5GROA

Crystal structure of the n-terminal anticodon-binding domain of non-discriminating aspartyl-trna synthetase from helicobacter pylori
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
103
structure length
103
Chain Sequence
b'RSHFCTEISEKDVGKIVKVAGWCNTYRDHGGVVFIDLRDKSGLVQLVCDPSSKAYEKALEVRSEFVLVAKGKVRLRGAGLENPKLKTGKIEIVLEELIIENKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartate--tRNA(Asp/Asn) ligase
publication title Crystal structure of the N-terminal anticodon-binding domain of the nondiscriminating aspartyl-tRNA synthetase from Helicobacter pylori
pubmed doi rcsb
source organism Helicobacter pylori 26695
molecule tags Ligase
total genus 22
structure length 103
sequence length 103
chains with identical sequence B
ec nomenclature ec 6.1.1.23: Aspartate--tRNA(Asn) ligase.
pdb deposition date 2016-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01336 tRNA_anti-codon OB-fold nucleic acid binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5groA00
4X66Q 1N8RC 4EQ5A 2Y0SE 1M1KC 1Q7YC 3L0OA 2E5LL 5IWAL 4JI1L 3RZDH 3AFQA 5EAYA 4DR5Q 4A76A 1Q82C 3T1YL 2HHHL 5J3BA 5IYDG 1KC8C 1T9HA 3GD7A 3DM3A 1B70B 1EUJA 4AQYL 5M3MH 3HOZG 3JAMi 1VQOA 4A3KH 1I94Q 4JBMA 4LF9Q 1X55A 2MO1A 2CFMA 4L5TA 1K83H 4X6AH 3D0FA 1VQBA 4IJHA 5LMUQ 3S1NH 1I6HH 4QGUA 1HZBA 2R7DA 4BY1G 2NVYH 3GTGH 1QUQA 1VQKA 4HJ8A 1AE3A 1GKHA 1X54A 5IYCG 2JA9A 4C3JH 4QIWE 1YNXA 3T1HL 1J6QA 3CD6A 1VQ6A 1UE1A 3HFZB 4DPGA 2R93G 4YWMA 1K3RA 1OXVA 5IYBH 4C3IH 1YIJA 3S16H 4A3FH 4DKAC 5IP9G 4IO9A 3T1YQ 3M4PA 1LM0A 4YWLA 2HHHQ 1U5KA 1CKOA 2WB1E 1QVGA 3NELA 4JI5L 3U4VA 1KQSA 3W5OA 4A93H 3KDFA 5AJ3Q 1H95A 4YY3L 5GADC 1IBMQ 3STBD 1HNWL 3GTLH 1Y1VH 4AH6A 4A3MG 2JA8H 3HOUG 2MFIA 3OTOQ 1FJGL 1NMFA 2BH2A 1CKMA 3S2HH 4WJ3M 4A3EG 1YZ6A 1K73C 1PH5A 1WI5A 1EFWA 3PUXA 1IBLL 3PIOA 1Q46A 2NN6G 1YJ9A 1TWHH 4R4OA 3ZJYC 4DV5Q 2R92G 4JYAQ 5GQOA 1QVFA 4POFA 1LUZA 1VQDA 2RF4A 5GAHC 2R7ZG 2LXKA 5IP7H 2OCEA 3TS2A 1KXLA 1OXTA 3CCLA 1SR3A 4A3JG 3S1MH 4YCVA 4BA1I 3K0XA 3I4NG 1C0AA 3TRZA 4A3CG 2K4KA 1G6PA 5IE8A 3CC2A 3KJPA 4A3DG 2IX0A 2DUDA 1G51A 1X3FA 2IHFA 1QVCA 4JOIA 3VDYA 4DUYL 5H1SE 1PH8A 3HOWG 3RNUA 4GLAC 2BA0A 1UE5A 4JI8L 3JC66 3PIPA 1IYJB 1NBWA 3SGIA 2B3GA 3HOXH 1A62A 3EN2A 4DV1L 2I0QA 4LFBQ 4OONA 1MJEA 3BJUA 3M4QA 5ELOA 3GTOH 3NBHB 4WJ4A 3ULJA 4HJ7A 1J5EL 2YYZA 3H3VI 1YVCA 4B3RL 4OO1I 4LNQA 2VS1A 2ZM6Q 3DLLA 4PZ6A 2KCMA 1VQ5A 4JI0L 1VCIA 4P73A 2XGTA 3J7ZC 4A3BH 2ZJRA 4GOPA 3FKIH 2QEXA 2HIXA 1UE7A 3UDIA 4DV6L 2ZTDA 2UUAL 2YU9H 4A3GG 4BBRG 1D7QA 3J81j 1WCMG 2IT1A 1Z9FA 5GAGC 3UE0A 3J81i 3A5UA 3M3YH 1KRSA 3M85A 3J80c 4Y7NH 5M5WH 4DUYQ 2KCTA 2WFWA 3HOYH 4KHZA 3UDFA 4LFAL 3KDFB 4GS3A 4X66L 4B3MQ 2A8VA 3K8AA 4JI2Q 5IY0A 3F2DA 1X56A 4IPCA 4DR5L 1PH1A 1TWCH 4KLKA 4LF4Q 4OX9Q 1CUKA 3FP9A 2NVXH 3I7FA 3PO2H 2JA7H 2NN6I 4B3RQ 3GDEA 2PI2A 2ID0A 1A63A 3A5ZB 4JI0Q 5IT9c 1QZHA 3STBC 1P8LA 1L2FA 4YCUA 2VW9A 2DGYA 5M3FH 4UPAA 2YTYA 3BU2A 1I94L 4LF9L 5JEAG 1PH3A 3ERSX 4PZ7A 4P74A 1Q1BA 4OXPA 5FLXc 2VQEQ 5LMUL 1N36Q 1I3QH 1VQ7A 2UU9L 1BKBA 4A3IG 2NVQH 2MQHA 4KHPQ 5IYDH 4DV7L 5C44G 2B63G 2CKZB 4JBKA 2N78A 2QA4A 4X65Q 1EWIA 4DK3C 2ZJQA 3BZKA 4LW1A 4B3TQ 4QJFA 2RHSB 1E24A 3PO3H 5JEAJ 2BH8A 2CCZA 1XTDA 1N34Q 1E3PA 4DAMA 1HJPA 3NENA 2R6GA 3PV0A 3A74A 5AJ3L 5IYCH 1IBML 1EIFA 4HIOA 5FLMG 1IXRA 2CWAA 1UEBA 3H0GH 1GO3E 1HZAA 3KJOA 4HIDA 4HIKA 2R93H 1LTLA 3OW2A 3EIVA 3S1RH 1IBKQ 3OTOL 3KF8B 4X62Q 3PF4A 2UU9Q 4C2MH 5IP9H 3GO5A 2CWPA 3PUWA 4IPGA 4DV7Q 1KIXA 4OO1G 1VQNA 5LMNQ 3I4OA 4JCVE 3UDGA 3M4OH 1NMGA 2VL6A 3E9HA 4DV5L 4JYAL 3MXNB 4GN5A 1OTCA 4LF8Q 1SROA 4R4QA 4NXNQ 3I4MG 4A3MH 2A1AA 1VQIA 3CCVA 1OXSC 3CF5A 4DR7Q 3GTMH 4MZ9A 1XMOQ 4LWCA 2OTJA 2GVBA 1XNRQ 2D0OA 1OXXK 2AMCB 1LYLA 4BA2I 3RLNA 4DR4Q 3OYYA 1MKHA 2AHOB 1VQEA 2CQOA 4NPSA 1L0WA 1XJVA 2N3SA 2R92H 3CPWA 1YITA 2R7ZH 3WWVA 1AE2A 4LUZA 1O7IA 2KENA 4A3JH 3PF5A 4DR1L 1W2BA 3AQQA 2E2IH 4LFBL 3I4NH 5M3MG 4DR2Q 1YI2A 1E1OA 1NJIC 3S1QH 4HJAA 3KYHC 2QGQA 4A3DH 2Q2TA 3U50C 3HOWH 2PI2E 2ZM6L 1JE5A 4BY7H 4R4CA 4LF6Q 1NTGA 1C7YA 5C3EG 3S24A 2AKWB 1V1QA 3B6YA 3E9IA 2UXDQ 3FHWA 1PVOA 1K0RA 3I56A 3F8TA 3CCMA 1Q86C 2V1CC 4IJLA 4DAYB 4MTNA 1BVSA 1PFSA 2H5XA 4H02A 2RCNA 4UP8A 5IYBG 2F4VL 1KD1C 3KLWA 1B8AA 2OQKA 3PUZA 4JOIC 1CSPA 5M5YH 1YEZA 2Z6KA 4BXXG 4B3ML 4POGA 2JE6I 4DR1Q 4JI2L 3K7UC 2R7FA 1NE3A 1E22A 4JI6Q 4P72A 4B3SQ 4LF5Q 1BBUA 1WFQA 1N9WA 5C0XJ 1N33Q 4A3GH 3JAMc 4GKKL 1IZ6A 1Y1VG 1E7ZA 1WCMH 1ASZA 1YBYA 4LF4L 4OX9L 2MO0A 1QZGA 2ZTEA 2RHQB 2FXQA 5BR8Q 5HGQA 2K5NA 4QY7A 4XTCS 3GTKH 2JA6G 5JJLA 1QUQB 4EX5A 4DUZQ 5FJ8H 5ELNA 5C4JH 3HKZE 3HKZG 4GOPC 2JA5H 1N36L 4PZ8A 2VQEL 1S72A 1PA6A 3PUYA 4KHPL 4GN4B 3CCRA 1L1OA 4R4IA 1Y1WH 4BBSH 1L1OC 2PQAA 4A3LG 1GM5A 4JG2A 1XPRA 2F4VQ 1Q1EA 2F3IA 1A0IA 2GN5A 4PG3A 4X65L 2OTLA 2UXCQ 2JK8A 4B3TL 4O0AA 4UP9A 2E2HH 2VY3A 3EBEA 4JBJA 4DV3L 3I2ZA 4DV2Q 2K5HA 1N34L 1VQMA 2C35B 2ATWA 3CC4A 3GTJH 4A3IH 4GKKQ 4JBWA 1XMQL 2UUCQ 4OWXB 1Q81C 2ZTCA 4GNXA 2IY5B 3A0JA 2WAQE 2WAQG 4GNXC 1S40A 2Q2UA 4OWWB 4IFDJ 3HOXG 5JJIA 4JI3Q 3IRBA 1P16A 3CAMA 4JI7Q 2A19A 3K7AH 1PH6A 4YHHQ 1IBKL 1VQPA 3AEVA 4TQUS 4X62L 2K14A 1YHQA 4K0KL 1I5FA 2E2JH 3Q8DA 4LFCQ 4C3HH 2YTXA 4A3BG 1R9TH 1C9OA 5LMNL 5C4XG 1KHIA 4GKJQ 2I5MX 4UY8C 3S17H 3FKIG 4HJ5A 4LF8L 2ASBA 3HOZH 4HIMA 5FLMH 4NXNL 4JI4L 4XIGS 1VQCA 2EXDA 2UXBQ 3AYHB 4DR7L 3HOVG 4DV3Q 1XMOL 2F52A 2OWOA 4NXML 4LUVA 3G4SA 1XNRL 4GLVB 2YV5A 4DV0Q 2L15A 1RL2A 1XMQQ 3H3VH 3ULPA 4DR4L 4AIMA 4DR3Q 4RMFA 4BY1H 3ICEA 1GD7A 1JB7A 3TEHB 1TXYA 3CW2C 3J7A5 2JEBI 3S14H 3I4MH 2K75A 3KOJA 1K8AC 2UUBQ 4NB3A 4YCWA 3H15A 3G6EA 3KF6A 3U58A 1K9MC 2HT1A 4K0KQ 2PNHA 4GOPB 4DR2L 2K50A 2Y0SG 3NEMA 1HNXQ 3PSIA 5M3FG 1SN8A 3CP0A 3K80C 1KL9A 2KBNA 5E7NA 1L1OB 3CC7A 2PQAB 3CCSA 4LF7Q 2VUMG 1N32Q 1G291 4LF6L 4JI4Q 4IFDI 4L5QA 3J81c 3HOUH 2Q2HA 5GAEC 4IOCA 4NXMQ 2UXDL 1W3SA 3U4ZA 4A3EH 4O2DA 1VQ4A 1HNZQ 3RZOH 2E8GA 2HIVA 4DV4Q 1EQQA 3W1BA 3S15H 5DLQE 1PHJA 3CCEA 3RN5A 2N49A 3PO3G 1VQLA 2KHIA 4JC0A 4KI0A 1XNQQ 4DK6C 1BBWA 2VQFQ 4GNXB 1FL0A 4P75A 1PH2A 1SMXA 1VQHA 1HZCA 3M7NA 4X64Q 5C3EH 4JV5Q 3PCOB 3G71A 4JI6L 1UE6A 1SRUA 1WYDA 3PUVA 1S3OA 4QL5A 1HR0L 4B3SL 3L7ZC 1MJCA 4LF5L 1X3GA 1N33L 4HJ9A 3I55A 3H0GG 1D8LA 2KHJA 4A3CH 3ULLA 4TVAB 1X65A 4UP7A 5LMNW 2N8NA 1VQAA 1V9PA 3CQZH 4A3KG 2E5LQ 1FGUA 1CKNA 5IWAQ 1V43A 5HY6A 3RLOA 5BR8L 3J80i 2IX1A 1VQJA 4JI1Q 1XPUA 1M90C 2NVTH 1AH9A 4BXXH 1X9NA 2MNAA 4ME3A 4GLXA 2WB1G 1SLJA 3K81C 2BA1A 4P71A 4DUZL 1VQ8A 4DR6L 1RIPA 1EOVA 3PGZA 4AQYQ 1VQFA 3GTQH 1PYSB 2D0PA 2NZHA 3MEFA 1YHBA 5C0XG 1HZ9A 1K8GA 3HKSA 2ALYB 1EYGA 4A3FG 3ER0A 1PV4A 2IHEA 2UXCL 1OXUA 3F1ZA 1DGSA 1Q12A 2JA6H 1YHAA 2Z6KC 2NZOA 2LSSA 3S2DH 4A93G 4YWKA 4RG1A 3RLFA 1HR0Q 3AFPA 4DV2L 1XPOA 1SFOH 2JJQA 1TWGH 1UWVA 1X3EA 4ALPA 1CSQA 4AYBE 1NY4A 4AYBG 4BBRH 1KAWA 3CCQA 3T1HQ 2UUCL 4A3LH 2D62A 3KF6B 3CMAA 2JA8G 1E1TA 4JI3L 2YTVA 1PH9A 4APVA 3KFUA 2PMZE 3L2PA 3CCJA 4JI7L 4GN3B 3UE1A 1U0LA 4JI5Q 3TREA 4YHHL 4DR6Q 3F2CA 3RN2A 1YJNA 4YY3Q 1HNWQ 5JJKA 1A8VA 4LFCL 4BY7G 5IP7G 1FVIA 2OQ0A 2EQSA 1FJGQ 4GKJL 1X6OA 4A4IA 1VS0A 4R1JA 4IFDG 1PH7A 4FDBA 1IBLQ 1TWAH 4OWTB 1WJJA 1Z47A 3E0EA 3CMEA 1EIYB 4L5RC 2UXBL 1ASYA 1HR0W 1PH4A 4DV0L 4L5SA 5C44H 2B29A 2ZJPA 5C4XH 3CCUA 4DR3L 3RR5A 2B63H 1EQRA 2K5VA 1WOCA 5GROA 2VNUD 3M9BA 4IPHA 1JJGA 1B7YB 2LXJA 3LGJA 1CKNB 1Y14B 3W1GA 2UUBL 4LUOA 3HOVH 2I5HA 4IOAA 2GVAA 5K36G 3D31A 2ES2A 2EIFA 4JI8Q 1JJ2A 1KRTA 1JMCA 1HNXL 5FJ8G 3TQYA 1IL2A 1PYBA 4A75A 5C0XI 4DV1Q 2JA5G 2AWOA 1SE8A 4IPDA 3GTPH 3CXCA 1I50H 4LF7L 3CPFA 1N32L 4PMWA 4MNOA 1YJWA 1Y1WG 4BBSG 3BZCA 1J5EQ 1TWFH 3UDXA 2JQOA 1HNZL 1GVPA 1Q8KA 3HOYG 2AWNA 3TS0A 4DV4L 1VQ9A 4QQBX 4J15A 2VZAA 1JT8A 4DNIA 1XNQL 4DV6Q 2HQLA 3G48A 2VQFL 2UUAQ 2Q2IA 2VUMH 4Y52H 1VQGA 2Z0SA 1MIUA 4X64L 1JJCB 3F2BA 2JEAI 4JV5L 3PO2G 2JA7G 2XTIA 4R4TA 1HH2P 2K52A 2WP8J 5M5XH 4LFAQ 2I5LX
chains in the Genus database with same CATH superfamily
5D3IB 1N8RC 4EQ5A 2Y0SE 4FF3A 3GV6A 4M1UB 1Q7YC 2E5LL 2B2YA 1HTPA 1T9HA 3GD7A 2QDLA 5TSSA 3HOZG 5JPNC 2DJFC 3D0FA 1I6HH 3S1NH 3QWNA 1HZBA 2NVYH 2F0FA 4ZUIA 1VQKA 1PTOB 5ISRA 1GKHA 2L0CA 1V1PA 3T1HL 1J6QA 1DOKA 1VQ6A 4DPGA 2L5TA 3S16H 1WTHA 4LAAA 4C3IH 4A3FH 4DKAC 3GTMB 2L9HA 1KDCA 4IO9A 3M4PA 1LM0A 5E1FA 3T1YQ 4A3EB 4DNRB 1QVGA 2WB1E 2Z1CA 3RZOB 3NELA 4A93H 2EY6A 1H95A 4YY3L 1HNWL 3STBD 1QOHA 3GTLH 1A3TA 4ZKCB 4A3MG 3X3NA 3WOFA 2MFIA 4NDXA 1NMFA 2BH2A 1CKMA 3LWEA 1F9RA 3S2HH 1YZ6A 1K73C 1PH5A 1QCBD 5KNCA 2NN6G 2PNRC 3A7LA 1TWHH 1GUWA 1ICWA 1CHPD 2EXZA 4KN4C 1IHZA 5GQOA 3ZJYC 4FYDA 1O78A 2RF4A 1KXLA 2JN4A 5IP7H 4IUQA 5CV5A 4BA1I 1C0AA 1QJOA 1GHJA 1HA5A 1G6PA 3C1FA 2EYMA 3GTQB 5L37A 3KJPA 2IX0A 4KY7A 4R8NA 3A8IE 3HOWG 1BDOA 1LT6D 1DZ1A 3PIPA 1IYJB 1NBWA 4DV1L 4LFBQ 3EN2A 4M8AA 3M4QA 4WORA 1SFOB 5CR3A 5JVH3 2YYZA 3H3VI 2A68D 1SNQA 4PZ6A 4FF4A 5C3XA 4A3BH 3J7ZC 1V1PB 2K05A 1F2LA 3URYA 2QEXA 2ZTDA 1QWYA 1EYAA 3SDZA 3BDOA 3OOCA 5FKAC 1G6ZA 2VB3X 3M85A 3J80c 4Y7NH 5M5WH 2J7ZA 4KHZA 4LFAL 2JXMB 2EJGC 2A8VA 3K8AA 5IY0A 4G7HC 3K5OA 1PH1A 1BUVT 4KLKA 4LF4Q 2NVXH 3I7FA 5CC4A 2B63B 4MIUA 2PI2A 1WTXA 1ESRA 1FYCA 2Q8RE 1A63A 2XVSA 1F2ZA 4JI0Q 1QZHA 3OSOA 1L2FA 2VW9A 2DGYA 1DCZA 4K5WA 5JEAG 3ERSX 4PZ7A 4P74A 4OXPA 5FLXc 1SMYD 4KHPQ 4DK1A 2MQHA 5IYDH 4DV7L 5C44G 5E4XA 3PIO3 2EZVA 4JK1C 3J81E 2O4XA 4DK3C 4B3TQ 3BZKA 4LW1A 1NR4A 2AUKA 4OIKA 1GUTA 4FO2A 3VR2A 1U4RA 1N34Q 1GXDC 1HJPA 2MPMA 4ABNA 1JE4A 3ZYYX 4EQNA 1DD2A 5IYCH 2JYOA 1IXRA 2XN9C 2R93H 2P5ZX 1IBKQ 1QE6A 4X62Q 2UU9Q 5IP9H 4G4KA 1EY6A 5I4DA 5C4HA 5F2DA 1KIXA 4OO1G 3UDGA 3E9HA 1F77A 4LF8Q 1SROA 4R4QA 2NZ1D 1PFNA 3I4MG 2A1AA 3GTMH 1HFNA 2GVBA 3QJYA 3OWFA 3TDQA 5BN4A 4BA2I 3RLNA 2F0KA 3OYYA 4DU9A 2K32A 3FEWX 3S15B 1PRTB 1MKHA 1L0WA 4CBVA 4NPSA 1K83B 2R7ZH 3WWVA 5KNBA 4DR1L 2B39A 4LFBL 2TMPA 5CGKA 5JJZA 4HJAA 4A3DH 3CQZB 1JE5A 3C2PA 1C7YA 5C3EG 2HD3A 3FHWA 2F0TA 1I4XA 2V1CC 1MD2D 1TS5A 2EPBA 1BVSA 1PFSA 1S5BD 1JWMD 1Y1VB 2RCNA 1EY9A 4UP8A 4C3IG 1KD1C 1I4PA 3L9AX 4BXXG 2Z6KA 1DONA 2A73B 2JE6I 2PMZB 2JA6B 2CQAA 1HQMC 3IAYA 5C0XJ 1D6EC 4MTKA 2MP1A 3HKZB 3M4YA 1IZ6A 2KECA 3DUZA 3HS0C 4LF4L 1S5DD 2EY2A 2ZTEA 2O5IC 4UAIA 4K8IA 5IGBA 4IUUA 4U68A 1QUQB 4EX5A 3GP7A 4DUZQ 5EJWA 1SNPA 2F3VA 2RCFA 3QOLA 3KK7A 3PUYA 4KHPL 1RD9D 1X32A 4GN4B 5CV4A 4Q0FA 4JG2A 2AQ2B 2F4VQ 2F3IA 1A0IA 3TBIB 1LTID 2UXCQ 3S9WA 2K6AA 4PMCA 4B3TL 1BQQT 4O0AA 3GTOB 3EBEA 4DV3L 2CH4W 2AQ3B 3I2ZA 4DV2Q 1N34L 2C35B 3GTJH 4A3IH 4JBWA 1SSOA 2WAQE 2E76C 4DF7A 4OWWB 4JI3Q 1P16A 2C9OA 3FKIB 2YU9B 1DOMA 2WKDA 1IBKL 5CBAE 4CJ1B 4X62L 5KNDA 4Z9CB 2E2JH 2XNAC 4A3BG 1R9TH 1C9OA 3WDNA 1VDZA 3S17H 1C8CA 1NSNS 4LF8L 2ASBA 4HIMA 4OL7A 3AYHB 2JP1A 3HOVG 2OWOA 2F52A 4LUVA 1B9MA 4GLVB 2ZT9C 4DV0Q 1VMCA 5C5LA 1XMQQ 4DR3Q 4BY1H 4Q5VA 4KKSA 1GD7A 2HCCA 2SNMA 2JEBI 2MHVA 4HCEA 2UUBQ 4NB3A 1IW7D 2QDBA 3CKIB 1K9MC 1D1KA 5DNFA 4O42A 4LK1C 3CP0A 5E7NA 3CC7A 2VUMG 2AQ1B 3QB3A 1CM9A 2A68C 4WJWA 4XYQA 1HNZQ 4RKBA 2E8GA 4V190 4PNYA 4DV4Q 2WINB 3S15H 3CCEA 1UAPA 2HDLA 3H0GB 5FOBB 3NP8A 1B3AA 2VQFQ 3GV3A 3S1RB 1PTOD 2BCOA 3DHQA 1HZCA 4X64Q 4JV5Q 3C3LA 3PCOB 3G71A 1UE6A 1SRUA 4FXGC 2A5HA 1S3OA 2RA4A 3L7ZC 1MJCA 2CW0D 3GTGB 4HJ9A 3I55A 2KHJA 5LMNW 4A3KG 3CQZH 4A3MB 2IX1A 1FGUA 2F0SA 5HY6A 3RLOA 1VQJA 4JI1Q 2MNAA 4DUZL 3K81C 1IKLA 3PGZA 4AQYQ 5LHY1 2NZHA 3MEFA 5C0XG 2NTTA 1SMYC 4PV1C 4XYOA 4RGMA 2ALYB 3RD4A 2E2IB 2UXCL 3F1ZA 1Q12A 2JA6H 3LX0A 2LSSA 3OIQA 3H09A 1CQFA 1K3BC 4RG1A 3S1QB 3AFPA 1LACA 2PZWA 4DV2L 2JJQA 1UWVA 2D5DA 4BBRH 1NY4A 4AYBG 3HOWB 2IPKD 2JA8G 1KAAA 4XT1B 4BY7B 5I6YA 1E1TA 2N55A 4JI3L 3HRZC 1PH9A 3D6CA 1TKWB 1NNXA 1U0LA 3F2CA 1JICA 5ELEA 4CKBA 2K5QA 1FJGQ 1G8ZD 4QUFA 1LTAD 3CMEA 1ASYA 1B53A 1YNJC 4DV0L 3KF8A 2K04A 3JAML 4DR3L 3FDTA 3L3OC 3M9BA 4CDCC 1JJGA 1B7YB 1JCKB 2G9DA 2RDHA 4HAEA 1QILA 3KLSA 3UI2A 3W1GA 2UUBL 3F2UA 2NBFA 4BBSB 2DN8A 4IOAA 4G7OC 3D31A 2EIFA 4KD3A 5ELCA 1STNA 2F0LA 1IL2A 4ULLA 2TSSA 4IPDA 1I50H 1JQYD 5EPKA 3AB9A 2F0JA 4MNOA 2A69D 1YJWA 1LTSD 1CTMA 2JQOA 3Q6SA 2NYZD 3OPOA 1GVPA 1HNZL 2PO4A 3MZ5A 2L4NA 4DV4L 1VQ9A 1HTLD 4J15A 2VZAA 1JT8A 2VQFL 2UUAQ 2Q2IA 1GUOA 4DN4M 4Y52H 2N88A 3T51B 4X64L 1JJCB 1PTOF 3F2BA 4JV5L 2JA7G 1IKMA 1TY2A 1HH2P 2K52A 4POFA 2WP8J 4RH6A 3I70A 1QNKA 1SE3A 1W6KA 2FHTA 4QB4A 4JI1L 5EAYA 1Q82C 4A76A 5JAVA 2HHHL 3K5NA 3TP6A 2ENBA 5JVG3 1ENAA 1EUJA 4AQYL 4OGQC 3JAMi 1I94Q 3TN2A 4LF9Q 3S14B 3I4MB 3NBHA 1VQBA 1DM0B 3DXJC 4HTHA 5FO8B 2Z6BA 4BY1G 5I2XA 3GTGH 1X54A 5D3DA 4KKTA 4C3JH 5KEEA 1MHWC 3CD6A 2OT2A 1VF7A 4XXEA 3I8ZA 3HOUB 1PRTD 5NUCA 1AN8A 3NQIA 1HUNA 2KEEA 3OWEB 1MGSA 3KDFA 1SE4A 4AH6A 1FJGL 1FGBD 2F4IA 5KYIA 5C3EB 4A3JB 1E0BA 1WI5A 4P2CB 3K5MA 1MI2A 1EEFD 3PIOA 4DXFA 2K1BA 4IQZA 3NXWA 4R4OA 1LUZA 1VQDA 2LXKA 1SYDA 1SR3A 4CJ2C 2NVTB 4V0BA 4FVMA 4IFDH 3I4NG 3MHBA 2RDGA 5IE8A 3CC2A 4RHRA 2DUDA 2PZTA 1G51A 1QVCA 1T5XD 3DEOA 4EQOA 4GLAC 1IW7C 1LV9A 4OELB 3I90A 3W2DA 4WFN3 2F0PA 2B3GA 3ND9A 5ELDA 3SGIA 3HOXH 3S2DB 1H9RA 4OONA 1Z7TA 1MJEA 5ELOA 3VYSA 3NBHB 4WJ4A 1TWGB 4HJ7A 1YVCA 4OO1I 5E3FA 4GOPA 2A6HD 3MA2B 4C1NI 2UUAL 4GZYC 3Q22A 2F0IA 4BBRG 1F2MA 5GAGC 3MXNA 1PTOC 5JOBA 4FXDA 1ET9A 3FVQA 3HOYH 3QR8A 3KDFB 1BCPB 4JI2Q 3F2DA 1TWAB 4H7BA 3PMFA 1H9MA 1WD0A 2C5CA 5BN3A 1RCVD 2J4XA 1TWCH 1IL8A 1UEAB 3FP9A 5I9OA 1W6JA 2ID0A 1I94L 4LF9L 5M3FH 1BXTA 1Y8NB 2VQEQ 1Q1BA 3HOVB 4XQNA 1AFPA 1I3QH 1J9OA 1BKBA 2CVRA 3C1EA 1CFMA 2CKZB 2Q8TA 2O5JC 1PZKD 5EKKA 1EWIA 5T1IA 2RHSB 1E24A 3PO3H 5JEAJ 4DAYA 2CCZA 1XTDA 4MN3A 2B2YC 4DAMA 1PRTF 4C3HG 3A74A 3D6WA 4H0LC 3BVZA 2EYFA 3M7GA 4HIOA 5FLMG 3KJOA 3CRLC 2ZXOA 2VUMB 1HZAA 2EJMA 4HIDA 1TS3A 1JR0D 3V96A 1EEID 3K5LA 1D5XC 4C2MH 2CWPA 3MXGA 1SAPA 4DV7Q 4ZYSA 5LMNQ 2OEOA 3M4OH 2QF7A 1NMGA 4KTAA 3E5SA 2I07B 3MXNB 4GN5A 1OTCA 3CRKC 5D14A 3CCVA 3RZDB 2NUCA 4MZ9A 4RFBA 1OXXK 4HSVA 5M3MB 5D65A 5CYUA 3X3MA 3SK4A 5A2QE 2CQOA 4A3KB 1XJVA 2B2VA 2RKSA 2R92H 1G2TA 1AE2A 4LUZA 2KENA 4A3JH 1SE2A 1B3QA 5EPJA 3AQQA 2B2TA 1A3UA 4DR2Q 1FNVA 1YI2A 1NJIC 2QGQA 2LKVA 3IFDA 2F0HA 1EIHA 2A69C 2PYKA 2PI2E 2A74C 4L63B 1NTGA 3QO2A 3S24A 2AKWB 1V1QA 2AUJD 3B6YA 1SXTA 1SBBB 2BOSA 1K0RA 3I56A 3F8TA 3CCMA 4C3JG 3BDCA 2KVMA 4DAYB 4FF1A 4MTNA 3BG3A 4RGNA 2QKIC 1B8AA 2OQKA 3PUZA 1PLFA 1CSPA 5M5YH 4DR1Q 4JI2L 3U9OA 4FXKC 2R7FA 1NE3A 3AU7A 4B3SQ 4LF5Q 1WFQA 1N9WA 2EE1A 4A3GH 3JAMc 2VXWA 4GKKL 1WCMH 1ASZA 2EOTA 3ND8A 5IGCA 3S1MB 1CI3M 5JJLA 5FJ8H 1II3A 1F9QA 3HKZE 2JA5H 1R4QB 3P75A 4PZ8A 2VQEL 1FNWA 3HZXA 3CCRA 4R4IA 2WKCA 3R2IA 1STBA 1A3VA 2GN5A 4PG3A 1H9JA 2JK8A 4IN3A 4UP9A 2VY3A 4JBJA 1VQMA 4CKCA 1PRTC 1B1ZA 3D4RA 1Q81C 4GNXA 1S40A 2WAQG 4GNXC 2Q2UA 3DWPA 3HOXG 5C4XB 3IRBA 2ICIA 2F0DA 4PQXA 4O1NA 4YHHQ 3M3YB 1YHQA 4K0KL 3Q8DA 1A15A 2K5WA 5LMNL 3QOJA 4UY8C 1SYBA 4HJ5A 1WD1A 4DAPA 3GTPB 1VQCA 3A56A 2EXDA 2QW7A 4KK7A 2LFNA 2UXBQ 4DV3Q 1WTPA 4N9TA 3G4SA 4IALA 5DAUA 2JA7B 2CHBD 1RL2A 3H3VH 3BZDB 4AIMA 1A6XA 2Y0SB 3TEHB 1TXYA 3CW2C 5FK9C 1RHPA 4J8QA 2NVQB 3KBXA 5IT9L 2NWGA 2L11A 2F3WA 3U58A 3SK5A 4DR2L 4N8X1 1PTOH 3DWAA 5M3FG 5BN5A 3K80C 1LABA 4LF7Q 4BWGB 1D2BA 2F03A 1YNJD 4A3EH 3RZOH 2A6HC 2K28A 4CDFC 1EQQA 3W1BA 4ID6A 1TVXA 3DMUA 3PO3G 3ITPA 1XNQQ 3MC0B 4DK6C 4HCSA 4GNXB 3BVMA 1PH2A 1SMXA 3M7NA 1B9NA 5DEHA 1WYDA 2H1EA 2WB1B 3P1HA 4B3SL 4LF5L 4A3CH 3ULLA 4TVAB 4ILWA 1V9PA 4CJ0B 2PZUA 1AH9A 1X9NA 4ME3A 1FNUA 3E6ZX 4GLXA 3FMCA 4IURA 1CA5A 3ONAB 3GTQH 1PYSB 2D0PA 2K01A 1M4VA 1HXYD 2EYJA 1KNEA 2A6EC 1AW7A 1E2ZA 3JAME 3PQIA 3FPUB 4A3FG 3MVVA 1BNZA 2O2LD 2EYOA 3I3CA 1OXUA 1DGSA 4NW2A 2Z6KC 1S5FD 4A93G 3RLFA 1Y69U 1XPOA 1SFOH 1G91A 4A3LH 2D62A 3CMAA 1WTQA 2YTVA 3KFUA 1PYWD 4QF4A 3DWQA 4ODGA 3L2PA 3CCJA 4GN3B 3J80E 4JI5Q 5CORA 4YHHL 4S3SA 3RN2A 1KDAA 3AMUA 2EYLA 5CV8A 5JJKA 1EFID 5IP7G 3T16A 3DM1A 2MUYA 4X3TA 1X6OA 4QMGA 4ZK9B 1PH7A 3VYTA 1IBLQ 1EY4A 1B2TA 1S4ZA 4IUPA 2UXBL 3EFXD 1HR0W 5ELBA 1U4LA 1PH4A 2OXPA 3EA6A 2E2DC 4NMZA 2B63H 5C4XH 1EY7A 5FLXE 3GTKB 2VNUD 5GROA 4IPHA 3LGJA 1STGA 4JVZA 1V1OA 1VMPA 1BCPD 3TZUA 1ICFB 1Y1WB 2BDOA 2GVAA 2X6LA 2ES2A 1TS2A 2M00A 1JMCA 5FJ8G 1U9RA 2JA5G 3GTPH 1SNDA 4LF7L 3CPFA 2Q8IB 1LT3D 1S5CD 2D2CC 1Q8KA 3PO2B 3TS0A 4RWSC 3LNNA 2SOBA 2G5DA 3TP5A 5J22A 2HQLA 1XNQL 3BDLA 4RA8A 3E3XA 1Q90A 3ERQA 4R9WA 4C3HB 3HG9A 5C5MA 4R4TA 1V8QA 1EYGA 1PMRA 2L1BA 3BYTB 2K50A 4X66Q 1M1KC 3HOZB 3OW7A 2I46A 3VA7A 3CU7A 4DR5Q 5J3BA 5IYDG 4K2KA 1KC8C 5A35A 3DM3A 1B70B 4L6TB 3NUCA 3NTHA 1VQOA 2HCIA 3NK9A 4JBMA 1X55A 2MO1A 4ZCKA 3T53B 4L5TA 4CHTB 1K83H 3H6MA 4QGUA 5EPLA 2SDFA 4HJ8A 5IYCG 1KDBA 4QIWE 1YNXA 2RDFA 3HFZB 2R93G 1NCVA 4YWMA 1K3RA 1OXVA 2IX3A 4DA2A 1D5MC 5IP9G 2HHHQ 4YWLA 2DY7A 4JI5L 1KQSA 3J81L 4DGZA 1JWSD 2RVLA 5GADC 1IBMQ 1IYVA 1LTTD 1SNCA 1Y1VH 1JOKA 2EVBA 3K59A 3J7AF 3QG1A 4A3EG 5IOCA 2L12A 3PUXA 1IBLL 1YJ9A 3C46A 1K8OA 4DV5Q 1PFBA 1QB5D 1QVFA 2LMCB 1HCZA 5GAHC 2R7ZG 3TS2A 1OXTA 3CCLA 4FP5D 4HN7A 5CBEE 4YCVA 3K0XA 1HHVA 4A3CG 4A3DG 4QCLA 3KUPA 1X3FA 2IHFA 4JOIA 4DUYL 1BCPF 1Q3LA 1PH8A 3RNUA 2BA0A 1CT1D 1BBXC 1GUGA 1WTVA 5IGFA 3JC66 5C4ZA 4DK0A 5DM63 1A62A 2I0QA 3GTOH 4HMJA 5JPMC 1PDQA 4B3RL 4LNQA 2VS1A 3DLLA 5T1GA 2KCMA 4N9PA 1VCIA 4P73A 2XGTA 2SNSA 1EYDA 2ZJRA 4K6LA 3FKIH 2YU9H 1UE7A 3UDIA 1D7QA 2KOLA 3J81j 1Z9FA 2KJXA 3J81i 3A5UA 1KRSA 1TY0A 1KLGD 1CHQD 5FO7B 4GS3A 4J1MA 4X66L 1K0SA 1I4QA 2X6GA 3MXUA 2E2HB 4X3SA 1EZ6A 2EDGA 4B9XA 2WV6D 3R3OA 4IPCA 4DR5L 4OX9Q 1CUKA 1KLUD 3PO2H 1I4RA 5C44B 2NN6I 1GOZA 5IT9c 4YCUA 1SYGA 2BDNA 3WOEA 3NWTA 3K7AB 1HA6A 2F0GA 1FD7D 4A3IG 2B63G 1F9SA 2QA4A 1O7ZA 1HFGA 1I6VC 2BH8A 1E3PA 1TWFB 2EY1A 3I4LA 5E4WC 3NENA 1EWCA 1IBML 2CWAA 3H0GH 4HIKA 3BYYB 1AZPA 3OW2A 3EIVA 3S1RH 3T4AC 3KF8B 3PF4A 3PUWA 4IPGA 1U4MA 1LTRD 2OF1A 2F0OA 3Q0AA 2VL6A 4DV5L 1EY5A 5G3LF 3MFYA 4A3MH 1VQIA 1FR3A 2B2WA 2B2WC 1L0XB 1BOSA 3TP8A 1EQTA 1XNRQ 1GHKA 2EYHA 3NTIA 2AMCB 1LYLA 1ESFA 4DR4Q 4J6HA 4ZAIA 2PW7A 2AHOB 2N3SA 1BCPC 2Z4HA 3CPWA 1ZKOA 1I6HB 3S1NB 1O7IA 1XX8A 1RDPD 2E2IH 3K6OA 1ONLA 2NVYB 5EBDA 4IUVA 1A2TA 1XWEA 4XQJA 1E1OA 3S1QH 2Q2TA 1EY8A 3MEHA 3U50C 3Q23A 3HOWH 1ENFA 3S16B 3OMCA 4R4CA 4C3IB 4A3FB 4BY7H 2UXDQ 1PVOA 2CH4A 2NTSA 1Q86C 4IJLA 3SHLA 5IGEA 2H5XA 4H02A 4ZUJA 3GTLB 3VYUA 3KLSX 3KLWA 1H9SA 1TR5A 3S2HB 4POGA 1E22A 1TWHB 4RAUC 2IWHA 4JI6Q 2E75C 1N33Q 1WTWA 3E0JA 1Y1VG 1E7ZA 2GA4B 1YBYA 4OX9L 2MO0A 2IJ0A 5K36H 1LT5D 4F87A 3NHHA 4XT3B 2JA6G 3V2TA 4GOPC 3HKZG 1STHA 4DAVA 1CK1A 1EU3A 3P20A 4BBSH 2PQAA 4FF2A 1GM5A 1Q1EA 4G7ZC 2OTLA 4ME5A 2E2HH 2EYPA 2K5HA 5IT9E 1TS4A 4GKKQ 1DJRD 2UUCQ 3MWYW 3A0JA 4IFDJ 4A3BB 1U4PA 3QIAA 4I7ZC 5KIXA 3CAMA 2E74C 4JI7Q 4TSSA 3K7AH 4LMQD 3AEVA 4TQUS 1GUNA 2K14A 4B08A 5I9PA 1I5FA 2A6ED 4LJZC 4LFCQ 3GQBA 4Y7NB 5M5WB 1KHIA 3FKIG 2QEJC 5EKLA 2DNEA 4JI4L 4XIGS 2L55A 1H9SB 4NXML 1XNRL 2NVXB 1X3QA 3ULPA 4OO1H 4DR4L 3D4WA 1JB7A 3MXPA 3SEBA 3J7A5 2MJ8A 3S14H 3I4MH 3J7YW 2RQXA 4EVOA 3H15A 2EJFC 3KF6A 2HT1A 4K0KQ 1XYIA 3K58A 5CV7A 4GOPB 4BS9A 3NEMA 1STYA 5M5XB 1SN8A 1E2WA 1KL9A 1KNAA 2KBNA 4YIJA 5KYLA 2PQAB 4CDDC 1G291 3H91A 4K5XA 2SEBD 3J81c 3HOUH 1K8MA 5GAEC 4IOCA 2UXDL 1VQ4A 2F0NA 3N6RA 1ZYRC 1PHJA 4DNTB 3RN5A 2N49A 1VQLA 2KHIA 4JC0A 4RCNA 2R93B 1BBWA 2B2VC 2KUMA 4P75A 1VQHA 4RGTA 5C3EH 3N52A 4XDXA 5EQ0A 4JI6L 1HR0L 2B2TC 2J0TD 2FJ2A 3MTSA 1N33L 1X3GA 3VR4A 3H0GG 1D8LA 2XRSD 2N8NA 3HEJA 5IWAQ 2KCNA 2NVTH 4BXXH 3HP3A 2V4DA 4UHVA 1EOTA 4DR6L 1RIPA 1EOVA 2R61A 3EVQA 1VQFA 1STEA 2R7ZB 1K8GA 3KLRA 4AYBB 2FMCA 1CA6A 3ER0A 3R2TA 1PV4A 2JA8B 2IHEA 1O80A 1SYEA 3S2DH 2NZOA 2EY5A 4K8JA 2QILA 4A3DB 1TWGH 1Y8PB 1CSQA 2HDMA 3CCQA 2UUCL 3KF6B 1D1IA 1LO5D 1WTRA 2PMZE 3H94A 4MHEA 4JI7L 2RBMA 1YJNA 2DNCA 1A8VA 1PXUA 4LFCL 4BY7G 1FVIA 3MAQA 1ML0D 1NUCA 1CZWA 4IFDG 1LTBD 4FDBA 1TWAH 4OWTB 1WJJA 1Z47A 1BR9A 4K6DA 3NE5B 4L5SA 1O7YA 4KJOA 2ZJPA 4K2LA 3RR5A 1F9PA 1EQRA 2K5VA 1SEBD 1WOCA 1RF2D 1Y14B 3U9SA 3HOVH 3SE0A 5K36G 4JI8Q 3NQTA 1AEXA 1KRTA 2F0WA 1EYCA 3TQYA 1PYBA 4A75A 2F0EA 2ZXPA 5CMDA 2Z8LA 2AWOA 5C0XI 1SE8A 3CXCA 4EQPA 1MSGA 4PMWA 1OO9B 4BBSG 3G7LA 3GTJB 4A3IB 3BZCA 1J5EQ 4JW0A 2K03A 3HOYG 2AWNA 1MSHA 1PZID 2WACA 4WRDA 1ZXTA 4DV6Q 2VUMH 1SJHD 2FINB 1KABA 2JSOA 2KQ3A 2Z0SA 2JEAI 2E2JB 5K5PA 2XTIA 1R9TB 3CCSA 1TIID 3S17B 5IGGA 5M5XH 3TSSA 2I5LX 4RGOS 2LS01 2G9HD 2PW5A 3L0OA 4ZQ3A 5IWAL 1B44D 3RZDH 1M8AA 3AFQA 1JWUD 4RCOA 3T1YL 4ZLTF 3BVGA 4K5VA 2F0QA 4DXGA 1S5ED 4BY1B 5M3MH 3TP7A 4A3KH 2CFMA 4NP5A 4IJHA 4X6AH 5LMUQ 2DJGC 1SYFA 3EROA 1J8IA 2R7DA 1QUQA 1AE3A 2JA9A 5C0XH 1T5EA 1UE1A 2BE5C 4B9WA 5IYBH 1YIJA 4PMBA 1RJTA 1EZ8A 1U5KA 1CKOA 1C48A 1VF5C 4HEDA 3U4VA 3W5OA 5AJ3Q 1LT4D 4ZRZA 4EGVA 1YNND 2D9UA 2JA8H 3HOUG 1EWHA 3OTOQ 1Y8OB 2K5DA 1X3PA 4WJ3M 4I7AA 1EFWA 1Q46A 3I4NB 4CGYB 3SXHA 2R92G 4JYAQ 3I73A 4IUTA 2OCEA 4A3JG 3S1MH 1I4GA 2H4OA 3TRZA 3T13A 1DXMA 2K4KA 4ZKBB 2M9VA 1MBYA 1SDFA 4NKLA 5C6AA 5M9OA 3R93A 4OEMB 3VDYA 2WIIB 5H1SE 2ICEC 3EJIA 1UE5A 4JI8L 1WVLA 2ZXRA 3BJUA 3ULJA 5A2QL 4BBRB 1J5EL 1RTOA 4KKUA 1A2UA 2ZM6Q 4C56C 1VQ5A 4JI0L 4QUCA 4DV6L 2HIXA 4A3GG 5C4JB 3P7JA 1WCMG 2IT1A 3M3YH 3UE0A 5KRUA 1UUPA 4DUYQ 2KCTA 2WFWA 1HPCA 3UDFA 1SNOA 4B3MQ 1G2SA 1X56A 3G6JB 5I2YA 3SK6A 3OMGA 1ET6A 2JA7H 4B3RQ 3GDEA 5AFWA 3A5ZB 3A8KE 4RKLA 3STBC 1P8LA 5COYA 2PCFB 4N8FA 4UPAA 2YTYA 3BU2A 1PH3A 2B8FA 1N36Q 5LMUL 1VQ7A 4KN7C 1PFMA 2UU9L 2NVQH 1K28A 1GJXA 3MFGA 2KHSA 4XQQA 1Q8IA 4JBKA 2N78A 3FPPA 4X65Q 2HQEA 1EY0A 2ZJQA 4K14A 1I50B 4QJFA 1SJED 3RUZA 1I4HA 4C1NK 2R6GA 3PV0A 1Z6HA 5AJ3L 1EIFA 1UEBA 1GO3E 1LTLA 3OTOL 1TU2B 3PIP3 3GO5A 4F7XA 2K33A 1VQNA 4JCVE 1LLRD 4JYAL 3NBIA 2KEDA 4NXNQ 1OXSC 3CF5A 4DR7Q 1XMOQ 4LWCA 2B8GA 2OTJA 1GUSA 3RMHA 2D0OA 3IFTA 4CKEA 1VQEA 2RSOA 2XIWA 2XWJB 1YITA 2PPBC 5CV6A 5EBCA 3PF5A 1B4OA 5IIFA 1E2VA 1W2BA 1ZEQX 3I4NH 5M3MG 1RTNA 4R8IA 3KYHC 4C3JB 5G3LD 2F0MA 4KY6A 4CDEC 2F0VA 3A7AB 2ZM6L 4LF6Q 2HUGA 3E9IA 1H9KA 3D8GA 3D3RA 4KMUC 3NPPA 4DFAA 5IYBG 2F4VL 4JOIC 3SR1A 1BO0A 3HGBA 5DM73 1DOLA 1YEZA 4E6IA 5FO9B 4B3ML 3K7UC 3W3AA 4I65A 4P72A 3A55A 1BBUA 4RHSA 2FMMA 1KTKA 1QZGA 4G57A 2RHQB 2FXQA 5BR8Q 1XTCD 5HGQA 5IODA 1PZJD 3DEPA 2K5NA 3D4DA 5IGDA 4QY7A 4XTCS 3GTKH 1R4PB 1F2YA 3SVMA 5ELNA 4JPBW 5C4JH 1ZYRD 1RODA 1N36L 1S72A 1PA6A 1L1OA 4A3LG 1Y1WH 1L1OC 3OIPA 4L8JA 2MGSA 1XPRA 2K7VA 2WAQB 4X65L 3HOXB 1IYUA 4IUNA 1JORA 4TRDA 1JB3A 2ATWA 3BS1A 3CC4A 1XMQL 4OWXB 1EIGA 2ZTCA 2IY5B 3I91A 5JJIA 4H13C 1ILPA 3V05A 3EQLC 2A19A 1PH6A 3VR6A 1VQPA 1B50A 1YNNC 4FNFA 3SK8A 2KCCA 4C3HH 2YTXA 3HOYB 1JOOA 5C4XG 4GKJQ 2I5MX 4OIJA 1HQRD 3HOZH 2B2UA 5FLMH 3J80L 2B2UC 4NXNL 1DYQA 4DR7L 1STAA 2XSCA 1TWCB 1XMOL 2R3ZA 3IL8A 3A8JE 1NAPA 2YV5A 2L15A 3FRPB 2Z9HA 4U673 4RMFA 3ICEA 5J39A 5M3FB 4IZ8A 2K75A 3KOJA 2RSNA 5KGUA 1K8AC 1I3QB 4YCWA 1CQVA 1C4QA 3G6EA 4F8MA 2PNHA 5FLXL 2Y0SG 1HNXQ 3PSIA 3IKJA 1L1OB 3PO3B 2QCPX 1N32Q 4LF6L 3R8BA 4JI4Q 4IFDI 4L5QA 2Q2HA 5LL6S 4NXMQ 1W3SA 3U4ZA 4O2DA 1NR2A 2IW3A 2HIVA 4HMIA 2NN6H 4OHJA 2LY7A 5DLQE 4QIWB 4KHVA 4F88A 5J1ZA 4KI0A 5I6WA 3J7AV 1FL0A 2PQEA 5EKIA 4C2MB 2F1MA 3T56B 3PUVA 4QL5A 3K57A 3M4OB 4UP7A 1X65A 1VQAA 2E5LQ 1CKNA 1V43A 4X3UA 5BR8L 3J80i 1XPUA 3CHBD 1M90C 1QNUA 2WB1G 1SLJA 2BA1A 4P71A 1VQ8A 2FFKB 3VYRA 4A93B 5ELFA 3VA5A 2R92B 1YHBA 1HZ9A 4HSPA 2DY8A 4UDUC 3HKSA 4H44C 1AP0A 3NWSA 1L0YB 1YHAA 2KA7A 3O13A 4YWKA 1TT2A 1HR0Q 3TMEA 4TKOB 1X3EA 1ENCA 3OHXC 4KV6A 4ALPA 2Z4IA 4AYBE 3T1HQ 1KAWA 1HRJA 2M2LA 1BF4A 1SYCA 4KJNA 3KBGA 4APVA 3UE1A 1HUMA 4DR6Q 3TREA 4YY3Q 1HNWQ 2NB0A 1SNMA 2OQ0A 4X3KA 5M5YB 2EQSA 5EGTA 4GKJL 4A4IA 1VS0A 4R1JA 3LWUA 3H3VC 2XWBB 1WTOA 4A3GB 3E0EA 1EIYB 4L5RC 1WCMB 5JEAH 1LTGD 5HURA 2BE5D 1EQVA 5C44H 2B29A 3VR5A 3CCUA 2F0UA 2LXJA 2JA5B 1CKNB 5LL6X 1UNSA 2VB2X 3VR3A 3Q24A 4LUOA 1D5ZC 2I5HA 2XRQD 2IL8A 3A54A 4KY5A 5CV9A 3K0YA 1JJ2A 2CW0C 1HNXL 4DV1Q 1EU4A 1N32L 1O7LA 1XXGA 3TZDA 1JOQA 1QG7A 1RKNA 1Y1WG 2X69A 1TWFH 3UDXA 1EL0A 4QQBX 1AZQA 4HR7B 5HGTA 4DNIA 1CZGA 4KD4A 3G48A 1VQGA 3NSWA 1TQOA 1JC7A 1MIUA 1ILQA 5C3WA 3PO2G 3I72A 3NTKA 4LFAQ 3I4OA
chains in the Genus database with same CATH topology
4X66Q 1N8RC 4EQ5A 2Y0SE 1M1KC 1Q7YC 3L0OA 2E5LL 5IWAL 4JI1L 3RZDH 3AFQA 5EAYA 4DR5Q 4A76A 1Q82C 3T1YL 2HHHL 5J3BA 5IYDG 1KC8C 1T9HA 3GD7A 3DM3A 1B70B 1EUJA 4AQYL 5M3MH 3HOZG 3JAMi 1VQOA 4A3KH 1I94Q 4JBMA 4LF9Q 1X55A 2MO1A 2CFMA 4L5TA 1K83H 4X6AH 3D0FA 1VQBA 4IJHA 5LMUQ 3S1NH 1I6HH 4QGUA 1HZBA 2R7DA 4BY1G 2NVYH 3GTGH 1QUQA 1VQKA 4HJ8A 1AE3A 1GKHA 1X54A 5IYCG 2JA9A 4C3JH 4QIWE 1YNXA 3T1HL 1J6QA 3CD6A 1VQ6A 1UE1A 3HFZB 4DPGA 2R93G 4YWMA 1K3RA 1OXVA 5IYBH 4C3IH 1YIJA 3S16H 4A3FH 4DKAC 5IP9G 4IO9A 3T1YQ 3M4PA 1LM0A 4YWLA 2HHHQ 1U5KA 1CKOA 2WB1E 1QVGA 3NELA 4JI5L 3U4VA 1KQSA 3W5OA 4A93H 3KDFA 5AJ3Q 1H95A 4YY3L 5GADC 1IBMQ 3STBD 1HNWL 3GTLH 1Y1VH 4AH6A 4A3MG 2JA8H 3HOUG 2MFIA 3OTOQ 1FJGL 1NMFA 2BH2A 1CKMA 3S2HH 4WJ3M 4A3EG 1YZ6A 1K73C 1PH5A 1WI5A 1EFWA 3PUXA 1IBLL 3PIOA 1Q46A 2NN6G 1YJ9A 1TWHH 4R4OA 3ZJYC 4DV5Q 2R92G 4JYAQ 5GQOA 1QVFA 4POFA 1LUZA 1VQDA 2RF4A 5GAHC 2R7ZG 2LXKA 5IP7H 2OCEA 3TS2A 1KXLA 1OXTA 3CCLA 1SR3A 4A3JG 3S1MH 4YCVA 4BA1I 3K0XA 3I4NG 1C0AA 3TRZA 4A3CG 2K4KA 1G6PA 5IE8A 3CC2A 3KJPA 4A3DG 2IX0A 2DUDA 1G51A 1X3FA 2IHFA 1QVCA 4JOIA 3VDYA 4DUYL 5H1SE 1PH8A 3HOWG 3RNUA 4GLAC 2BA0A 1UE5A 4JI8L 3JC66 3PIPA 1IYJB 1NBWA 3SGIA 2B3GA 3HOXH 1A62A 3EN2A 4DV1L 2I0QA 4LFBQ 4OONA 1MJEA 3BJUA 3M4QA 5ELOA 3GTOH 3NBHB 4WJ4A 3ULJA 4HJ7A 1J5EL 2YYZA 3H3VI 1YVCA 4B3RL 4OO1I 4LNQA 2VS1A 2ZM6Q 3DLLA 4PZ6A 2KCMA 1VQ5A 4JI0L 1VCIA 4P73A 2XGTA 3J7ZC 4A3BH 2ZJRA 4GOPA 3FKIH 2QEXA 2HIXA 1UE7A 3UDIA 4DV6L 2ZTDA 2UUAL 2YU9H 4A3GG 4BBRG 1D7QA 3J81j 1WCMG 2IT1A 1Z9FA 5GAGC 3UE0A 3J81i 3A5UA 3M3YH 1KRSA 3M85A 3J80c 4Y7NH 5M5WH 4DUYQ 2KCTA 2WFWA 3HOYH 4KHZA 3UDFA 4LFAL 3KDFB 4GS3A 4X66L 4B3MQ 2A8VA 3K8AA 4JI2Q 5IY0A 3F2DA 1X56A 4IPCA 4DR5L 1PH1A 1TWCH 4KLKA 4LF4Q 4OX9Q 1CUKA 3FP9A 2NVXH 3I7FA 3PO2H 2JA7H 2NN6I 4B3RQ 3GDEA 2PI2A 2ID0A 1A63A 3A5ZB 4JI0Q 5IT9c 1QZHA 3STBC 1P8LA 1L2FA 4YCUA 2VW9A 2DGYA 5M3FH 4UPAA 2YTYA 3BU2A 1I94L 4LF9L 5JEAG 1PH3A 3ERSX 4PZ7A 4P74A 1Q1BA 4OXPA 5FLXc 2VQEQ 5LMUL 1N36Q 1I3QH 1VQ7A 2UU9L 1BKBA 4A3IG 2NVQH 2MQHA 4KHPQ 5IYDH 4DV7L 5C44G 2B63G 2CKZB 4JBKA 2N78A 2QA4A 4X65Q 1EWIA 4DK3C 2ZJQA 3BZKA 4LW1A 4B3TQ 4QJFA 2RHSB 1E24A 3PO3H 5JEAJ 2BH8A 2CCZA 1XTDA 1N34Q 1E3PA 4DAMA 1HJPA 3NENA 2R6GA 3PV0A 3A74A 5AJ3L 5IYCH 1IBML 1EIFA 4HIOA 5FLMG 1IXRA 2CWAA 1UEBA 3H0GH 1GO3E 1HZAA 3KJOA 4HIDA 4HIKA 2R93H 1LTLA 3OW2A 3EIVA 3S1RH 1IBKQ 3OTOL 3KF8B 4X62Q 3PF4A 2UU9Q 4C2MH 5IP9H 3GO5A 2CWPA 3PUWA 4IPGA 4DV7Q 1KIXA 4OO1G 1VQNA 5LMNQ 3I4OA 4JCVE 3UDGA 3M4OH 1NMGA 2VL6A 3E9HA 4DV5L 4JYAL 3MXNB 4GN5A 1OTCA 4LF8Q 1SROA 4R4QA 4NXNQ 3I4MG 4A3MH 2A1AA 1VQIA 3CCVA 1OXSC 3CF5A 4DR7Q 3GTMH 4MZ9A 1XMOQ 4LWCA 2OTJA 2GVBA 1XNRQ 2D0OA 1OXXK 2AMCB 1LYLA 4BA2I 3RLNA 4DR4Q 3OYYA 1MKHA 2AHOB 1VQEA 2CQOA 4NPSA 1L0WA 1XJVA 2N3SA 2R92H 3CPWA 1YITA 2R7ZH 3WWVA 1AE2A 4LUZA 1O7IA 2KENA 4A3JH 3PF5A 4DR1L 1W2BA 3AQQA 2E2IH 4LFBL 3I4NH 5M3MG 4DR2Q 1YI2A 1E1OA 1NJIC 3S1QH 4HJAA 3KYHC 2QGQA 4A3DH 2Q2TA 3U50C 3HOWH 2PI2E 2ZM6L 1JE5A 4BY7H 4R4CA 4LF6Q 1NTGA 1C7YA 5C3EG 3S24A 2AKWB 1V1QA 3B6YA 3E9IA 2UXDQ 3FHWA 1PVOA 1K0RA 3I56A 3F8TA 3CCMA 1Q86C 2V1CC 4IJLA 4DAYB 4MTNA 1BVSA 1PFSA 2H5XA 4H02A 2RCNA 4UP8A 5IYBG 2F4VL 1KD1C 3KLWA 1B8AA 2OQKA 3PUZA 4JOIC 1CSPA 5M5YH 1YEZA 2Z6KA 4BXXG 4B3ML 4POGA 2JE6I 4DR1Q 4JI2L 3K7UC 2R7FA 1NE3A 1E22A 4JI6Q 4P72A 4B3SQ 4LF5Q 1BBUA 1WFQA 1N9WA 5C0XJ 1N33Q 4A3GH 3JAMc 4GKKL 1IZ6A 1Y1VG 1E7ZA 1WCMH 1ASZA 1YBYA 4LF4L 4OX9L 2MO0A 1QZGA 2ZTEA 2RHQB 2FXQA 5BR8Q 5HGQA 2K5NA 4QY7A 4XTCS 3GTKH 2JA6G 5JJLA 1QUQB 4EX5A 4DUZQ 5FJ8H 5ELNA 5C4JH 3HKZE 3HKZG 4GOPC 2JA5H 1N36L 4PZ8A 2VQEL 1S72A 1PA6A 3PUYA 4KHPL 4GN4B 3CCRA 1L1OA 4R4IA 1Y1WH 4BBSH 1L1OC 2PQAA 4A3LG 1GM5A 4JG2A 1XPRA 2F4VQ 1Q1EA 2F3IA 1A0IA 2GN5A 4PG3A 4X65L 2OTLA 2UXCQ 2JK8A 4B3TL 4O0AA 4UP9A 2E2HH 2VY3A 3EBEA 4JBJA 4DV3L 3I2ZA 4DV2Q 2K5HA 1N34L 1VQMA 2C35B 2ATWA 3CC4A 3GTJH 4A3IH 4GKKQ 4JBWA 1XMQL 2UUCQ 4OWXB 1Q81C 2ZTCA 4GNXA 2IY5B 3A0JA 2WAQE 2WAQG 4GNXC 1S40A 2Q2UA 4OWWB 4IFDJ 3HOXG 5JJIA 4JI3Q 3IRBA 1P16A 3CAMA 4JI7Q 2A19A 3K7AH 1PH6A 4YHHQ 1IBKL 1VQPA 3AEVA 4TQUS 4X62L 2K14A 1YHQA 4K0KL 1I5FA 2E2JH 3Q8DA 4LFCQ 4C3HH 2YTXA 4A3BG 1R9TH 1C9OA 5LMNL 5C4XG 1KHIA 4GKJQ 2I5MX 4UY8C 3S17H 3FKIG 4HJ5A 4LF8L 2ASBA 3HOZH 4HIMA 5FLMH 4NXNL 4JI4L 4XIGS 1VQCA 2EXDA 2UXBQ 3AYHB 4DR7L 3HOVG 4DV3Q 1XMOL 2F52A 2OWOA 4NXML 4LUVA 3G4SA 1XNRL 4GLVB 2YV5A 4DV0Q 2L15A 1RL2A 1XMQQ 3H3VH 3ULPA 4DR4L 4AIMA 4DR3Q 4RMFA 4BY1H 3ICEA 1GD7A 1JB7A 3TEHB 1TXYA 3CW2C 3J7A5 2JEBI 3S14H 3I4MH 2K75A 3KOJA 1K8AC 2UUBQ 4NB3A 4YCWA 3H15A 3G6EA 3KF6A 3U58A 1K9MC 2HT1A 4K0KQ 2PNHA 4GOPB 4DR2L 2K50A 2Y0SG 3NEMA 1HNXQ 3PSIA 5M3FG 1SN8A 3CP0A 3K80C 1KL9A 2KBNA 5E7NA 1L1OB 3CC7A 2PQAB 3CCSA 4LF7Q 2VUMG 1N32Q 1G291 4LF6L 4JI4Q 4IFDI 4L5QA 3J81c 3HOUH 2Q2HA 5GAEC 4IOCA 4NXMQ 2UXDL 1W3SA 3U4ZA 4A3EH 4O2DA 1VQ4A 1HNZQ 3RZOH 2E8GA 2HIVA 4DV4Q 1EQQA 3W1BA 3S15H 5DLQE 1PHJA 3CCEA 3RN5A 2N49A 3PO3G 1VQLA 2KHIA 4JC0A 4KI0A 1XNQQ 4DK6C 1BBWA 2VQFQ 4GNXB 1FL0A 4P75A 1PH2A 1SMXA 1VQHA 1HZCA 3M7NA 4X64Q 5C3EH 4JV5Q 3PCOB 3G71A 4JI6L 1UE6A 1SRUA 1WYDA 3PUVA 1S3OA 4QL5A 1HR0L 4B3SL 3L7ZC 1MJCA 4LF5L 1X3GA 1N33L 4HJ9A 3I55A 3H0GG 1D8LA 2KHJA 4A3CH 3ULLA 4TVAB 1X65A 4UP7A 5LMNW 2N8NA 1VQAA 1V9PA 3CQZH 4A3KG 2E5LQ 1FGUA 1CKNA 5IWAQ 1V43A 5HY6A 3RLOA 5BR8L 3J80i 2IX1A 1VQJA 4JI1Q 1XPUA 1M90C 2NVTH 1AH9A 4BXXH 1X9NA 2MNAA 4ME3A 4GLXA 2WB1G 1SLJA 3K81C 2BA1A 4P71A 4DUZL 1VQ8A 4DR6L 1RIPA 1EOVA 3PGZA 4AQYQ 1VQFA 3GTQH 1PYSB 2D0PA 2NZHA 3MEFA 1YHBA 5C0XG 1HZ9A 1K8GA 3HKSA 2ALYB 1EYGA 4A3FG 3ER0A 1PV4A 2IHEA 2UXCL 1OXUA 3F1ZA 1DGSA 1Q12A 2JA6H 1YHAA 2Z6KC 2NZOA 2LSSA 3S2DH 4A93G 4YWKA 4RG1A 3RLFA 1HR0Q 3AFPA 4DV2L 1XPOA 1SFOH 2JJQA 1TWGH 1UWVA 1X3EA 4ALPA 1CSQA 4AYBE 1NY4A 4AYBG 4BBRH 1KAWA 3CCQA 3T1HQ 2UUCL 4A3LH 2D62A 3KF6B 3CMAA 2JA8G 1E1TA 4JI3L 2YTVA 1PH9A 4APVA 3KFUA 2PMZE 3L2PA 3CCJA 4JI7L 4GN3B 3UE1A 1U0LA 4JI5Q 3TREA 4YHHL 4DR6Q 3F2CA 3RN2A 1YJNA 4YY3Q 1HNWQ 5JJKA 1A8VA 4LFCL 4BY7G 5IP7G 1FVIA 2OQ0A 2EQSA 1FJGQ 4GKJL 1X6OA 4A4IA 1VS0A 4R1JA 4IFDG 1PH7A 4FDBA 1IBLQ 1TWAH 4OWTB 1WJJA 1Z47A 3E0EA 3CMEA 1EIYB 4L5RC 2UXBL 1ASYA 1HR0W 1PH4A 4DV0L 4L5SA 5C44H 2B29A 2ZJPA 5C4XH 3CCUA 4DR3L 3RR5A 2B63H 1EQRA 2K5VA 1WOCA 5GROA 2VNUD 3M9BA 4IPHA 1JJGA 1B7YB 2LXJA 3LGJA 1CKNB 1Y14B 3W1GA 2UUBL 4LUOA 3HOVH 2I5HA 4IOAA 2GVAA 5K36G 3D31A 2ES2A 2EIFA 4JI8Q 1JJ2A 1KRTA 1JMCA 1HNXL 5FJ8G 3TQYA 1IL2A 1PYBA 4A75A 5C0XI 4DV1Q 2JA5G 2AWOA 1SE8A 4IPDA 3GTPH 3CXCA 1I50H 4LF7L 3CPFA 1N32L 4PMWA 4MNOA 1YJWA 1Y1WG 4BBSG 3BZCA 1J5EQ 1TWFH 3UDXA 2JQOA 1HNZL 1GVPA 1Q8KA 3HOYG 2AWNA 3TS0A 4DV4L 1VQ9A 4QQBX 4J15A 2VZAA 1JT8A 4DNIA 1XNQL 4DV6Q 2HQLA 3G48A 2VQFL 2UUAQ 2Q2IA 2VUMH 4Y52H 1VQGA 2Z0SA 1MIUA 4X64L 1JJCB 3F2BA 2JEAI 4JV5L 3PO2G 2JA7G 2XTIA 4R4TA 1HH2P 2K52A 2WP8J 5M5XH 4LFAQ 2I5LX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X66 Q;  1N8R C;  4EQ5 A;  2Y0S E;  1M1K C;  1Q7Y C;  3L0O A;  2E5L L;  5IWA L;  4JI1 L;  3RZD H;  3AFQ A;  5EAY A;  4DR5 Q;  4A76 A;  1Q82 C;  3T1Y L;  2HHH L;  5J3B A;  5IYD G;  1KC8 C;  1T9H A;  3GD7 A;  3DM3 A;  1B70 B;  1EUJ A;  4AQY L;  5M3M H;  3HOZ G;  3JAM i;  1VQO A;  4A3K H;  1I94 Q;  4JBM A;  4LF9 Q;  1X55 A;  2MO1 A;  2CFM A;  4L5T A;  1K83 H;  4X6A H;  3D0F A;  1VQB A;  4IJH A;  5LMU Q;  3S1N H;  1I6H H;  4QGU A;  1HZB A;  2R7D A;  4BY1 G;  2NVY H;  3GTG H;  1QUQ A;  1VQK A;  4HJ8 A;  1AE3 A;  1GKH A;  1X54 A;  5IYC G;  2JA9 A;  4C3J H;  4QIW E;  1YNX A;  3T1H L;  1J6Q A;  3CD6 A;  1VQ6 A;  1UE1 A;  3HFZ B;  4DPG A;  2R93 G;  4YWM A;  1K3R A;  1OXV A;  5IYB H;  4C3I H;  1YIJ A;  3S16 H;  4A3F H;  4DKA C;  5IP9 G;  4IO9 A;  3T1Y Q;  3M4P A;  1LM0 A;  4YWL A;  2HHH Q;  1U5K A;  1CKO A;  2WB1 E;  1QVG A;  3NEL A;  4JI5 L;  3U4V A;  1KQS A;  3W5O A;  4A93 H;  3KDF A;  5AJ3 Q;  1H95 A;  4YY3 L;  5GAD C;  1IBM Q;  3STB D;  1HNW L;  3GTL H;  1Y1V H;  4AH6 A;  4A3M G;  2JA8 H;  3HOU G;  2MFI A;  3OTO Q;  1FJG L;  1NMF A;  2BH2 A;  1CKM A;  3S2H H;  4WJ3 M;  4A3E G;  1YZ6 A;  1K73 C;  1PH5 A;  1WI5 A;  1EFW A;  3PUX A;  1IBL L;  3PIO A;  1Q46 A;  2NN6 G;  1YJ9 A;  1TWH H;  4R4O A;  3ZJY C;  4DV5 Q;  2R92 G;  4JYA Q;  5GQO A;  1QVF A;  4POF A;  1LUZ A;  1VQD A;  2RF4 A;  5GAH C;  2R7Z G;  2LXK A;  5IP7 H;  2OCE A;  3TS2 A;  1KXL A;  1OXT A;  3CCL A;  1SR3 A;  4A3J G;  3S1M H;  4YCV A;  4BA1 I;  3K0X A;  3I4N G;  1C0A A;  3TRZ A;  4A3C G;  2K4K A;  1G6P A;  5IE8 A;  3CC2 A;  3KJP A;  4A3D G;  2IX0 A;  2DUD A;  1G51 A;  1X3F A;  2IHF A;  1QVC A;  4JOI A;  3VDY A;  4DUY L;  5H1S E;  1PH8 A;  3HOW G;  3RNU A;  4GLA C;  2BA0 A;  1UE5 A;  4JI8 L;  3JC6 6;  3PIP A;  1IYJ B;  1NBW A;  3SGI A;  2B3G A;  3HOX H;  1A62 A;  3EN2 A;  4DV1 L;  2I0Q A;  4LFB Q;  4OON A;  1MJE A;  3BJU A;  3M4Q A;  5ELO A;  3GTO H;  3NBH B;  4WJ4 A;  3ULJ A;  4HJ7 A;  1J5E L;  2YYZ A;  3H3V I;  1YVC A;  4B3R L;  4OO1 I;  4LNQ A;  2VS1 A;  2ZM6 Q;  3DLL A;  4PZ6 A;  2KCM A;  1VQ5 A;  4JI0 L;  1VCI A;  4P73 A;  2XGT A;  3J7Z C;  4A3B H;  2ZJR A;  4GOP A;  3FKI H;  2QEX A;  2HIX A;  1UE7 A;  3UDI A;  4DV6 L;  2ZTD A;  2UUA L;  2YU9 H;  4A3G G;  4BBR G;  1D7Q A;  3J81 j;  1WCM G;  2IT1 A;  1Z9F A;  5GAG C;  3UE0 A;  3J81 i;  3A5U A;  3M3Y H;  1KRS A;  3M85 A;  3J80 c;  4Y7N H;  5M5W H;  4DUY Q;  2KCT A;  2WFW A;  3HOY H;  4KHZ A;  3UDF A;  4LFA L;  3KDF B;  4GS3 A;  4X66 L;  4B3M Q;  2A8V A;  3K8A A;  4JI2 Q;  5IY0 A;  3F2D A;  1X56 A;  4IPC A;  4DR5 L;  1PH1 A;  1TWC H;  4KLK A;  4LF4 Q;  4OX9 Q;  1CUK A;  3FP9 A;  2NVX H;  3I7F A;  3PO2 H;  2JA7 H;  2NN6 I;  4B3R Q;  3GDE A;  2PI2 A;  2ID0 A;  1A63 A;  3A5Z B;  4JI0 Q;  5IT9 c;  1QZH A;  3STB C;  1P8L A;  1L2F A;  4YCU A;  2VW9 A;  2DGY A;  5M3F H;  4UPA A;  2YTY A;  3BU2 A;  1I94 L;  4LF9 L;  5JEA G;  1PH3 A;  3ERS X;  4PZ7 A;  4P74 A;  1Q1B A;  4OXP A;  5FLX c;  2VQE Q;  5LMU L;  1N36 Q;  1I3Q H;  1VQ7 A;  2UU9 L;  1BKB A;  4A3I G;  2NVQ H;  2MQH A;  4KHP Q;  5IYD H;  4DV7 L;  5C44 G;  2B63 G;  2CKZ B;  4JBK A;  2N78 A;  2QA4 A;  4X65 Q;  1EWI A;  4DK3 C;  2ZJQ A;  3BZK A;  4LW1 A;  4B3T Q;  4QJF A;  2RHS B;  1E24 A;  3PO3 H;  5JEA J;  2BH8 A;  2CCZ A;  1XTD A;  1N34 Q;  1E3P A;  4DAM A;  1HJP A;  3NEN A;  2R6G A;  3PV0 A;  3A74 A;  5AJ3 L;  5IYC H;  1IBM L;  1EIF A;  4HIO A;  5FLM G;  1IXR A;  2CWA A;  1UEB A;  3H0G H;  1GO3 E;  1HZA A;  3KJO A;  4HID A;  4HIK A;  2R93 H;  1LTL A;  3OW2 A;  3EIV A;  3S1R H;  1IBK Q;  3OTO L;  3KF8 B;  4X62 Q;  3PF4 A;  2UU9 Q;  4C2M H;  5IP9 H;  3GO5 A;  2CWP A;  3PUW A;  4IPG A;  4DV7 Q;  1KIX A;  4OO1 G;  1VQN A;  5LMN Q;  3I4O A;  4JCV E;  3UDG A;  3M4O H;  1NMG A;  2VL6 A;  3E9H A;  4DV5 L;  4JYA L;  3MXN B;  4GN5 A;  1OTC A;  4LF8 Q;  1SRO A;  4R4Q A;  4NXN Q;  3I4M G;  4A3M H;  2A1A A;  1VQI A;  3CCV A;  1OXS C;  3CF5 A;  4DR7 Q;  3GTM H;  4MZ9 A;  1XMO Q;  4LWC A;  2OTJ A;  2GVB A;  1XNR Q;  2D0O A;  1OXX K;  2AMC B;  1LYL A;  4BA2 I;  3RLN A;  4DR4 Q;  3OYY A;  1MKH A;  2AHO B;  1VQE A;  2CQO A;  4NPS A;  1L0W A;  1XJV A;  2N3S A;  2R92 H;  3CPW A;  1YIT A;  2R7Z H;  3WWV A;  1AE2 A;  4LUZ A;  1O7I A;  2KEN A;  4A3J H;  3PF5 A;  4DR1 L;  1W2B A;  3AQQ A;  2E2I H;  4LFB L;  3I4N H;  5M3M G;  4DR2 Q;  1YI2 A;  1E1O A;  1NJI C;  3S1Q H;  4HJA A;  3KYH C;  2QGQ A;  4A3D H;  2Q2T A;  3U50 C;  3HOW H;  2PI2 E;  2ZM6 L;  1JE5 A;  4BY7 H;  4R4C A;  4LF6 Q;  1NTG A;  1C7Y A;  5C3E G;  3S24 A;  2AKW B;  1V1Q A;  3B6Y A;  3E9I A;  2UXD Q;  3FHW A;  1PVO A;  1K0R A;  3I56 A;  3F8T A;  3CCM A;  1Q86 C;  2V1C C;  4IJL A;  4DAY B;  4MTN A;  1BVS A;  1PFS A;  2H5X A;  4H02 A;  2RCN A;  4UP8 A;  5IYB G;  2F4V L;  1KD1 C;  3KLW A;  1B8A A;  2OQK A;  3PUZ A;  4JOI C;  1CSP A;  5M5Y H;  1YEZ A;  2Z6K A;  4BXX G;  4B3M L;  4POG A;  2JE6 I;  4DR1 Q;  4JI2 L;  3K7U C;  2R7F A;  1NE3 A;  1E22 A;  4JI6 Q;  4P72 A;  4B3S Q;  4LF5 Q;  1BBU A;  1WFQ A;  1N9W A;  5C0X J;  1N33 Q;  4A3G H;  3JAM c;  4GKK L;  1IZ6 A;  1Y1V G;  1E7Z A;  1WCM H;  1ASZ A;  1YBY A;  4LF4 L;  4OX9 L;  2MO0 A;  1QZG A;  2ZTE A;  2RHQ B;  2FXQ A;  5BR8 Q;  5HGQ A;  2K5N A;  4QY7 A;  4XTC S;  3GTK H;  2JA6 G;  5JJL A;  1QUQ B;  4EX5 A;  4DUZ Q;  5FJ8 H;  5ELN A;  5C4J H;  3HKZ E;  3HKZ G;  4GOP C;  2JA5 H;  1N36 L;  4PZ8 A;  2VQE L;  1S72 A;  1PA6 A;  3PUY A;  4KHP L;  4GN4 B;  3CCR A;  1L1O A;  4R4I A;  1Y1W H;  4BBS H;  1L1O C;  2PQA A;  4A3L G;  1GM5 A;  4JG2 A;  1XPR A;  2F4V Q;  1Q1E A;  2F3I A;  1A0I A;  2GN5 A;  4PG3 A;  4X65 L;  2OTL A;  2UXC Q;  2JK8 A;  4B3T L;  4O0A A;  4UP9 A;  2E2H H;  2VY3 A;  3EBE A;  4JBJ A;  4DV3 L;  3I2Z A;  4DV2 Q;  2K5H A;  1N34 L;  1VQM A;  2C35 B;  2ATW A;  3CC4 A;  3GTJ H;  4A3I H;  4GKK Q;  4JBW A;  1XMQ L;  2UUC Q;  4OWX B;  1Q81 C;  2ZTC A;  4GNX A;  2IY5 B;  3A0J A;  2WAQ E;  2WAQ G;  4GNX C;  1S40 A;  2Q2U A;  4OWW B;  4IFD J;  3HOX G;  5JJI A;  4JI3 Q;  3IRB A;  1P16 A;  3CAM A;  4JI7 Q;  2A19 A;  3K7A H;  1PH6 A;  4YHH Q;  1IBK L;  1VQP A;  3AEV A;  4TQU S;  4X62 L;  2K14 A;  1YHQ A;  4K0K L;  1I5F A;  2E2J H;  3Q8D A;  4LFC Q;  4C3H H;  2YTX A;  4A3B G;  1R9T H;  1C9O A;  5LMN L;  5C4X G;  1KHI A;  4GKJ Q;  2I5M X;  4UY8 C;  3S17 H;  3FKI G;  4HJ5 A;  4LF8 L;  2ASB A;  3HOZ H;  4HIM A;  5FLM H;  4NXN L;  4JI4 L;  4XIG S;  1VQC A;  2EXD A;  2UXB Q;  3AYH B;  4DR7 L;  3HOV G;  4DV3 Q;  1XMO L;  2F52 A;  2OWO A;  4NXM L;  4LUV A;  3G4S A;  1XNR L;  4GLV B;  2YV5 A;  4DV0 Q;  2L15 A;  1RL2 A;  1XMQ Q;  3H3V H;  3ULP A;  4DR4 L;  4AIM A;  4DR3 Q;  4RMF A;  4BY1 H;  3ICE A;  1GD7 A;  1JB7 A;  3TEH B;  1TXY A;  3CW2 C;  3J7A 5;  2JEB I;  3S14 H;  3I4M H;  2K75 A;  3KOJ A;  1K8A C;  2UUB Q;  4NB3 A;  4YCW A;  3H15 A;  3G6E A;  3KF6 A;  3U58 A;  1K9M C;  2HT1 A;  4K0K Q;  2PNH A;  4GOP B;  4DR2 L;  2K50 A;  2Y0S G;  3NEM A;  1HNX Q;  3PSI A;  5M3F G;  1SN8 A;  3CP0 A;  3K80 C;  1KL9 A;  2KBN A;  5E7N A;  1L1O B;  3CC7 A;  2PQA B;  3CCS A;  4LF7 Q;  2VUM G;  1N32 Q;  1G29 1;  4LF6 L;  4JI4 Q;  4IFD I;  4L5Q A;  3J81 c;  3HOU H;  2Q2H A;  5GAE C;  4IOC A;  4NXM Q;  2UXD L;  1W3S A;  3U4Z A;  4A3E H;  4O2D A;  1VQ4 A;  1HNZ Q;  3RZO H;  2E8G A;  2HIV A;  4DV4 Q;  1EQQ A;  3W1B A;  3S15 H;  5DLQ E;  1PHJ A;  3CCE A;  3RN5 A;  2N49 A;  3PO3 G;  1VQL A;  2KHI A;  4JC0 A;  4KI0 A;  1XNQ Q;  4DK6 C;  1BBW A;  2VQF Q;  4GNX B;  1FL0 A;  4P75 A;  1PH2 A;  1SMX A;  1VQH A;  1HZC A;  3M7N A;  4X64 Q;  5C3E H;  4JV5 Q;  3PCO B;  3G71 A;  4JI6 L;  1UE6 A;  1SRU A;  1WYD A;  3PUV A;  1S3O A;  4QL5 A;  1HR0 L;  4B3S L;  3L7Z C;  1MJC A;  4LF5 L;  1X3G A;  1N33 L;  4HJ9 A;  3I55 A;  3H0G G;  1D8L A;  2KHJ A;  4A3C H;  3ULL A;  4TVA B;  1X65 A;  4UP7 A;  5LMN W;  2N8N A;  1VQA A;  1V9P A;  3CQZ H;  4A3K G;  2E5L Q;  1FGU A;  1CKN A;  5IWA Q;  1V43 A;  5HY6 A;  3RLO A;  5BR8 L;  3J80 i;  2IX1 A;  1VQJ A;  4JI1 Q;  1XPU A;  1M90 C;  2NVT H;  1AH9 A;  4BXX H;  1X9N A;  2MNA A;  4ME3 A;  4GLX A;  2WB1 G;  1SLJ A;  3K81 C;  2BA1 A;  4P71 A;  4DUZ L;  1VQ8 A;  4DR6 L;  1RIP A;  1EOV A;  3PGZ A;  4AQY Q;  1VQF A;  3GTQ H;  1PYS B;  2D0P A;  2NZH A;  3MEF A;  1YHB A;  5C0X G;  1HZ9 A;  1K8G A;  3HKS A;  2ALY B;  1EYG A;  4A3F G;  3ER0 A;  1PV4 A;  2IHE A;  2UXC L;  1OXU A;  3F1Z A;  1DGS A;  1Q12 A;  2JA6 H;  1YHA A;  2Z6K C;  2NZO A;  2LSS A;  3S2D H;  4A93 G;  4YWK A;  4RG1 A;  3RLF A;  1HR0 Q;  3AFP A;  4DV2 L;  1XPO A;  1SFO H;  2JJQ A;  1TWG H;  1UWV A;  1X3E A;  4ALP A;  1CSQ A;  4AYB E;  1NY4 A;  4AYB G;  4BBR H;  1KAW A;  3CCQ A;  3T1H Q;  2UUC L;  4A3L H;  2D62 A;  3KF6 B;  3CMA A;  2JA8 G;  1E1T A;  4JI3 L;  2YTV A;  1PH9 A;  4APV A;  3KFU A;  2PMZ E;  3L2P A;  3CCJ A;  4JI7 L;  4GN3 B;  3UE1 A;  1U0L A;  4JI5 Q;  3TRE A;  4YHH L;  4DR6 Q;  3F2C A;  3RN2 A;  1YJN A;  4YY3 Q;  1HNW Q;  5JJK A;  1A8V A;  4LFC L;  4BY7 G;  5IP7 G;  1FVI A;  2OQ0 A;  2EQS A;  1FJG Q;  4GKJ L;  1X6O A;  4A4I A;  1VS0 A;  4R1J A;  4IFD G;  1PH7 A;  4FDB A;  1IBL Q;  1TWA H;  4OWT B;  1WJJ A;  1Z47 A;  3E0E A;  3CME A;  1EIY B;  4L5R C;  2UXB L;  1ASY A;  1HR0 W;  1PH4 A;  4DV0 L;  4L5S A;  5C44 H;  2B29 A;  2ZJP A;  5C4X H;  3CCU A;  4DR3 L;  3RR5 A;  2B63 H;  1EQR A;  2K5V A;  1WOC A;  5GRO A;  2VNU D;  3M9B A;  4IPH A;  1JJG A;  1B7Y B;  2LXJ A;  3LGJ A;  1CKN B;  1Y14 B;  3W1G A;  2UUB L;  4LUO A;  3HOV H;  2I5H A;  4IOA A;  2GVA A;  5K36 G;  3D31 A;  2ES2 A;  2EIF A;  4JI8 Q;  1JJ2 A;  1KRT A;  1JMC A;  1HNX L;  5FJ8 G;  3TQY A;  1IL2 A;  1PYB A;  4A75 A;  5C0X I;  4DV1 Q;  2JA5 G;  2AWO A;  1SE8 A;  4IPD A;  3GTP H;  3CXC A;  1I50 H;  4LF7 L;  3CPF A;  1N32 L;  4PMW A;  4MNO A;  1YJW A;  1Y1W G;  4BBS G;  3BZC A;  1J5E Q;  1TWF H;  3UDX A;  2JQO A;  1HNZ L;  1GVP A;  1Q8K A;  3HOY G;  2AWN A;  3TS0 A;  4DV4 L;  1VQ9 A;  4QQB X;  4J15 A;  2VZA A;  1JT8 A;  4DNI A;  1XNQ L;  4DV6 Q;  2HQL A;  3G48 A;  2VQF L;  2UUA Q;  2Q2I A;  2VUM H;  4Y52 H;  1VQG A;  2Z0S A;  1MIU A;  4X64 L;  1JJC B;  3F2B A;  2JEA I;  4JV5 L;  3PO2 G;  2JA7 G;  2XTI A;  4R4T A;  1HH2 P;  2K52 A;  2WP8 J;  5M5X H;  4LFA Q;  2I5L X; 
#chains in the Genus database with same CATH topology
 5D3I B;  1N8R C;  4EQ5 A;  2Y0S E;  4FF3 A;  3GV6 A;  4M1U B;  1Q7Y C;  2E5L L;  2B2Y A;  1HTP A;  1T9H A;  3GD7 A;  2QDL A;  5TSS A;  3HOZ G;  5JPN C;  2DJF C;  3D0F A;  1I6H H;  3S1N H;  3QWN A;  1HZB A;  2NVY H;  2F0F A;  4ZUI A;  1VQK A;  1PTO B;  5ISR A;  1GKH A;  2L0C A;  1V1P A;  3T1H L;  1J6Q A;  1DOK A;  1VQ6 A;  4DPG A;  2L5T A;  3S16 H;  1WTH A;  4LAA A;  4C3I H;  4A3F H;  4DKA C;  3GTM B;  2L9H A;  1KDC A;  4IO9 A;  3M4P A;  1LM0 A;  5E1F A;  3T1Y Q;  4A3E B;  4DNR B;  1QVG A;  2WB1 E;  2Z1C A;  3RZO B;  3NEL A;  4A93 H;  2EY6 A;  1H95 A;  4YY3 L;  1HNW L;  3STB D;  1QOH A;  3GTL H;  1A3T A;  4ZKC B;  4A3M G;  3X3N A;  3WOF A;  2MFI A;  4NDX A;  1NMF A;  2BH2 A;  1CKM A;  3LWE A;  1F9R A;  3S2H H;  1YZ6 A;  1K73 C;  1PH5 A;  1QCB D;  5KNC A;  2NN6 G;  2PNR C;  3A7L A;  1TWH H;  1GUW A;  1ICW A;  1CHP D;  2EXZ A;  4KN4 C;  1IHZ A;  5GQO A;  3ZJY C;  4FYD A;  1O78 A;  2RF4 A;  1KXL A;  2JN4 A;  5IP7 H;  4IUQ A;  5CV5 A;  4BA1 I;  1C0A A;  1QJO A;  1GHJ A;  1HA5 A;  1G6P A;  3C1F A;  2EYM A;  3GTQ B;  5L37 A;  3KJP A;  2IX0 A;  4KY7 A;  4R8N A;  3A8I E;  3HOW G;  1BDO A;  1LT6 D;  1DZ1 A;  3PIP A;  1IYJ B;  1NBW A;  4DV1 L;  4LFB Q;  3EN2 A;  4M8A A;  3M4Q A;  4WOR A;  1SFO B;  5CR3 A;  5JVH 3;  2YYZ A;  3H3V I;  2A68 D;  1SNQ A;  4PZ6 A;  4FF4 A;  5C3X A;  4A3B H;  3J7Z C;  1V1P B;  2K05 A;  1F2L A;  3URY A;  2QEX A;  2ZTD A;  1QWY A;  1EYA A;  3SDZ A;  3BDO A;  3OOC A;  5FKA C;  1G6Z A;  2VB3 X;  3M85 A;  3J80 c;  4Y7N H;  5M5W H;  2J7Z A;  4KHZ A;  4LFA L;  2JXM B;  2EJG C;  2A8V A;  3K8A A;  5IY0 A;  4G7H C;  3K5O A;  1PH1 A;  1BUV T;  4KLK A;  4LF4 Q;  2NVX H;  3I7F A;  5CC4 A;  2B63 B;  4MIU A;  2PI2 A;  1WTX A;  1ESR A;  1FYC A;  2Q8R E;  1A63 A;  2XVS A;  1F2Z A;  4JI0 Q;  1QZH A;  3OSO A;  1L2F A;  2VW9 A;  2DGY A;  1DCZ A;  4K5W A;  5JEA G;  3ERS X;  4PZ7 A;  4P74 A;  4OXP A;  5FLX c;  1SMY D;  4KHP Q;  4DK1 A;  2MQH A;  5IYD H;  4DV7 L;  5C44 G;  5E4X A;  3PIO 3;  2EZV A;  4JK1 C;  3J81 E;  2O4X A;  4DK3 C;  4B3T Q;  3BZK A;  4LW1 A;  1NR4 A;  2AUK A;  4OIK A;  1GUT A;  4FO2 A;  3VR2 A;  1U4R A;  1N34 Q;  1GXD C;  1HJP A;  2MPM A;  4ABN A;  1JE4 A;  3ZYY X;  4EQN A;  1DD2 A;  5IYC H;  2JYO A;  1IXR A;  2XN9 C;  2R93 H;  2P5Z X;  1IBK Q;  1QE6 A;  4X62 Q;  2UU9 Q;  5IP9 H;  4G4K A;  1EY6 A;  5I4D A;  5C4H A;  5F2D A;  1KIX A;  4OO1 G;  3UDG A;  3E9H A;  1F77 A;  4LF8 Q;  1SRO A;  4R4Q A;  2NZ1 D;  1PFN A;  3I4M G;  2A1A A;  3GTM H;  1HFN A;  2GVB A;  3QJY A;  3OWF A;  3TDQ A;  5BN4 A;  4BA2 I;  3RLN A;  2F0K A;  3OYY A;  4DU9 A;  2K32 A;  3FEW X;  3S15 B;  1PRT B;  1MKH A;  1L0W A;  4CBV A;  4NPS A;  1K83 B;  2R7Z H;  3WWV A;  5KNB A;  4DR1 L;  2B39 A;  4LFB L;  2TMP A;  5CGK A;  5JJZ A;  4HJA A;  4A3D H;  3CQZ B;  1JE5 A;  3C2P A;  1C7Y A;  5C3E G;  2HD3 A;  3FHW A;  2F0T A;  1I4X A;  2V1C C;  1MD2 D;  1TS5 A;  2EPB A;  1BVS A;  1PFS A;  1S5B D;  1JWM D;  1Y1V B;  2RCN A;  1EY9 A;  4UP8 A;  4C3I G;  1KD1 C;  1I4P A;  3L9A X;  4BXX G;  2Z6K A;  1DON A;  2A73 B;  2JE6 I;  2PMZ B;  2JA6 B;  2CQA A;  1HQM C;  3IAY A;  5C0X J;  1D6E C;  4MTK A;  2MP1 A;  3HKZ B;  3M4Y A;  1IZ6 A;  2KEC A;  3DUZ A;  3HS0 C;  4LF4 L;  1S5D D;  2EY2 A;  2ZTE A;  2O5I C;  4UAI A;  4K8I A;  5IGB A;  4IUU A;  4U68 A;  1QUQ B;  4EX5 A;  3GP7 A;  4DUZ Q;  5EJW A;  1SNP A;  2F3V A;  2RCF A;  3QOL A;  3KK7 A;  3PUY A;  4KHP L;  1RD9 D;  1X32 A;  4GN4 B;  5CV4 A;  4Q0F A;  4JG2 A;  2AQ2 B;  2F4V Q;  2F3I A;  1A0I A;  3TBI B;  1LTI D;  2UXC Q;  3S9W A;  2K6A A;  4PMC A;  4B3T L;  1BQQ T;  4O0A A;  3GTO B;  3EBE A;  4DV3 L;  2CH4 W;  2AQ3 B;  3I2Z A;  4DV2 Q;  1N34 L;  2C35 B;  3GTJ H;  4A3I H;  4JBW A;  1SSO A;  2WAQ E;  2E76 C;  4DF7 A;  4OWW B;  4JI3 Q;  1P16 A;  2C9O A;  3FKI B;  2YU9 B;  1DOM A;  2WKD A;  1IBK L;  5CBA E;  4CJ1 B;  4X62 L;  5KND A;  4Z9C B;  2E2J H;  2XNA C;  4A3B G;  1R9T H;  1C9O A;  3WDN A;  1VDZ A;  3S17 H;  1C8C A;  1NSN S;  4LF8 L;  2ASB A;  4HIM A;  4OL7 A;  3AYH B;  2JP1 A;  3HOV G;  2OWO A;  2F52 A;  4LUV A;  1B9M A;  4GLV B;  2ZT9 C;  4DV0 Q;  1VMC A;  5C5L A;  1XMQ Q;  4DR3 Q;  4BY1 H;  4Q5V A;  4KKS A;  1GD7 A;  2HCC A;  2SNM A;  2JEB I;  2MHV A;  4HCE A;  2UUB Q;  4NB3 A;  1IW7 D;  2QDB A;  3CKI B;  1K9M C;  1D1K A;  5DNF A;  4O42 A;  4LK1 C;  3CP0 A;  5E7N A;  3CC7 A;  2VUM G;  2AQ1 B;  3QB3 A;  1CM9 A;  2A68 C;  4WJW A;  4XYQ A;  1HNZ Q;  4RKB A;  2E8G A;  4V19 0;  4PNY A;  4DV4 Q;  2WIN B;  3S15 H;  3CCE A;  1UAP A;  2HDL A;  3H0G B;  5FOB B;  3NP8 A;  1B3A A;  2VQF Q;  3GV3 A;  3S1R B;  1PTO D;  2BCO A;  3DHQ A;  1HZC A;  4X64 Q;  4JV5 Q;  3C3L A;  3PCO B;  3G71 A;  1UE6 A;  1SRU A;  4FXG C;  2A5H A;  1S3O A;  2RA4 A;  3L7Z C;  1MJC A;  2CW0 D;  3GTG B;  4HJ9 A;  3I55 A;  2KHJ A;  5LMN W;  4A3K G;  3CQZ H;  4A3M B;  2IX1 A;  1FGU A;  2F0S A;  5HY6 A;  3RLO A;  1VQJ A;  4JI1 Q;  2MNA A;  4DUZ L;  3K81 C;  1IKL A;  3PGZ A;  4AQY Q;  5LHY 1;  2NZH A;  3MEF A;  5C0X G;  2NTT A;  1SMY C;  4PV1 C;  4XYO A;  4RGM A;  2ALY B;  3RD4 A;  2E2I B;  2UXC L;  3F1Z A;  1Q12 A;  2JA6 H;  3LX0 A;  2LSS A;  3OIQ A;  3H09 A;  1CQF A;  1K3B C;  4RG1 A;  3S1Q B;  3AFP A;  1LAC A;  2PZW A;  4DV2 L;  2JJQ A;  1UWV A;  2D5D A;  4BBR H;  1NY4 A;  4AYB G;  3HOW B;  2IPK D;  2JA8 G;  1KAA A;  4XT1 B;  4BY7 B;  5I6Y A;  1E1T A;  2N55 A;  4JI3 L;  3HRZ C;  1PH9 A;  3D6C A;  1TKW B;  1NNX A;  1U0L A;  3F2C A;  1JIC A;  5ELE A;  4CKB A;  2K5Q A;  1FJG Q;  1G8Z D;  4QUF A;  1LTA D;  3CME A;  1ASY A;  1B53 A;  1YNJ C;  4DV0 L;  3KF8 A;  2K04 A;  3JAM L;  4DR3 L;  3FDT A;  3L3O C;  3M9B A;  4CDC C;  1JJG A;  1B7Y B;  1JCK B;  2G9D A;  2RDH A;  4HAE A;  1QIL A;  3KLS A;  3UI2 A;  3W1G A;  2UUB L;  3F2U A;  2NBF A;  4BBS B;  2DN8 A;  4IOA A;  4G7O C;  3D31 A;  2EIF A;  4KD3 A;  5ELC A;  1STN A;  2F0L A;  1IL2 A;  4ULL A;  2TSS A;  4IPD A;  1I50 H;  1JQY D;  5EPK A;  3AB9 A;  2F0J A;  4MNO A;  2A69 D;  1YJW A;  1LTS D;  1CTM A;  2JQO A;  3Q6S A;  2NYZ D;  3OPO A;  1GVP A;  1HNZ L;  2PO4 A;  3MZ5 A;  2L4N A;  4DV4 L;  1VQ9 A;  1HTL D;  4J15 A;  2VZA A;  1JT8 A;  2VQF L;  2UUA Q;  2Q2I A;  1GUO A;  4DN4 M;  4Y52 H;  2N88 A;  3T51 B;  4X64 L;  1JJC B;  1PTO F;  3F2B A;  4JV5 L;  2JA7 G;  1IKM A;  1TY2 A;  1HH2 P;  2K52 A;  4POF A;  2WP8 J;  4RH6 A;  3I70 A;  1QNK A;  1SE3 A;  1W6K A;  2FHT A;  4QB4 A;  4JI1 L;  5EAY A;  1Q82 C;  4A76 A;  5JAV A;  2HHH L;  3K5N A;  3TP6 A;  2ENB A;  5JVG 3;  1ENA A;  1EUJ A;  4AQY L;  4OGQ C;  3JAM i;  1I94 Q;  3TN2 A;  4LF9 Q;  3S14 B;  3I4M B;  3NBH A;  1VQB A;  1DM0 B;  3DXJ C;  4HTH A;  5FO8 B;  2Z6B A;  4BY1 G;  5I2X A;  3GTG H;  1X54 A;  5D3D A;  4KKT A;  4C3J H;  5KEE A;  1MHW C;  3CD6 A;  2OT2 A;  1VF7 A;  4XXE A;  3I8Z A;  3HOU B;  1PRT D;  5NUC A;  1AN8 A;  3NQI A;  1HUN A;  2KEE A;  3OWE B;  1MGS A;  3KDF A;  1SE4 A;  4AH6 A;  1FJG L;  1FGB D;  2F4I A;  5KYI A;  5C3E B;  4A3J B;  1E0B A;  1WI5 A;  4P2C B;  3K5M A;  1MI2 A;  1EEF D;  3PIO A;  4DXF A;  2K1B A;  4IQZ A;  3NXW A;  4R4O A;  1LUZ A;  1VQD A;  2LXK A;  1SYD A;  1SR3 A;  4CJ2 C;  2NVT B;  4V0B A;  4FVM A;  4IFD H;  3I4N G;  3MHB A;  2RDG A;  5IE8 A;  3CC2 A;  4RHR A;  2DUD A;  2PZT A;  1G51 A;  1QVC A;  1T5X D;  3DEO A;  4EQO A;  4GLA C;  1IW7 C;  1LV9 A;  4OEL B;  3I90 A;  3W2D A;  4WFN 3;  2F0P A;  2B3G A;  3ND9 A;  5ELD A;  3SGI A;  3HOX H;  3S2D B;  1H9R A;  4OON A;  1Z7T A;  1MJE A;  5ELO A;  3VYS A;  3NBH B;  4WJ4 A;  1TWG B;  4HJ7 A;  1YVC A;  4OO1 I;  5E3F A;  4GOP A;  2A6H D;  3MA2 B;  4C1N I;  2UUA L;  4GZY C;  3Q22 A;  2F0I A;  4BBR G;  1F2M A;  5GAG C;  3MXN A;  1PTO C;  5JOB A;  4FXD A;  1ET9 A;  3FVQ A;  3HOY H;  3QR8 A;  3KDF B;  1BCP B;  4JI2 Q;  3F2D A;  1TWA B;  4H7B A;  3PMF A;  1H9M A;  1WD0 A;  2C5C A;  5BN3 A;  1RCV D;  2J4X A;  1TWC H;  1IL8 A;  1UEA B;  3FP9 A;  5I9O A;  1W6J A;  2ID0 A;  1I94 L;  4LF9 L;  5M3F H;  1BXT A;  1Y8N B;  2VQE Q;  1Q1B A;  3HOV B;  4XQN A;  1AFP A;  1I3Q H;  1J9O A;  1BKB A;  2CVR A;  3C1E A;  1CFM A;  2CKZ B;  2Q8T A;  2O5J C;  1PZK D;  5EKK A;  1EWI A;  5T1I A;  2RHS B;  1E24 A;  3PO3 H;  5JEA J;  4DAY A;  2CCZ A;  1XTD A;  4MN3 A;  2B2Y C;  4DAM A;  1PRT F;  4C3H G;  3A74 A;  3D6W A;  4H0L C;  3BVZ A;  2EYF A;  3M7G A;  4HIO A;  5FLM G;  3KJO A;  3CRL C;  2ZXO A;  2VUM B;  1HZA A;  2EJM A;  4HID A;  1TS3 A;  1JR0 D;  3V96 A;  1EEI D;  3K5L A;  1D5X C;  4C2M H;  2CWP A;  3MXG A;  1SAP A;  4DV7 Q;  4ZYS A;  5LMN Q;  2OEO A;  3M4O H;  2QF7 A;  1NMG A;  4KTA A;  3E5S A;  2I07 B;  3MXN B;  4GN5 A;  1OTC A;  3CRK C;  5D14 A;  3CCV A;  3RZD B;  2NUC A;  4MZ9 A;  4RFB A;  1OXX K;  4HSV A;  5M3M B;  5D65 A;  5CYU A;  3X3M A;  3SK4 A;  5A2Q E;  2CQO A;  4A3K B;  1XJV A;  2B2V A;  2RKS A;  2R92 H;  1G2T A;  1AE2 A;  4LUZ A;  2KEN A;  4A3J H;  1SE2 A;  1B3Q A;  5EPJ A;  3AQQ A;  2B2T A;  1A3U A;  4DR2 Q;  1FNV A;  1YI2 A;  1NJI C;  2QGQ A;  2LKV A;  3IFD A;  2F0H A;  1EIH A;  2A69 C;  2PYK A;  2PI2 E;  2A74 C;  4L63 B;  1NTG A;  3QO2 A;  3S24 A;  2AKW B;  1V1Q A;  2AUJ D;  3B6Y A;  1SXT A;  1SBB B;  2BOS A;  1K0R A;  3I56 A;  3F8T A;  3CCM A;  4C3J G;  3BDC A;  2KVM A;  4DAY B;  4FF1 A;  4MTN A;  3BG3 A;  4RGN A;  2QKI C;  1B8A A;  2OQK A;  3PUZ A;  1PLF A;  1CSP A;  5M5Y H;  4DR1 Q;  4JI2 L;  3U9O A;  4FXK C;  2R7F A;  1NE3 A;  3AU7 A;  4B3S Q;  4LF5 Q;  1WFQ A;  1N9W A;  2EE1 A;  4A3G H;  3JAM c;  2VXW A;  4GKK L;  1WCM H;  1ASZ A;  2EOT A;  3ND8 A;  5IGC A;  3S1M B;  1CI3 M;  5JJL A;  5FJ8 H;  1II3 A;  1F9Q A;  3HKZ E;  2JA5 H;  1R4Q B;  3P75 A;  4PZ8 A;  2VQE L;  1FNW A;  3HZX A;  3CCR A;  4R4I A;  2WKC A;  3R2I A;  1STB A;  1A3V A;  2GN5 A;  4PG3 A;  1H9J A;  2JK8 A;  4IN3 A;  4UP9 A;  2VY3 A;  4JBJ A;  1VQM A;  4CKC A;  1PRT C;  1B1Z A;  3D4R A;  1Q81 C;  4GNX A;  1S40 A;  2WAQ G;  4GNX C;  2Q2U A;  3DWP A;  3HOX G;  5C4X B;  3IRB A;  2ICI A;  2F0D A;  4PQX A;  4O1N A;  4YHH Q;  3M3Y B;  1YHQ A;  4K0K L;  3Q8D A;  1A15 A;  2K5W A;  5LMN L;  3QOJ A;  4UY8 C;  1SYB A;  4HJ5 A;  1WD1 A;  4DAP A;  3GTP B;  1VQC A;  3A56 A;  2EXD A;  2QW7 A;  4KK7 A;  2LFN A;  2UXB Q;  4DV3 Q;  1WTP A;  4N9T A;  3G4S A;  4IAL A;  5DAU A;  2JA7 B;  2CHB D;  1RL2 A;  3H3V H;  3BZD B;  4AIM A;  1A6X A;  2Y0S B;  3TEH B;  1TXY A;  3CW2 C;  5FK9 C;  1RHP A;  4J8Q A;  2NVQ B;  3KBX A;  5IT9 L;  2NWG A;  2L11 A;  2F3W A;  3U58 A;  3SK5 A;  4DR2 L;  4N8X 1;  1PTO H;  3DWA A;  5M3F G;  5BN5 A;  3K80 C;  1LAB A;  4LF7 Q;  4BWG B;  1D2B A;  2F03 A;  1YNJ D;  4A3E H;  3RZO H;  2A6H C;  2K28 A;  4CDF C;  1EQQ A;  3W1B A;  4ID6 A;  1TVX A;  3DMU A;  3PO3 G;  3ITP A;  1XNQ Q;  3MC0 B;  4DK6 C;  4HCS A;  4GNX B;  3BVM A;  1PH2 A;  1SMX A;  3M7N A;  1B9N A;  5DEH A;  1WYD A;  2H1E A;  2WB1 B;  3P1H A;  4B3S L;  4LF5 L;  4A3C H;  3ULL A;  4TVA B;  4ILW A;  1V9P A;  4CJ0 B;  2PZU A;  1AH9 A;  1X9N A;  4ME3 A;  1FNU A;  3E6Z X;  4GLX A;  3FMC A;  4IUR A;  1CA5 A;  3ONA B;  3GTQ H;  1PYS B;  2D0P A;  2K01 A;  1M4V A;  1HXY D;  2EYJ A;  1KNE A;  2A6E C;  1AW7 A;  1E2Z A;  3JAM E;  3PQI A;  3FPU B;  4A3F G;  3MVV A;  1BNZ A;  2O2L D;  2EYO A;  3I3C A;  1OXU A;  1DGS A;  4NW2 A;  2Z6K C;  1S5F D;  4A93 G;  3RLF A;  1Y69 U;  1XPO A;  1SFO H;  1G91 A;  4A3L H;  2D62 A;  3CMA A;  1WTQ A;  2YTV A;  3KFU A;  1PYW D;  4QF4 A;  3DWQ A;  4ODG A;  3L2P A;  3CCJ A;  4GN3 B;  3J80 E;  4JI5 Q;  5COR A;  4YHH L;  4S3S A;  3RN2 A;  1KDA A;  3AMU A;  2EYL A;  5CV8 A;  5JJK A;  1EFI D;  5IP7 G;  3T16 A;  3DM1 A;  2MUY A;  4X3T A;  1X6O A;  4QMG A;  4ZK9 B;  1PH7 A;  3VYT A;  1IBL Q;  1EY4 A;  1B2T A;  1S4Z A;  4IUP A;  2UXB L;  3EFX D;  1HR0 W;  5ELB A;  1U4L A;  1PH4 A;  2OXP A;  3EA6 A;  2E2D C;  4NMZ A;  2B63 H;  5C4X H;  1EY7 A;  5FLX E;  3GTK B;  2VNU D;  5GRO A;  4IPH A;  3LGJ A;  1STG A;  4JVZ A;  1V1O A;  1VMP A;  1BCP D;  3TZU A;  1ICF B;  1Y1W B;  2BDO A;  2GVA A;  2X6L A;  2ES2 A;  1TS2 A;  2M00 A;  1JMC A;  5FJ8 G;  1U9R A;  2JA5 G;  3GTP H;  1SND A;  4LF7 L;  3CPF A;  2Q8I B;  1LT3 D;  1S5C D;  2D2C C;  1Q8K A;  3PO2 B;  3TS0 A;  4RWS C;  3LNN A;  2SOB A;  2G5D A;  3TP5 A;  5J22 A;  2HQL A;  1XNQ L;  3BDL A;  4RA8 A;  3E3X A;  1Q90 A;  3ERQ A;  4R9W A;  4C3H B;  3HG9 A;  5C5M A;  4R4T A;  1V8Q A;  1EYG A;  1PMR A;  2L1B A;  3BYT B;  2K50 A;  4X66 Q;  1M1K C;  3HOZ B;  3OW7 A;  2I46 A;  3VA7 A;  3CU7 A;  4DR5 Q;  5J3B A;  5IYD G;  4K2K A;  1KC8 C;  5A35 A;  3DM3 A;  1B70 B;  4L6T B;  3NUC A;  3NTH A;  1VQO A;  2HCI A;  3NK9 A;  4JBM A;  1X55 A;  2MO1 A;  4ZCK A;  3T53 B;  4L5T A;  4CHT B;  1K83 H;  3H6M A;  4QGU A;  5EPL A;  2SDF A;  4HJ8 A;  5IYC G;  1KDB A;  4QIW E;  1YNX A;  2RDF A;  3HFZ B;  2R93 G;  1NCV A;  4YWM A;  1K3R A;  1OXV A;  2IX3 A;  4DA2 A;  1D5M C;  5IP9 G;  2HHH Q;  4YWL A;  2DY7 A;  4JI5 L;  1KQS A;  3J81 L;  4DGZ A;  1JWS D;  2RVL A;  5GAD C;  1IBM Q;  1IYV A;  1LTT D;  1SNC A;  1Y1V H;  1JOK A;  2EVB A;  3K59 A;  3J7A F;  3QG1 A;  4A3E G;  5IOC A;  2L12 A;  3PUX A;  1IBL L;  1YJ9 A;  3C46 A;  1K8O A;  4DV5 Q;  1PFB A;  1QB5 D;  1QVF A;  2LMC B;  1HCZ A;  5GAH C;  2R7Z G;  3TS2 A;  1OXT A;  3CCL A;  4FP5 D;  4HN7 A;  5CBE E;  4YCV A;  3K0X A;  1HHV A;  4A3C G;  4A3D G;  4QCL A;  3KUP A;  1X3F A;  2IHF A;  4JOI A;  4DUY L;  1BCP F;  1Q3L A;  1PH8 A;  3RNU A;  2BA0 A;  1CT1 D;  1BBX C;  1GUG A;  1WTV A;  5IGF A;  3JC6 6;  5C4Z A;  4DK0 A;  5DM6 3;  1A62 A;  2I0Q A;  3GTO H;  4HMJ A;  5JPM C;  1PDQ A;  4B3R L;  4LNQ A;  2VS1 A;  3DLL A;  5T1G A;  2KCM A;  4N9P A;  1VCI A;  4P73 A;  2XGT A;  2SNS A;  1EYD A;  2ZJR A;  4K6L A;  3FKI H;  2YU9 H;  1UE7 A;  3UDI A;  1D7Q A;  2KOL A;  3J81 j;  1Z9F A;  2KJX A;  3J81 i;  3A5U A;  1KRS A;  1TY0 A;  1KLG D;  1CHQ D;  5FO7 B;  4GS3 A;  4J1M A;  4X66 L;  1K0S A;  1I4Q A;  2X6G A;  3MXU A;  2E2H B;  4X3S A;  1EZ6 A;  2EDG A;  4B9X A;  2WV6 D;  3R3O A;  4IPC A;  4DR5 L;  4OX9 Q;  1CUK A;  1KLU D;  3PO2 H;  1I4R A;  5C44 B;  2NN6 I;  1GOZ A;  5IT9 c;  4YCU A;  1SYG A;  2BDN A;  3WOE A;  3NWT A;  3K7A B;  1HA6 A;  2F0G A;  1FD7 D;  4A3I G;  2B63 G;  1F9S A;  2QA4 A;  1O7Z A;  1HFG A;  1I6V C;  2BH8 A;  1E3P A;  1TWF B;  2EY1 A;  3I4L A;  5E4W C;  3NEN A;  1EWC A;  1IBM L;  2CWA A;  3H0G H;  4HIK A;  3BYY B;  1AZP A;  3OW2 A;  3EIV A;  3S1R H;  3T4A C;  3KF8 B;  3PF4 A;  3PUW A;  4IPG A;  1U4M A;  1LTR D;  2OF1 A;  2F0O A;  3Q0A A;  2VL6 A;  4DV5 L;  1EY5 A;  5G3L F;  3MFY A;  4A3M H;  1VQI A;  1FR3 A;  2B2W A;  2B2W C;  1L0X B;  1BOS A;  3TP8 A;  1EQT A;  1XNR Q;  1GHK A;  2EYH A;  3NTI A;  2AMC B;  1LYL A;  1ESF A;  4DR4 Q;  4J6H A;  4ZAI A;  2PW7 A;  2AHO B;  2N3S A;  1BCP C;  2Z4H A;  3CPW A;  1ZKO A;  1I6H B;  3S1N B;  1O7I A;  1XX8 A;  1RDP D;  2E2I H;  3K6O A;  1ONL A;  2NVY B;  5EBD A;  4IUV A;  1A2T A;  1XWE A;  4XQJ A;  1E1O A;  3S1Q H;  2Q2T A;  1EY8 A;  3MEH A;  3U50 C;  3Q23 A;  3HOW H;  1ENF A;  3S16 B;  3OMC A;  4R4C A;  4C3I B;  4A3F B;  4BY7 H;  2UXD Q;  1PVO A;  2CH4 A;  2NTS A;  1Q86 C;  4IJL A;  3SHL A;  5IGE A;  2H5X A;  4H02 A;  4ZUJ A;  3GTL B;  3VYU A;  3KLS X;  3KLW A;  1H9S A;  1TR5 A;  3S2H B;  4POG A;  1E22 A;  1TWH B;  4RAU C;  2IWH A;  4JI6 Q;  2E75 C;  1N33 Q;  1WTW A;  3E0J A;  1Y1V G;  1E7Z A;  2GA4 B;  1YBY A;  4OX9 L;  2MO0 A;  2IJ0 A;  5K36 H;  1LT5 D;  4F87 A;  3NHH A;  4XT3 B;  2JA6 G;  3V2T A;  4GOP C;  3HKZ G;  1STH A;  4DAV A;  1CK1 A;  1EU3 A;  3P20 A;  4BBS H;  2PQA A;  4FF2 A;  1GM5 A;  1Q1E A;  4G7Z C;  2OTL A;  4ME5 A;  2E2H H;  2EYP A;  2K5H A;  5IT9 E;  1TS4 A;  4GKK Q;  1DJR D;  2UUC Q;  3MWY W;  3A0J A;  4IFD J;  4A3B B;  1U4P A;  3QIA A;  4I7Z C;  5KIX A;  3CAM A;  2E74 C;  4JI7 Q;  4TSS A;  3K7A H;  4LMQ D;  3AEV A;  4TQU S;  1GUN A;  2K14 A;  4B08 A;  5I9P A;  1I5F A;  2A6E D;  4LJZ C;  4LFC Q;  3GQB A;  4Y7N B;  5M5W B;  1KHI A;  3FKI G;  2QEJ C;  5EKL A;  2DNE A;  4JI4 L;  4XIG S;  2L55 A;  1H9S B;  4NXM L;  1XNR L;  2NVX B;  1X3Q A;  3ULP A;  4OO1 H;  4DR4 L;  3D4W A;  1JB7 A;  3MXP A;  3SEB A;  3J7A 5;  2MJ8 A;  3S14 H;  3I4M H;  3J7Y W;  2RQX A;  4EVO A;  3H15 A;  2EJF C;  3KF6 A;  2HT1 A;  4K0K Q;  1XYI A;  3K58 A;  5CV7 A;  4GOP B;  4BS9 A;  3NEM A;  1STY A;  5M5X B;  1SN8 A;  1E2W A;  1KL9 A;  1KNA A;  2KBN A;  4YIJ A;  5KYL A;  2PQA B;  4CDD C;  1G29 1;  3H91 A;  4K5X A;  2SEB D;  3J81 c;  3HOU H;  1K8M A;  5GAE C;  4IOC A;  2UXD L;  1VQ4 A;  2F0N A;  3N6R A;  1ZYR C;  1PHJ A;  4DNT B;  3RN5 A;  2N49 A;  1VQL A;  2KHI A;  4JC0 A;  4RCN A;  2R93 B;  1BBW A;  2B2V C;  2KUM A;  4P75 A;  1VQH A;  4RGT A;  5C3E H;  3N52 A;  4XDX A;  5EQ0 A;  4JI6 L;  1HR0 L;  2B2T C;  2J0T D;  2FJ2 A;  3MTS A;  1N33 L;  1X3G A;  3VR4 A;  3H0G G;  1D8L A;  2XRS D;  2N8N A;  3HEJ A;  5IWA Q;  2KCN A;  2NVT H;  4BXX H;  3HP3 A;  2V4D A;  4UHV A;  1EOT A;  4DR6 L;  1RIP A;  1EOV A;  2R61 A;  3EVQ A;  1VQF A;  1STE A;  2R7Z B;  1K8G A;  3KLR A;  4AYB B;  2FMC A;  1CA6 A;  3ER0 A;  3R2T A;  1PV4 A;  2JA8 B;  2IHE A;  1O80 A;  1SYE A;  3S2D H;  2NZO A;  2EY5 A;  4K8J A;  2QIL A;  4A3D B;  1TWG H;  1Y8P B;  1CSQ A;  2HDM A;  3CCQ A;  2UUC L;  3KF6 B;  1D1I A;  1LO5 D;  1WTR A;  2PMZ E;  3H94 A;  4MHE A;  4JI7 L;  2RBM A;  1YJN A;  2DNC A;  1A8V A;  1PXU A;  4LFC L;  4BY7 G;  1FVI A;  3MAQ A;  1ML0 D;  1NUC A;  1CZW A;  4IFD G;  1LTB D;  4FDB A;  1TWA H;  4OWT B;  1WJJ A;  1Z47 A;  1BR9 A;  4K6D A;  3NE5 B;  4L5S A;  1O7Y A;  4KJO A;  2ZJP A;  4K2L A;  3RR5 A;  1F9P A;  1EQR A;  2K5V A;  1SEB D;  1WOC A;  1RF2 D;  1Y14 B;  3U9S A;  3HOV H;  3SE0 A;  5K36 G;  4JI8 Q;  3NQT A;  1AEX A;  1KRT A;  2F0W A;  1EYC A;  3TQY A;  1PYB A;  4A75 A;  2F0E A;  2ZXP A;  5CMD A;  2Z8L A;  2AWO A;  5C0X I;  1SE8 A;  3CXC A;  4EQP A;  1MSG A;  4PMW A;  1OO9 B;  4BBS G;  3G7L A;  3GTJ B;  4A3I B;  3BZC A;  1J5E Q;  4JW0 A;  2K03 A;  3HOY G;  2AWN A;  1MSH A;  1PZI D;  2WAC A;  4WRD A;  1ZXT A;  4DV6 Q;  2VUM H;  1SJH D;  2FIN B;  1KAB A;  2JSO A;  2KQ3 A;  2Z0S A;  2JEA I;  2E2J B;  5K5P A;  2XTI A;  1R9T B;  3CCS A;  1TII D;  3S17 B;  5IGG A;  5M5X H;  3TSS A;  2I5L X;  4RGO S;  2LS0 1;  2G9H D;  2PW5 A;  3L0O A;  4ZQ3 A;  5IWA L;  1B44 D;  3RZD H;  1M8A A;  3AFQ A;  1JWU D;  4RCO A;  3T1Y L;  4ZLT F;  3BVG A;  4K5V A;  2F0Q A;  4DXG A;  1S5E D;  4BY1 B;  5M3M H;  3TP7 A;  4A3K H;  2CFM A;  4NP5 A;  4IJH A;  4X6A H;  5LMU Q;  2DJG C;  1SYF A;  3ERO A;  1J8I A;  2R7D A;  1QUQ A;  1AE3 A;  2JA9 A;  5C0X H;  1T5E A;  1UE1 A;  2BE5 C;  4B9W A;  5IYB H;  1YIJ A;  4PMB A;  1RJT A;  1EZ8 A;  1U5K A;  1CKO A;  1C48 A;  1VF5 C;  4HED A;  3U4V A;  3W5O A;  5AJ3 Q;  1LT4 D;  4ZRZ A;  4EGV A;  1YNN D;  2D9U A;  2JA8 H;  3HOU G;  1EWH A;  3OTO Q;  1Y8O B;  2K5D A;  1X3P A;  4WJ3 M;  4I7A A;  1EFW A;  1Q46 A;  3I4N B;  4CGY B;  3SXH A;  2R92 G;  4JYA Q;  3I73 A;  4IUT A;  2OCE A;  4A3J G;  3S1M H;  1I4G A;  2H4O A;  3TRZ A;  3T13 A;  1DXM A;  2K4K A;  4ZKB B;  2M9V A;  1MBY A;  1SDF A;  4NKL A;  5C6A A;  5M9O A;  3R93 A;  4OEM B;  3VDY A;  2WII B;  5H1S E;  2ICE C;  3EJI A;  1UE5 A;  4JI8 L;  1WVL A;  2ZXR A;  3BJU A;  3ULJ A;  5A2Q L;  4BBR B;  1J5E L;  1RTO A;  4KKU A;  1A2U A;  2ZM6 Q;  4C56 C;  1VQ5 A;  4JI0 L;  4QUC A;  4DV6 L;  2HIX A;  4A3G G;  5C4J B;  3P7J A;  1WCM G;  2IT1 A;  3M3Y H;  3UE0 A;  5KRU A;  1UUP A;  4DUY Q;  2KCT A;  2WFW A;  1HPC A;  3UDF A;  1SNO A;  4B3M Q;  1G2S A;  1X56 A;  3G6J B;  5I2Y A;  3SK6 A;  3OMG A;  1ET6 A;  2JA7 H;  4B3R Q;  3GDE A;  5AFW A;  3A5Z B;  3A8K E;  4RKL A;  3STB C;  1P8L A;  5COY A;  2PCF B;  4N8F A;  4UPA A;  2YTY A;  3BU2 A;  1PH3 A;  2B8F A;  1N36 Q;  5LMU L;  1VQ7 A;  4KN7 C;  1PFM A;  2UU9 L;  2NVQ H;  1K28 A;  1GJX A;  3MFG A;  2KHS A;  4XQQ A;  1Q8I A;  4JBK A;  2N78 A;  3FPP A;  4X65 Q;  2HQE A;  1EY0 A;  2ZJQ A;  4K14 A;  1I50 B;  4QJF A;  1SJE D;  3RUZ A;  1I4H A;  4C1N K;  2R6G A;  3PV0 A;  1Z6H A;  5AJ3 L;  1EIF A;  1UEB A;  1GO3 E;  1LTL A;  3OTO L;  1TU2 B;  3PIP 3;  3GO5 A;  4F7X A;  2K33 A;  1VQN A;  4JCV E;  1LLR D;  4JYA L;  3NBI A;  2KED A;  4NXN Q;  1OXS C;  3CF5 A;  4DR7 Q;  1XMO Q;  4LWC A;  2B8G A;  2OTJ A;  1GUS A;  3RMH A;  2D0O A;  3IFT A;  4CKE A;  1VQE A;  2RSO A;  2XIW A;  2XWJ B;  1YIT A;  2PPB C;  5CV6 A;  5EBC A;  3PF5 A;  1B4O A;  5IIF A;  1E2V A;  1W2B A;  1ZEQ X;  3I4N H;  5M3M G;  1RTN A;  4R8I A;  3KYH C;  4C3J B;  5G3L D;  2F0M A;  4KY6 A;  4CDE C;  2F0V A;  3A7A B;  2ZM6 L;  4LF6 Q;  2HUG A;  3E9I A;  1H9K A;  3D8G A;  3D3R A;  4KMU C;  3NPP A;  4DFA A;  5IYB G;  2F4V L;  4JOI C;  3SR1 A;  1BO0 A;  3HGB A;  5DM7 3;  1DOL A;  1YEZ A;  4E6I A;  5FO9 B;  4B3M L;  3K7U C;  3W3A A;  4I65 A;  4P72 A;  3A55 A;  1BBU A;  4RHS A;  2FMM A;  1KTK A;  1QZG A;  4G57 A;  2RHQ B;  2FXQ A;  5BR8 Q;  1XTC D;  5HGQ A;  5IOD A;  1PZJ D;  3DEP A;  2K5N A;  3D4D A;  5IGD A;  4QY7 A;  4XTC S;  3GTK H;  1R4P B;  1F2Y A;  3SVM A;  5ELN A;  4JPB W;  5C4J H;  1ZYR D;  1ROD A;  1N36 L;  1S72 A;  1PA6 A;  1L1O A;  4A3L G;  1Y1W H;  1L1O C;  3OIP A;  4L8J A;  2MGS A;  1XPR A;  2K7V A;  2WAQ B;  4X65 L;  3HOX B;  1IYU A;  4IUN A;  1JOR A;  4TRD A;  1JB3 A;  2ATW A;  3BS1 A;  3CC4 A;  1XMQ L;  4OWX B;  1EIG A;  2ZTC A;  2IY5 B;  3I91 A;  5JJI A;  4H13 C;  1ILP A;  3V05 A;  3EQL C;  2A19 A;  1PH6 A;  3VR6 A;  1VQP A;  1B50 A;  1YNN C;  4FNF A;  3SK8 A;  2KCC A;  4C3H H;  2YTX A;  3HOY B;  1JOO A;  5C4X G;  4GKJ Q;  2I5M X;  4OIJ A;  1HQR D;  3HOZ H;  2B2U A;  5FLM H;  3J80 L;  2B2U C;  4NXN L;  1DYQ A;  4DR7 L;  1STA A;  2XSC A;  1TWC B;  1XMO L;  2R3Z A;  3IL8 A;  3A8J E;  1NAP A;  2YV5 A;  2L15 A;  3FRP B;  2Z9H A;  4U67 3;  4RMF A;  3ICE A;  5J39 A;  5M3F B;  4IZ8 A;  2K75 A;  3KOJ A;  2RSN A;  5KGU A;  1K8A C;  1I3Q B;  4YCW A;  1CQV A;  1C4Q A;  3G6E A;  4F8M A;  2PNH A;  5FLX L;  2Y0S G;  1HNX Q;  3PSI A;  3IKJ A;  1L1O B;  3PO3 B;  2QCP X;  1N32 Q;  4LF6 L;  3R8B A;  4JI4 Q;  4IFD I;  4L5Q A;  2Q2H A;  5LL6 S;  4NXM Q;  1W3S A;  3U4Z A;  4O2D A;  1NR2 A;  2IW3 A;  2HIV A;  4HMI A;  2NN6 H;  4OHJ A;  2LY7 A;  5DLQ E;  4QIW B;  4KHV A;  4F88 A;  5J1Z A;  4KI0 A;  5I6W A;  3J7A V;  1FL0 A;  2PQE A;  5EKI A;  4C2M B;  2F1M A;  3T56 B;  3PUV A;  4QL5 A;  3K57 A;  3M4O B;  4UP7 A;  1X65 A;  1VQA A;  2E5L Q;  1CKN A;  1V43 A;  4X3U A;  5BR8 L;  3J80 i;  1XPU A;  3CHB D;  1M90 C;  1QNU A;  2WB1 G;  1SLJ A;  2BA1 A;  4P71 A;  1VQ8 A;  2FFK B;  3VYR A;  4A93 B;  5ELF A;  3VA5 A;  2R92 B;  1YHB A;  1HZ9 A;  4HSP A;  2DY8 A;  4UDU C;  3HKS A;  4H44 C;  1AP0 A;  3NWS A;  1L0Y B;  1YHA A;  2KA7 A;  3O13 A;  4YWK A;  1TT2 A;  1HR0 Q;  3TME A;  4TKO B;  1X3E A;  1ENC A;  3OHX C;  4KV6 A;  4ALP A;  2Z4I A;  4AYB E;  3T1H Q;  1KAW A;  1HRJ A;  2M2L A;  1BF4 A;  1SYC A;  4KJN A;  3KBG A;  4APV A;  3UE1 A;  1HUM A;  4DR6 Q;  3TRE A;  4YY3 Q;  1HNW Q;  2NB0 A;  1SNM A;  2OQ0 A;  4X3K A;  5M5Y B;  2EQS A;  5EGT A;  4GKJ L;  4A4I A;  1VS0 A;  4R1J A;  3LWU A;  3H3V C;  2XWB B;  1WTO A;  4A3G B;  3E0E A;  1EIY B;  4L5R C;  1WCM B;  5JEA H;  1LTG D;  5HUR A;  2BE5 D;  1EQV A;  5C44 H;  2B29 A;  3VR5 A;  3CCU A;  2F0U A;  2LXJ A;  2JA5 B;  1CKN B;  5LL6 X;  1UNS A;  2VB2 X;  3VR3 A;  3Q24 A;  4LUO A;  1D5Z C;  2I5H A;  2XRQ D;  2IL8 A;  3A54 A;  4KY5 A;  5CV9 A;  3K0Y A;  1JJ2 A;  2CW0 C;  1HNX L;  4DV1 Q;  1EU4 A;  1N32 L;  1O7L A;  1XXG A;  3TZD A;  1JOQ A;  1QG7 A;  1RKN A;  1Y1W G;  2X69 A;  1TWF H;  3UDX A;  1EL0 A;  4QQB X;  1AZQ A;  4HR7 B;  5HGT A;  4DNI A;  1CZG A;  4KD4 A;  3G48 A;  1VQG A;  3NSW A;  1TQO A;  1JC7 A;  1MIU A;  1ILQ A;  5C3W A;  3PO2 G;  3I72 A;  3NTK A;  4LFA Q;  3I4O A; 
#chains in the Genus database with same CATH homology
 4X66 Q;  1N8R C;  4EQ5 A;  2Y0S E;  1M1K C;  1Q7Y C;  3L0O A;  2E5L L;  5IWA L;  4JI1 L;  3RZD H;  3AFQ A;  5EAY A;  4DR5 Q;  4A76 A;  1Q82 C;  3T1Y L;  2HHH L;  5J3B A;  5IYD G;  1KC8 C;  1T9H A;  3GD7 A;  3DM3 A;  1B70 B;  1EUJ A;  4AQY L;  5M3M H;  3HOZ G;  3JAM i;  1VQO A;  4A3K H;  1I94 Q;  4JBM A;  4LF9 Q;  1X55 A;  2MO1 A;  2CFM A;  4L5T A;  1K83 H;  4X6A H;  3D0F A;  1VQB A;  4IJH A;  5LMU Q;  3S1N H;  1I6H H;  4QGU A;  1HZB A;  2R7D A;  4BY1 G;  2NVY H;  3GTG H;  1QUQ A;  1VQK A;  4HJ8 A;  1AE3 A;  1GKH A;  1X54 A;  5IYC G;  2JA9 A;  4C3J H;  4QIW E;  1YNX A;  3T1H L;  1J6Q A;  3CD6 A;  1VQ6 A;  1UE1 A;  3HFZ B;  4DPG A;  2R93 G;  4YWM A;  1K3R A;  1OXV A;  5IYB H;  4C3I H;  1YIJ A;  3S16 H;  4A3F H;  4DKA C;  5IP9 G;  4IO9 A;  3T1Y Q;  3M4P A;  1LM0 A;  4YWL A;  2HHH Q;  1U5K A;  1CKO A;  2WB1 E;  1QVG A;  3NEL A;  4JI5 L;  3U4V A;  1KQS A;  3W5O A;  4A93 H;  3KDF A;  5AJ3 Q;  1H95 A;  4YY3 L;  5GAD C;  1IBM Q;  3STB D;  1HNW L;  3GTL H;  1Y1V H;  4AH6 A;  4A3M G;  2JA8 H;  3HOU G;  2MFI A;  3OTO Q;  1FJG L;  1NMF A;  2BH2 A;  1CKM A;  3S2H H;  4WJ3 M;  4A3E G;  1YZ6 A;  1K73 C;  1PH5 A;  1WI5 A;  1EFW A;  3PUX A;  1IBL L;  3PIO A;  1Q46 A;  2NN6 G;  1YJ9 A;  1TWH H;  4R4O A;  3ZJY C;  4DV5 Q;  2R92 G;  4JYA Q;  5GQO A;  1QVF A;  4POF A;  1LUZ A;  1VQD A;  2RF4 A;  5GAH C;  2R7Z G;  2LXK A;  5IP7 H;  2OCE A;  3TS2 A;  1KXL A;  1OXT A;  3CCL A;  1SR3 A;  4A3J G;  3S1M H;  4YCV A;  4BA1 I;  3K0X A;  3I4N G;  1C0A A;  3TRZ A;  4A3C G;  2K4K A;  1G6P A;  5IE8 A;  3CC2 A;  3KJP A;  4A3D G;  2IX0 A;  2DUD A;  1G51 A;  1X3F A;  2IHF A;  1QVC A;  4JOI A;  3VDY A;  4DUY L;  5H1S E;  1PH8 A;  3HOW G;  3RNU A;  4GLA C;  2BA0 A;  1UE5 A;  4JI8 L;  3JC6 6;  3PIP A;  1IYJ B;  1NBW A;  3SGI A;  2B3G A;  3HOX H;  1A62 A;  3EN2 A;  4DV1 L;  2I0Q A;  4LFB Q;  4OON A;  1MJE A;  3BJU A;  3M4Q A;  5ELO A;  3GTO H;  3NBH B;  4WJ4 A;  3ULJ A;  4HJ7 A;  1J5E L;  2YYZ A;  3H3V I;  1YVC A;  4B3R L;  4OO1 I;  4LNQ A;  2VS1 A;  2ZM6 Q;  3DLL A;  4PZ6 A;  2KCM A;  1VQ5 A;  4JI0 L;  1VCI A;  4P73 A;  2XGT A;  3J7Z C;  4A3B H;  2ZJR A;  4GOP A;  3FKI H;  2QEX A;  2HIX A;  1UE7 A;  3UDI A;  4DV6 L;  2ZTD A;  2UUA L;  2YU9 H;  4A3G G;  4BBR G;  1D7Q A;  3J81 j;  1WCM G;  2IT1 A;  1Z9F A;  5GAG C;  3UE0 A;  3J81 i;  3A5U A;  3M3Y H;  1KRS A;  3M85 A;  3J80 c;  4Y7N H;  5M5W H;  4DUY Q;  2KCT A;  2WFW A;  3HOY H;  4KHZ A;  3UDF A;  4LFA L;  3KDF B;  4GS3 A;  4X66 L;  4B3M Q;  2A8V A;  3K8A A;  4JI2 Q;  5IY0 A;  3F2D A;  1X56 A;  4IPC A;  4DR5 L;  1PH1 A;  1TWC H;  4KLK A;  4LF4 Q;  4OX9 Q;  1CUK A;  3FP9 A;  2NVX H;  3I7F A;  3PO2 H;  2JA7 H;  2NN6 I;  4B3R Q;  3GDE A;  2PI2 A;  2ID0 A;  1A63 A;  3A5Z B;  4JI0 Q;  5IT9 c;  1QZH A;  3STB C;  1P8L A;  1L2F A;  4YCU A;  2VW9 A;  2DGY A;  5M3F H;  4UPA A;  2YTY A;  3BU2 A;  1I94 L;  4LF9 L;  5JEA G;  1PH3 A;  3ERS X;  4PZ7 A;  4P74 A;  1Q1B A;  4OXP A;  5FLX c;  2VQE Q;  5LMU L;  1N36 Q;  1I3Q H;  1VQ7 A;  2UU9 L;  1BKB A;  4A3I G;  2NVQ H;  2MQH A;  4KHP Q;  5IYD H;  4DV7 L;  5C44 G;  2B63 G;  2CKZ B;  4JBK A;  2N78 A;  2QA4 A;  4X65 Q;  1EWI A;  4DK3 C;  2ZJQ A;  3BZK A;  4LW1 A;  4B3T Q;  4QJF A;  2RHS B;  1E24 A;  3PO3 H;  5JEA J;  2BH8 A;  2CCZ A;  1XTD A;  1N34 Q;  1E3P A;  4DAM A;  1HJP A;  3NEN A;  2R6G A;  3PV0 A;  3A74 A;  5AJ3 L;  5IYC H;  1IBM L;  1EIF A;  4HIO A;  5FLM G;  1IXR A;  2CWA A;  1UEB A;  3H0G H;  1GO3 E;  1HZA A;  3KJO A;  4HID A;  4HIK A;  2R93 H;  1LTL A;  3OW2 A;  3EIV A;  3S1R H;  1IBK Q;  3OTO L;  3KF8 B;  4X62 Q;  3PF4 A;  2UU9 Q;  4C2M H;  5IP9 H;  3GO5 A;  2CWP A;  3PUW A;  4IPG A;  4DV7 Q;  1KIX A;  4OO1 G;  1VQN A;  5LMN Q;  3I4O A;  4JCV E;  3UDG A;  3M4O H;  1NMG A;  2VL6 A;  3E9H A;  4DV5 L;  4JYA L;  3MXN B;  4GN5 A;  1OTC A;  4LF8 Q;  1SRO A;  4R4Q A;  4NXN Q;  3I4M G;  4A3M H;  2A1A A;  1VQI A;  3CCV A;  1OXS C;  3CF5 A;  4DR7 Q;  3GTM H;  4MZ9 A;  1XMO Q;  4LWC A;  2OTJ A;  2GVB A;  1XNR Q;  2D0O A;  1OXX K;  2AMC B;  1LYL A;  4BA2 I;  3RLN A;  4DR4 Q;  3OYY A;  1MKH A;  2AHO B;  1VQE A;  2CQO A;  4NPS A;  1L0W A;  1XJV A;  2N3S A;  2R92 H;  3CPW A;  1YIT A;  2R7Z H;  3WWV A;  1AE2 A;  4LUZ A;  1O7I A;  2KEN A;  4A3J H;  3PF5 A;  4DR1 L;  1W2B A;  3AQQ A;  2E2I H;  4LFB L;  3I4N H;  5M3M G;  4DR2 Q;  1YI2 A;  1E1O A;  1NJI C;  3S1Q H;  4HJA A;  3KYH C;  2QGQ A;  4A3D H;  2Q2T A;  3U50 C;  3HOW H;  2PI2 E;  2ZM6 L;  1JE5 A;  4BY7 H;  4R4C A;  4LF6 Q;  1NTG A;  1C7Y A;  5C3E G;  3S24 A;  2AKW B;  1V1Q A;  3B6Y A;  3E9I A;  2UXD Q;  3FHW A;  1PVO A;  1K0R A;  3I56 A;  3F8T A;  3CCM A;  1Q86 C;  2V1C C;  4IJL A;  4DAY B;  4MTN A;  1BVS A;  1PFS A;  2H5X A;  4H02 A;  2RCN A;  4UP8 A;  5IYB G;  2F4V L;  1KD1 C;  3KLW A;  1B8A A;  2OQK A;  3PUZ A;  4JOI C;  1CSP A;  5M5Y H;  1YEZ A;  2Z6K A;  4BXX G;  4B3M L;  4POG A;  2JE6 I;  4DR1 Q;  4JI2 L;  3K7U C;  2R7F A;  1NE3 A;  1E22 A;  4JI6 Q;  4P72 A;  4B3S Q;  4LF5 Q;  1BBU A;  1WFQ A;  1N9W A;  5C0X J;  1N33 Q;  4A3G H;  3JAM c;  4GKK L;  1IZ6 A;  1Y1V G;  1E7Z A;  1WCM H;  1ASZ A;  1YBY A;  4LF4 L;  4OX9 L;  2MO0 A;  1QZG A;  2ZTE A;  2RHQ B;  2FXQ A;  5BR8 Q;  5HGQ A;  2K5N A;  4QY7 A;  4XTC S;  3GTK H;  2JA6 G;  5JJL A;  1QUQ B;  4EX5 A;  4DUZ Q;  5FJ8 H;  5ELN A;  5C4J H;  3HKZ E;  3HKZ G;  4GOP C;  2JA5 H;  1N36 L;  4PZ8 A;  2VQE L;  1S72 A;  1PA6 A;  3PUY A;  4KHP L;  4GN4 B;  3CCR A;  1L1O A;  4R4I A;  1Y1W H;  4BBS H;  1L1O C;  2PQA A;  4A3L G;  1GM5 A;  4JG2 A;  1XPR A;  2F4V Q;  1Q1E A;  2F3I A;  1A0I A;  2GN5 A;  4PG3 A;  4X65 L;  2OTL A;  2UXC Q;  2JK8 A;  4B3T L;  4O0A A;  4UP9 A;  2E2H H;  2VY3 A;  3EBE A;  4JBJ A;  4DV3 L;  3I2Z A;  4DV2 Q;  2K5H A;  1N34 L;  1VQM A;  2C35 B;  2ATW A;  3CC4 A;  3GTJ H;  4A3I H;  4GKK Q;  4JBW A;  1XMQ L;  2UUC Q;  4OWX B;  1Q81 C;  2ZTC A;  4GNX A;  2IY5 B;  3A0J A;  2WAQ E;  2WAQ G;  4GNX C;  1S40 A;  2Q2U A;  4OWW B;  4IFD J;  3HOX G;  5JJI A;  4JI3 Q;  3IRB A;  1P16 A;  3CAM A;  4JI7 Q;  2A19 A;  3K7A H;  1PH6 A;  4YHH Q;  1IBK L;  1VQP A;  3AEV A;  4TQU S;  4X62 L;  2K14 A;  1YHQ A;  4K0K L;  1I5F A;  2E2J H;  3Q8D A;  4LFC Q;  4C3H H;  2YTX A;  4A3B G;  1R9T H;  1C9O A;  5LMN L;  5C4X G;  1KHI A;  4GKJ Q;  2I5M X;  4UY8 C;  3S17 H;  3FKI G;  4HJ5 A;  4LF8 L;  2ASB A;  3HOZ H;  4HIM A;  5FLM H;  4NXN L;  4JI4 L;  4XIG S;  1VQC A;  2EXD A;  2UXB Q;  3AYH B;  4DR7 L;  3HOV G;  4DV3 Q;  1XMO L;  2F52 A;  2OWO A;  4NXM L;  4LUV A;  3G4S A;  1XNR L;  4GLV B;  2YV5 A;  4DV0 Q;  2L15 A;  1RL2 A;  1XMQ Q;  3H3V H;  3ULP A;  4DR4 L;  4AIM A;  4DR3 Q;  4RMF A;  4BY1 H;  3ICE A;  1GD7 A;  1JB7 A;  3TEH B;  1TXY A;  3CW2 C;  3J7A 5;  2JEB I;  3S14 H;  3I4M H;  2K75 A;  3KOJ A;  1K8A C;  2UUB Q;  4NB3 A;  4YCW A;  3H15 A;  3G6E A;  3KF6 A;  3U58 A;  1K9M C;  2HT1 A;  4K0K Q;  2PNH A;  4GOP B;  4DR2 L;  2K50 A;  2Y0S G;  3NEM A;  1HNX Q;  3PSI A;  5M3F G;  1SN8 A;  3CP0 A;  3K80 C;  1KL9 A;  2KBN A;  5E7N A;  1L1O B;  3CC7 A;  2PQA B;  3CCS A;  4LF7 Q;  2VUM G;  1N32 Q;  1G29 1;  4LF6 L;  4JI4 Q;  4IFD I;  4L5Q A;  3J81 c;  3HOU H;  2Q2H A;  5GAE C;  4IOC A;  4NXM Q;  2UXD L;  1W3S A;  3U4Z A;  4A3E H;  4O2D A;  1VQ4 A;  1HNZ Q;  3RZO H;  2E8G A;  2HIV A;  4DV4 Q;  1EQQ A;  3W1B A;  3S15 H;  5DLQ E;  1PHJ A;  3CCE A;  3RN5 A;  2N49 A;  3PO3 G;  1VQL A;  2KHI A;  4JC0 A;  4KI0 A;  1XNQ Q;  4DK6 C;  1BBW A;  2VQF Q;  4GNX B;  1FL0 A;  4P75 A;  1PH2 A;  1SMX A;  1VQH A;  1HZC A;  3M7N A;  4X64 Q;  5C3E H;  4JV5 Q;  3PCO B;  3G71 A;  4JI6 L;  1UE6 A;  1SRU A;  1WYD A;  3PUV A;  1S3O A;  4QL5 A;  1HR0 L;  4B3S L;  3L7Z C;  1MJC A;  4LF5 L;  1X3G A;  1N33 L;  4HJ9 A;  3I55 A;  3H0G G;  1D8L A;  2KHJ A;  4A3C H;  3ULL A;  4TVA B;  1X65 A;  4UP7 A;  5LMN W;  2N8N A;  1VQA A;  1V9P A;  3CQZ H;  4A3K G;  2E5L Q;  1FGU A;  1CKN A;  5IWA Q;  1V43 A;  5HY6 A;  3RLO A;  5BR8 L;  3J80 i;  2IX1 A;  1VQJ A;  4JI1 Q;  1XPU A;  1M90 C;  2NVT H;  1AH9 A;  4BXX H;  1X9N A;  2MNA A;  4ME3 A;  4GLX A;  2WB1 G;  1SLJ A;  3K81 C;  2BA1 A;  4P71 A;  4DUZ L;  1VQ8 A;  4DR6 L;  1RIP A;  1EOV A;  3PGZ A;  4AQY Q;  1VQF A;  3GTQ H;  1PYS B;  2D0P A;  2NZH A;  3MEF A;  1YHB A;  5C0X G;  1HZ9 A;  1K8G A;  3HKS A;  2ALY B;  1EYG A;  4A3F G;  3ER0 A;  1PV4 A;  2IHE A;  2UXC L;  1OXU A;  3F1Z A;  1DGS A;  1Q12 A;  2JA6 H;  1YHA A;  2Z6K C;  2NZO A;  2LSS A;  3S2D H;  4A93 G;  4YWK A;  4RG1 A;  3RLF A;  1HR0 Q;  3AFP A;  4DV2 L;  1XPO A;  1SFO H;  2JJQ A;  1TWG H;  1UWV A;  1X3E A;  4ALP A;  1CSQ A;  4AYB E;  1NY4 A;  4AYB G;  4BBR H;  1KAW A;  3CCQ A;  3T1H Q;  2UUC L;  4A3L H;  2D62 A;  3KF6 B;  3CMA A;  2JA8 G;  1E1T A;  4JI3 L;  2YTV A;  1PH9 A;  4APV A;  3KFU A;  2PMZ E;  3L2P A;  3CCJ A;  4JI7 L;  4GN3 B;  3UE1 A;  1U0L A;  4JI5 Q;  3TRE A;  4YHH L;  4DR6 Q;  3F2C A;  3RN2 A;  1YJN A;  4YY3 Q;  1HNW Q;  5JJK A;  1A8V A;  4LFC L;  4BY7 G;  5IP7 G;  1FVI A;  2OQ0 A;  2EQS A;  1FJG Q;  4GKJ L;  1X6O A;  4A4I A;  1VS0 A;  4R1J A;  4IFD G;  1PH7 A;  4FDB A;  1IBL Q;  1TWA H;  4OWT B;  1WJJ A;  1Z47 A;  3E0E A;  3CME A;  1EIY B;  4L5R C;  2UXB L;  1ASY A;  1HR0 W;  1PH4 A;  4DV0 L;  4L5S A;  5C44 H;  2B29 A;  2ZJP A;  5C4X H;  3CCU A;  4DR3 L;  3RR5 A;  2B63 H;  1EQR A;  2K5V A;  1WOC A;  5GRO A;  2VNU D;  3M9B A;  4IPH A;  1JJG A;  1B7Y B;  2LXJ A;  3LGJ A;  1CKN B;  1Y14 B;  3W1G A;  2UUB L;  4LUO A;  3HOV H;  2I5H A;  4IOA A;  2GVA A;  5K36 G;  3D31 A;  2ES2 A;  2EIF A;  4JI8 Q;  1JJ2 A;  1KRT A;  1JMC A;  1HNX L;  5FJ8 G;  3TQY A;  1IL2 A;  1PYB A;  4A75 A;  5C0X I;  4DV1 Q;  2JA5 G;  2AWO A;  1SE8 A;  4IPD A;  3GTP H;  3CXC A;  1I50 H;  4LF7 L;  3CPF A;  1N32 L;  4PMW A;  4MNO A;  1YJW A;  1Y1W G;  4BBS G;  3BZC A;  1J5E Q;  1TWF H;  3UDX A;  2JQO A;  1HNZ L;  1GVP A;  1Q8K A;  3HOY G;  2AWN A;  3TS0 A;  4DV4 L;  1VQ9 A;  4QQB X;  4J15 A;  2VZA A;  1JT8 A;  4DNI A;  1XNQ L;  4DV6 Q;  2HQL A;  3G48 A;  2VQF L;  2UUA Q;  2Q2I A;  2VUM H;  4Y52 H;  1VQG A;  2Z0S A;  1MIU A;  4X64 L;  1JJC B;  3F2B A;  2JEA I;  4JV5 L;  3PO2 G;  2JA7 G;  2XTI A;  4R4T A;  1HH2 P;  2K52 A;  2WP8 J;  5M5X H;  4LFA Q;  2I5L X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...