5GRJH

Crystal structure of human pd-l1 with monoclonal antibody avelumab
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
118
structure length
118
Chain Sequence
b'EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYIMMWVRQAPGKGLEWVSSIYPSGGITFYADTVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARIKLGTVTTVDYWGQGTLVTV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords avelumab H chain
publication title Structural basis of anti-PD-L1 monoclonal antibody avelumab for tumor therapy.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 23
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2016-08-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5grjH00
5CEZE 1U2HA 4IOIB 4KTEL 1KCRL 3J8F7 4KI5C 5JTWA 2C3XA 1JWSB 1RSFA 1CFVL 4XNXL 2BOCA 1M71B 4OAWB 2YSSB 2ED7A 1YQVL 4PRBA 2XRAH 2CLZB 3WNPA 5JNYA 2CKBA 5KSBB 1CE1L 3LQZA 2IALA 3RWDA 1KJ2A 1T1ZA 4KKCC 1VESA 5AG9A 3CFJA 3GRWL 3H7BB 4U6VL 4PJXA 3TBVA 3FONA 5J1SC 5EU5B 2R2BB 1OARH 3LQAL 5E1HB 5DZLA 5D1QD 3VD9A 2P5EB 4JM2A 5D7KD 3OAZH 4IRJB 2YBRB 2UUDK 1N5YH 4M6OL 5DYOA 3X12B 4YQXH 5E8DL 3ZTJH 4OLWL 5HYSB 3MJ9L 3ZDYF 1P84J 3GMPB 5ITFA 3MXWL 2Z8VC 2CK0L 4PJIF 2X6MA 2ADFH 5CBEA 1PZ5A 4KRPC 5GS0H 2BK8A 4G6JL 3H9YA 4LLDA 4WW2A 3THMH 3NIDE 3L5JA 1BFOA 4FFVD 5FO7A 3WFCL 3F6LA 1D9KB 2HJLB 2DLFL 1RV6X 4KJWD 1NUGA 2YA1A 2X9XA 3ARGD 4ISVB 2ZJSL 3SEPA 3FQTB 1QLRA 5FM8A 2AEPL 3UBXI 3HI1A 1T2JA 3D0VB 4WUUE 3SBWC 2ZOLB 3HZVB 5HYEA 2EDOA 1MI5A 1U8MB 3C6LC 3RPIA 4X9FA 3ULVC 5DFTA 2G75A 5DVLA 4ZQKB 3O6LL 1G7PA 1PW3A 2JJWA 4R3SB 2IAND 4ONGH 3RA7H 1F45A 1JHKL 2MHAB 4J3SA 4HIEB 1C7TA 1TCRA 3FJTA 3QIUA 1EERB 4QHLB 3VH8A 5GRUL 1OAYH 5BS0E 3QIBC 1KBGH 2JK5A 3TVMB 3NTCH 3EAKA 3T0EC 3UAJC 4J4PD 1QFUL 2R1XA 3VGFA 1L6ZA 4U1MB 2DI7A 4R2GB 4ZO8A 1Q9WA 1S7RB 1X6NA 3I6LE 1PYWB 1NMBH 1I7RB 2ADIA 5IB2B 3X11A 4MD0B 1FO0B 4OZIB 4QRRA 3ZKSD 3PGFH 1NGXB 2FJHA 2DTML 2PYEB 4GKZA 4Z7UE 5JPMA 5D2NE 1A1MA 5CS7A 3KVQA 5A16B 2WV3A 4Q6IB 3T1FB 5B39B 4LRIA 1E27B 2DQEL 1BD2A 4BM7A 5I1LB 1ED3B 3KXFA 5TGBB 1J86A 1RULL 4JRYE 3AREA 4MNQA 1K2DA 2WBKA 4YBLC 1MFEH 5FGRA 4ELMA 5C2BL 4P2OB 2LABA 3PWJB 1ZHLB 3GBLA 1RPQA 4GG8B 4PP1C 5CEYA 4J12A 4WI2A 3QYCA 4N9OB 1QRNA 1NMCB 4M1GH 2HVJA 3WSQH 2VN4A 4OZGA 1HILA 1X3DA 3MRJA 4FQJH 1OP3K 4I9WD 1CU4L 1LO2H 1CN4A 2XNAA 4HULB 1PEZA 1RUMH 3BD4A 2JB5H 3GEWB 1I8LA 4U1IB 4LNVA 3FO2A 2AJUL 4U1GB 3T08A 1WZ1H 4N9GA 2DOCA 2UVFA 4HH8A 1BVKA 3QULA 4M1DH 1YUHA 5H94B 1YC7A 3GIVA 3LKQA 5GS1C 1X5YA 1P4LA 2Q87A 4OFVA 2IH1B 2XA8H 4YDIH 1G6RL 1UCBH 4M6AA 1ACYH 1XF5B 4E42A 3QZWB 2B0SL 3Q1SH 4WVRA 4JFDB 5LGHL 4HWNA 1Z3GL 4FA8A 1FL5B 4XCCH 2VN7A 1OLLA 3IJSB 3WS3B 5C9JB 2JLLA 2DM4A 1JI1A 3GO1H 3S3JA 4JVWA 4PJEA 3VFNA 4DEPB 4DN3H 2FD6L 5I1DB 5I19L 1G9EA 4NKOB 2HTLC 4IRSC 4ZTPL 4GKNB 1ZT4A 4GAFB 3T09A 5I1EL 5DQ9A 4ZOAA 3EO9H 4BSVA 1IT9L 3HCVA 4G8GA 4OZHB 5EC1A 1GZPA 4BFEA 2NTFA 5FCUL 3DUUB 4TOYL 1F13A 1ONQA 4P23A 3FB8B 5CD5C 2DM7A 2E27L 1CDBA 3EYSL 4P9HC 4Z7WE 4X6DB 1MFCL 3MBEA 5IFJA 3O41A 1U92B 2CH8A 3UTPE 4APQA 2P8PB 3UBXB 3CD4A 3GI9L 3O9WA 3MR9A 1G7QA 4UB0L 1HEZB 5F96H 1OAQH 2ZCLH 3FAWA 4OQTA 4ZTOH 2FL5A 1IM3A 4LBEA 5DEGA 2WP3T 5KBNC 1FFOB 1UM6L 1CLYL 3IS0X 3UJTH 1XR8A 5C0FA 5IMOB 2GJ6D 4HS6B 4FXGA 2ZUXA 1Z6JT 4CVUA 5IESL 4LSRH 4M7JH 1C5CL 1MUJA 1HXMB 4GMSH 4RX4A 5T3ZL 3RWIA 4PRAB 4DVBA 1RJYA 3RZWA 3SE8L 5HHPA 3U0TB 3WIHA 1WZMA 4YDLB 4NM8H 2BHZA 4OJFL 5MEPB 3QEHB 3C60A 3ZHLA 3VRIB 4Q9QH 2DBJA 4ODSL 1RJZA 2XYCA 1MIEL 2CR3A 4P9ML 1FNGA 5E08H 5GGTA 5DRNB 3F12A 2CXGA 2X70A 4JN2A 1YN6A 5J9PA 4KXZI 2EECA 1TJIH 3DV4A 2J4WL 2PN5A 1PG7X 4MD4A 3EZ8A 3QQNA 5DJ0B 1T80A 3X3FL 2E6PA 2FDBP 1U8OA 3BPCA 3KYKH 4KMTL 4TNVK 3MRGB 1OARL 1BZ9B 5DMYA 1I1FB 4CMMA 4L29B 1T0NA 1CZ8L 3IU3A 2EDDA 1N5YL 1JJUA 1NGYA 3MMEA 3QJFA 3WV0A 2E8YA 4PRPE 4JHAL 2VXSL 5FGCE 3U4BH 1F4YH 1TPXC 4WFED 1ZT7B 3O4OC 4WGWB 3W9DA 4U05A 1E4KA 2ADFL 1KTDB 2H8PB 5GS0L 1S7QB 3SGKC 3THML 1XZ0B 1LO5A 4PJGE 4PJ9A 1MCSA 1FRGL 1M7DB 1R24B 5SWQA 1XF2B 5E0QA 1F3JB 4RZCB 3F7QA 1AGEB 1YMMA 3OB0K 1P6FA 1NC4A 1EJOH 3DO3A 1EXUB 3B9KD 4EVNB 4S1RH 4J8RB 5IW6A 1KELH 3MA9H 4TPRH 3JZ7A 1CGVA 3MNZA 4YDJA 4N8VB 1NCBH 4XP4H 3G5VA 5IVXA 2Z31B 4UIMB 4JKPH 1U95B 1T83C 4O02L 3TO2B 4HIJA 2A2QT 1LDSA 5B21A 5C0CE 1T5XA 4X6BB 3CSBA 4HV8A 4ONGL 5B38G 4OZ4A 1CD1B 4U1LA 5T3ZE 5F3BA 3D5OF 3ARGB 1AXIB 4LSDA 2UV3A 1CIDA 3EFFA 4I18A 1DBMH 2RAMA 4YDKH 4HFWB 2ZUQB 3GNMH 5FECB 5DHXB 4AEIL 1NFIA 2QADB 3AROA 4U0RB 1AGBB 3KPLB 1SMAA 4JR9H 1BJ1J 1PG7L 3K80A 3BQUD 3ULSA 2VLLB 5KJRH 1OQOA 4ODXB 4R0LA 2FYYB 3P4MA 2IMNA 4ZAKA 1J0ZA 3H0TB 2DYPD 1URLA 1IM9A 1NGZB 5C7XL 2QSTA 3H9SA 4HMEA 3MXVH 4LLVA 3RUGF 1OB1A 5ADPL 2D0GA 2B8OT 1BAFH 4RWYL 2X4PB 4ETQB 5IM7A 3FO1B 4ZPVA 4X8JA 3MRPA 1EAPA 4J3OC 4KKAD 2HFGH 2XTJE 1LP9F 3BXNB 4S1SL 2J8UE 5L88H 4RIRA 1CFSA 3BMWA 5JOFA 5MEQA 3WSQL 1OCWH 2W92A 2X7LA 4ONHB 3B43A 5DMKA 3STLB 5DDHA 1EBAA 3VXRA 5EDXA 1HK6A 1HQRB 3HNVH 4PB9H 5FK9A 1LO2L 5E6IB 2OBGA 5F6HI 4P59H 1RUML 3BPNC 1B0GB 2JB5L 5D1XB 4QXTA 4DJMA 1GH7A 5DRZA 3U46B 4YIQB 1HH6A 3CLFH 3HFMH 3RZCD 3JWOH 2Y07H 2VQTA 2CLVA 3RWEA 1JPFB 1UVQB 2VLKA 1F58L 2XZQH 4MDJA 4S1QH 4AIXA 5CGYC 3GKWH 3BMVA 2V9RA 4ZUTA 2A0LD 5HYJE 2FATH 2AEQL 2XA8L 4MQSB 4G7VH 1VKXB 2AJXL 3BT2L 2WBJD 5FUCC 1ZHKA 4ORGA 5F44A 2ZUWA 3VFMA 1F90L 4LSSH 3DURA 5DUMH 3DX8B 3KPNB 1T22A 3KPRA 2BSSA 1V7MH 3RIAF 3ROLA 3OKKA 3KYOB 4PJHE 4JY5L 4PRDB 4D0BB 1DSFL 4DN3L 2F54A 5CP3H 1DUZA 1LK3L 4FFYH 3QXAB 3VWKA 2BNRD 3PG2A 3EO9L 4NO5B 4YE4H 5D2LF 2R2HB 3ZYZA 1QEWA 3QUXA 5F9WB 2CO7B 2EH7L 4WFHD 1CDIA 4NQSB 4EDXB 2R69L 6CGTA 3SKNA 3CH8A 2R0ZH 3FT4B 4NPYA 4HS3A 1IEAA 3HC0A 3NIFE 3TBWA 5HY9A 5IBUG 1S78C 2CSPA 3FFCD 3O2DL 3GGWA 2Z35A 1AR1C 3GJFA 4JCMA 1I7UB 3KR3H 4ZOEA 1YJDC 1CFBA 1WWCA 2VDRH 4I4WA 3QFDB 1HSBA 5L2KE 5FUCE 4JCLA 3QDGE 2FWOA 5IMLB 5EN2B 3OZ9H 3UJTL 5DT1H 5A2FA 3QIWC 4RNRA 1LK2A 3QNZB 2YUZA 1NLDH 4FMFA 3OPZL 5F8QC 2VL5B 1AGDB 4LSRL 4RGNB 1QFWM 5K9JL 4M7JL 1I7ZA 4GMSL 4M7ZC 1TETH 1A9BA 4P2QE 1I1AB 1NGQH 2QTEA 5I66B 2I24N 5HYQA 4PTUA 2QKIB 3MUGB 4P48A 4B41A 4NM8L 4CDHA 2Y72A 3T3MF 1AGCB 4L9LA 3SDXF 4NKDB 3MFFB 3L3GB 4TN9A 2DIAA 4NFDA 1D5MB 1ZVYA 1A02N 4U7MA 4YGAB 5DK0B 4LHUD 2V17L 4QCIA 4ZSOE 1LEGB 4R8WH 2GJ6B 3HRPA 4DVRL 1AC0A 5HYIA 2HVKA 4ZXBD 1PY9A 3OAYK 4HW6A 4R4NC 5BRZA 4R7NA 3JV6A 1J05B 1TZIB 5DO2C 1MVFA 5J6HA 2YPVL 3KYKL 3CVIH 3ARRA 5FGSA 5J4MA 3V6ZB 1WK0A 4XHJC 4PJIE 1J87A 4G9FD 3RUGB 2FO4A 4G3YH 4P49A 3VGHA 4MDIA 1Q9KB 1HKLH 3S8WA 5KG9A 3P30H 5TF1H 3QEQA 3REVB 2QSCH 2XWTA 5CMAA 3VGEA 1XGPB 1NBYA 3MBXH 3FB6A 4YX2H 4P46A 5EBLA 2EDJA 5B3NA 1N6QL 1K4CA 3G5ZA 4HJGB 4Y8AA 4LVOC 3VXQB 4L8DA 1MREH 4B0MM 3V0VB 4RGOL 4LQFL 5D70H 4Q9BA 1G9MH 4NO3A 3U4EB 1QYGH 1RY7B 2BVOA 4P2RE 5C09A 1ZLWH 3HNTL 4XPTL 2GK0A 2GSGB 2D2OA 4LLMA 3SCMD 2J2ZA 4GOSA 4PY8J 5ISZE 4X0KB 3OKOB 2QHRH 3TPUB 4S1RL 1T89A 4XNMA 3UTTE 4P5TC 4KK5D 4LSPL 2AXGB 3ILQD 5I1GH 3T0DA 2PUQT 4XCNA 4QRPA 4U2ZA 4XP4L 1QBLH 3IDXH 1C08A 3DMMA 1UFUA 3TIEB 4JKPL 2ED8A 2ATPA 4MMXC 1AIFA 4XVUC 2ZOKA 1C5BH 2DLGA 4PJ8D 1S3KH 4ORZC 1RZFH 2AK4D 5J3HC 2X4NB 3W9EA 1FYTA 3OHXA 4LU5L 5BJTB 4I2XE 5BMFH 5C0JA 3HPJB 3OKNA 5EUKB 1UXSA 3U9UA 2NZIA 1GXEA 1K8IA 3L3JA 1INEL 2A6KB 1T20B 2R56H 1S7SB 3RWGB 1SY6A 5E03A 3SKJL 3M1BB 5C07A 4MWFA 5IB3A 3SDYL 3KPMB 3UEZA 5IFHH 1LNUA 3UC0H 4WEBH 5KJRL 1QA9B 3GMNB 4IIQA 5EZIH 3I3DA 4N1CA 1XIWD 5CJOL 3V5HA 1VFOA 3RVVC 5DWUH 4DUWA 2HN7A 4Y2DA 3TO4A 5EOCL 3VXOA 5HVHC 2V7HA 2L7JA 1KB5H 4Y7MA 1JPSH 5HD8C 4EIZC 1YDPA 1I4FB 3EYVB 1HOCB 4PJBF 5IB1B 1OAZH 1CGYA 4P4RB 4JFFD 4HWBH 4NUJA 3ZHDA 3ZL4L 5D7KE 3W0WA 1Q0YH 4L4JA 1FZJA 2CIKA 2B5IB 5C0IA 5LGJA 5I1CL 1KIPB 3SKOA 3E6HB 4PBXA 5BV7B 1R5WB 2OL3A 3BO8B 4GLRI 4JFYB 1RMFL 3FRPA 3HNVL 4LDOB 4PB9L 1KTLA 5MERA 3O0RL 4F7TA 3NFSH 4HQQH 2NPLX 1PVHA 2FEDD 3MRBB 3JWOL 3FOMA 3QAZC 2Y07L 3ARVA 3PWVA 4FQXC 2FX7H 1G7HA 2XZQL 5E1AB 4PTTA 3GKWL 3V6BR 5IR1B 2AV7A 2X89A 3WO3B 3NZ8A 2A77H 4JN1L 4G7VL 3CX2A 1C8PA 1SQ2N 5IKCB 1IJ9A 2V9TA 2CPCA 3NA4A 3D2UA 2ID5A 4KY1H 1YNTB 5D5MB 5DUML 2IANE 1WITA 1AD0A 5C6WH 1U3YA 2CLRB 1ZSDB 2JJSA 2EKSB 3IDNB 2IBZY 3SY0B 4YLQT 3TN0A 2WUBH 1ZV5A 4FFYL 1OW0A 4BH7A 5E94B 2A73B 2ZSVA 4YE4L 4I5BB 1FGNL 5ACZA 1WFNA 4ZFFB 7FABH 5ICZA 3TA3B 3LD8B 2VXTH 3JTSB 2G2RB 3D69B 1U8HB 1FG2A 4HWUA 3VMPA 4Z78A 1P1ZB 3QUZD 1XF3B 4KZEL 2FJFB 2CUMA 4PLKD 4FQQB 4DGYH 4E0RB 5ESQA 5AZ2H 2NQCA 3DHMA 2KUTA 4TTDD 1JV5B 2XZAL 1MAJA 3OXSB 4R90H 4MJ5A 3SPVB 2GK2A 43CAA 3OZ9L 3PWPE 4K2UH 1MWAB 2YOCA 2XY2A 3WDIA 5SWZD 4P4KC 3CXHJ 2Z8SA 3MNVB 1ZOXA 4I0KA 1MFBH 2AKRB 1D6EA 5J12C 1TETL 2BRRL 4LEXH 2ZUUA 4FOMA 5DA4A 4AQOA 1EEYB 4UDTA 4WY7H 2J88H 1Q38A 4MJ4A 1CT8B 1XCQB 1F5WA 4MQ7A 4XPFH 3QO1B 4OZFA 4IOFC 2VH5H 2WNGA 1BIIB 1Y6KR 1BGXH 1U3HC 3WIIH 1NC2D 4OFIA 1SYSB 4GLRH 3MOBH 2H41A 4BYHA 2G5RA 3BOVA 2OI9C 5FEBA 3ARBA 5EIIA 1U58A 4V1DD 1ORSB 4PRIB 5IFAH 4G9DA 3HUJE 2V7NA 2OTPA 4UQ3A 5B3JF 3RTQD 4HIXH 4KQ3H 3R4DA 2WBWB 5EUOB 3QR2A 4PJBB 1OP5K 3WJLA 3HAEH 4QO1A 5TF1L 2QSCL 2ESVE 4PJCF 3IU4L 1VCAA 3C87A 4L4VD 4YHIB 3PXJA 1WCQA 2YN3A 4YX2L 4ZXBB 1ZLVH 2ILLA 2WWMD 1DVFA 4J23A 3DI2B 4GBXC 1FZMA 3KS0H 3WJJA 3X13A 4K3EH 4Q7DA 3MRCA 1A64A 2NW3A 2BVTA 4NC1C 5CJBA 5EU6A 1MREL 3RY4A 2LV4A 1F4AA 3UTSD 5DK2B 3FOLB 4G6AC 2I9LB 2F5BH 2HFEA 4N0UE 5ESAB 5E5MB 1F97A 1EZVX 4ZUUB 5KSAA 2CRZA 4C56B 4WWKD 3BZFA 1OGTB 3LN5B 2H6PA 2P42B 3BH8B 1WBYB 4F9LC 2YKLH 2YXMA 3DXAE 3SO3C 2VABA 3E2HC 1IQDB 3I02B 4H26A 5I1GL 3BKJH 2YHGA 1R3JA 1QR1B 1FIGL 3QPQC 5LQBL 5B8CC 1QBLL 4U6HA 3VG9B 3IDXL 5E6YA 3FRUB 1DP0A 2HLFD 1D5ZA 4AH2A 1C5BL 4UV4H 4Y5XB 1S3KL 3BIKB 3S35L 4BQ8A 4P3CH 1RZFL 1T0MA 4L3ED 4JREB 4K9EC 4YXKL 1RJLA 1UM5H 4TUJA 1MCJA 4L8CA 4LPYA 3ARFC 5DFVD 4HEPG 4LSVH 5E9DD 4F9PA 4ZFOB 5TE4H 2R56L 3VXPB 5D7SH 1C5DB 5HYSG 1WGOA 3UC0L 4N0YH 4WEBL 4DOHE 2NY6C 5C08D 4PJ8B 4PR5A 5EZIL 4DZ8B 5DWUL 1QZ1A 3C5ZC 3MRQA 3MA7B 1SBBA 1PDKA 1LEKB 1R0AH 1EVTC 1KB5L 2VDKH 4L8BA 4YUEH 4O2EB 4M03A 2J1KA 1OAZL 3GSXB 4OGXH 3IVKA 1VFUA 4HWBL 5D71H 3MJ7B 1KPRA 4B53A 1Q0YL 3TIDA 3QUMH 5GSRB 4MA3B 2APVA 3B2UC 2IAMB 4BELD 4YHNA 3BD5A 4M61B 1XIWB 3CCHB 4A6YA 2BVQA 4WUKH 4DN4H 4NN5B 4R97C 1AFVL 5GGVH 1SYVB 5J13C 5DJDB 4KJPC 1GGTA 2HT3C 1G84A 2HLAB 1IGIH 3LRSA 3BEVB 1SJEA 4QOKE 3OGCB 2OJEB 3NFSL 2WZPD 5LXGH 4JFFB 1KIQA 4FTVE 1LE9A 5A40E 5GQBA 2W9EH 2EZ0D 3MV7A 3RKPA 4JO2L 3T4YB 3GUTB 2LVCA 3CX5K 3ZT5A 1YECL 4NQDD 5I9QB 5IEHA 3RL2B 4JGMA 3ULUD 1ZT1B 1SBSL 2A77L 3TH3T 2MCG1 4NQCB 5IMKA 4HG4J 4YHMH 2ZG2A 3D18B 3IDIB 3N50A 4Y5VB 4I0PD 3NCYP 3GB7B 3RVUD 2NZ9D 4KY1L 4L8SB 3KWWA 5HI5C 5BS0A 5D2LE 1ZEAL 1EFXD 3TCXA 5T1KD 3MX0A 4M5ZL 1N59A 4RBPK 1YPZE 1F4HA 5B39G 1MLBB 4HZLA 1YEEH 1YA5A 5E00A 1MEXL 1CDHA 2E7HA 1P2CA 3QXDA 1DUYA 2BDNH 2R23A 1Z9SA 2WUBL 1H3WM 1TJHL 2RFXA 3U2SA 4UIKH 1T7XA 4WO4B 1R5IB 3H3KA 3U0PA 2CRYA 4KDTC 3Q6FB 5DJCA 3MV9E 3UPRB 5GRJL 3D0LB 2OK0H 3DSFH 1UH3A 3NA9H 1E6JH 3K8KA 4XC3H 1MFDL 4XTRD 2PYFB 4KKNA 1S7XA 1U8IB 4JRYA 4RFNB 5C0BA 2YPKB 1JPGB 2MMXA 3BZ4B 3DVNB 4JM2D 1T1XB 3LS5H 2NXZC 3FN9A 3MUZ1 4G8IB 3SQOH 4DGYL 4HXBL 5AZ2L 2D7QA 3AM8A 1A1OA 3QCUL 1J9CT 3MJ9A 4DCQA 3RIFK 4R90L 4GKSA 4Z6AT 4LK4A 1R3LB 1NKRA 4K2UL 1CLOL 4KK8C 4NNYA 5JIHA 3G5YB 3Q0HA 4FQLH 3SDXE 2W38A 3N1MC 2I60L 2HH0L 3WIFA 5FYLD 1A22B 3O6FC 2AGJH 1MFBL 2AXFB 1UM4L 3CH1A 4L1HA 4YC2B 5CAYB 1QFOA 3QZWG 4Z7NF 3QUZB 1OGAB 4AENA 5D7IF 12E8L 5D96C 4WY7L 1KSRA 3IYLW 3VW3L 1LO4H 4YNYB 4HAFA 1N26A 1UB6B 1PBYA 5I8CB 4ONOA 2FGZA 2DWDA 4OGAD 1BF8A 1QQDA 5C1MB 4LEOA 3VFVA 2DQFB 2C3VB 1Z2KA 1L4IA 1MI5D 5FO8A 4M93C 2FCBA 3V4UL 3EOBB 5IFAL 5IOPA 5ICXB 2Y23A 1K8DB 3HG1E 4GXVH 4BSWA 5IHUL 4XBPB 2PO6B 4HIXL 3QIUD 1LWRA 1IC4L 1UWXK 3FQRA 1JCKA 3ULUF 2AI0H 2DKUA 3SDDB 3FO0H 3NN8A 4C57C 2C26A 2HJFA 1NDMA 4QRTA 4MSWA 3JXAA 4PJDF 1RURL 3I6KA 5I18H 3MCKA 4NDMA 4AG4H 3B83A 2N56A 4JO4H 5ITBH 2HKHH 4NHUA 4V1DB 5D7JB 4QRRD 5GS1A 4Z7WA 1ZKAA 5CSZA 5E4EC 5C6PB 4CKVX 4CN1A 3RPKA 2IQAB 4MZ3A 5CP7A 4RFOH 4XPGH 4JKMA 2YUWA 5DS8B 4ZS7L 1RUKL 1DBBH 1BD2D 3KXFD 4MNQD 1GOFA 3FFCE 1F4XH 2YR3A 3FB7B 2ZKHH 2DJUA 2X5PA 3MRNB 1FVDA 1FP5A 4WU5A 4XAKD 2G60H 2YKLL 1UG9A 1NUFA 4HKBB 4IEFB 1QRND 4ZNEE 3V79C 1CFNB 4PJXF 1N4XH 3B8SA 4LVHC 3UTSB 4C83B 5K9KA 4UV4L 4PD4J 1CLZH 4KFZC 4O00A 4EI5A 4NCC1 1B9ZA 2EIZA 4H8WL 2F53B 1VACB 3CC5A 3MLZH 2AJZB 5TDNA 1UM5L 3BYYA 5TPWH 4TSAH 3DUHA 4G7YL 4K7PX 2Q8AH 3QUKA 2M1KA 2YD9A 1CICC 3ARDC 2YPLA 3NPSC 5D7SL 3G08B 2FJGB 1G6RA 4O51B 1Q9OA 5HHOD 3BE1H 4KPHH 3OR7B 1KFAH 3MV8A 5F1NA 4N0YL 3UTQB 3WN5A 1JZ8A 2Y4SA 4F7EB 4WJ5B 5SX5H 4WW1A 1T3FA 2VYRE 2MCPL 1MHHB 1X5IA 3HE7C 5FKAA 2GYSA 1R0AL 2VDKL 3AY4A 3CMOL 4JFXA 2IADA 2NW2A 3H42L 5E9DB 3FZUD 4OGXL 4PJ5E 4YPJA 4G9FE 4N0RA 4QRQA 2Y7QA 4GAYB 3QDJB 4ODBD 5DJAB 3CPLA 3L3IA 4MX7A 2DN7A 4G8GD 4ODVL 5C08B 3I9GL 4B50A 2ZCKH 4HIHA 5C0DA 4XVTL 4DN4L 1S8DB 4PJGA 4PRHB 2Z0BA 5GGVL 4N8VG 2H2PD 3BRGC 4P23D 3W39A 1KYOK 5IQ7L 2VWEC 1HXYA 4GRMA 5LXGL 3MBED 5MEOB 4APQD 1H3UA 4HIIA 4DTGH 1KLGB 3O9WD 4NRZB 2W9EL 2VZTA 3WEXB 2H1PH 3IFNL 2P46B 4J3UA 2X10A 2BSRA 2XZCL 4YHZL 1MJJB 1K3IA 1BBJA 1T6WA 3ULUH 1B4RA 4OLUL 5JW3H 3OMZA 4X6CB 4HJ0D 4GRLC 5C0CA 3V5KA 5GHWH 1IBGH 3U79A 3F7VA 3WBDA 4N0FA 4G80A 1K5NA 3O4LB 4RX4D 1AO7E 4U33A 3V7MA 3VXSA 3RDTC 2VDOH 3LN9A 3GM0A 3MLWH 2AJYH 4ELMF 4K7PL 5F93C 1J1OH 1RZJH 3TCLA 2I26N 2XTLA 5DHVB 1C16B 4NNPH 4X9IA 2AK4E 3C60D 3BP7A 3T8XB 4GG6B 2VAAB 3NFNA 3BKML 4KVCL 4G42B 3VXME 4HWEL 3GBNL 4OZGF 5I8OL 3GMQB 2BDNL 4LPWA 5C3TA 1LE5A 4D2NA 1YMHB 4Y5YA 2CKBH 4NUGH 4Y19E 4XGZB 1KJ2H 2WUCH 1I8MB 5DJ2B 1FDLH 3IFOA 3QCTH 1I85A 3NABL 4YBHA 5FYKD 3NCFB 2EDQA 3BN9D 2WIIB 4B7LA 3QHZH 4JRXE 2N4IA 3C2AL 4CGTA 3B9AA 4LCIH 4F7CA 3EIFA 4I3RH 1T83A 3BPOB 3BUYA 5T5NG 4LF3A 3WL9A 3DVFA 2J8UA 3NCMA 4AM0A 1FE8H 3SQOL 4KMLB 4Y1AA 5JNYB 5ID0A 5ALCH 3RWDB 4NQVB 2Z91A 1S7UB 3QDMB 4UU9A 5TE7L 4NGHH 5FYLH 4FQHA 3C6SA 4YAQA 3VMOA 4IRJC 3FQUA 1KNOB 4JM2B 4PJ9D 2Y25A 3LEYH 3LDBB 1YMMD 2ZUSA 3G6DH 3PL6C 4AEHH 1NC4D 4EJ1C 5HGAA 5EA0L 5HYJA 4PLNC 3WD5L 4OI9A 1NCWH 5ITFB 1MH5A 5GISH 5B3JE 3F58H 1BVZA 2IF7A 4PY7A 3G04B 5CBEB 3NMEA 5HDQH 2GTWA 3D9AL 1U8NA 4LLDB 4WW2B 4FRWA 1A6UH 4PJCE 1D9KC 5KSBE 2AJSH 5F7EH 5FO7B 5IROA 4GXVL 3ARSA 5JXEC 2R9HC 5LBSL 15C8H 3GMMA 1MCPH 5EZJB 2W65B 4LGSB 4FABH 5TFSH 3DGCR 1IE5A 1HHGA 1U8QB 3O81A 3HI1B 3F7YB 2AI0L 1PJ9A 2OJZH 4P5KB 4ODUA 5INDA 1MI5B 4QTHB 3RPIB 2G75B 3QSKB 1L0XA 2DKMA 5DF0A 2UZIH 5ITBL 3CZJA 4KKLD 4ZAKD 1MPAL 4WU7B 1IM9D 1KPVB 4PGEA 1IGTA 3TVMC 1TCRB 3H9SD 3VH8B 4RFOL 1FNSH 4XPGL 1HKFA 2JK5B 2VLJB 4R2GC 3K74B 5FUOL 2JF1A 3UJJH 3QI9A 5L2KA 1KEGH 2QL1A 2BVEA 2R1XB 3QDGA 4NN6B 3SDAC 4Y4HD 2GY5A 4HC1L 3T65B 4WEUD 1Q9WB 3VFWA 1HZHH 2NYYC 4MXVE 4X99A 3WHE0 4Q6IC 2E7LC 2XKUA 4P2QA 1N4XL 3VXRD 1DLHA 2OS7A 5JPMB 1XF4B 5KSVA 4HF5L 3V52H 5H37H 2UUDH 1CLZL 4P2OC 4RRPA 4QTIH 4PIRF 3QA3A 1MCWW 3AREB 3PE9A 4Q0XL 1MQKH 2DWEA 5AD0A 3DX9A 3KGRA 4ZSOA 2VLKD 3RL1B 1WBZA 5ICYA 4OBSA 2EE6A 2GJZB 1UXWA 2GSIA 1HILB 2IEPA 3MRJB 4UTBH 4RFEA 2LAAA 3DROA 2KZ1B 1KFAL 4KPHL 3CLEL 1MVUA 5T1LB 1RAMA 1KG0A 2DQUL 4PJIA 5F9DC 2OQJA 2AJVH 3N06B 1CR9H 1CXHA 3KPRD 3TNNA 3D25A 2PYEE 5JPNA 5JLZB 1VFBA 1BVKB 3QULB 4BQCA 3U36A 1A7RH 2NY3B 3O3EA 5E8OA 4D0CA 2D31A 1KPUA 2F54D 4MNGE 1ETZA 3VWKD 3BP5B 5IVXF 2M26A 3QWOA 1WF5A 5CCKH 2ZCKL 3DRTA 4E42B 3QUXD 4JPWL 2YK1H 4L4VE 3O45B 3MACH 4KRNA 4PRNA 1AE6H 2FIKA 1DE4B 1LD9A 4P2RA 4DEPC 1F11B 3O2DA 4PBWD 5I1AA 1UZ8B 5FGBA 4X5XB 1JNNH 5ISZA 1Z9MA 4PJEB 3MRLB 4DW2L 3WXWL 1CFTA 4NZTH 5JO5A 5DJ6B 3UTTA 1ZT4B 3X14A 2AK1H 3FB5B 4XI5D 3TM6A 2UWEE 3HCVB 4OQTH 2FEEI 5E24E 1PG7W 4AK1A 2EXWD 4XNYL 2DAVA 3ULUL 5IK3A 1ZS8B 1ONQB 3ROOA 5GZOC 1II4E 2D9QB 5J7CC 3EYQC 1IBGL 4MXQC 2GTZB 5FHBH 2Z4QB 3O41B 5D7LE 5HHNB 3R8BB 4I2XA 2VDOL 3MZGB 3O9WB 4X7EC 3WIHH 1MOEA 2AJYL 1G7QB 4YPGA 1RZJL 2Q76B 2FL5B 5DEGB 1TFHA 3UYRH 3GSOA 4TNVF 5IJKC 2QSVA 3OKMA 2GUOA 1OP3H 1BVLA 5GGTH 4OB5H 1FORH 3IT8D 1GGUA 1KC5H 3K0WA 1AJ7H 2CKBL 4NUGL 4MCZA 3TT1H 2DBLH 1KJ2L 1WZLA 2WUCL 1MUJB 1KT2A 3GSNH 4YDLC 4XX1G 3QCTL 1RJYB 3F5WA 5FYKH 5BRZD 4BQ6A 2FX9H 3QHZL 2R1WA 3QQ3B 4K8RC 5EH1A 4PUBH 3KPSE 3O4OB 4MJIE 3F7PC 1J0HA 2FSEB 4LCIL 5AZEL 3PP4H 1JF1A 4MA7L 3V6FA 5JXAH 5I0ZA 1A4KA 1DEEB 1FFQA 3VFRA 2GHWB 3K3QA 4S11A 1FNGB 3VDBA 4MHHI 4YHYB 2FO1A 1FE8L 3QEQD 3VFTB 5HVGB 3CJJA 2VITB 5J9PB 1UJTA 4P46D 5T1DH 3BFOA 2X4RA 4IMKC 3DV4B 2CDEA 3TBYB 4NGHL 1NQBA 4HD9A 3FMGH 4M4RA 1JZ5A 2C4XA 1TTFA 1CXIA 4NN7B 3EJZD 3VXTB 4CMMB 4CN4A 5D1ZA 5KZCD 1T0NB 3HLAB 4FHBD 1UACH 4QRUA 5C09D 1NFKA 5JW5B 5DEZA 5EBGA 3LEYL 3MGAA 4AEHL 5F6HJ 2F74B 3SE3C 2YD5A 4AT6B 3Q3GB 1NCWL 3SKMA 2EE9A 1T04A 5GISL 1W72L 1BMGA 1CGXA 4DZBB 1JYWA 3DX7A 4NQDE 2H2SD 2WSKA 1SJXA 1H3GA 4QRPD 3ULUE 4XVSH 1WBXA 2BZDA 3VI3E 3JV4A 4F3FB 4FP8H 4DGIH 1LO5B 1S9VA 3DMMD 3O8XB 4U6XA 1HHJA 4UT9H 4PJ9B 2AJSL 3MRKA 5EU3A 1C1EH 2VE6B 4CU8A 3QFJB 3O3AA 3QQ4A 5J11B 1IARB 1MNUH 1VGEH 4HJJL 1KJMB 4PJDE 3T1WA 3QG6A 1NSNL 2YC1A 5DQJA 15C8L 5I2IA 1MCPL 2W1NA 3PWUA 1FYTD 2NX5B 3L95B 5GZND 4RMSA 2EE3A 3RHWK 2JTDA 2OJZL 2Z31C 2FBJL 3MNZB 5DRWB 4FFVC 1MHCB 2R39A 5C07D 3G6JE 4HUVB 3VFOB 1XEDA 2UZIL 4I13B 4KJWC 4HV8B 3ARGC 1DBJL 2YD4A 2VNCA 4H0GA 4NWTH 4Y2DD 4U1LB 1WV7T 3TO4D 3FFDA 1T1WA 1IGMH 1TVBA 4NCDA 2ZUQC 4KDWA 5F1KC 5HSFA 3EFFB 4I18B 5C0EB 2QADC 4U0RC 3MUY1 3BKYL 3ECBB 4K94H 1NANI 2X4TB 3UJJL 1Y6NR 1J8HB 4RMQA 3WUZA 3EFDL 1NFIB 1VB9A 2C3WA 3PWPA 3W0WD 4YO0B 5DEFA 2Q86A 4NWUL 4EZMA 4GW4A 1KN2L 5ETUA 3O2WL 5E7FA 3ULSB 5JHDE 1HHIB 1IGCH 2MPAL 4YEEA 4ZAKB 3RVTC 3MLTA 3TV3H 2VRAA 3UX9B 1PQZB 3KJ6L 3RY6C 1N5AA 5IW1A 3LPWA 5IWLC 1QSFE 1OB1B 2C4FU 4J4PC 5DR5L 3A6CL 4XWOC 4Y4FA 5HHXL 3TYGL 1MRDL 3UZEA 4EOWL 1NL0H 1NFDB 3CDYA 4QTIL 4WI7A 4X9GA 5DJ8B 5DHYB 1A7OH 5E5RB 2QJDA 1QO3A 3OKDA 3NPZB 4M62H 4PGBA 2IBZX 4X8JB 4ZPVB 3MRPB 5A3IC 1S7TA 3CNKA 1PEWA 1T5WA 4RIRB 4E5XB 1VADA 5I1IH 5JOFB 1KCVH 5E6IC 1LVEA 2X89D 2X7LB 1KN4H 3Q2CA 1EVUA 5D1XC 4KZDH 1X9QA 4UTBL 3HUJA 2XN9B 4NKMA 4Q2ZA 5J0BA 3C8KA 3RVXD 3SQBA 3D2UD 5I8EB 5B38A 1TNNA 3OB0H 4UT7H 2AJVL 5DRZB 4NQTA 1HH6B 1W0VB 4JRWA 5ENWB 4YWGH 1AY1L 3INUH 2CLVB 2WM0A 4WHCA 1CL7I 2VLKB 1PX4A 2ESVA 2IC2A 4BH8B 1A7RL 5DLMH 2A1WH 5CP3A 2ZSWA 4L5FH 4W70A 3TN0D 4EQ2A 4Z76A 5CINL 3CU7A 3V2AR 5J89A 4M1CC 4HWZB 1B0RB 3BD3A 1TZHA 3U1SH 1T6VN 2Y5TA 2YK1L 4OQ1A 4ORGB 3VFMB 1JNLH 1U3HA 1JE6A 3DURB 4N0UA 1T22B 2ZPKL 3KPRB 1E4XI 2KBGA 4V2BA 1MRFH 1I3VA 3KYNA 4ODWA 4QYOA 2DB8A 2V2WB 2D7MA 1N0LA 1T21A 4JVUA 1ADQA 3RWHB 1JNNL 2NLJA 2EDEA 3T0AA 3DXAA 1DUZB 3GJFH 3OJDA 3VWKB 3OJVC 4R26L 2CD0A 5F9WC 4R4FL 3MRDA 4MNQE 2XFXA 5DFWH 4ZUSA 4F58L 1OD7A 3QUXB 4C4KO 3X17A 3RX8A 5GGQH 5T3XH 5CEXB 3GJEA 1X5HA 3SKNB 3LKPA 3NIGF 1QRNE 3M45A 4NPYB 1JGEA 1IEAB 3HC0B 4HGWA 4LKXB 5HY9B 2ZCHH 1TLKA 3DVIA 2BVPA 5MEND 5F9JA 3GGWB 4NRYA 3P73B 4GBXA 2Z35B 3ARYA 3GJFB 4FXLA 2C7UA 3HR5A 4MZ2A 1RIHL 1OTUC 4ONFH 2FR4A 4HBCL 1JHLL 1HSBB 4LPTA 3UYRL 3VXUA 3K7UA 2GAZA 1S9YA 4LARL 1CIUA 3S4SB 3OGOE 4RGNC 4RNRB 3CFIC 2E7CA 4OB5L 1FORL 4HT1H 1I1AC 2APTA 1KC5L 1ZGLA 3SE4C 4M6MH 1AP2B 4F9LA 2DI8A 2F58H 5IGXL 3GSNL 3ARBD 1A9BB 4LLQA 5HHOE 4ZYKA 3FHAA 3PQYB 5CIPB 4PTUB 4PUBL 1RK0A 4U1NB 3LV3A 5T33H 5B8CA 4XBGB 3S88H 4H88H 4L9LB 4WCYH 3PP4L 3BGMA 3GK8H 4G6KH 2H26B 4RAVB 5BZWA 4D0DA 1IAIH 1VHPA 3KNBA 3U0WH 4XPBL 2KQMA 4QCIB 1DQJA 1HYSC 5BOZG 2NY5H 2EYRA 1DQLH 1A6TB 1JZ4A 1J1PH 2CO6B 1QNZH 1DVFD 4R7NB 5BRZB 3JV6B 4PLJD 3EOAA 4QOKA 1QVOB 5EU6D 1G7JA 4P5TB 2Q7NA 5ABDE 1NGWA 2P24B 3G9AB 3P9LA 4FTVA 2C3GA 1XGTA 2IPUK 2FO4B 4Y16D 2HTKD 5I8KL 2B20A 4RGNE 4HUXA 5KSAD 1MAMH 2XWTB 5DD6A 5CMAB 4J3WA 5F1IA 4GQ9H 4Z7VB 5SX4I 5IF0B 1ZAGA 5EBLB 1IKNC 3CXHK 1K4CB 3G5ZB 1NCAH 5F7DA 4EIGB 3LN4A 1X5JA 4Z5RB 4L8DB 1HDMA 4LFHG 1WFUA 5D2LA 4FP8L 5EWIL 4DGIL 5CEZD 5KZCB 1E4XH 4RA0C 1JWMB 1YQ2A 3GDBA 1YPZA 1MF2H 2PW1B 1VGEL 5C09B 2YD8A 3WNMA 5IIEB 4NIKB 3IB4A 4X7FC 5D6DA 3UPAA 1NGPH 3P0YL 4LLMB 3FHQA 5BXFA 1AGFA 3KS0J 3N85H 1JUFA 35C8L 2WWKO 1GGBH 5HVHB 4PJFB 4XNMB 4Z0XB 4JAMA 1NUNB 1CDUA 2DQGL 3MV9A 4G6MH 3ZO0A 3HE6A 5I15H 1G9MC 1XR9A 2XWJA 3L3OA 5ANMA 3VWJB 1SY6H 4QRPB 3CXDH 1YY9D 3BQUA 1ZGLP 1NEZG 2XOTA 3L7FA 4XPHL 4M43L 4M6NL 3N1PC 3ZE2F 2MFNA 1AIFB 1U93A 2ZOKB 1Q8MA 1SEQH 1EHAA 4F15B 2JCCE 5LWYH 5TDOA 5J06A 3B9KC 3TT3L 4NWTL 4QXUL 2BY2A 1IGML 3W9EB 4NYLB 4NNXB 5DUPH 3VU2A 5KS9A 2W60A 5BW7C 3V95A 4L3AA 2W0FB 4HWBA 4PJAB 1DBAL 4ZOCA 5HXMA 1K8IB 1D6VL 2ZNWA 1R3KA 3P77B 4OM1H 5ALBL 3R8QA 1YY8B 3MO1B 3OKEA 5C07B 3ARXA 4MWFB 3SDXA 5IB3B 3NCYS 1UWEL 3S96B 1ZTXH 3EGSB 5DTFA 3KYMA 4IIQB 1KIRA 3CU1A 4M5YH 5HTSA 3GZKA 2OL3H 5C6TL 1TMCB 2A6IA 3TO4B 3NBNA 1CGWA 1HHHA 1AHWB 4PY8I 1YDPB 2BVUA 3EYFA 3MYJA 3R06B 4M02A 2FGWL 1MRCH 2B5IC 4KKCD 1EA9C 2R2CA 1A7OL 4KJYA 1RZ7L 5D8JH 4M62L 3K2MC 1A3LL 2SEBA 3MV7D 5BV7C 1FZJB 3VRLF 4JHWH 2WLYA 3SGEH 1BZ7B 1YMME 4HEME 2Q3ZA 1AR2A 3EW3B 1KCVL 2DQIH 1HSAB 2OL3B 2FIRT 1KN4L 4OLXL 3VRJA 3DX6A 4JG0H 4KZDL 1KTLB 1RU9H 3HG1A 1T1YA 1EHNA 4K3DL 3IRPX 1V05A 4EN3B 3EDKA 3ZE0F 3RWJA 2Q6WB 4WV1A 4UT7L 5BS0D 2GT9A 4HKZB 5I1HH 2MTPA 2YUXA 4AMKH 4YWGL 5DUBB 4KRPD 3PWVB 3TZVB 5GS3A 5IHBA 3D85D 3V0WL 5SX4H 4PTTB 2A1WL 3C9NA 3PIQA 1X4YA 2AV7B 2FNBA 3I6LD 3NZ8B 1WWBX 2CKNA 4XCFL 4TUOA 2EDHA 2PW2A 4DQOH 2C4FT 1XGQB 3U1SL 3RZCC 3D2UB 1N3NB 3REWB 4LP5A 5M95B 4XX1E 2X1PA 3CDGA 4XRCA 4DKDC 5IHZB 4A2MA 4JRYD 3EYOB 5C0BD 2ZG3A 4Q9RH 3ULVD 1CXFA 4R96A 2NY1D 1BOGA 2H3NB 1RHHB 4GRWF 5H2BA 3TYFA 2VDNH 2I07A 4BH7B 4ZNEA 1ND0B 3TA3C 1H15A 3ZYOA 3LD8C 1N6VA 1TZGH 1V7NL 3MRIB 1NBQA 5GGQL 1JWUB 1NKOA 5T3XL 5ICZB 3MNWA 4X98B 3UAJD 4QNPE 1EO8H 1JN6A 2VLRB 4QRSA 5C0NC 1H0DB 2NY7H 2ZCHL 4NM4H 5DD3L 5KVGL 3BAEL 4OLZH 1WTGT 5ILTH 1Q0XH 4IHOB 5DXWA 1YEJH 3QDHA 1GHFL 3WFZA 3T2NH 4KQ4H 4ONFL 5ESQB 4JJ5A 4OZFH 1WAAA 4HG4K 4KI5F 3U48A 3H9HA 1MCRA 1JTOA 2BJMH 1OF2A 4I77H 5FYKU 4N8CL 4NRXA 2VQUA 1P7QA 2P8MA 1FZOA 4PG2C 3LAFA 4HT1L 4LVEA 3DGGA 1R5VA 4KHTL 4L4TA 2F58L 2GITB 5J57B 3VE0A 1Y18A 3T4AA 1TJGH 4PP1D 3HA0A 5ACLA 5EO1B 4Z7QE 4OCXH 3VG0H 1UEYA 4PJ5A 1Z9LA 1WUNT 1ZHBA 3LVEA 2DL2A 4WCYL 4MQ7B 3GK8L 4G6KL 5CILL 1IAIL 3FAXA 3IDMB 5K93A 2VLME 4X6EB 1CD9B 2IBBA 1HN1A 2F54E 1J1PL 2IQ9H 5SWSB 5GIRB 3ARBB 1WCBA 4P3DA 5EIIB 4D94A 1U58B 5FKPB 3U7WH 1CICA 5ESVA 1ACZA 3SO3B 4FG6D 2V7NB 1RUPH 5EORH 4HUWA 4UQ3B 4CBPA 4YH6A 5E8EB 1OAUH 1IFHH 4LCCB 1BFSA 2FLRT 2JIXA 3QEGH 3DETC 4X7CC 4C58B 2A9NL 5E8PB 4ZXBC 3LEVH 4Z18A 1EMTH 1K85A 3QEUA 4ESKA 2EDKA 1NCAL 1DVFB 1FZMB 2QQLH 1J0JA 2EDFA 2IWGA 5EU6B 5I16A 5LVEA 1AO7A 3FT3B 3PXHA 2HTLD 4JFHD 4JZNB 1GVIA 5T3XE 3BDBA 3ULVF 5CEZH 1U6AL 2X9WA 4WTZG 4LASL 3MRFA 1MF2L 1A6ZA 5L9DL 3CK0L 1I8IB 5IVZB 4AY0A 3MRRB 3BZEA 2ARJQ 4FNLH 2P4AB 4EI5D 1J7VR 1NCCH 5EU7C 1NGPL 4PRIE 1NAML 3VXMA 3C5ZB 2P47B 1R3IH 4KRLB 4X9BA 1GGBL 3CFCL 1MHEA 1A0QL 1JTPA 3MFGB 5EUOE 4Y19A 4YBQC 5DC0A 4GRWH 4G6ML 4H26B 5HGDA 2YPLD 2Z8WC 1SY6L 3CXDL 3V5DB 4Y5XC 4TQEL 4MB3A 3HPLA 4JRXA 5MI0B 3MV8D 1D5ZB 4AH2B 1Q1JH 3R0MA 5JHLH 4JREC 5LWYL 1IAOA 3SKUD 3ESVF 3L3KB 2VDQL 3OG6B 4KK5C 1RJLB 3ILQC 1MJUH 4G43A 4LCWE 2D03H 5KAQG 3LH2L 4OM1L 4XHQA 5J1AB 4PJ8C 4LVNC 4C56E 1BHGA 1B4JH 3GIZH 3WUWA 5EZLA 2EDRA 3SGDI 1Z5LB 2R0KL 1U2CA 4A6YH 5J6GB 5AYQA 1TQBB 4LIQH 4XVJL 4XMKH 5DVOA 3H3BC 5EFIA 2R4SL 3HNSH 1OP5H 4KK6D 4BSJA 1MRCL 3PABA 2IAMC 1KPRB 4IOIA 1JK8A 3TIDB 1XIWC 1JWSA 4NN5C 1KCSH 1A14H 2YWYA 3CVHL 4OAWA 4LCUB 3U9PH 4YHNB 4U6TA 4A6YB 1GGIL 4UOW1 5HGBA 2DQIL 3S36X 2CLZA 3RU8H 4PJCA 5JZ7D 5KSBA 2O5ZH 4JG0L 3WLBB 1M05B 5C0CD 1RU9L 3LRSB 4GFTB 2DD8H 1SJEB 1INQA 3RY5A 5T3ZD 5EU5A 3VXSD 2R2BA 1MCHA 4WHYH 3C08L 3TPKA 1LE9B 4AMKL 5I9QC 4WUUB 1KCRH 2YUVA 1DLFH 2K7PA 4LGPB 2YBRA 4LLAA 2CIIB 1A3RH 3X12A 5KANI 4Y5VC 5A2KH 3QDAA 1DFBL 1YQVH 4NBYB 1CE1H 4L8SC 3C2SA 3GMPA 2FEDC 2EICA 1JHTB 1UC6A 2L4OA 3RVWC 2O61B 5LG1A 5BS0B 4U6VH 4H1LB 2DTSA 1N59B 1BPVA 3RIFF 1BJ8A 3LQAH 3E8UH 3JSSA 4PG9B 4HZLB 3CGTA 3ULVH 4Q9RL 3WKMH 3NIGE 3KYAA 1D9KA 2HJLA 2XTJD 1P2CB 3FQNB 3QXDB 4JDVA 4WO4C 1DUYB 4M6OH 2R23B 2VDNL 5E8DH 4ISVA 2X4QA 4NO0B 3LS4L 5HI3C 3JBG7 4CW1B 4Y1AD 5JXEA 3U2SB 3FQTA 3U0PB 1JZ2A 3MJ9H 2JE8A 4RDQG 1U8PB 4Z7UB 3D0VA 2DQTH 5D2NB 3HZVA 2CK0H 3JUZA 5ID1B 3BVNA 4RFNC 5AAWA 2NCMA 5EOQL 3T0BA 1S7XB 1MCBA 4J1UA 5EBWB 4ZQKA 5DMJB 2NY7L 4XXCA 2R29H 4R3SA 5D72H 5ILTL 1HWHB 1Q0XL 2MHAA 3EOTH 4HIEA 5TDPB 1K9TA 4D9LH 2AQ1A 1A2YB 2VIRB 4QHLA 4FZ8H 3WS6C 4NQEB 4KQ4L 4UI2A 5CJ8A 5HYJD 1JNHB 4DCQB 3S36L 2AEPH 2XY1A 2D7TH 4GKSB 2BJML 4I77L 1KOAA 4EDWH 5E4IA 2NXYB 3BW9B 5HPMA 4YC2C 1S7RA 2OZ4A 5C2UB 5IVNA 5GRVL 1PYWA 4QHNB 3QUZC 1I7RA 5IB2A 4U1SB 1FO0A 2AQ3A 3O6LH 1CGSL 2UYLB 1FQ9C 1FBIL 1NGXA 1OPGL 1TJGL 2PYEA 1ORQB 4Y88A 1JHKH 5ERWA 5A16A 3VG0L 4Q6IA 5LAXA 5JORB 3T1FA 4NZJA 2QQNL 5B39A 4NC0B 4MNGA 2FB4L 5I1LA 1W8OA 4YFLI 4Z8FL 5TGBA 2XPGA 2VDPL 1O0VA 1D5BA 3I6GB 3VFVB 1JGUH 4L4VA 5J8OA 2Q8BH 3ALWA 3MLPA 4GG8A 1KTRL 5EB9A 3X3GL 1B6DA 3RFZC 3A6OA 2IQ9L 3OJMB 4BQBA 5L8JB 1BQLH 1K6QL 5IOPB 1Z0NA 3BIAX 4RBPH 2DTMH 4Z7OF 5EORL 4D9QE 3W5MA 3WLWD 4XP6H 2P44B 1B2WL 5K9QI 4XCYB 4P57B 4U1IA 4X8XA 2ICEA 1N7MH 3QEGL 5FV1L 5JW4N 1XGUB 4ZUVA 2UWEA 4IOSD 3KPQA 3WNLA 3QI9D 4HBQA 4J6RL 5L2KD 1OGAE 4HC1A 4NFCA 1EMTL 2HJFB 3QDGD 1GC1L 1NDMB 1NPUA 2N7AA 5H94A 3I6KB 2P7TA 1A7BA 4NDMB 3K4DA 3JVGA 3LKNA 4Z7WB 4HK3J 3K4AA 5CSZB 4P2QD 5D7LA 1CU4H 4KK9D 4K3HA 3L5XH 3NPSB 5CP7B 3QZWA 4X4XA 5CEZL 4CADB 1IEBA 1MCOL 2AJUH 1NCCL 1FL5A 3DBXB 1HIML 3ZE2E 1RIUL 4K07A 5MENE 3NZHH 2AP2A 2Z9TA 3WS3A 5C9JA 4MAUL 1R3IL 3PWLA 3NOIA 5FB8A 4WU5B 4JFEE 5KVFL 4YHKH 2CMRL 5I1DA 4NKOA 4P9HH 2D0FA 3DWTA 3AB0B 4RMVA 4MAYA 4ERSL 2OTUB 3VFSA 3SDCB 4OZHA 1G6RH 3BESR 4X5WB 4HLZH 4O4YL 4XNUL 3I75B 3DUUA 3KPSA 4WWKC 2BVYA 4MJIA 2B0SH 2O93L 2VJXA 5JHLL 4OKVA 3FB8A 4EI5B 5LGHH 1DJSA 3L3DA 4GAGH 1GC1C 2VXQH 1Z3GH 4QY8B 2OYPA 4E41E 3P9MA 4X6DA 2W9DL 1ROWA 1AKJA 1JF5A 2P8PA 3QUKB 1MJUL 3BIBX 1HEZA 1AC6A 3Q5YA 3PGDA 4ZTPH 5GSVA 5C0RH 5I1EH 3S6CA 4YGVB 1L9NA 1Q9OB 1B4JL 3GIZL 4GS7B 3IDYB 4KVNL 3WN5B 1FFOA 4EUPB 2A6JA 4TOYH 1CQYA 1JNJA 3DUSA 1RFDL 4WW1B 4OF7A 4HS6A 3BJ91 1FNAA 2Y5EA 4IS6A 4F7MA 4LIQL 3D39E 4XMKL 2E27H 1X5LA 4P2RD 1HXMA 1UWXH 2X1XR 5F7UA 1GZQA 2GCYB 4PRAA 3LOWA 4O58L 1MFCH 4PRPB 5FDYA 5FGCB 2NW2B 1P53A 4HCRA 5ISZD 3IS1X 3GI9H 4JZJB 4R4ND 4UB0H 1PZUB 1X5FA 3V8CA 2HRPH 3UTTD 2F53E 2YD7A 1U8KB 3VRIA 5DK3A 3L3IB 5K59F 4MX7B 2YMXL 3UTZA 4RSVA 4JFQB 3NIFF 1UM6H 4NQXA 1CLYH 5DVMA 5I71B 4O5LH 4PJGB 3RU8L 5DZOA 2XQYG 4GXUM 1KEML 4Y4KB 1HXYB 4GRMB 1OT2A 5T3ZH 5DJ0A 4IMKA 5HHQB 3MRGA 1BZ9A 1ZA6B 3DV6A 2VKWA 3JWDC 4JDZA 5KTEL 4L29A 4OJFH 3TH4T 1DLFL 1WT5C 5CJQH 1OY3B 4ODSH 5FDWB 1MIEH 1BBJB 3OTTA 1A3RL 4P5MA 3G6JA 4PP2B 4P9MH 4X5LA 4WTWA 3PNWB 3O2VL 2RIKA 1P5VA 2J6EA 5C0CB 3V5KB 1CVSC 1IGYB 3BPLB 4GRWE 4M3KB 3QDJE 2AV1A 1E28A 1ZT7A 4N0FB 4G80B 2J4WH 4AJ0A 1FSKC 3MLVH 4L3CB 1VEOA 5F7KC 3X3FH 2HMIC 4XNZC 4U31A 4JY4B 4KMTH 1XZ0A 2ZUVA 3TCLB 4HZAA 4PRHE 5GGUB 3E8UL 3ULVL 1D3CA 3WKML 1XF2A 1CZ8H 2P45B 1OVZA 1AGEA 3I85A 2CGRL 5JHDA 2EDNA 4JHAH 1EXUA 2VXSH 4EVNA 5J3HD 3LSOA 1CF8L 3PL6B 2DQTL 5AWNH 2DMCA 4M9PA 3BRDA 1QSFA 4PGJA 5JA9A 2QEJA 4QF1A 2VZ1A 2Z31A 3IFPA 4KI5E 3ZYJA 5DZNA 4BQ9A 1YNLL 5HJ3B 3BPOC 3TO2A 2FECL 2ITDA 2R29L 4JFOB 4KKBC 4LIQE 5D72L 5D1ZD 2KDGA 1FRGH 3MLSL 2XTJB 3EOTL 3BUYB 4LF3B 4YHLH 4D9LL 2J8UB 3O4LE 4AM0B 4FZ8L 4MHHG 2KZWA 5ID0B 1A5FL 3L3HA 1U36A 4HFWA 5HHME 2WANA 2D7TL 5FECA 1FNHA 1W72A 3EKCA 3MQIA 3MV7E 3KAAA 4UU9B 4EDWL 1D5IH 4IMLB 3KPLA 1UA6H 4JM2C 2VLLA 3C6SB 4YAQB 2FYYA 3BGAA 1KCLA 2D4DA 3RX7A 3H0TA 5MHSE 4O02H 2JJUA 1CLCA 3LDBC 1SVCP 1V3JA 1NGZA 4PS4L 3MRHB 4OLEA 2HKFL 1T4KB 4LSUL 2EC9U 3RY6A 3A67H 5IWLA 4YK4B 4ETQA 1MH5B 3FO1A 3AVEA 4WW2C 1G1CA 1MLCA 3QHTC 4AEIH 2BSTA 1JGUL 3AAZB 3JV5A 2Q8BL 3OKYA 3WNNA 3B9DA 3BXNA 1PG7H 1IC5L 1BJMA 2ICWA 3AS3A 1A6AA 3SDAB 1BQLL 4ONHA 4NO2B 3STLA 1QSVA 4KWUA 1HQRA 3QDME 4PJHB 5BVJA 4F7PA 5C7XH 1BFTA 4XP6L 5F8RC 5CSGA 1B0GA 5D1XA 4OGAC 5ADPH 1BOYA 4QXGL 1HHGB 1N7ML 5HDBF 2CXKA 4U49A 4YIQA 3DO7B 4RWYH 5C0BE 3ULVE 1UVQA 2A6DA 1CDGA 2HJKB 3PWPD 2ARJB 2Y36H 3U7YH 4DKFL 2YEZB 2Z92A 2BSED 4S1SH 2A74A 5INCB 2V5RA 4QHMA 2OCFD 4HK3N 3S4SG 1CBVH 3MROA 4JKKA 5IJVA 3L5XL 1V3KA 1AD9A 3T0EE 4OF6A 2P43B 4JGUA 32C2A 4JPIA 4Y4FD 4NN6C 5EULV 3RWFA 1PX3A 3DX8A 3G5XB 2VO5A 5EO9A 3OAUH 2DKSA 3NZHL 2WAHA 2H32H 1JMXA 1F58H 4PRDA 4D0BA 4DUVA 4YHKL 1TXKA 3P0VH 4P9HL 1HWGB 4X99B 4OKDA 1LO3L 3FCTB 5GGSB 1QSEB 1AXSA 3PHOA 2AEQH 5F88B 2C1OB 1DLHB 1G7MA 1P4BL 2R2HA 4J3XA 5HHOA 3EJJX 3AREC 2AJXH 4NKIH 3BT2H 3BEWA 4NQSA 4U6YA 4EDXA 5GRYA 3RGVB 5E56A 1F90H 4GAGL 2VXQL 3QA3B 1TQCB 1T0PB 2PTTB 1NLBL 5AUMA 3DX9B 3D3VE 3SOBH 4JY5H 2ESVD 1JIBA 1DSFH 2XG5A 3LB6C 2X4OB 1QBAA 5C0RL 1LK3H 3QFDA 4AL8H 2GSIB 2J3SA 4RFEB 1QFWH 4XZUB 1OAXL 5EN2A 3DOSA 4N0CC 2EH7H 5HDOA 4IOFD 4PJIB 3D1MC 2R69H 3QNZA 1U3HD 3GMLB 4XMLH 3MLUH 1A3QA 5IT2H 1AGDA 2NY3C 3NCJL 1I1AA 3D25B 5JPNB 3SE4A 5I66A 4JQXC 3PWNB 3O2DH 3GHEH 3MUGA 1YN7B 5GJSH 2D31B 1KPUB 5DI8A 1AH1A 4MS8D 1AGCA 3DXAD 1NBVL 2HRPL 3WCYA 2K1MA 2VQ1B 1D5MA 2DQCH 4JZOA 3DRTB 4KMQA 3ZT6A 1LEGA 2IPTH 3HZKB 4O5LL 1LD9B 3OPZH 2IBGA 1XH3A 3FZUC 5K9JH 1J05A 1TZIA 2OX5A 4JFHE 3ZDXF 1VPOL 2VISB 5ISZB 3TBTB 3P9WB 2ZUTA 3V6ZA 4GBXD 5JO5B 3UTTB 1GAFH 4DK6A 5CJQL 3TF7C 5E70A 2H2PC 3B5HA 3IKCA 1EX0A 4G6AD 4O2FB 1LILA 2CUIA 2OTWA 1UKTA 3VXUD 1Q94A 1XGPA 2V17H 3IDJB 4BFIB 4P0DA 3ROOB 4DVRH 1I1CA 5IEKA 3VDAA 4XWGH 2JCCA 1DQDL 4OCYL 5LJYH 4AZ8A 1VEPA 2YPLE 3GSNA 4HJGA 4OCMC 3O9WC 3MLVL 3VXQA 5D6CA 2C5DC 2PXYA 3WFEL 3LEXB 3P2TA 3MV8E 3I2CH 4RMTA 2YPVH 3V0VA 4LLYB 3MGTA 1OTTD 3L5WA 4FS0A 3QPQD 3C5SB 3U4EA 1BX2B 4EI6B 1HINL 1U3JA 4HJ0C 4ENED 1E4WH 5FA3B 5CBAB 3E6FA 1OWWA 2FHBA 4U0QB 4MVBC 3OKOA 4XB8A 3TPUA 1KIUA 3HUJF 2EKJA 4MCZB 1UWGL 3AUVA 2AXGA 1N6QH 1KT2B 4GW5B 5AWNL 1CI5A 5EIQA 3P4OA 5DJYA 4LGRB 4I0CC 4QOKD 3FL7A 3S98A 3SHSA 2NNAB 1NAKH 2ENSA 3TIEA 5D1QB 4M7LT 4RGOH 4LQFH 4QGYA 5CJXA 4FTVD 1JF1B 3V6FB 4YHYC 3DYOA 3RAJL 5DVNA 2NY6D 3VFRB 4CJ0A 2LU3A 4YHLL 3HNTH 2EO1A 4XPTH 2X4NA 1EHLH 5BJTA 3VXNB 2F8OA 1J11A 5EUKA 3BH9A 1YYLL 3QWQB 4DKEL 2A6KA 1T20A 4LSPH 1D5IL 3RWGA 1RUAH 4JPKH 1A9EA 3QH3B 3EHBD 3M1BA 4NN7C 1UA6L 4S1DC 3KPMA 1JMZA 1QA9A 1P69B 4MCYA 3GMNA 4U1KB 3RHWF 4C54A 5D1ZB 3B2UD 1JGDB 4RA3A 4QRUB 5GGSY 3CIQA 3ZDZE 4LU5H 3EYVA 2IGFH 1HOCA 4KJPD 2HT3D 3VXSE 2PF6A 3A67L 5IB1A 3IGAA 4Z7OE 1UJ3A 2FRGP 1BBDH 2FEEL 3SKMB 4WRLA 1IMHC 1P7KB 1INEH 3PP3K 3MV9D 3CMGA 3HE6D 3SKJH 3O8XC 1AQDB 3KLAB 4PJ9C 1KIPA 1I1RA 3MREA 5J11C 3SDYH 4OV6F 5IBLC 5IMMB 3EDFA 1S9VB 2HFFB 4ZFZB 5EU3B 4JFYA 5CJOH 2IANB 3O3AB 1MFAL 3QQ4B 4KUCD 4URTB 5EOCH 1F3RB 2YC1B 2F19H 5DQJB 3PWUB 4ZUWA 1C7SA 1I9JL 3ES6B 3MJGX 3MRBA 2X4UB 3ZL4H 4Y4HA 5HI5D 3DARA 3KG5A 4BA8A 4W4OA 2Y36L 5I1CH 3U7YL 5E1AA 5IR1A 5A2IH 4Y1AE 4C4KT 1YEDB 3OR6B 4ZDHA 3IJHA 1RMFH 25C8L 1CBVL 4KAQL 5IKCA 5JOPE 4I18C 3WFDH 3LPGA 3FFDB 2EC9T 3O0RH 1YNTA 5D5MA 3WKNA 3GHBL 2Z93A 3OAUL 3QFJE 5EO0A 1DN2A 5BCAA 3PWPB 1YNKH 2QR0A 5DEFB 4ZAKC 4HFUH 2EKSA 3IDNA 3SY0A 3P0VL 3ZSSA 3HS0A 1U91B 3MLTB 2PCPA 1FL6A 5E94A 4IDJH 2A73A 4JN1H 1JZ7A 4WNQA 4I5BA 3IXTB 4UOJA 1N5AB 1F42A 1GGCL 3BP4B 3OQ3B 4K94C 3S3PA 4ZFFA 3HG1D 1YJDL 3FTGB 3HMXL 4NKIL 4Y4FB 4AQ1B 2PR4L 3TA3A 1BP3B 3O3UN 5DRXA 4FN0A 1JPTH 3D69A 4P3WA 3GBMH 3RWCB 4JHBA 1IQWL 1MCEA 3BDYH 4S0SD 1MSPA 5A1AA 1P1ZA 3SOBL 4XNQA 1KXVC 2OXHA 2E8ZA 1VADB 3MC0A 1I8KB 4FQQA 1SEBB 1WC7B 4ZODA 1R3HB 4AL8L 4OLYL 1J8HE 1JV5A 1QFWL 1FGNH 3PDOB 3HUJB 3SPVA 1LMKA 3GSRA 3QXWA 1MWAA 3C8KB 1YPZF 1IC1A 3S5LG 2HT4D 5K59E 2XKSA 1ZLUH 3MNVA 4XMLL 3MLUL 4LOUC 2G9HB 5IT2L 1G0DA 1GYAA 4HK0A 2RR3A 1EEYA 1ADQH 3GHEL 4KZEH 1T7WA 5GJSL 2ZSWB 4JFPB 4DFIA 1XCQA 4PGDB 4Z76B 1E0OB 4WHDA 5HPOA 5FYJL 4RAUA 2XZAH 5BZDB 1IGJB 2DQCL 3T0XA 1FFPA 4KUCF 2Y5TB 1EPFA 2IPTL 1SYSA 4UBDD 3TJHC 1CTNA 1MQ8A 4N0UB 2RJMA 2WINA 1KCKA 2YD6A 5E2VL 3I3EA 3S34H 1PKQE 1L7IL 3KYNB 4ODWB 4PRIA 5KS9F 2BRRH 1PLGH 1T21B 5FIEA 3VWKC 3AC0A 2XN9E 1F2QA 1SVZA 3FQWB 3DXAB 2CR6A 3QUXC 5EUOA 1GAFL 3MRDB 3RI5K 2WWKT 5CUSL 2VZUA 2JJTA 4ZUSB 3QO0B 2VKXA 3DVGA 3KPOB 4IM8A 2YD2A 3GJEB 4YHIA 4QT5B 1P7QD 4P99A 4BZ2H 3C5JB 4ZD3L 4XWGL 3T04D 1D5XB 1JGEB 1S9XA 4L4TD 3LKSB 1V8HA 4TRPH 1ZHNB 3NCCB 4GW1A 3I2CL 4NRYB 1HQ4A 5DK2A 2EXWC 4LCWA 4FQCH 2I9LA 3HR5B 4PJ5D 2NY0D 2HT2D 2FR4B 5E5MA 4NBXB 4ETYA 7CGTA 4ZUUA 3NH7H 1E4WL 1H3TA 4C56A 5TH2A 1OGTA 3BP6A 3LN5A 3CFBB 4DOHB 3BH8A 1WBYA 3CUPA 3IU4H 1N2RB 4RMRA 1S7WA 1ZGLB 1LP9B 4PB0L 1IQDA 4RQQA 4LLQB 2DIJA 3TBSA 3VCLB 4ZYKB 1FH5H 4L9LC 1CICD 3ARDD 1NAKL 1RK0B 3PHSA 2BP3A 4Y5XA 2G5BB 3BGMB 4W81A 2JIXD 1LHZA 2EDYA 5BZWB 3WNKA 2HG5A 3KNBB 4M3JA 5JW4Q 2FHFA 1EHLL 4M8VA 1X7QB 3CFKA 5JQ6L 1I9IL 5CKAA 2VUOA 5I17B 2NY4D 4PJ7F 3PF2A 3VXPA 4WWID 1RUAL 1DANU 5FYJE 1W2KT 2ADJB 1IRAY 2IPKB 4JPKL 4BFGA 1C5DA 5E5UB 1FIGH 5LQBH 1G7JB 1JL8A 1AO7D 3ALPA 2IPUG 2KKQA 3P9LB 4FTVB 5E8NA 1W8NA 1XGTB 3QRFM 2B1HL 3N1QC 4LPXA 3S35H 3UDWA 1XGRB 4H1LG 3MJ8B 3AXLA 1QHPA 1NAMA 3EZJB 2DQDH 3PQYE 4YXKH 2IGFL 4JY6B 3B9KB 3VXMD 3IETA 4KH2A 1G9NC 3AMLA 1BBDL 2BHUA 3MJ7A 4Y19D 3LKOB 3EJZC 4LQ1A 1HDMB 5GSRA 4MA3A 4IDLA 2IAMA 5HDBE 1RZKC 5D2LB 3AU1B 4M61A 3HI5H 4JRXD 2EXYD 4YHOH 4YJZL 3CSYB 1YPZB 1IGFH 1SYVA 1FLRL 2O5YL 4ELKB 3BEVA 2F19L 5DJXB 1EUUA 3ZE1F 3OGCA 5BXFB 4GRLD 1X4XA 2YA0A 1WAAF 2H2SC 3VWJC 1E6OL 4JAMB 1JP5A 2Q7YA 3T4YA 3HE6B 2XWJB 5BVPL 1QACA 5ELIA 3BQUB 4LLUB 3L7FB 4F15C 4LKCB 3IF1A 1M7IB 4Z7VE 1KLUB 1P9MA 2PETA 1ZT1A 2DYPB 1I3GL 3QUYA 1AFVH 4NQCA 3UTOA 1KB9J 3IDIA 4Y5VA 4CVXB 3WFDL 1HYRC 1KB5B 2P8LA 3GB7A 5DD0H 5GRVK 1DN0A 4PV9A 3VI4F 4L8SA 5EOTA 4U1JA 2W60B 2GKIA 5JA8B 5A43C 2NY2D 3LRHA 4JO2H 1YNKL 4IIQC 4GSDL 3OKEB 4HFUL 3SDXB 1YECH 4TVPL 1RK1B 3CVHA 2BY1A 1OTSC 1XF1A 3TO4C 3KYMB 1KIRB 1AHWC 1SBSH 4IDJL 4PJFE 4WO4A 1R5IA 2W0KA 1RUQL 1HHHB 3UPRA 1EEZB 3B5TA 1T66C 3D0LA 1M4KA 3A0OA 5DD5H 1VA9A 3L7EB 5FA4B 3MYJB 4HKXA 1WISA 5B4MC 1ZEAH 1JPTL 2PYFA 3GBML 4ZOBA 1U8IA 3RZCB 4M5ZH 3BDYL 1DCLA 2YPKA 1JPGA 2AERT 2SEBB 4PPTA 1T2QH 5CZVL 1MEXH 1WWWX 3WXVH 4YDVB 4G8IA 4LPUA 4PGCA 4OUOA 1P4IH 1TJHH 4WI9A 4PJAE 1NEZA 2B4CC 3BWAA 4EN3C 3HG1B 3WS6A 1T1YB 1R3LA 4N5EC 5GRJH 2WBJB 1IAMA 1ZA3A 1ZK9A 1MFDH 4X9HA 3RWJB 1FL3B 3EJYC 4WV1B 3TZVC 1PSKH 3QNYB 2QSQA 4F33A 2V5TA 5I74B 4HKJA 1OGAA 3LKRB 1ADQL 4X7TB 2R15A 3C9NB 1EO5A 1I75A 5I6XB 1D9KD 3V8OA 5KANG 4JKLA 4H0IA 4YNYA 2BNRB 4HXBH 3HZMB 3RVXC 1NDGA 3V4VL 4N90E 3ZDXE 4S10A 3QCUH 5JXED 2PW2B 3GMRB 1WTLA 1VENA 4H25A 4MLIA 4S0TD 5D9SA 1ITBB 1CLOH 2DQFA 2C3VA 3M8OH 4J3VA 1KGCE 2I60H 2HH0H 8FABB 5JIPA 3S34L 1UM4H 1QSZA 1CG9A 3EOBA 3TN0C 5ICXA 3FFCB 1PLGL 5MENA 1K8DA 3U30B 1OW0C 5H2BB 3L1OL 4XBPA 2PO6A 1U41A 12E8H 4JFEA 4POZD 3TYFB 1AQKH 3S35X 4X6FA 1RI8A 3VW3H 2MNUA 1IKFH 4KJQD 1H15B 2XICA 3SDDA 1EAJA 1JGLL 1SJHB 4TVPE 3MNWB 4UAOB 3M17A 4BZ2L 5K9OA 5JDSA 1U9KA 4QRSB 2F15A 4EUPG 4TRPL 3V4UH 5D7JA 3BGFB 4E41A 3ILPA 2PYED 5E7BA 4ZPTB 2GFBA 2P48B 4N68A 2NYYD 4UV7L 5IHUH 4FQCL 5C70A 1IC4H 1I1YA 5FXCH 5DS8A 1Y6MR 1A7QH 1CDYA 2P5WE 1DL7L 3MTRA 4LMQE 3NH7L 3H9HB 5DJZA 4LHUB 3FB7A 1QUNA 2UZXB 1HCVA 5KSBF 3U4AA 3ME0A 2P8MB 1FZOB 3MCG1 2BMKB 3DGGB 4CVZA 5I76A 1RURH 2OSLA 3EYUH 4KV5E 1MFNA 4LDEB 4K9EL 3RQ3A 4OGYL 3D39A 1ZVSB 1CFNA 4O9HL 3VE0B 1EBPA 1Y18B 3PHQB 3T4AB 4OD1H 1FH5L 3O3DA 2VERN 3DRQA 4I48B 4GMTH 2NY0B 4Y16A 4G9FB 1ZHBB 1YYMH 2VLRE 4ZS7H 4K23L 1RUKH 2F53A 1VACA 2R1YB 3HAEB 1FVEA 4PYGA 3H6JA 2AJZA 1F3DJ 3ZSTA 2I9TA 5DGQA 3ARBC 2QV2A 4WI5A 3WFHA 4F80A 2VDMH 1BF2A 4XXDA 2EH8L 4P3DB 1WSST 4YHPA 5F7FA 3C8DA 3G08A 2RB8A 4LCCC 3KDMA 4HUWB 3OR7A 1L6XA 1V3LA 5D7LD 3GSVB 1QFHA 3WJLC 4F8QA 5JW4R 4WJ5A 1NJ9A 3AS1A 5K9QG 1MHHA 4JFDD 5F3HB 5C8JB 2M2DA 4H8WH 4PREB 2HAZA 2DQDL 3SCMB 3N0PB 4MXVF 2EYSB 1DVFC 1EZVY 3T3PE 1CGTA 3WJJC 4HHAB 3NAAL 5J56B 1XAUA 2NY4B 4G7YH 4OIAA 3U6RB 3LMJL 5DQDL 4NC1E 4QHUB 1JRHL 2VXVH 3QDJA 4FZEH 4MAYD 2IFGA 4W6WB 1AO7B 1N64H 5KVDH 1JVKA 3JTTB 3VXUE 1NCDL 1QR4A 5BQ7A 4NZUL 3HI5L 2ICES 4RISH 4YHOL 3KPSD 4LVNB 4PRHA 4MJID 4LDLB 5SWSE 1IGFL 3BZEB 2MCPH 1DBKH 2AK4B 4Z95L 3QJHB 3OKLA 2C1PB 3VXMB 3MLYL 1FV1B 3CMOH 4ALAL 5FF6B 4O2CA 1AKJD 1OSZA 3H42H 3MGOB 4MXQD 5HVWA 2EDBA 1DANT 3WEXA 4Y19B 5FUZL 5TE6L 5MI0C 1XT5A 3ZTJG 5DSCA 3T2QA 4F37K 4ODVH 5EPMB 3I9GH 1G7LB 4OZIF 4GT7A 2X9YA 4XVTH 3IJYB 2VDLH 4BZYA 3OG4B 2X1OA 1GJIA 3IXAB 1A4JB 5CD3A 5IQ7H 5DD0L 4F9PC 3O4LA 4EEEA 3AS2A 4NHCH 2X1QA 3QUMB 3IFNH 3QXVA 3S37X 1O7VA 5F7MC 3WUWB 2XZCH 5CKGA 5EZLB 4YHZH 1DQTA 3OF6A 4G42A 1TQBC 4OLUH 3IAQA 4OCSH 5F71A 5I0DA 4FQIH 4NZRH 5DJ2A 5DD5L 1GGYA 3VGAB 4S2SB 3TJEL 4Z77B 1J0IA 2UWEF 1G0YR 1X6LA 4F57L 2NY2B 3PABB 3ZKXB 5T5FH 4K7PH 1JK8B 4OFPA 1T2QL 3D85A 1IZJA 4H20L 3WXVL 3BKMH 4KVCH 3VFUB 4HWEH 1VERA 2ORBH 3GBNH 5HGBB 5I8OH 3ZKNC 1P4IL 5KSUB 4PJCB 2F8VA 3SGJC 4NQVA 1S7UA 3HMWL 1B6UA 3QDMA 1FGVH 1UB5B 1INQB 3B9EA 3D87B 5ANME 1FVCB 3NABH 3SBWA 1PSKL 1FN4A 3C2AH 4BKLB 3BHBA 4D8PA 1RZIB 1KNOA 3C6LA 1AXTH 5TQ2L 2D4FA 2OR9L 3STZA 4JFZH 2E6QA 5JHDD 5KS9E 1BFVH 4OZHF 1TVDA 2V2XA 3RNQB 3QWRA 3QIBA 3G04A 5TE7H 3M8OL 4XMPH 3T0EA 1YEGH 4M48H 1QSFD 5AYUL 4DFHA 2Z31D 3SN6N 4X6DF 4WFGE 4HGMA 5K33A 1CXEA 4RRPG 3GMOB 1WIPA 3S37L 2I27N 4JDVB 1AQKL 4BUGA 5EZJA 2W65A 2X4QB 5D2NC 5EA0H 1IKFL 3Q6GH 3WD5H 1U8QA 5AG8A 3F7YA 3W11C 1IAKB 4P5KA 5EC2A 3LQAC 2CK2A 3BVNB 4MD5A 2QADD 5SWZB 4QTHA 4U7KA 3D9AH 4NSKA 2VL4A 3LRGA 2OZ4H 2NY1C 4LCYB 2H9GB 4J1UB 3CSPA 4WFFE 1A1NA 1T7VA 1FO0H 1PY4A 1FC1A 4WU7A 4FQ1L 3D3VA 3QT2A 1KPVA 3AM8C 3RVTD 5LBSH 3WO4B 2NXYC 2VLJA 1A7QL 3UBXG 3VI3F 4XWOD 1NC2B 3H8NA 4M8QB 3T65A 3VD7A 1HI6B 2OMBA 3GFUA 5HPMB 1FNFA 4UUJB 4CDGC 3EYUL 2BNQE 5HI4C 3TWCH 5A3ID 5IV2A 1WJ3A 1JGVH 1INDL 1MPAH 4OD1L 2X1WL 3VA2C 1XF4A 5KW9L 5ERWB 4PJ7E 3HZYA 5E6ID 5LAXB 3PJSB 4GMTL 3RTQB 3RKDC 1TVHB 2X4SA 1BQHA 2MKLC 5C0AE 4TSCL 5D1XD 3IRZA 1YYML 4MNGB 1KYOJ 2XPGB 3B4NA 3G6JF 5FUOH 2JJVA 1P84K 1D5BB 43C9B 4HC1H 4L4VB 1CYGA 2VDML 3RL1A 1IEHA 2R4RL 4G6FD 1IL1B 4NQEE 2GJZA 5A2JH 3WMSA 4IRSA 5T1LA 4HF5H 1NH6A 1BLNA 2UVEA 4OD3H 1G6VK 4M1CD 2ICEB 5L7XL 2I25N 2ED9A 1F6AB 3UO1L 1FFNB 3KHOA 3MUHL 4ZUVB 5GGVY 2UWEB 4R4BA 1LEIB 3KPQB 4WWKB 2GI7A 2BNUB 1SHMA 5JLZA 2QQKH 4Q0XH 3VMNA 5E2UH 1YEHL 2DQJL 1CE6B 1F4WL 3VD3A 2P7TB 4FG6C 4WI3A 4Y0GA 3MRMA 4JQXA 5HVFB 3L6FB 2VXVL 2IJ0C 4FZEL 3ZE1E 5IB4A 1GPOL 2ADGB 1HNGA 3LKNB 3BP5A 1I7TA 1WAAE 2PTVA 1NCNA 1N64L 5D7LB 5KVDL 3CLEH 4X4XB 3O45A 5GGRA 4RISL 1IEBB 2DQUH 5KN5B 1DE4A 4XBEH 1ZMYA 4L4TE 1DBKL 4L3EB 3EBAA 5CHNA 3P4LA 1F11A 3SJVE 5IG7B 3AB0C 1UZ8A 5T1MA 3PWLB 4X5XA 4M00A 5FB8B 3MRLA 3SDCC 4GQPH 1YEIL 5DJ6A 3KLHC 4K7PY 3FB5A 4MAYB 3VI4E 1H5BB 4YXLH 5TF0A 3VFSB 2AVGA 1U42A 3DLQR 3BX7C 3RNKB 3T0VA 4EI5C 2R2EA 1OTUD 3KPSB 4JPWH 4MJIB 2VDLL 1ZS8A 4OKVB 2PNDA 3AMKA 3L3DB 1MJ8H 1DEDA 1DQQB 2D7NA 2GTZA 2XQYK 4RGND 1FC2D 3P9MB 2Z4QA 1I1AD 1XFPA 1AKJB 5HHNA 1ZE3C 1N6UA 3NFPA 4NHCL 4UDUA 5FOBA 3L9RB 4DW2H 2I5YL 4GS7C 4HCRH 3WXWH 3IDYC 5D7IB 3PGDB 3WN5C 5L2JA 5GSVB 3I50L 4NZDA 2Q76A 2VXUH 3MODH 4Y8DC 4K8RH 3VA6A 4PV8A 2E7MA 3VFGL 2FX8H 1JBJA 4XNYH 4OV5A 1DDHB 4QGTA 3VFPA 3ZKQD 2V5YA 4YFDB 2A6JB 1H9VA 3AY4C 3DUSB 1I3RA 4OCSL 4IS6B 4F7MB 2DLHA 2ICWI 1M6OA 1JZ3A 1HYSD 2IH3B 4FQIL 1ZANL 4NZRL 1GZQB 4JZJC 5CGTA 2DLIA 2Z8RA 5F72S 1NL0L 5T5NF 3QQ3A 1YZZA 4QHKJ 1UQSB 5T5FL 1FSKB 4TTGA 1OOAA 3WE6B 4HH9A 2FSEA 3EDJA 2ITCA 1SMOA 4XNZB 3SGKA 5HGHB 1MCKA 5I71C 1DEEA 2ATKA 4NQDB 3UTZB 2YA2A 4NJAH 4NQXB 3VFTA 2ORBL 2XRAL 4Y4KC 2VITA 1UZ6E 3W82A 2VWEE 4KK6C 2J6EH 4PGZA 1KULA 5F7HA 4I0PB 1LQSR 4RMUA 4PJDB 4UQ2A 1FGVL 3TBYA 5C0GA 4HAGA 1MCQA 4PBVC 2PXYD 1EFXB 4G8EA 5T1KB 2LFGA 4OD2A 3DV6B 3VXTA 3BJLA 5JIKA 4JDZB 5AZEH 3HLAA 4MA7H 5F1SA 4X4ZA 1AXTL 3DI3B 5JZ7C 3MJ6A 3P4NA 3KPPA 5JW5A 2BOCB 2WQRA 4JFZL 3G6JB 4P5MB 4YQXL 3BPLC 3OJ2C 2F74A 1BFVL 4PRBB 1KTKE 3H2WA 4AT6A 2CKBB 3Q3GA 3LQZB 2IALB 1KJ2B 2CRMA 2AV1B 1E28B 1T1ZB 1VFAA 4HLJA 4EXPX 1OAKH 4DZBA 3CFJB 4XMPL 1YEGL 4M48L 2HWZH 4PJXB 1QRKA 3TBVB 3FONB 5KOMC 4F3FA 3O8XA 4JQVC 4J2XA 2VR9A 5CZXC 2VE6A 3QFJA 2YN5A 5EBMA 1EGJH 1CXKA 1KJMA 1TTGA 4Y5YC 4CUCA 4UOW0 5JHDB 3GI8H 5DYOB 4W68A 2NX5A 2MSPA 1CQKA 3L95A 3Q6GL 1I85C 4G8FA 3LSOB 1MCWM 3UP1A 1QG3A 1BZQK 1W72H 2VZOA 5DRWA 1QSFB 4OI8A 1PZ5B 1WIUA 1MHCA 3STBA 1WWAX 4QF1B 2GY7B 3IFPB 2DS4A 2OZ4L 3VFOA 4HUVA 2XTJC 1VDGA 1ZWIA 4M9OA 1FO0L 1B88A 2ITDB 1BFOB 3RA7L 1H3XA 4HJJH 2LE9A 1NSNH 3U82B 1MAKA 1OAYL 3GSWA 3DTXA 1K4DA 3L3HB 5C0EA 1KBGL 2VR4A 3NTCL 3ECBA 1QLRB 5GS0C 2X4TA 3T2PA 5HBBA 1J8HA 3DIFA 1W72B 4UNVA 2P5EE 2FBJH 4PYHA 4M7KH 3AFLA 4YO0A 3GJFK 1NMBL 2BXZA 2FH6A 1HHIA 4OF0A 3TWCL 3TFKD 4JO1H 1G7PB 1JGVL 3PGFL 4B7IA 1DBJH 1PQZA 3NCEB 3SE9H 4YK4C 3QIUB 2YZ1A 4NT6A 3H9ZA 1NFDA 5DJ8A 5DHYA 4BK4A 2D7PA 3BKYH 1VGKA 3GSQA 1MFEL 1MLCB 1Q9LA 3EFDH 3KHQA 3HRZA 2BSTB 3N9GH 2JCCF 4NWUH 1KN2H 3O2WH 3MSPA 5IROC 2ICWB 4E5XA 1A6AB 4KXZH 4M1GL 2ADIB 2MPAH 3X11B 1NBZA 2V2TA 1PKQA 4QRRB 4FQJL 2FJHB 5BVJB 4GKZB 4F7PB 3KJ6H 1A1MB 2XN9A 5SV3A 3ZKMC 5DR5H 3A6CH 4KRMB 4OD3L 5I8EA 3TYGH 1MRDH 4EOWH 4F8TA 5HHXH 2CDGA 3B6SA 3T2OA 1BD2B 1S9WA 1W0VA 3KXFB 4MNQB 1WZ1L 5ENWA 4WHTA 1ES0A 1K2DB 1XGYH 2H32A 4ELMB 2A6DB 2QQKL 4OSUH 5E2UL 2UY6A 4BH8A 3N1GC 4M1DL 4G6FB 2Z92B 2A74B