F 1NFDF 1FJ1A 1U3ZA 1MFDH 4XHJD 4RWYL 3CUPA 1H3GA 5FHBH 3FQUA 3KDMB 4WW2B 4QGTA 2BSTA 3AY4C 4NDMB 3RU8H 5GGVH 4WFFD 2P5ED 2XZCH 3GMMA 4DN3H 1KCVH 2JCCE 3BW9B 2YUXA 3AREC 3O2DL 1OGTB 2NXYC 1TLKA 4P5TD 4YBLC 5K93A 2QADC 4E5XA 1EERB 1IAIM 4GRLA 4G6JL 3X3FL 2PW1A 5GSVA 1UEMA 1U8KA 5IW6A 4FQQB 4RFOL 1KLFA 1R3LA 4PRAA 2NY2C 3CXHK 1T5XB 5MENE 3T0WA 3L3HB 1YYLL 3MRDA 5D1XC 1TPXB 1SMOA 1N3NB 1UYWL 4X7EC 4YIQA 3RBSA 1RZ8B 3RVVC 2CDFA 3W2DL 5IW3A 1DUZB 4R4BA 3MRJB 5AAWA 2Q76B 4PTUA 4FRWA 4GKSB 4RFNC 5DSCA 4M43H 3FFCB 3RGVA 4NHCH 2X9WA 4LLMB 4QOKE 4TSAL 4POYA 2FCBA 3NFNA 1XGUB 2V5MA 5D71L 3E2HC 1D5XB 4HLJA 2H2SD 5D5MB 1G9NL 1FE8L 1E27B 4XWOC 4F33B 3GSVB 3SE4A 3RHWK 4X9HA 3UC0L 1DUYB 4JO2H 1U3YA 1U0QA 4YNYB 3JV5A 3L1OL 1IGJB 1P2CA 4JFEB 5EU6E 1KJ3H 1WV7T 4KDVA 1A9EB 2QV2A 3X13B 1AGFB 5EG6C 5DVNA 3ILPB 5IWLC 4MVBD 5HI4D 3ARFB 5KVFL 3QFJE 2DB8A 1I1AB 4HWEL 1P7QA 3DV6B 4FQXA 5KSBF 1AIFA 2FEDD 2QBWA 5EU6D 3ARBD 2VN4A 4LRNH 4Q9QH 2LTQB 1BBDL 4AG4H 1CN4A 1NAKL 2ORBL 2Z8SA 5EUOA 5C0EA 1C5BL 2D7PA 4LU5H 4LPWA 3RWCA 3OKKB 4MWFA 4I1NB 3RVXD 4Z7QE 4XP4H 3KR3H 1G0DA 1XAUA 4I77L 1FG9C 4QGYA 2XPGB 5JMOC 2BNRD 1GC1H 3QUZB 4I3RL 5DHYB 4HWZB 3HR5B 4JFFE 2B5IB 1J18A 3V0AC 3OHXA 2EDNA 2XXMB 1T1XB 3P77B 3KHQA 3QIBD 4ZFGH 7CGTA 3ORJA 1G7JA 5FYJU 1NCNA 4FNLH 4XZUB 4X6DA 4OGXL 4Z78A 2VABA 3W39A 3CCHA 5I8OL 3WIIL 3V6OC 3WO3B 1RUKL 2HT4D 1IQWH 4JFFD 3T0VA 1J1XH 2VLRB 1KCRL 3KPRA 2MSPA 3M1BA 4L5FH 3EO0A 2YPLB 1GZPB 1I9RL 4Z7WA 5FUOL 4DZBA 1FH5L 2IFGA 3MOAH 3OJMB 4EUPA 2JJWA 2X6MA 3MRCB 2PCPB 1JHKH 3BYYA 4WV1C 3PDOA 4Z6AT 4NQCA 2ICWI 2IH1B 4NJ9H 4TULL 4Q74A 5C6TL 1IGCH 4QRPE 4WGWB 4UIKH 2H1PH 4O00A 3MJ7A 1WZLA 1RUQL 3FHQA 3FB5A 5FB8A 1F90L 4UIMA 2DWDB 5I66A 2YD3A 2XQYG 3G5ZB 2ZPKL 3LEXB 5FO9A 1HWGB 3IDXH 1K3IA 3MRQA 3NGBB 2NLJA 2MTPA 4QRPD 1G84A 3DHJA 5GS0C 1DQDH 4G9DB 5CEXB 1IC7L 2WIIA 4XPGH 2NX5B 5J1AB 3IFOB 1MCBA 1YMHB 1H3PL 1FSKB 2D9CA 4ODTH 3RKDD 5HHOE 1M71A 1G7IA 1RQ5A 3GNMH 4GAJH 3V2AR 3IETB 4ZUVA 2P7TB 3WIHA 2ATKB 3S35L 1IC5L 3MRRB 5E94B 1CDUA 4LLVA 5L0QB 2BJML 1UCBH 2WINA 4DVRL 2E7LA 3G6DL 1GRWA 2EKSB 4QXGH 2VAAB 4XNMB 5DJZA 4KJPD 5IB5A 3VMPA 1EAJA 2RJMA 4DOHB 4LGSB 4GAGL 3D9AL 4XVSH 3SN6N 5HHOD 5F9JA 1H0DA 1CQKA 3KPPA 2Y5TA 5FGBC 3P0YH 5SX4H 4KVNL 3VWKD 4LSUL 1XGRA 4HAFA 3MOQA 1GH7A 2DQEH 2P44B 2B1HH 4HWBL 2X4UA 3VXQB 5CCKH 4FQLH 2DKSA 4TPRH 3QISA 1NGWB 2RAMA 5EZJA 4L29B 4HDIB 3RUGE 1ETZA 3O45B 1CF8H 3BE1H 1KELL 2ED8A 3DRTB 4WTZG 3FOMB 1F4XL 1HH9A 4OZIB 5TF1L 5KJRH 5IW1A 1CIDA 5EU3A 4GAYA 2BDNL 3QEQA 4DTGH 5JNYB 3E6FA 3SDAB 4YE4H 3CDGB 3BH8B 1NMBH 4K3DH 2HJFB 3FB8A 4FFWD 5IHBA 5BQ7B 1KIQB 4Q6IC 3BPNC 1Z5LA 5I8CB 4Y4KB 2YZ1A 5I1DA 4FG6D 5DMJB 5T3XL 3TPUB 3WKML 3IFPB 3I6LD 4OZFB 4BKLA 3U9PH 3VD9A 3NIDE 1J0HA 1MHEA 1MLCB 4JFDB 1OY3B 2HMIC 3KLDA 3QJFB 1OARL 1PKQE 1VACB 2C5DC 1BOGA 1C12A 1UH3A 3HC0B 4Y5VC 2V17L 5IP4A 4UQ2B 5T1MB 3RL2B 3UTPE 5BW7C 4NBYB 2NW2A 1OAYL 4M3KB 4TNVF 3UPCA 1I8IB 3WS3A 4EN3B 1CGSH 3D85D 1P84J 3WE6A 1R3HB 2XWJB 4FQHA 5CHNA 3U4BL 2VISB 4NO5A 3LS4H 1J7VR 5F7WC 2EH8L 2VDRL 3GGWB 3OX8A 2Z35B 1AO7D 3ULVL 3DVIA 1H15B 2ERJB 3KPSA 1T1WB 2C7UB 1N64L 1ZA6B 1NCBL 3U0TB 4LCYB 3BWAA 5ALBL 3UTPD 3OWEA 5F89B 1QO3A 3MLXH 2MCG1 4TUKH 3HPLB 5EBWB 3VXRD 1NMCC 4E0RB 4R3SB 1ONQB 2AEPL 5HPOA 1TZHB 2XQBH 3WNKA 4F7PA 5DUBB 4MXWH 1AD9A 4OV5B 1BM3L 4TRPL 1JWSA 1S5HB 2VDOH 1F4YH 5ALCL 3L3OB 4M62L 5A43C 2FWOA 1HINH 2NXZB 5IHZB 1BVZA 3HAEB 1GOFA 2V5TA 3O9WA 1CXFA 5I1IH 1KG0A 5I0DA 4HZLA 3HE6D 3T2NH 4D0CB 2J4WL 3RVTD 2IANE 3N1QC 4XPTL 3DX9B 1EJ6A 3SY0B 2GI7A 2AEIT 4N0YH 4HH9B 1BIHA 3L5WA 5L6YH 5CD5C 2DI8A 1U9KA 3DURB 4DZ8B 1SJHB 2VYRE 2APBA 2GYSA 2WIMA 1EBPA 1A64A 4X4YB 5C08A 1PY4A 4PJAF 3OMZA 1HXYB 1IC4H 4RISL 4MQ7A 2IAND 4Y4HC 3W11C 3LQAC 4KK5D 1W0YT 2X70A 2B2XH 2FEEI 4K94H 4MCYB 2ATPB 4NGHH 3SBWC 3EBAA 3VD7A 3QIUA 4PR5B 1KEMH 4F3FB 3REVA 5D6CB 4HHAB 3ZDZE 5A2JH 2CGRH 1AH1A 1NBVH 1OW0C 4NM8L 5T33H 4MAUL 3HI5L 4KZDL 2MHAA 3RDTB 4NKMB 3QUKB 4QWWD 4ZFOB 1ORQA 1P84K 1T22A 4U3CA 3BXNA 4Z7WE 1A0QH 2WUCL 3WDJA 4LCCB 1OAXH 4TNWK 3FMGL 1ZLUK 5IFAH 4X4ME 5L9DL 4P2OC 3BIKA 3CFEA 2AJ3A 3BZ4A 3ROOA 3OKEB 3P30H 3MRPA 4ORGA 5IJKC 3ES6B 3CFDA 1G1YA 4LCIH 5D2LB 5LGJB 2WBJA 4PFEA 3SDCA 4LVNB 5F1IB 5K9KB 1S9VA 5FOBA 3TYGH 3VGBA 1CICC 4IRSD 2FD6H 4MX7B 3QEGH 1Q0XH 4FXGB 4LLAA 3BD5A 1J05B 4S1DD 5BV7H 4QHLA 3CPLB 4UNTA 4ZAKA 5GS1C 4F57H 3FTGA 2CRIA 3IU4L 1YEIL 5F7NC 1JIBA 1S7SB 3KGRA 1F2XK 2H8PA 3BZEB 5INDB 4ZD3H 15C8L 2X1QA 1BJMA 2ICEA 3AMKA 4APQA 1FRGL 1UZ6F 1TJIH 5DJYB 1NH6A 1QG3A 1DDHA 3L5IA 5L88H 2YKLL 3IXTB 4MQSB 1UA6L 1CBVL 4I9WE 1CR9L 1KB5B 1HWHB 3EYUL 1PX3A 4NNPL 3MC0A 3LKNA 4MSWA 3DX6B 3DSFH 5AWNH 2B20A 3UJTL 2GK0A 4KUZL 4H0IA 1IAII 1KEGL 4D8PB 2AS5M 1I7UB 5KSUA 4HJ0C 4ZSOE 2DQTL 4I9WD 4XP1H 5DYOA 1G6VK 2WBWB 5TFSH 4WFGE 3WUWB 3D3VE 2XOTA 1FBIL 3MGOB 4XGZB 5J3HD 3V7AG 1D6EA 1S9YA 1HK6A 2R4SH 4PV8A 2VKXA 3FQRA 3REWB 1Y18A 3B9EA 4U6YB 4G8FB 4PGJA 3HUJB 3C5JB 1ROWA 5I75B 4FQ1L 3RWDA 3ULUH 4PREA 3O41B 4OZGB 3MRGA 1NKRA 4I18A 2AXJA 4NC2B 5EOCL 3QXDA 4WFGD 1K2DA 5KS9A 5ITBH 1AP2B 3C6LD 1DSFH 2ESVE 5DZNA 5DJCA 4DEPB 4HJGA 4XX1E 5DTFB 2J88H 4IS6A 4N8VB 2WAHA 5LBSL 5C07A 3FZUD 4L3AA 4JFHE 3D18A 3IS0X 5ICYB 4GQ9L 4V1DB 2UZYB 5CBAA 1K6QL 2VR4A 1WZ1L 4PJFF 3IDNB 3WN5A 4WUKL 2R1WA 4J3XA 4Y2DB 2ESVD 3BN9D 4OFPA 4XI5D 5LGKA 3T1WA 3GBML 3UTQA 1MHPH 3ALPA 2OP4L 4U1NB 1MNUH 3QHZH 5D1ZA 4ZXBA 5I76A 1LGVA 1HSBA 1TQBC 1MI5B 3C08H 4JFHD 1JRHL 6CGTA 3MCLH 2IBBA 4IOSD 5DRXB 4HJJL 4WNQB 1U2CA 3MGTB 5E0QA 4EQ3A 4E41B 4GUPB 4MHHI 5FUZL 3QRFM 3UDWA 2Q3ZA 1U8OB 2DIAA 32C2A 4Z0XB 3MPCA 4PJXE 5T1KA 3HRPA 1FYTB 5HHVL 1JPFB 3BP7A 4KHTH 3X11B 5ITFA 5ID1A 1QLEH 1G0XA 2AABL 4ONGH 1MJJB 4L3EB 4NRXA 4XP5L 1AGEB 4AT6A 2I24N 3RGHA 3ZTJG 1FZOB 2NXYB 4PB0H 2J8UF 4RRPG 2QADB 5AUMA 3UTTA 2EDEA 3WNNA 3KPSE 1RU9L 3VXMA 3LEYH 1FCCA 3MLSL 5JIHA 4CMMA 2EC8A 4LPCA 4YK4C 2ARJQ 1W72B 1PYWB 4MD0B 1DL7L 4LFHD 4EI5C 3VXUB 4RA0C 5KVMC 2NY2B 4H88L 3C9NA 4ZTOH 4YGVB 2PW2B 1F3RB 1PLGL 3F7RA 1TZIB 1T83A 2WMPA 3ABZA 5D1XB 3C5ZA 5DVMA 5T3ZL 4HBCL 2NR6C 5F1SA 4O5LL 3RWIA 2GK2A 3QG7H 1M7XA 1I1YB 1M4KA 2HT2D 4PLKC 3BQUD 4UT6H 1T2QH 4PP1D 4X9FA 5FGRA 5IBTL 4BZ1H 4RFNB 3HE7A 5J6HB 5DD3H 5DJ8A 3RWHA 1G1CA 3OKMA 5I8KL 4X5XB 3E2HB 5JW5B 4K8RL 2EEBA 1T7XA 2VLJE 5F70A 3VG9C 3EFFB 4QXUL 3TO4C 1T1ZB 1S5IH 3TT3H 3QEHB 1WBXA 4QXTB 4YHPA 4GKNB 4UAOC 5EO9B 1CL7I 1E4WL 1ED3B 2FX8L 3QXAA 3JWOC 1JHTA 1WZKA 5TE7L 2AAVA 4MD4A 3H9SA 1N0XH 5D7LB 1UH2A 4JANB 3OJDB 2HWZL 2VLJD 1ACYL 3DETC 1S7VA 3MRLB 2YN3A 3H0TB 3PWPA 1OAKH 2ZSVA 2IQ9L 1HYSD 2KQMA 5IK3A 3OXSB 4B5EA 3MFGB 4R9HA 4ZO7A 1UEYA 4OGAC 3IDGB 4PGCB 1VFBA 5F7EH 4S2SB 3VFGH 5SWQA 1J5OH 2UWEE 4GT7A 3KXFB 4MB4A 1SY6L 2D9QB 2JB6B 3AU1B 3GSNL 4P59H 4L8CA 4X8XA 1NUFA 3A6CH 1IEBA 5J4MA 3EHBD 5DQDL 3S5LB 4NQDA 3TBVB 1HHJA 4P4KC 2ZCKH 4OD2B 5EA0H 5JUEL 5HGBB 1FNAA 2FX7H 3VRLF 5L7XH 2BVQA 3O81A 1H8NA 4JDVB 1OB1A 4JY5H 2XZZA 1M6OB 3GIZH 5GJTH 4OLWH 5HGAA 1H5BA 3U9UA 3VFVA 5HI3C 1BLNA 2HTLD 4KK9D 1MIEH 4KI5F 3B5HA 4F2MB 1I8MA 1RK0B 5ESAA 1KCUH 3DRQB 3GEWB 3TN0D 1JYWA 1TVHB 4NM4L 1GPOL 3WD5L 5FO8A 1CYGA 3CFJB 3PP3K 4FQPA 3BUYB 2HLAA 3B9VA 2BVUA 2CK0L 1AGBA 1KUMA 2BSED 1LP9F 2GFBB 1KJVB 1K5NA 4KHXH 1LMKA 3V5HA 2ICWA 3VFSA 3MNWB 5DMKB 4ALAL 4YAQB 1QSFA 4WV1B 3FO1A 1B88A 4NQEB 2BNQD 5IIEB 1Q9WA 5CJOL 1T3FB 2VQ1A 5ISZA 2NY6D 2H3NB 2O26U 3IGAA 5C2BL 2DQUL 1L6XA 3RWFA 3F65A 1A6AA 4L8DA 4KY1H 1NC2A 4LNRA 1IL1A 3QIWD 3EDDA 4AENA 1M05A 2A9NL 4HIIA 4YLQT 1MPAH 4LEXL 1JN6B 4ONHA 4PB9L 4OFVA 5KW9H 1BFSA 1KOAA 3T0AA 3FN0H 3D69B 3H3KA 3RPKA 1T03H 3M8OL 3NMEA 2HVJB 1CD1A 4PV9B 2GTZB 1HDMB 1RFDH 4R0LC 4NWTH 2XWTA 3IAGC 1KJMA 2F53E 4U33A 4DK6A 2FJHB 1ODAA 2CJUH 3SGKC 4P3WA 5DRWA 3DV4A 5KS9E 7FABL 2Q1EA 5ERWA 5IMLB 2W0FA 2ADGA 4KKCC 4Y5XC 5KSVA 3AVEA 4PRNB 2JIXB 5DD6B 1NDMA 5B21A 1MJ8H 3O3AA 1NSNH 1ZWIA 2NCMA 2Z92B 3TPKA 2F54A 1EEUA 5IT2L 5KSBB 1ZMYA 1RVFH 2AGJL 4OLXL 3R4DA 2YD8A 5I1HH 1FZMA 3UJJL 3C6SA 2RBLA 4OZFG 3HZMA 4GW5B 4GXUN 3TO2B 3V52L 1JGLL 4EZMA 1I1CA 1SJEB 2JJSC 2R69H 3RZCC 1P7HL 4NDMA 1FDLL 3SDXF 3IFLL 1EHLL 1MLBA 2VZUA 1O7SA 3BW9A 4KVCH 1X5HA 4OF5A 2ZUYA 1OT1A 4EIZC 2P49B 3I6KB 5BV7B 4MDJB 1J8HB 1CK0L 3TV3H 5FYJE 4LSRH 3MBXH 3U1SH 4KI5C 1HKLL 5HHXH 2EE6A 4NT6A 3L3HA 5E6IA 4PS4L 2ED7A 5MEQB 1AGCA 3MV9B 1FFPA 4DCQA 5IROA 5C3TA 2XN9A 5FUCE 2X1XR 43C9A 4YDKH 4XAWL 4H8WH 4PRIA 3CK0H 5CSZB 1DUZA 6FABL 2JCCF 5SX5K 1EEQA 5BZWA 1CS6A 4S11A 3L7EA 4G6AC 4Q6IB 2CIKB 4GKSA 3BPNB 1VEOA 1MFDL 1TNNA 5DD1L 3FFCA 4JAMB 5FHBL 4LLMA 2MKWA 4LDOB 4YH6A 3RU8L 5GGVL 1G7HB 1IILE 1UJ3C 1GJIA 2AXHA 1U58A 2XZCL 4KKLC 4ZDHB 4DN3L 4PRDB 2W0LA 1MCCA 4PJCB 1E27A 3HAEG 4GRWE 1Z2KA 1MQ8A 3AUVA 1LDPL 1Q94B 4M93C 1KXTB 1DEEB 5HY9A 3D6GA 4R26H 2R2EB 4K3HA 4RRPA 4Y5VB 2C4FU 2KUTA 5DXWA 2BRRH 2VJXA 3QHFH 3S6CA 1K9TA 3MLPA 4PRBB 4XNYH 1IAIH 1A9EA 4MA1C 4NKOA 4NC1E 5FOJA 3OKLB 3QULB 5CEZH 1HKFA 3M17B 3GKWH 3FKUS 1IKNA 3ARFA 4FTVE 4X83A 2V9RA 1AXSA 2KPNA 2NMSA 1I1AA 1QYGH 3EYFA 3LKQB 4G6FD 4XTRD 4IOFD 4NHCL 3WIHL 1XMWA 2EKJA 2QSQA 3VD5A 4C83B 4G8GE 3EW3B 3WFDL 1CXHA 1CFBA 1X5AA 4OF8A 1NMCB 3OKKA 3H9SE 4HC1A 2YRPA 4Y16A 1WFOA 1XIWC 1C7SA 3WFEH 3OKDB 4FTVD 3PWPE 3SJVB 3J8F7 4HWZA 1AE6H 1NJ9B 5DFWH 1JK8A 3HR5A 5CKAA 4KRPB 4PJ8C 5CINL 3LN4B 4JREB 1TETH 2IPUG 3EDKA 4I2XE 4PUBH 4G8GD 3U7WH 1BECA 4IRJA 4LLDB 3SQOH 1MCOL 4LLUA 1Q9OB 1IE5A 2GCYA 5F1NB 2W65B 3K2UH 2XY1A 2IADB 2HT3D 3C2SA 1OAQL 2YC1B 5IFHH 2XWBB 1XF4A 5E6YA 3AMLA 4NIKB 3V6ZB 4HUWA 4L4VB 4XVJL 1F8TH 4Z7QF 3CC5B 5DDHA 3OR6B 3IDIB 4P5TC 3QJHB 1JNNH 1YEGH 3NZ8A 4LRNL 1GZPA 5A2KH 2W9DH 2B39A 4UDTA 4AG4L 1Q9KB 2EIBA 1QD0A 2MOVA 4OUOA 1YEHL 4LU5L 3MRCA 1RJCA 3KR3L 3LCYA 4XP4L 1MRCH 1CFTB 4Y4HB 3PUCA 4UINH 3DXAA 1JGDB 3BP6B 3NAAL 2MCPH 3ARGA 5IQ7H 1GC1L 1D5MB 2I60L 4CJ1A 4LCUA 1ZLUH 2AJSL 2OR9H 3BKCH 1EFXD 1G7QA 1LILA 3IJHB 3BRFA 4OLYH 1PQZB 4ZFGL 1T04A 3HN3A 3ZKNC 2FSEB 5DJXB 3G5ZA 5JDSB 3LEXA 1JI2A 2X4TB 4J6RL 4FNLL 3RZWA 3V4VL 1BBJA 3DYOA 1YECL 4O58H 2IBZX 3MCG1 4OTXL 4L5FL 1UZ8B 1J11A 1U93B 3P0VH 2O5XL 1YMHA 5C0JB 3WUWG 1IT9H 1CICB 1JHKL 4E42A 4HF5L 3KG5A 4JFOB 2MMXA 1XCTB 4UILH 4GMTH 3P9MB 3PGCB 3GI9L 3G5YA 1GZQB 4G5ZH 4NJ9L 4Z18A 4NZUL 3IETA 2P7TA 5GS1B 3P73B 5DI8A 3MRRA 4UIKL 1G7LB 4MVBC 2OXGA 3HB3D 2EKSA 1ZV5A 2VAAA 5JPNB 2G9HA 5ANMA 2WUBL 1XGPB 1WZMA 4C56D 4Y1AD 3ARBC 4IIQA 3UAJD 4F7EA 5B8CC 4K7FA 2YUVA 3IDXL 5KZCD 2JF1A 5DRNB 4S1RH 3GMLA 4Q58C 1DFBH 4OD1H 2A38A 4N8VG 3RVXC 4OFKA 2EDLA 1RZIA 1DQDL 4OM0H 2R2HB 4GRMA 3K8MA 5D9SA 1CL7H 4MNGB 5EZIH 3V7AE 5CIPH 4B7LA 1KTDB 1BFVH 1NEZA 3UMTA 3L7FB 4L29A 4HDIA 3SE3C 1Q1JH 4LLYB 1FN4B 1TENA 3QG6B 4X6BA 3VFPA 5DHVH 4BUHA 2RQ8A 1JGUH 1M7DB 3JWDC 4OZIA 2GHWB 3CSPA 2P8MA 1VSCA 2Q8BH 3U7AA 3QDGD 5TE4H 3CDGA 3BH8A 1ZANL 4XMPL 4AJ0A 2HJFA 5H37H 1R3JB 1X5LA 5EIIB 5L2JB 4FZEH 2ZCHH 1IAKB 5C0CD 3C60A 4PJAB 1HIMH 4MA7L 3RUGF 4LGRB 3QWOA 1PAMA 5TF0A 5CJXA 1RZ7L 3TPUA 1VFMA 5DURD 3P0YL 3IFPA 1B0RA 3EOBB 2Z8VC 2VITB 4OZFA 5DC4B 2DQEL 4UDUB 1MFBH 5CCKL 4FQLL 2V2WA 5FF6B 2FYYA 4WY7L 4JFDA 2R23A 5CILH 3QJFA 4WU5A 2A6JB 1CF8L 1VACA 2M26A 5IF0B 1WSST 2MQCA 4OBSA 5I19H 2ZG3A 4IMLB 1BOYA 3H2WA 4YPGA 2HAZA 4HEPG 5KJRL 3S7GA 1NGZA 3GO1H 3RA7H 5HVFB 4GSDH 1NGXA 3LDBB 4OB5H 4XNXH 3GRWA 4DTGL 4EEEA 1R3HA 3FQNB 4YE4L 2BVPB 2XWJA 5JOPE 2OLDA 5I1AB 2IC2A 4HULB 4GMSH 3NIDF 1KTLB 5D5ME 2Z35A 2XKNA 4HXBH 4WWKA 2EIZB 1H15A 1T1WA 2ARJB 5EC2B 2LVEA 3U0TA 4LCYA 3V5KA 3OGOE 5F71A 1BFTA 5F89A 4MYWB 3RKDC 1RUMH 2JK5A 4JFEE 3ZE2E 9CGTA 4ZYKB 4K2UH 3KPMB 3OL2A 5EBWA 3LKPA 5ICZB 4P23A 5JOPD 2E5EA 2Z93B 4E0RA 5CBEA 4N0CC 3G5XB 1XCQA 4OV5A 1QVOB 3MO1A 1A14L 5EPMB 2C3XA 5BZDB 2JKXA 4HKBA 3L3OA 2X4RB 4KJPC 1PX4A 4WI5A 1TTUA 4JFED 3ZKQD 1CGSL 3DIFA 2NY3D 4YK4B 4D0CA 1JPTH 4EI5B 3LS4L 3VWKC 1INEL 2IH3A 3HZKA 3SY0A 4M5ZH 3KPNB 5GXBB 4GBXD 3CFKA 4HH9A 4MNHA 4ODVH 2F8VA 4LPTA 1F4AA 3D0VA 2N7BA 4CVWA 5KTEH 3MBEA 4DZ8A 3DURA 1UB5A 1SJHA 3K4AA 2G60L 2WLZA 1KT2B 2CDEA 3DROB 4N0FB 5JORA 4TUKL 1XT5A 1RIVL 4LNVA 1MUJA 1I9JH 2CKBB 1UACL 3V0WL 5J8OA 2EE9A 4K55A 3DX8A 5MERB 3SGJC 2E6QA 1U8MA 3S5LG 4XB8A 3QDAA 4P5KB 2JJTA 2AP2A 3QWRD 5F7FA 4PR5A 1CE1L 3MTRA 4HHAA 3VG9B 1HINL 4ODWB 3TO4B 4HK3N 5LXGH 5CIPA 1CXEA 1NFIA 4UAOB 2VLRE 1LO0H 4QRRA 4FG6C 1J86A 2YPLE 4FABH 4LF3B 2WBKA 3I3BA 4LCCA 2Z91B 5DHVA 4U1LA 4WHCA 2UYLA 1D9KA 4N0YL 3WLBA 1TIUA 3CZJA 4WCYL 5L6YL 1CDYA 5KVEL 3MJ8A 1UM5H 2N7AA 4D9LH 4LMQI 1OOAA 5DC9B 3ZDZF 5D2LA 4P57B 1WBZA 5ILTH 2VLRD 5F7HA 2YPLD 3DMMB 5I17A 3ARDC 3N1FC 4JR9L 4I4WA 4MX7A 4WHTB 3KPTA 4FXGA 1DBMH 4QY8B 5GS3A 1FG2B 5E2UL 4K94L 2ZCLL 1KEML 3GJEB 4LPYA 5EULV 3S34H 1T0MB 1VFOA 4TUJB 1NBVL 4KK6D 4P9HC 1J10A 5JPMA 4RQQB 5ENWA 4RX4A 1SEQH 4P4KB 5KN5A 4R8WL 2P24B 4ENEC 2ILLA 1PKOA 1JNHA 1TJHH 3ZHKA 4HUXB 3PHQB 2NX5E 3HPJB 1A0QL 4NZDA 5IB2A 2CDGB 1OAXL 4I3SH 2FO4A 1IMHC 1UT9A 2V2TB 2RCSL 1KB5A 4CNIB 3TJHD 4KDTA 3P30L 5E5UB 4MJ4A 4U0RC 2X4NA 3Q6FB 4HPOL 2E7CA 5F8QC 1CTOA 2J8UB 4Y88A 4LAQL 4EBQL 2ZUXA 2DWEB 2ADIB 4D8PA 2NX5D 4K3JH 1U8JA 3AS3A 2H26B 2FD6L 1NUGA 1Q0XL 3LSOB 3N9GH 2FJFB 4RA3A 4DOHE 1P4IH 3QBTB 5D7IA 3WUWA 5C70A 3RVTC 4JEGB 4XGZA 5EOTA 1TDQA 2PKDA 5B39B 1NBQA 2UUDK 1DQQB 4G42B 1X44A 4Q9BA 4L8BB 1MAKA 4ZD3L 3TJEH 1NCUA 2Y4SA 1DVFB 4U6YA 1QSZA 1TJIL 3C5JA 3WDIA 1J12A 1OVZA 2MJWA 3DWTA 1INDH 4OZGA 5L88L 3VXSB 4MMXC 3KWWA 1BVKB 2XTLA 4OI7A 1ZGLP 1VEMA 3F7PC 4GW4A 2XV6B 4KK5C 3KPOB 4MXQD 3DSFL 5E5RB 1GAFH 1SEBB 5JO5A 1C08A 1YY8B 4KWUA 4JLRB 1YNLL 3PWNA 1QFUH 1KLGB 4BQ8A 4QWWC 3QP3A 2IWGA 3RY6C 3U0PA 4R0LB 5TFSL 5ICYA 3IF1B 2CRYA 3BWUC 4Y19D 2C1OB 2XFXB 1SYSB 3QNZA 2R4SL 5GRXG 2Z0BA 2VWEE 4Y2DA 4F8QA 2ZWLT 2YEZA 3FB7B 4JQIH 4XXCA 2HFGH 1C5CH 1HHHB 2EDOA 3RKPA 3SDAD 4MNQA 2XKUA 3K4DA 4Y5XB 3ULUL 1MI5A 3V6FA 5CAYB 1NLBH 4L4TB 4WNQA 3MGTA 3UCRA 4IRSC 4Y4KD 4E41A 4LGPB 4LSSH 3T09A 3IAPA 3BEWA 1E4KC 4S1DC 1V7NH 3ARYA 2AV1B 5EU5A 3RZCB 3AY4A 1DBJH 4L3EA 1AGEA 1JVKA 3DI3B 3IXAB 3D5OF 4G8EA 4H0HB 3VXTB 3AREA 2FBOJ 1FZOA 5TDOB 2AEQL 2C3VA 4NQSB 3M45A 1HCFX 4MJIB 2Y06L 4ODSH 2L7UA 3T0BA 2PTTA 1MJUH 1GGYA 3VXUA 2PO6B 1B0WA 4EN3D 4J2XA 3U7YH 1P7QD 4YX2L 2WNGA 4YGVA 4XPBH 4M1CD 3QHZL 1PZUB 5FECB 1TZIA 4PJXF 5D1XA 4ZOBA 3C08L 4DQOL 1W0WB 1BZ9A 4FQCL 1GGCH 1BQHB 3F12A 1P4BH 3WFCH 1I1YA 1X5KA 4PJBA 3MRIB 4F9PC 3BT2H 5GGSB 3AROA 3DUUB 4O2CB 2K7QA 1LO5B 4NQVA 3MJ6A 4PBVC 1OLLA 2XNAB 1QLEL 1VGKB 1UJ3B 4OQTA 4X5XA 4N90E 3VW3L 3C09C 3VI3F 3ZYOA 3GBNL 1T1ZA 3FQXB 4PB0L 4JQVC 1QNZH 2F15A 4G3YH 4GKNA 3PWJA 5CP7B 5KSAD 5I1EH 1NUNB 4P9HH 2NY1D 4M93B 4IDLA 2E8ZA 3MYZA 2GSGB 5TGBB 3NA9H 3D87B 4ZTOL 3MUZ1 3L5XL 1RURL 2EDHA 3DI2B 1ZT7A 3B43A 5D7LA 4MZ3A 4MA1B 1T6VN 4N90D 2HYMA 1IKFH 2C3GA 2DL2A 2HFEA 3SE8H 4OCWH 3W9DA 3QG7L 4O2EA 1KN4H 1S7WA 4UT6L 3FZUC 4NO3A 4X8JB 3STLA 1F97A 3OKOB 4PGCA 3PL6B 5DQ9A 5FGSA 2YMXH 5FCUH 3NIFE 3AU1A 3BN9C 2XRAL 4QYOB 4XI5C 1D5BA 4Z7OF 5DD0H 1HNGA 1V7ML 1Y0LB 4OD2A 1NCWH 3RDTD 5F7UA 1CFSB 5D2LE 2Z31C 4PJ8B 2ITDA 5TDNA 3OKYA 1M6OA 5ICXB 1CZ8L 1LO4L 1NFDA 3LH2H 1LK3H 4HD9A 1N0XL 1MCIA 2UWEF 1WBYB 3GKZA 3OAZK 1K4DB 1MREH 2P46B 4LBEA 3SDXB 4WI2A 4F2MA 1A6TB 3DRQA 1TVHA 3MYJB 2W38A 3V6OA 3CFJA 2EE2A 3BUYA 2DQCH 3QXVA 5F7EL 3WEXB 4QKXB 3VFGL 1J5OL 2QLVB 4BQ9A 1KPVA 4XP6H 2RR3A 4BJLA 1N6QL 4P59L 5EN2B 4BYHA 1TCRA 2GFBA 3O3EB 4JKKA 5J7CC 3K2MC 5FKAA 3CLEL 3A6CL 3QNXA 5CP3H 1S7TB 4MQXD 5IMKB 3MNWA 2ZCKL 4YAQA 2W59A 1NGPH 2DD8L 2V5SA 2DICA 3TVMA 1WCBA 1I9IL 2JCCB 2H3NA 1U8LB 1RZKC 1KPRA 2YD9A 3U6RA 2HT2C 4JY5L 4ZPVB 3BQUC 3QZWB 5GJTL 4XPAH 4OLWL 5I18H 4YHYC 5DT1L 1IEAB 3LN5B 4YBHA 1JN6A 3AS0A 4R4FH 4HIJA 5LAXB 1CGUA 3BI9X 3WJJC 3B9KD 3L6FB 3G04A 5DK2A 5AAMA 4CU7A 3ALWA 4JZJC 4HEME 1Y6KR 3HUJE 4ZUWA 4YXKH 2YRLA 4R96A 2VZSA 3NCFB 1A7NL 1B3JA 4HFUH 4X99A 3IJYA 1FZKB 3NOIA 4Q6YA 2EC9U 2M1KA 4KJQD 1G9MH 4ERSH 3WSQL 3HS0A 4PRNA 2JIXA 4CVUA 2CLRB 4WEBH 5JIPA 3GDBA 5KSBA 1MEXL 2AK4D 4KY1L 4LHUD 4YO0B 2G2RA 2GY5A 3F58H 4GS7C 5BVJB 5A3ID 4V1DE 3WFHB 2XKSA 3ARBB 4M3JA 3VA2C 2EE3A 5KW9L 5EOCJ 4JFZL 1TVBB 3FN0L 1G9NC 4JM2B 3EHBC 5FGBA 5MEOB 4RAHA 5FHAH 5J9PB 3O3BB 1QFWH 2WWKO 2BNRB 4AH2A 3STBA 1NCDH 4LIQH 4DKEH 1MI5E 4MB3A 4YBQD 3I6KA 4XT1C 5F3BB 4N5UA 3TA3D 1J8HA 2CJUL 1RUAH 1BJ1J 4V1DD 4BSJA 4HS8L 4F7TB 4AYFA 4E41E 1MWAA 3V0VB 3VFRB 2APWA 5D6DC 4BQ6A 1AGDA 2HTLC 4KK9C 1FZJA 3SKMA 1CT8B 3NBNA 4OZ4A 5MEQA 3MV9A 1FYTE 3TN0C 5HHMB 2A6KA 1RVFL 2FZ3A 4JZNB 1WWCA 3QNYB 3BGFC 2D7MA 5I1HL 4Q6IA 4PJEE 4OF6A 4OGYH 2EYSB 1EZVX 3HG1B 4H5SB 5D1QA 3FRPA 1QFOA 4JY4A 1G7HA 5DVKA 2R0WH 3BDXA 1FYTD 1T1YA 3MLYL 4WDIA 3TZVD 3GHBH 1KCSL 5HYSB 2NY6C 2GEEA 1FL6A 3BKJH 3RWEA 3MQIA 2BXZA 5HGHB 2NXYD 3NCJH 1Q94A 1FFNB 3TV3L 2V5YA 3MBXL 4A6YH 4JHWH 3U1SL 2R2EA 2NZ9D 4KTEL 3QIWC 4OM1H 1FORL 4WI4A 5BW7A 1MAJA 1SBSH 4X4XB 2DJSA 3PWUB 1HI6B 1JV5B 2EDYA 3MRBB 1A9BB 4U6VL 4PJGB 5I6XC 4KMQA 4H8WL 3G6AA 5DJAB 3M17A 4QRPB 3UO1L 2NW3A 4UMGA 3SEPA 3LKSB 4H1LA 1P5VA 1A6WL 4GRWF 5FDWB 3VE0A 2MWCA 1EAPA 4ZPTB 3FQTA 4JDZA 1BWWA 3HI1B 3GMNB 4GJTB 1LE9A 1CGVA 4Z7VF 3HCVB 4QHKJ 4ODXB 5D7LE 4Z9KB 1S7RA 5CEYA 4J1UA 3GMPA 3VGGA 3SJVA 1NJ9A 1VGEL 4R26L 5DJ6A 2VXUH 1GGBH 4NCC1 5EOQH 4FFVD 3QHFL 5SV3A 4LLDA 3LN9A 3WKNA 1PG7X 1XF5B 2YPKA 4XC1H 5I74C 4XNYL 1Q9OA 4J23A 3BKMH 1IAIL 3K1KC 3KXFE 3LKRB 3SDCD 5CEZL 4Z7UB 1DBKH 1FIGH 1WITA 4KC3B 2YC1A 2XWBA 3VWKB 4L4VA 3GKWL 4BQCA 3NFPA 1YA5A 2LE9A 1QYGL 5A2LH 3FO2B 2P5WB 3T0XA 1ZSDA 4H26B 4Z0BL 3O2DH 3CX5K 3TCLA 1IFHL 4OCYH 4OCNC 4F7CB 4XH2A 3KXFD 2QSVA 4G6JH 1P4LA 4APQD 5GHWL 3X3FH 2BZDA 4JFPB 1ZHBB 4YDVA 1MVFA 4HQQH 4RFOH 3BGAA 1HZHL 3KLAB 3SBWA 4OV6F 4I0KA 3TESA 1UXWA 2AW2A 2HFFB 2HLFD 4NRYA 1UYWH 4P2QA 3RUGB 4PUBL 3U7WL 1QBAA 1KF9B 4I0CC 3SQOL 3W2DH 3I9GH 3FL7A 3K2UL 3IKCA 4HV8B 4OI8A 4JE4B 5IFHL 4P2CG 4J3SA 5EORH 4XMLL 1A2YB 1BP3B 4YWGH 3T4YA 1DQJA 4NP4H 5FUCC 4PJIE 3T77A 4P2OA 2VR5A 3DYMA 2AXFA 5E8OB 2O5ZL 4NQEE 4ZUUB 4N0UB 1JNNL 5IJKA 1UZ8A 3EYSH 3O2WL 4ONOA 4OZHB 1I7RA 1U93A 2V2XB 2VLKA 1G9NH 4NKQB 2W9DL 3GRWL 4HZAA 4PLJD 2F74B 4M61A 3UC0H 5CGMA 2PTVA 2W92A 1QSVA 5I9QC 5B39G 3ARDB 4P3DB 3QO0A 3L1OH 5IKCA 2RIKA 3O6KH 5IQ7L 12E8L 2I9TB 1X4XA 4GFTB 3S96B 3JSSA 5HHNA 4NQED 2A6IB 3N06B 2OR9L 2A0LD 5AYUL 1B6DA 5IVOA 3VDCA 5KVGH 1MFAL 1PKQB 3GSQB 3HR6A 1AO7B 4OLYL 2FHFA 1QSEE 5HVGB 3U36B 4XTRC 1MCRA 4IOFC 1XGPA 1QP1A 1IQDB 3OPZH 2DIJA 4KRMB 4NRZB 1RAMA 3O6ML 3UYPA 4O58L 5E9DB 3VXRB 2KZWA 3T04D 1XZ0B 2A77H 5D7JD 2ORBH 4U0RB 2PYEA 1AI1L 1C5BH 2IMMA 5D2NC 1LE5B 1ZHLA 1JFQL 2UUDH 1QSED 1YEDA 3QB7C 5BJTB 1RULH 1SYVA 5K9QI 4I77H 2CRMA 4FMKA 1S7XB 4XCEA 1P7KB 3QG6A 1V3KA 1JZ4A 2C1PB 3LKOB 1KTRL 1M7DA 5E00A 5C0ND 5DJDB 2HT3C 2HJKB 5HGDA 1I3RA 4LQFH 4X6CA 5FV1L 1QHOA 3L5HA 4J12A 5FCSH 4OLUH 2VKWA 3J7HA 3SKOB 1A1MA 2IAMB 1R3JA 5EIIA 1NPUA 1A6VH 4OGXH 4JG1H 4FQ2H 1OP5H 3WIIH 1RUKH 4S1RL 4UT9L 1J8HE 1HYRC 2BVOA 5E1AB 1PY9A 3EOBA 3UTTD 2IANB 2VITA 5E2JA 3RTQA 1CL7L 1XR9B 3F62A 4KZEH 1JYVA 4PJ7F 1NCTA 5FF6A 3MV9E 3GSUA 3PABB 1JPGA 4WGVB 2YXFA 4L9LC 4OKVA 2E8YA 4TULH 5C6TH 1JGUL 3MROA 4AEEA 1N4XH 3BISA 2VZVA 2YWYA 4JFQB 1Q38A 1UQSB 1SBBA 3OKNB 1RUQH 4D2NA 4QF1A 5C6WH 5TE4L 3FO0L 2BVPA 2ZPKH 4RBPH 1RJYB 1JZ5A 4J8RB 4WO4D 3MNZB 2O61B 4ODBD 1BQHG 4OCMC 1UM4L 2NTFA 5BXFA 4PJCE 2R8SH 4UU9B 4JRXA 5KG9B 1HIML 4JDTH 3LS5H 2EIZA 5ID0A 2ARJA 5EC2A 1K8DB 1T89C 1IC7H 3C5SB 3K1DA 1MRFH 3IDYC 1UWEH 1YEFL 4DGIL 1HHKB 1MFBL 5ICZA 4Z7NE 3G5XA 4QRUB 3CFIC 1EX0A 3D2UB 1N5AB 5CILL 5I1LA 2FGZA 3HNTH 1QVOA 5J13C 5EPMA 1H3XA 1WK0A 4Z76A 3TBTA 3HB3C 4G43B 5I19L 5D5MF 4P0DA 2X4RA 4U1JB 5GSRA 2I26N 4QHKI 3PNWB 2BJMH 3GO1L 1HNFA 4DVRH 3CFBA 4GSDL 4C54A 2GY7B 3UAJC 1FL5A 3JV6A 5E8DL 3V4PL 4D94A 3P4MB 5H37G 3MV7A 3ZE2F 3NCMA 4P2RB 4D0DB 3RI5F 4GMSL 2O93L 1CWVA 2EECA 1QBLH 3PJSA 3KPNA 2HRLA 3VGDA 3ULUD 2DQGH 1LEKA 4R7NB 4KVNH 1EEZA 3MRNB 4CUCA 1NLDH 3SPVB 3FONA 3CFCL 4HWBH 4Y8DC 1FNGB 2X42A 4X7DC 1RUML 1KT2A 4K2UL 2BSSB 3EYOB 5HVWA 2XZQH 5CD3B 3ESVF 2CKBA 5F7DA 5GRJH 2Q6WB 2QQLH 1DP0A 2DLHA 3MXWL 4L4VE 3C09B 3ISWA 2BDNH 2DI7A 4ODWA 3TO4A 4Y4FB 4PJHA 1UKTA 3OZ9H 4KRPD 1JPTL 1B9ZA 3IT8D 1NUDA 1YN7B 4LF3A 4OLZH 1L7IH 1MELA 4YHML 2H6PA 5T3XH 4I5BA 3QT2A 3FOLB 4ODVL 3TH2T 3JTSB 5KTEL 4RZCA 5E2WH 4FP8L 1ZHKB 3DVNB 2IJ0C 4CADB 3MNVA 2BY2A 3VDAA 4XBGB 4OGZA 4MCZA 1VENA 3WNOA 4PJFA 5ISZD 1J0IA 3I02A 4YEFA 2V17H 1JE6A 4MA8L 1EXUB 4F7MB 1KB9K 1YMMA 2ESVB 3GJEA 4Y4HD 1KACB 5C8JA 1F2QA 3RJDA 2NY0D 4RQQA 4M7ZC 5E2TH 5LXGL 4A6YB 3QCUH 1UKSA 3OAZH 3QZWG 3B6SB 3JUZA 4UT7L 3T2OA 1RMFH 4RGMC 2DLEA 4NSKB 2F8OA 5C09B 2OYPA 1WUNT 2EH8H 1FV1A 2VDRH 3NCYS 1LEGB 3HPJA 3I85A 2W9EL 2Z31B 5E8PB 4EDXA 4NUJB 2R1XB 5FM5O 3ULVH 2EYRB 3VXPA 5HYIA 1MCPH 5IVZB 1FNHA 3ZDYE 1NCBH 5A2IH 5ALBH 4G7YH 3SDDA 1KJ2H 2R2BA 2QTEA 3P11H 3QI9A 4D9LL 2WP3O 4RAVA 3Q6FA 2C9AA 2NQCA 3ECBB 4LCWE 5ILTL 1BZ7B 1O0VA 4HKXB 1BM3H 5JLZB 4XVTH 2AJZB 1Y6MR 5BRZB 3LSOA 1DBML 3CH1A 4L3CB 5ALCH 4X98A 1JUFB 1OLZA 2NY3C 1CICD 2OZ4A 1XR8B 4LRIA 3OXRA 1JPST 4TOYH 5B39A 1NAMA 3THML 2BHUA 4PJXB 2P8PA 3VFUA 4QTHB 2J4WH 5CJBA 4JPIB 5C9JB 1B0GA 4GBXC 2OMBA 2W0PA 4LCWD 5JW3H 4JKMA 1FLRL 4XPTH 5J6GB 5JR1L 4MNGE 3PV7A 1OWRM 2VSDA 2N1KA 4QNPE 4HKJB 3TYFB 5E70A 4OQTL 1BVKA 5CJ5A 1NCAH 3R0NA 2QL1A 3DTXA 1J0JA 4Y5YA 1OQOA 3W5NA 2L4OA 1KLGA 4JZJB 1JTOA 1P4IL 4NM8H 3LOWA 4R0LA 2AK1H 1EVUA 4PJAE 5H8DA 5C71A 2C1OA 2ZOLA 4HK3J 1JYXA 3GMOB 3EAKA 5F7LB 2VDPH 1SM3L 3SGKA 3TJEL 3AM8A 5JHDE 2WUCH 2UZIL 3E3QE 4PJDB 3FMGH 2CR3A 2W1NA 3EKCA 1CQYA 4XP9H 1V05A 3IJSB 1INDL 4S0TD 3T1FB 3BPCA 2R1YA 8FABB 1D5ZB 3ETBF 4L4TA 4LSTH 3AAZA 3ARPA 1A6ZB 4GS7B 5DRZA 5B3JF 5DR5H 1NDGA 4EKXA 5JHDD 2GJZB 4K8RC 4ZUTA 5HYSG 4KK6C 2DKMA 2JJSA 5D96C 3RZCA 3VFOA 5A2FA 5C0FA 4LKXB 4U49A 3IU4H 3VXTA 2VZ1A 5FA3B 2LU7A 2NY5H 4WHYG 1HEZB 3OJVC 4OIAA 1FFOA 2UWEB 5ACZB 5MEPA 4JQIL 4XCCH 5JOFA 2HFGL 5JIKA 1C5CL 3TJHC 2YKLH 5F8RC 1UA6H 5IR1B 1CBVH 1CR9H 3DX7B 3WL9B 2WWKT 3D25A 3TN0B 1NLBL 4NNPH 1A21A 5IQ9B 3O11B 3QO1B 4JY6A 3UJTH 4KUZH 5EUOF 4HS3B 3MV8A 3F7QA 1LP9A 3BGFB 5GS2H 5GGSA 4D0BB 2CH8A 2ZOKA 4I48B 5J56B 5E8NA 5SWZB 1UFUA 3RQ3A 4PGBB 1FBIH 5DMIH 3F7VA 1KJ2A 3CMGA 1P53A 1TFHA 2BNQB 3W0WA 5GGRY 2QEJA 2MQ0A 2HRPL 2NY6B 3GB7B 5TQ0L 4PY7B 4WI7A 5D4QA 4ODSL 3SGEH 3ZE1E 1MJUL 3U46A 4FQ1H 2GSGA 3U7YL 3QIWB 5HJ3B 1OCWL 5TGBA 4X6DF 1OT2A 3EOTL 3K80A 4EI5D 4JHZA 5EOCH 3VFMB 1R0AH 2APFA 4P46A 3GSRA 1P4BL 3WFCL 2XICA 3OB8A 3CD4A 1UB6B 2ZKHH 5BS0A 3BT2L 3M07A 1ZA3A 3OKOA 1T7WA 5LBSH 2CO7B 1BJ1H 2X10A 1LDSA 2FBJL 1YJDH 1RJLA 1I3VA 4GQ9H 1RPQA 3U83A 1K6QH 5IVXF 2LQRA 2R29H 1WZ1H 4WUKH 1XGTA 1BFOB 4FQIH 5CMAA 2A1WL 4S1SH 1GXEA 1QNZL 4G3YL 1XIWA 3GBMH 1L7TL 5T5FH 4YHZL 1U8IB 1MCLA 1PSKL 1URLA 2OP4H 1SJVA 5AD0A 1CDCA 1CFSA 3P4LA 5F9AC 1J1OH 1U3HB 1CU4L 4PJ8A 4Y4KC 5JA9A 5TH2A 3GJFK 3QDMA 2AJYH 4KQ4H 5AG9A 5I74B 3S37X 4J7RA 3WHE1 1AKJB 1FVDA 1IKFL 1K4DA 3I3DA 3NIFF 3SDXA 3OQ3B 1RD6A 3SE8L 4OCWL 5AYQA 1HE7A 3PWLB 5FUZH 3EYVB 1A6TA 1KCLA 2CLZA 1ZS8B 4OFYD 5HYQA 2YSSB 3MYJA 5CLWA 3DECA 4PTTB 4PRHA 4HIHB 2LAGB 2P5EA 4GG8A 1MWAL 4HW6A 3SOBH 1CG9B 4P5TA 2DYPB 5EUKA 2AABH 1YPZB 4HMEA 1QPXA 1JGVH 3DMMD 5FCUL 3HNSL 4P4RA 1NGYA 1RIHH 2X44D 3GIVA 5HHQB 4EN3C 3MLSH 2HN7B 3BDYL 1U8QB 1WC7B 5DD0L 1X5YA 2FX9H 1QA9B 3RWGA 2C26A 1NCWL 1Q8MA 4TVPL 5EZLA 3RL1B 2JCCA 3UTSB 3VXOA 1T80A 2XQYK 1PZ5B 3BD4A 3FQWB 2J8UE 4JHAL 3DVFA 5GGTA 3QZWA 2ERJC 5T3ZH 4EDWH 3H6JA 3TEUA 2Y25A 4NKIL 5B22A 2DJUA 1IEAA 1ZE3C 4V2CB 4RMTA 5CEZD 1ZT1B 2QR0B 1MREL 3QRGH 2LABA 3IFNL 5IBTH 2K9UA 2BNUB 5LAXA 5HI3D 4ZO9A 1VADA 2X4SA 1DQLH 3TNNB 4J3UA 4JO4H 4M7LL 5IESL 4U1HB 4ELMF 3NACH 4H25B 1I85A 5I8KH 4K8RH 4XP6L 3L3GB 5KSAC 5DQJA 2HKHL 2NY1C 2R0LH 5ESQB 2FATH 3VXSE 1XGQB 5I9QB 4QOKA 4RMWA 1FZKA 2FX8H 1CTNA 4PJ9B 5C0DB 3RVUC 4QRSB 3MMEA 1D6VL 5TE7H 4Y0GA 4LLQB 2CLRA 1DVFD 3QDJB 2HWZH 3JTTB 4U0QB 4XPAL 4HIEA 4YFLF 1YNTB 3KS0J 3IDMB 2V7HB 1AD0B 1QFHA 4YQXL 1BIIA 4MMZC 4QHMA 4G6FB 1H9VA 4JN2B 1KPUA 3B2UD 5EU6A 3ARBA 5B8CA 2KQNA 4KRLB 4Z7VB 2E9IA 1N2RA 2Y07H 4N9GB 1SY6H 3NPZB 1N59A 2PTUA 3O8XD 2HFTA 4J3OC 5FO7B 3JV4A 1QTYT 2OSLB 4FTVB 3BEVA 5D2NB 5DQDH 4YXKL 3K8LA 3FN9A 3ARSA 3N1PC 2DQJL 4NQXA 4L4TE 4HFUL 4G8GB 4F7TA 1MVUB 3V0VA 3VFRA 3T3MF 2N4IA 3QIBA 4F8TA 3IB4A 5DJ2B 2A74A 5ECJE 4WEBL 2OJEB 2IEPA 2QQNL 3HRZB 2MPAH 4NCDA 4JZNA 3F58L 3VRLE 5BOZG 4JFFA 1VFAA 3P0GB 1S7QA 4NM4H 3WD5H 3B2VL 2AVGA 3O6FB 5JXEA 1JZ2A 4NPYA 1UC6A 4Z77A 4OCRL 4MJIE 4L9DA 1FO0A 3T0EB 4DWHA 4X5WB 1W8NA 2CK0H 3EJJX 3P4NA 5IM7B 4AY0A 1CXKA 3LQZB 5IJVB 3RIFF 3MXVL 1ZGLB 4YZFE 4DUXA 3MV11 3EO9H 4POZC 4DKEL 2X89D 4ALAH 1KNOB 5HGHA 4XB7A 4HLZG 1FFNA 4L9LB 3RNKB 1UXSA 1KIPB 3BMVA 1AQDB 2A6DB 2DQUH 4PJEF 4X4XA 3MBED 2IQAB 2PO6D 5C0AB 1R5WB 2A9NH 4ZNEE 3B9KC 4HCRA 3K81A 4QRPA 3GUTA 4PB9H 2GT9B 4HUVB 2GKIA 3KYOB 5F7YC 4L8SA 2N56A 3LKSA 4KTDL 3NIGE 1AHWB 2AERT 1HH6B 1GL4B 2HVKA 1A4KA 1I8KB 3DGGB 4WJ5B 3L3KA 3MLUL 2PETA 4KI1A 2R0WL 3IDYB 3T8XA 4ZUSB 5I15H 1GC1C 4KJQC 3HCVA 4GH7B 4QRRD 5TDPB 3BKJL 4PP2B 4JFYB 7FABH 4MJ6B 1Z9SA 5J13B 1E4XL 5I75C 2OTUA 4JHWL 3WHXB 1MQKH 1SBSL 4C56B 5A3IC 4Y1AB 1N0LA 5HHOA 1WEJH 4TQEL 1ZLVH 5JHLL 2AGJH 3PF2A 4OLXH 2HG5A 5CWSB 5JXAH 2RGSA 3UJJH 4WU7A 2BSRA 3AXLB 2P45B 5EDXA 1MCWW 1QFPA 4DN4H 1CFNA 3V52H 1A1OB 3PV6B 2YN5A 3OGCB 4C57C 5D70L 3VFTB 3FO2A 4XRCB 4J3WA 3MA7A 3IFLH 1EHLH 1CGTA 1JNLH 2DQFB 1WISA 4YBQC 3UYOD 3TA3C 1ZK9A 2AQ3A 5F21B 2VUYA 3PL6D 4NO0D 1Q72H 4YHIB 1HHGB 4QHUB 1IGYB 1OGAD 1CK0H 1ZHBA 1T21B 4ETYA 1HKLH 1I3GL 3SDXE 5TQ2H 3QDGB 2CLVA 5HYFA 2GITA 1KXQE 3B3IA 1U41A 1GGBL 1WFTA 4WFFE 4WWID 4EJ1C 2P8LA 1ZLSH 3RUGA 4R7DA 4XAWH 5C0CB 1BVLA 3GMRB 3BKML 6FABH 4GKZA 4HV8A 1FIGL 1CD0A 5F88A 1PG7W 3NCEB 5DURB 4IEFB 3QUYA 4PJ7B 4NNYA 5DD1H 5L8JB 3BHBB 1T0PB 3QXUA 4AIZB 3TZVC 3GSWA 3QH3B 1I3UA 5E8OA 4UZGA 1I7ZB 2GTWB 4N0UA 4K7PX 1RZJH 5FK9B 3MREB 4JJ5A 4OCYL 5EFIB 3K0WA 1OD7A 4YC2B 2EXYD 2NZ9C 1QLFB 3BX7C 1MHCA 4OLEA 2CIIB 1LDPH 4LFHG 3VFWA 3ULSB 1ND0B 3VJ6A 1TTGA 4HQQL 4M8QA 2IGFH 3D85A 4KPHL 3ARTA 4AEHL 2VE6A 1YEJL 2Z4QB 4YFEA 1FVCB 3PDGA 3PGDB 1ADQA 1R3KA 4PJIF 4M7ZB 3MJ9A 3KJ4B 5LWYH 1PKQA 3I9GL 5CGYD 3EJZC 3G6JE 4RGMB 3QIUC 3U36A 4X9IA 5JDJA 5EORL 4LEOA 3ZKND 4LPXA 3MRKB 1HOCA 5IB4B 3KJ6H 5GRUH 3T3PF 5HDBE 5ESVA 1UVQB 4YWGL 4NP4L 3WIHH 2D0GA 4OCXH 4XWGL 3WFDH 4YHNB 3A6BL 5FM5M 1HN1A 5IEKA 3EYSL 4XBEH 3I6GB 5TJWK 1ORSA 3MRHA 2DTSA 5IOPA 1A3LL 1IM9B 4FFVC 4LPVA 4EVNA 2C1PA 2X4OA 3LKOA 3O6KL 3WYRA 5CINH 1ES0B 3HE6A 2NY3B 2WBJC 3SDCC 1JF1A 5AEAA 1IGIL 2WP3T 4ZFZB 1MCOH 4DAGL 3S88L 4XNQA 3V9FA 2ARWA 1V3LA 5A16B 2J6EH 5B38B 1OAQH 4R90H 5IB1A 4GBXB 5KVGL 3CVIH 1CE6B 4JRYB 3ALXA 4OUUB 4S0SD 1A4JB 3L3IA 4XVJH 5AZEH 4GW1B 2BNRE 3OPZL 5DJ0A 4PGDB 2APTA 1Q9LA 3OF6A 1MCKA 4LASL 4APQC 5I0ZA 4PRPB 3FB6B 1U8NA 2IANA 2A77L 3G08A 4G9FB 3UBXA 1YEHH 2I25N 4HGWB 4JM2D 3E6HB 5C0GB 3O4OC 4U2ZA 2IMNA 4AQ1B 2X7LB 1RULL 3V8OA 3NAAH 2HLFC 2BOBB 5HHME 1QR1A 2VR9A 2I60H 5C0IA 5EBLB 5FKPB 3BH9B 4K71C 3S4SB 3RY6A 2EDDA 2AJSH 1CXLA 4UUJA 4JFQA 3OKNA 1UQSA 4LQFL 3MUHL 3PDDA 1FVEB 5LQBL 3HG1E 4OLUL 3T4AA 4OF0A 2VQUA 3H9HB 1EO5A 1RJYA 4J8RA 4J6RH 2O61A 5DEGB 3RWJB 2R9HD 3V4VH 1A6VL 2CUHA 5HHMD 4JG1L 1YECH 4FQ2L 1X5XA 5KG9A 1IM3A 1S9XA 1V8HA 3BZDA 1WGOA 4OTXH 3TC9A 4PLJC 5BVPH 2GJ6E 2BHYA 3CLFH 2BCKB 4IRSA 3QCTH 2O5XH 3HG1D 4KZEL 1E4KA 2EDTA 4HF5H 4KMTL 1C5DA 2ENSA 4X4MA 4Z5RB 1AR1D 3ILQD 3ET9F 2VLMD 4PJGE 5C0BB 3GI9H 5D96B 4BSVB 2A0LC 4QLRA 5IGXH 4NZUH 3C8KB 3OV6A 5IB3B 2BMKA 3ARQA 4PJCF 1N4XL 3S36X 2GJ6D 2D7OA 1R5VB 1T20A 4D3CL 1A7QL 5HPMB 1ZLWK 2Q86A 2ZJSH 3JBG7 4RGND 2WUBH 1P6FA 1RI8A 4D0DA 4HPYH 3HZVB 4JVUA 3N85H 3QCVH 4OSUL 5KANG 4LLWB 4Z7NF 5D7JC 3WJLC 2PYFB 5GGUB 2R8SL 3VFNA 1YYML 4YDLB 5E5MB 4RFEA 4R7NA 4JDTL 1LQSR 3LS5L 4WW1A 2OZ4L 5EC1B 3ULUF 3I50H 3FO9B 1NAML 5J0BA 5HTSA 1OF2B 1F6FB 1MRFL 5K9OB 5HDQH 1UWEL 4F9PA 4FZ8H 4ZXBC 3C2AL 4K94C 3GSNB 5C0NC 3D39E 3FN3A 5F3HB 2Q6WA 4Z7UE 3HNTL 4LARH 1A22B 1GOHA 3KPQB 2HJLA 1K4CB 4M6MH 4N0CD 1G0YR 1V5JA 2IBGA 5KAQF 1JWMA 4IMKC 2Q87A 1L4IA 3UDWC 1FJ1B 3H42L 4JQVA 1ZANH 4XMPH 2P5WE 2VL5A 4RIRA 3FQUB 5DA4A 2BSTB 4ZSOA 2DQIH 3D39D 3GMMB 3TIDB 4CN4A 3D3VA 4MA7H 1ACZA 1QBLL 2CXKA 3LV3A 3C6LA 1RZ7H 3F5WA 2DQGL 2WM0A 3PHSA 2E27L 4W6YB 2PW1B 4NNXB 2OL3A 1NLDL 1BQUA 5GSVB 1U8KB 1X4ZA 4BFIB 4ELKA 5IG7A 1R3LB 4PRAB 2P5WD 4JJHA 4CADA 2J6EA 3EOYG 4WY7H 4OAWA 4XBGA 1DLHB 2X05A 5BV7C 2XZQL 4ONFL 4MD5B 5J57B 3MRDB 1EGJA 3VXNA 3TVMD 5INCA 4YIQB 4Y19B 4O2FA 4HX1A 1KFAL 5GRJL 2CDFB 3LVEA 4LVHC 1F3JA 4YUEL 4KTYA 2ESVA 2DM3A 1RHFA 4KGLA 2QQLL 3RPIA 3KLSA 2EYTA 1ZT4A 4YHKH 4PTUB 3I6LE 4WO4C 5DSCB 3KYAA 5MHSD 3RGVB 2GAZA 3OZ9L 1U2HA 4UTAL 2E6PA 4N0UE 3NFNB 1KULA 4R4NC 2E7MA 4OZHE 4OLZL 1JMZA 1L7IL 5E8PA 4RMSA 5BMFL 2VDKL 1U91A 5IVZA 1F45A 1P9MC 3BP5B 1SHMA 3VA6A 5E2WL 1R6VA 4IHOA 5F93C 1P2CB 4X7SH 1R5IA 1MF2L 1YUHA 2A73A 3ECBA 3OBAA 5E8EB 4OJFH 4HKXA 3CSBA 3ARXA 1T4KB 3ESUF 1A14H 1AO7E 2EO1A 4F9LC 1JUFA 3GK8H 1A1NB 3ARDD 4JG0H 3ZDYF 4ESKA 4C55A 1P7QB 4PJXA 5GJSL 4XCYA 5E9DE 3VXRE 4JPIA 4FQXB 5E2TL 1UADC 3QCUL 3ULUC 4G8IB 3SHSA 1INEH 1RMFL 5T1LD 5J6GA 2X1OA 3DUHA 5EUOB 4I0PA 1T66D 3QUXD 4ENED 3UPRA 2VXQH 3RWCB 3VRIB 4MWFB 4MJ5A 3BQUA 1MCPL 2BC4B 5IMMA 2VTFA 2DLFL 5SWSE 4G7YL 5KOMC 5DVLA 1KJ2L 2G60H 3JVGC 2WZPD 3P11L 1KXVC 2VMFA 3EO1B 2GSIA 5E9DD 2VQTA 1RIVH 3AS2A 2HP4A 5HI5C 1F6AA 1FP5A 4ZNCD 4URTB 4AIXA 1UACH 3V0WH 4RNRB 3MA9H 4ODHH 4HKZB 1G6RA 2H32H 1XF3B 1RZFH 4XVTL 1G7JB 4OFDA 4JZJA 1CE1H 3B83A 5JIIA 4KRPC 5KSAB 5SWSD 4JREC 3Q5YA 1XF2A 1JGEA 4QNPF 2NY1B 4X6DB 3MCKA 4Z78B 2VABB 3GM8A 3CCHB 4NWUL 4TOYL 3W39B 1F00I 1JPSH 2JLLA 5JW3L