5GRUH

Structure of mono-specific diabody
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
240
structure length
240
Chain Sequence
VQLVESGGGLVQPGGSLRLSCAASGFNFSSSSIHWVRQAPGKGLEWVASISSSSGSTSYADSVKGRFTISADTSKNTAYLQMNSLTAEDTAVYYCARGYYYTGLWYPYAMYEFGMDYWGQGTLVTVSSGGGGSDIQLTQSTSSLPASLGDRVTISCRAGQDISNHLNWYQQKPDGTVKLLIYYTSRLHSGVPSRFSGSGSGTDYSLTISNLEQEDIATYFCQQGNTLPWTFGGGSKLEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of mono- and bi-specific diabodies and reduction of their structural flexibility by introduction of disulfide bridges at the Fv interface.
pubmed doi rcsb
molecule keywords Maltose-binding periplasmic protein
molecule tags Immune system
source organism Escherichia coli
total genus 56
structure length 240
sequence length 240
ec nomenclature
pdb deposition date 2016-08-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5gruH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5gruH01
3TIDA 1PW3A 2GTZB 2A9NL 5I1DB 3VXRB 1WFNA 4PG9A 2GCYB 2GJZA 3PP3K 3ZDZF 1KACB 1NGYB 3G6JF 3F7QA 2EE2A 2CR3A 1CFVH 3X12A 3O2DH 2CXKA 1U6AH 2D2OA 5DVMA 2H2PC 2F8OA 4DFHA 3CUPA 3VRJA 1YN7B 4WI3A 5CP7A 1GOFA 1X4ZA 3AXLB 2Q87A 5HHNA 5HD8C 2MJWA 5ESVB 5IB4B 5DI8A 4RMRA 4NKIH 3PABA 1IGFL 2UZYB 3NN8A 4DOHE 2O5ZL 2FX9L 3HI5H 1JYWA 5INCB 2D7QA 2BP3A 3I6GB 2C3WA 3NABH 4GS7C 1VFMA 4FFZH 3CX5K 3HFML 2DM3A 3OAYH 5DD5L 3WL9B 1AD0A 1OARL 3QNYB 3IDIA 4W4OA 3KPTA 3O6ML 5ICXA 4A2MA 4OI7A 4I3GA 4KZEL 1CFTB 3HE7C 3QI9D 5CSBA 4LDOB 3ETBF 3RGVD 3ULVD 2D0HA 3EJYD 3IXAB 4ZMAT 1OAZH 2BVQA 4PY7B 5I15L 2IBGA 3O3EA 2W92A 3FMGH 1JNLL 3X17A 4JFQA 4DKFH 2XRAH 2VDNL 35C8H 4PJGF 2ADFH 3DVIA 1TJHH 2CRIA 1DBAL 5TQ0H 2EDTA 1TZIB 1PYWA 4LSRL 4MDJB 3RX7A 3HMXA 3V7AE 1VACA 3R06B 3VXPA 4HUVB 5CEZL 1WIPA 2E9WA 1ZGLM 4RDQF 3DMMD 3KPSD 5D1ZD 4XVUD 4WO4D 4MQXD 2AJ3B 3H3BC 3BEWA 3QDGA 4KJQC 1IM3A 1H5BB 4X5WA 2Y36L 4K3DL 5CJXC 4X98A 1FSKC 4L3EA 5KS9A 3HG1B 3O8XC 5D4QA 4BH7B 1A3RH 1CGUA 2G9HB 4YHZH 4YPGB 5A2KH 4S2SA 5IFHH 5IROC 4UDUA 3QIUA 5BS0B 5ID0A 4NQCA 5E08H 4I5BB 2OI9C 4YHPB 3RWGA 1NFDE 2P49B 1JNJA 3T77A 4WY7H 2DQFA 3TJHD 2BDNL 2VZ3A 1IEBA 3R1GH 4RMQA 3TESA 1U8IA 1YEIL 4K3JH 1HQRA 4DZBB 1MJ8L 4WEUD 5C2UB 1SYSB 3BN9D 4HZAA 4TTDD 3TZVD 4X80L 4NKOA 4TN9A 5I1HH 3MBEA 3GB7A 3O6FA 4NPYA 2X70A 1DVFA 1E4WL 2NW3B 4OGYH 2J12B 2A74B 5F72S 4PUBL 3TCLB 3CFIC 3ZE2F 2CRZA 2M2DA 1IFHH 1MI5A 2ZUUA 4X6FA 3OJMB 4KUCF 1LEIB 1T0PB 5DJ6A 3M1BB 1H3VA 4NZRL 2YPLD 3I9GL 5CGTA 1X7QA 3SOBH 3PQYE 5KJRH 3P4NB 4U33A 1T5WA 3I3DA 4ONGL 3MXVL 5E8PB 4L5FL 5JW3H 2OZ4A 3OGCA 5DR5H 2EYSA 3BXNB 1Q72H 5DD6A 2D7NA 1XF3B 1JWUA 3EOTH 2NY1D 1EMTL 3KWWA 3ARGD 4ORGA 4B5EA 3PV7A 3QUXD 1PGRB 1QRND 3K2MC 4LARH 1PX3A 4MXVF 4N8VB 3JV6B 4PG2A 4Z78A 3LH2H 2N1KA 4R2GC 5C0AD 4FFYL 3QH3A 1QKZH 4ZO8A 2ID5A 2Z8RA 1UC6A 3BKML 4G8GB 1C7TA 1MEXH 1NCBH 4NP4H 3T3MF 4NUJB 3MLRH 5IOPA 4HPYL 2Z31C 5LCVH 7CGTA 2VKXA 5A40E 1CD8A 1KCSL 5F7UA 2WUCH 4KQ3H 4OIAA 4ALAL 4BK4A 1IC4L 4P5TA 1ORSA 4Y5YA 2LAAA 2OTUB 3ZO0A 4C59B 5E8NA 5EFIA 2YPVH 3PV6B 4PV8B 2DQDL 4FQIH 1C5CH 4JVPA 1ORQA 3EYQC 4G9FD 5CEXA 2IQAB 4AIOA 4JRYA 1T1ZA 1UZ8B 3H3KA 4AQ1B 1BQLL 3D0VB 1BOGB 3QJHA 3QDHA 3PHOA 4BQ8A 3V6ZA 2NY2C 5HGAA 1M7IB 1CCZA 4HW6A 4YO0B 2IAMA 4D0CA 3W9EB 4JRYE 1OGTB 1QFPA 2UWEE 3BH8A 1FIGH 4K9EC 5D1QC 1DBKH 3QAZC 5JO5B 3BZ4A 3WO4C 2FGZA 1CL7L 4E5XA 5I8KH 3RUGB 3ET9F 1BD2E 4KMTL 1S7TB 4Q9RL 3SDYH 1W8OA 4K7PL 3NMEA 1Q9WA 5FA3B 4HGKC 1M71B 4KKLC 3GIVB 1RURL 3FKUS 3QT2A 1U3ZA 3STBA 5J12B 3FO0L 4RMSA 3BT2L 4NC2B 3VDBA 3UBXG 1VFAB 2C3XA 4YX2L 3HTLX 3KGRA 2ADIA 5F89A 5TDPB 3P2TA 5C0NC 4I0PB 2Z92A 1CL7I 3MLZH 2DMBA 3VXSE 5D2LE 1YNLL 4E41A 5B4MC 2YD3A 3DRQA 1V8HA 3B9KC 1XZ0A 5EZJA 2Y7QB 2A6DA 4DVRL 5C0FB 4POYA 1QFUH 1TJGH 1FNFA 4JKLA 2NLJA 5D7SL 1XGRB 1CXLA 5GGTA 2HT3D 3NZ8B 4LDLB 4QWWC 1YMMB 2VOTA 1CE1H 1MFNA 2YD4A 1INEL 1GOHA 5I1EL 5IEKB 5IGXH 4XVJL 3EW3B 3MRBB 4GXUM 3HPJA 3PNWB 3T0EC 4WEBH 2WBWB 3P4LA 4IIQA 1BEYH 2JB5H 5F6HI 1A5FL 5DRZB 1RZIA 4HUMB 2GT9B 4OFYD 2XXCB 4L9LA 1P4IL 3QHZH 4X7CC 1A2YB 1P2CB 2QSTA 5GJSL 4PJDA 2DYPD 3L9RA 4PP2A 5F7DB 3BGMA 2FIRT 5HVHB 1S5IH 3LS4L 4IRSB 5JIHA 3B43A 1AE6L 2IBZX 4E42B 4M8VA 3MV8D 4OM0H 3A6BL 1Q1JL 4G8IB 1FVEB 3QWQB 1H3PL 3DLQR 3GIZH 1EGJL 1QSFB 2BNQD 4OCSL 5F88A 5HHVL 4JZJA 5D7LA 1CLCA 4XPHL 4NM8H 4PJ9D 5KVFL 3NH7L 2IPKB 2FSEA 3D18A 2EIBA 2XZZA 4F2MB 1I75A 4MJ5A 1N2RA 2J8UB 2NPLX 3UTTB 3PG2A 1B6DA 5EU3A 2NXZB 5GRWA 1I1AC 4TUKL 4WW1B 4I1NB 5B8CC 1NBQA 4JLRA 1T21B 3GI8L 4QNPE 1B0GB 2Q86B 4PJEB 3HE6C 1U8NB 4P48A 2L7UA 3I50H 1RZFL 2AK4A 5EWIH 3HMWL 1MAJA 1AY1H 3VMPA 5DT1H 3EYUL 5GS1A 1UWXH 1ZHKB 1BIIB 3GZKA 5SWSB 1XIWA 3V4UL 2KPNA 2I07B 1C5BH 5D7JC 5ABDE 5GGRA 4MYWB 2GTZA 4Y2DB 4ZQKB 5LKNA 5I1DA 1FGVH 3P9WB 3VXRA 2GCYA 3FJTA 4ZFGL 4ONFL 2ESVB 4OFIA 1I7ZB 2I25N 5JA9A 4CJ0A 5GS2D 3ZKNC 1WJ3A 2AJSL 3MRKB 3EBAA 4QRRE 3GI9H 4LKCA 3TV3H 1YN7A 1OAYH 1QBAA 1FO0H 2OL3B 5J9PB 3AXLA 1LO2H 4KI5F 5IB4A 4HIXH 4OQTH 2CK0H 4PBVC 4JFFD 4KGLA 5C6TL 1QR4A 2WWKT 2L7JA 3F65A 1A7QH 2R0ZH 5INCA 1H3XA 4JE4B 2ZPKL 3IGAB 3WHXB 4J6RH 5FYKU 4FQ1H 3I6GA 4AY0A 1KYOK 1LEKB 5DUBA 1XGYH 3QRGH 1Y6NR 3HNTH 3FB7B 2NXYD 4RBPK 1EA9C 5JA8B 1CFTA 3WS3B 1NAKL 3QWOB 4RDQG 2PF6A 2AK1L 4W4OC 4EI6B 1YA5A 1SJEB 5F1OB 2EE3A 2YA0A 4DUXA 2P5WD 3IXAA 4OFKA 3VFTB 1GYAA 4PY7A 3DGGB 2KZWA 3HRZB 4L4VD 4LHUG 2VDLH 4P3WA 4HT1L 2BNRB 3EAKA 4OD2B 5J3HC 2AJUL 5HSFA 1TZIA 5IVNA 3ULUD 2AS5M 4PFEA 4R6UA 4MDJA 3R06A 4WI8A 4ZDHB 5J7CC 4HUVA 3N06B 1BFVL 4KKNA 3V8OA 3SGEH 1A6WH 3QO1A 4Z95H 2XWJB 3QCTH 5FCUL 1GRWA 2AJ3A 3B5HA 5E03A 1H5BA 2D7TH 1F2QA 3B83A 1KIPA 1U8QA 3MGAA 4JN2B 4PB9L 2MKWA 5FKPA 4Z8FL 3RWJA 3FFCD 4BH7A 1U58B 2HLFC 2G9HA 3ORJA 4PJ5D 4YPGA 2O5YL 3AUVA 5KVGL 1FE8H 3MJ9A 4UQ3B 3SO3C 1FJ1B 5BS0A 4TOYL 3GMNA 3S5LB 4G3YL 4YHPA 4C57C 4RCAA 5MP6L 1NMAL 3UTQB 3NOIA 5L2JB 1LK2B 1J0KA 3QIUC 4M1DL 4KU1A 4EXPX 2VYRE 1DQML 4K94L 3VXOB 4NGHH 4NFCA 4R2GD 5DFWH 3F5WA 5E2TL 1AD9B 4DZBA 4B41A 1QFOA 1SYSA 4CVUA 1VGEH 4YBQC 4F57H 2WBJC 3BKYL 4H25B 1M6OB 2VUYA 2VLKE 1F42A 5IMKB 2E7LA 2PTUA 2BVYA 1BQHG 3S4SB 2YK1H 3MBEC 3O6FC 4X5LA 2A74A 1X5HA 4M7JH 3T2NH 1N0XL 1A1OB 1DVFC 1LMKA 3MRDB 3DUSB 3TCLA 5B38G 4ZS7H 5I0DA 1JGVL 5MEQB 3IFLH 1PJ9A 1LEIA 2DJ4A 3I2CL 3M1BA 3RRQA 2DIJA 4RISH 4J3XA 3RAJH 1FYTB 1MF2L 3P4NA 5JW4R 5DD3L 1LO3H 2UY6A 2I27N 3D39B 4MA7L 4PY8J 5E8PA 3WUZA 2CLZB 1J10A 3BXNA 3TIEB 2FL5B 5IVZA 1XF3A 1F4XL 4M93B 5GS0L 3R0NA 2OTWB 3OF6D 4BKLA 4Z6AT 4O4YH 4N8VA 3JV6A 2EDOA 5E0QA 5JOEA 1TCRB 1BOYA 5D1QD 3O3DB 4W6WB 4G8GA 4PG2C 4NQTA 2GSIB 4NUJA 4IOFC 3QNZA 5HVWA 2IPTL 2AGJH 2GQHA 4L8CB 3TFKC 5EC2B 4NO3B 4KKLD 1B2WH 1IGMH 5GSRB 3OKKA 3O4OB 3RWCA 5KSBF 2AXFB 4D9LH 1KNOB 3QDJB 2OTUA 1CQKA 4HS8H 5J1AB 1J1OL 4WFGE 3ALPA 2W9LA 3P4OB 4LCUB 5C0ND 3PV6A 4PV8A 1A7BA 2F74B 4HD9A 3T1FB 4LVOC 5JW5A 2E9BA 3FT3B 5L0QB 3CPLB 2IQAA 4WHTA 4GRWB 2HTKC 4GRLB 2ENSA 1FGNH 2IQ9L 5EA0H 2FO4B 5B4MD 5DO2D 2JJSC 4KJWC 3D0VA 5ALCL 3B9KD 5KVDH 2GITB 4X6DE 2X4OB 5TE6L 1M7IA 4YO0A 1Q9KB 3W9EA 1SYVB 5BJTB 1LP9E 4LOUD 2I24N 1OGTA 4CN6A 5IW3A 1WTGT 2IAMC 1H15B 2N7BA 5HBBA 2Z9TA 4AMKH 5JO5A 3HI6L 3MUHL 1UG9A 3VXMA 3RUGA 3ARBD 3TEUA 4QRUB 3MO1B 1S7TA 4JDTH 4YWGH 5FA3A 3H7BB 1M71A 4M5YL 3GIVA 5IB2B 3SGKC 1FV1B 2WIMA 4OCLC 1TTFA 1JZ7A 1TVHB 5TDPA 4Z7NF 3MLXH 5FA4B 1CLOH 5CSZB 3VXME 3CVHH 4RAUB 4Y4KC 2JCCB 1UM5L 2DLFL 3BWAB 2H32H 5DZLA 4JY4B 2SEBB 2AQ3A 1ETZA 3SDCC 4TPRL 2NR6C 3MRNB 1J8HB 1NGWB 2Y7QA 2BNQE 3C5SB 1QLRB 2BMKB 4I4WB 4YE4L 5FCSH 3PF2A 5C0FA 3ULVF 5EU6B 3K4DA 3WFDL 2QLVB 4RMTA 4ZAKB 1UM4L 5EH1A 4ODVL 3U6RB 1XGRA 1I1AD 3AMLA 1MNUH 5FGBC 2PYEB 3VI3E 1R5WB 1YMMA 4ZTPH 4LPVA 5J8OA 5IEKA 4H8WL 5B3JE 1YDPB 4GJTB 4IS6B 1AGDB 3MRBA 1I1RA 4ZD3H 2R0WL 3OAYK 4ETYA 3LQAH 2ZNXA 4JREC 4PRAB 2ZUWA 2QV2A 4EOWH 1J0IA 2Q76A 3MV7D 4WI6A 5DRZA 3ARDD 2LU3A 1RZJC 2VRAA 3H8NA 1IGIH 2GT9A 4IIQC 2WP3T 1A2YA 5D7KD 1J5OL 1MCHA 2BY1A 5F7DA 1T20A 4IRSA 4QXWA 4E42A 3V7AG 4X9IA 3CLFH 3D48R 4A2LA 4G8IA 3KJ4B 1ZS8B 1FVEA 3QFJE 4V1DB 1QSFA 3ZKND 1GGBL 3I75B 1WF5A 1BZQK 3ISWA 1S7RB 3VFSB 4EDWH 2IPKA 3V0WL 1ZMYA 2D3VA 4JZJC 1VPOL 4WW2F 4F2MA 1KTDA 2J8UA 1MJJB 3UTTA 2W65A 1OAQL 4WW1A 3INUH 4QOKE 5KAQF 1T21A 4JGMA 4NZUH 1B0GA 2Q86A 4PJEA 4OZGE 1U8NA 3WNLA 4D9RE 1RMFH 3BP4B 5GIRB 1DEEA 5HXMA 4XP5H 2X4TB 2R29L 4JPKH 1WIOA 1ZHKA 3W2DH 1BIIA 5SWSA 1FZOB 4M8QB 4PJAE 4H1LH 4ODTL 2I07A 4LSTH 3QHFH 5I1GH 4ZQKA 5EUOE 3HS0B 3K4ZA 4NQEE 4WJ5B 5SX5K 1NCDH 4HV8B 1X5GA 5DJ2B 1XIWC 4DCQB 4N9GB 1KPVA 3UJIH 3C08L 2VZTA 1EXUB 2ESVA 3FQXB 4G6MH 3L1OL 1MFDH 2YD5A 3UC0H 1XF4B 2CRYA 3MRKA 2UZIH 1BF2A 4YXHL 1JZ2A 3VU2A 2OL3A 5FKAB 4PLOB 5J9PA 5F7HA 5FYJU 2BSTB 3WXVH 3SDAB 2DMCA 4WCYH 3KS0H 3IGAA 1JPSH 2R4RL 3QDGD 4I77H 1NJ9B 5BV7H 4MS8D 5CBAA 3BD5A 3FB7A 3C09C 3EIFA 3EJZC 4HFUH 4L3ED 3RY6A 5A1AA 2O5XL 1I1FB 1S7SA 2V5SA 4EI6A 4YZFE 1SJEA 2VXVH 5CKAA 3O3AB 1T2QL 4IEFB 3VFTA 3D69B 3DGGA 3QCUH 3HRZA 3H9SE 5DYOB 3W11C 1ITBB 2ZG3A 1Q0XH 2XNAB 2BNRA 4HUNB 5F8RC 2VDRL 4OD2A 3RTQB 3WKNA 5E99H 1BZ9B 4LRNH 3UBXI 4MAUH 3V6OE 4JFZH 3D9AH 4RA3A 4ZDHA 2HP4A 4J3SA 2CQVA 1IGYA 1RY7B 1V3LA 3PL6B 2XWJA 3O6FD 3TPUB 2XA8H 4H20H 4KJYB 1KN2L 5I30L 1DQQB 3LMJH 3WNOA 1XEDA 4YEEA 1BMGA 1J1XH 5I76B 5C07B 4PJIA 3KAAA 3NACH 3SKNB 3MOBH 1HXYB 4JN2A 1MI5D 3WCYA 3HKFA 3DYOA 4DAGH 2ATKB 1U58A 3RKDC 3QULB 2DBLL 4YQXH 5FDWB 3EFDL 4UQ3A 1M7DB 4P57B 4YDVB 4MDIB 4OI9A 3S5LA 3TA3B 4PJIE 1MCNA 1N59B 2YZ8A 3ARSA 1H9VA 3QG7L 3S88L 3HB3C 3UTQA 2JKXA 1YNKL 2BSED 1LK2A 4GBXB 5CUSH 5L2JA 3D2UB 3QZWB 1EEZB 2EZ0C 5C0IB 4EKXA 1AD9A 1YYML 4NBZB 4F9PC 5EBWB 1MQKH 1NLBH 4PJXF 3L5IA 3S9DB 5C3TA 1DSFH 1PKQE 2E27H 2AV1A 3BIKB 2F53A 4IOFD 3NTCL 4H25A 1M6OA 2I60H 3ZYZA 5IMKA 3FHAA 3WN5B 3IDNB 4FTVB 3S4SA 2JJWA 1CFSB 5EOTA 1IAIH 2LE9A 3MRDA 2E7LC 3DUSA 4OLWL 3LAFA 2OYPA 2QSVA 1I85C 1WCBB 4P5TD 1KTLB 5MEQA 2X05A 1FL6B 1FPTH 4M7KL 3QXVA 5CD5C 4MXWL 4R26L 4LU5L 5DD1L 1NSNH 1KV3A 4AEHL 3D39A 4IBLT 1I9RH 1ND0B 2CLZA 5JUEL 5GRZA 3FTGB 3TIEA 4GG6F 3NA9L 2VERN 3Q1SH 4LQFH 3MA9H 2DQTH 2OTWA 1WCQA 2DM4A 2W9DL 1C08B 4XXCA 3VD3A 5LGHL 1KF9B 1SBSL 5KVEH 3EDKA 2IAMD 2VDQL 1TCRA 4ZFOB 3V5KA 4U1MB 3O3DA 2B5IC 2EDHA 1NBZB 4WFFD 1KB9J 5GZNC 2X9XA 2GSIA 3U7WL 1RUQL 4XPAH 3RZCD 2QQNH 4FHBD 1QFWH 2Z35A 4C54A 3BRDA 4L8CA 3VDAA 5F7EL 5EC2A 4NO3A 4K07A 3EUUA 5GSRA 3LQMA 1EBPA 4NO0D 3FRUB 2AXFA 2VXUH 1KNOA 3QDJA 2CKNA 5GGQL 1U3YA 5J1AA 3D1MC 1NCCL 3NFNB 3P4OA 4LCUA 3MJGX 2F74A 4OSUH 3ZYOA 3T1FA 1PFCA 1NEUA 3FT3A 5GHWL 3CPLA 4KTDH 4Y16B 1Y6MR 4GRLA 1DP0A 1FBIH 3TWCL 3S36H 5CIPH 5HJ3A 2FO4A 1MCSA 1ROWA 2GITA 4G8FB 2X4OA 4E41D 4FMKA 3QDMA 5JQ6L 2WWMC 3KPRE 3OSKA 2FGWL 1Q9KA 2XY2A 4J3WA 1ZGLP 1SYVA 2P5EB 3IDXH 5BJTA 3HR5B 2YN3A 3MFGB 4MD5B 4NN6C 5LGKA 5MENE 4KTEH 3B2VL 2XPGA 3V52H 1NANH 4OZFH 4YUEH 4P59L 4TVPL 1RIHH 5LXGL 3REWB 4W4NA 4QRUA 3MO1A 1OAUH 3KXFE 1R6VA 1RIUH 1ZVYA 4YHML 2MSPA 3KYOB 5EBGA 3H0TB 4BFEA 3WDIA 5IB2A 4MA8H 5D8JH 1FV1A 2YRZA 4JRXB 5FB8B 3MV7E 4JFOA 2JJUA 1TVHA 5IF0A 1AKJA 1UWEL 3QEQE 1WSST 5CSZA 1YEHL 4XPGH 4OZIB 4RAUA 5J12C 1I7TB 2Z0BA 2JCCA 4PGBB 5D7KE 1F4WL 2YUWA 1K85A 2ARJB 5EO1B 4TNVF 4XHJC 4G7VL 2OJZL 2QEJA 2JE8A 1QG3A 2SEBA 1GL4B 1N5AB 3DX7B 4I3RH 4L4TE 3MRNA 1J8HA 1NGWA 4WU7B 3ZE0F 1PBYA 3C5SA 5I74B 3GSRB 1QLRA 4I4WA 5D7LD 5GS2H 5EU6A 4ZAKA 4QTIH 2HRPL 5D93C 3D85B 2WZPD 4Z7WA 2R4SH 2PYEA 1R5WA 1EIBA 3GJFA 4P2CG 5E70A 1DZBA 4H1LG 1YJDC 1KEGL 4IS6A 1AGDA 1EDQA 1JGUH 3ULUF 1IQWH 4PRAA 2BERA 4S0TD 2Z93B 3BKJH 5IK3B 5MHSE 2R23B 3BE1H 1EO8L 3CFCL 4NKDB 2AK4D 3CLEH 3N1FC 5F9OH 3Q3GB 1EHXA 4U1GC 2PYFB 3OKNB 4YFEA 5E6ID 1JGLL 4NCDA 4KAQL 1FNGA 5DUPH 1BHGA 4M1GH 1AGCA 4P9MH 2DQGL 2RQ8A 1R3KB 2F54E 4UV4L 4UT7L 3VXRD 4XVSH 4CVWA 2F19H 1KIQB 1ZS8A 1ZHLA 4IRSC 2AJZB 4V1DA 3H9YA 3SQOL 4XC3H 4QHUA 3I75A 1S7RA 1P4BH 3VFSA 3ARRA 3S6CA 1T7YA 5E94A 4GW4B 3P9MB 4X6CF 4P49A 2BK8A 3MCG1 3PHQB 1TVBB 1MJJA 1YUHB 4OM1H 4DKAA 1NCAL 2EDYA 3ULUH 5EZIH 3BPLB 1NUFA 3AS2A 4RMWA 1F6LL 4IM8A 4H0HB 1G9NC 4W6XB 1YQVL 4DN3L 3BP4A 1UA6L 5GIRA 3OWEA 1HNFA 3MLSH 1LDPL 4MNGB 2X4TA 3OJ2C 5ILTH 4KVCL 4TSAL 4MZ2A 1R5VB 1EZVX 1FZOA 4M8QA 3SE3A 4GRMB 1OGAB 5E4IA 3HS0A 4WJ5A 2R8SL 1BJ8A 3S36X 5C0BE 5HYSG 4DCQA 4PJFB 4N9GA 4XMPH 2CK2A 3MACH 1EXUA 4HKZB 4OUOA 3SKUD 1HXMA 4MB3A 3W11D 1ZHNB 3W39B 2QSCL 3FQXA 2R9HD 3O0RL 2ILLA 5F9WB 4JB9L 1XF4A 5F97E 3S96B 4OI8A 1HH9B 3Q6GH 4XTRC 4P2OB 3SGDI 5FKAA 3TN0B 1CLZH 4Z7QF 2HFFB 4M6OH 4OLUL 3OB0H 4LLDB 5CEZD 2VXQH 2YUVA 2BSTA 2B39A 3TT3H 5CGMA 4GOSA 5JXAL 3SDAA 2WLZA 4Y0GA 4OBSA 2ZOLB 1N26A 3UTOA 4ZFFA 1MCPL 4X0KB 3KDMB 2FJHB 1KENL 2WIIB 1FFOB 1OD9A 2D0FA 4AQOA 3BGAA 5AZ2L 1CVSC 1QLEL 4OF3A 3HG1D 4JO2H 1I1FA 4PYHA 4K8RL 2EC9U 2AJXH 1T6WA 5I2IB 1VFOA 1YYLL 4KZDH 2QBWA 1BIHA 3O3AA 3TVMB 1BFTA 1BWMA 3MRHB 3D69A 4EBQH 3PXHA 3HC3H 5DYOA 5BS0D 2KZ1B 4KTYA 1OTTC 4N0UE 3JWOC 4HC1L 2WAHA 1PY4A 3RTQA 1EO5A 1F3DJ 5DDHA 4X8XA 1EJOH 4PJBF 1AHWB 3I6KA 3X14B 1HHJB 1OCWL 3UZVB 1MELA 2KBGA 5FHBH 1B0WA 3BDBA 4DGVH 2Y06H 3EYFB 3TPUA 5J13C 4G42B 5KANI 4KJYA 5F6IB 1N5YL 1DQQA 4PJCB 5C07A 2XIDA 4PLJD 1G9ML 3SKNA 5HHXL 5CD5D 3EOAB 4QGTA 4L29B 5D7IF 4ISVB 2ATKA 3LHPH 3A6CH 3LS5H 2FWOB 3VFWB 3KLAB 2KKQA 5FDWA 2VLMD 1CD0A 3OG4B 4I13B 3RPIB 1M7DA 4X7TB 1I4FB 4P57A 1NLDL 4YDVA 1ZT7B 3TNMB 3VG0L 2W9EL 1N59A 3MBXH 4UTAH 2E8ZA 4GBXA 2O26U 3D2UA 3QZWA 4JHBA 1EEZA 1Q38A 5DHVB 5C0IA 4K2UL 3L3IB 5EBWA 5TFSH 3MX0A 2GJ6B 3BIKA 3TCXA 1U42A 4X4XB 5E24E 4Z7UB 2VLJA 4G8GD 4WFFE 1ZTXL 2YOCA 3IDNA 4FTVA 4JZOA 4Q9CA 1CFSA 3BEVB 1F45A 3AVEA 2X6MA 5IR1B 4Z0XB 3MA7B 3JVGA 3VG9C 1AFVH 1FORH 4ZOCA 4LF3B 2DQCL 3QJFB 5C2BL 5D72H 1WCBA 1KTLA 1FL6A 5EIQA 5JXED 5IT2H 2VLJE 3QEGH 5E9DD 4L8SC 3W9DB 2V9TA 5FYLE 2V7HB 5CBEB 1ND0A 5IM7B 2QQLL 4JANB 3FTGA 2HKFH 2P7TB 3GBML 5BO1L 2Q1EA 2AEQH 2X7LA 4X7SH 4DEPC 2WWMD 5AG8A 4YHIB 2EH7H 1CTNA 1C08A 1IAMA 5DJDB 4M93C 1E6OL 1PKOA 1NQBA 4EN3B 5IP4A 4ZFOA 2BXZA 3AM8A 4U1MA 5FUZL 2PR4H 1NBZA 1B4RA 3LKRB 2VLLB 1LE9B 3RL2B 4XP6L 2FEDC 4JQVA 4OCRL 1QYGL 1C7SA 1W0VB 1EFQA 1ACZA 1Y18A 3UTPE 1BFSA 3FRUA 3RNQB 5DVNA 3T4AB 3PP4H 2IFFL 3NFNA 4JRWA 5JHDA 3E1F1 4KRPB 1H3GA 4NJAL 4Y16A 4KK6C 3TP4A 2BFVH 2MKLC 4I0PD 5FUOH 1OP5H 3MXWL 3ZKXC 4XHJD 4MQTB 4U2ZA 1I3VA 5BMFH 3ILQD 4JO1L 4LMQE 1KSRA 1KPRB 2GAZA 4PJHE 3SKMB 4G8FA 5JHDE 1GGYA 3M17A 1MCJA 2F58L 2VLRA 2P5EA 2XN9E 3HR5A 2VABB 3NAAH 4OZHB 4MD5A 3VW3L 3HR6A 3UTSB 3JV4B 1EH9A 5C7XH 3CX2A 1A6PA 1JGEB 3KJ6L 4KDWA 1I9IH 1RVFL 3UX9B 1K3IA 4QTHB 4PRPE 4KMQA 4FQQA 3REWA 3MNWB 1FLRH 2AQ2A 1YMMD 3KPMA 3O6LL 1U3HC 4JG0H 5EU4B 3KYOA 3H0TA 3EO9L 4IDJL 4C56B 1FN4B 2RFXB 1T80A 5B22A 4AEFA 5DXWA 3KPNB 4OZIA 3E3QC 2ZUYA 3T09A 1I7TA 4PGBA 1XF2B 4R7NB 1SBBA 2ARJA 5EO1A 1W2KT 3WFBL 5GJTH 2GFBB 2H41A 4PJ7B 4KV5E 4JFXB 4IRSD 1CFQA 3JV5A 5JR1H 5KS9F 3RL1B 1N5AA 3HC4H 4JY6A 1CIUA 2IG2H 2PNDA 3DX7A 4M6ML 5BOZG 2FJFA 4WU7A 1KCVL 1QSFD 3ZT5A 3TF7C 3GSRA 1LO4H 5EUKB 4M62L 3PHSA 3RDTA 3D85A 3H7LA 1T22B 3PGCA 5FYJL 4LCIL 1FFNB 5DMIH 3UTTD 2NXZD 2FATL 2ZKHL 4RIRB 3MUY1 2I9TB 1G1CA 4PLNC 4NZJA 2PXYB 4DKDC 2E9JA 1MIML 4APQB 5IK3A 3SKJL 4P3DB 4POZD 1K2DB 4U1HA 5GGUA 4NKDA 4Y8AA 5FK9B 4RX4A 3Q3GA 5E2UL 2XG5A 4JHWL 4U7SA 4OFDA 3OKNA 1QBML 4GKSA 4NKMB 4R90L 1MJ7H 4XP4H 4PGEB 4XNUH 3I84A 5SWSD 3CU1A 3KLSA 4LSSH 4Y2DD 1R3KA 1SEQL 1MWAL 4O58H 1KIQA 4LSQL 4MHHG 3WS6A 1V7NL 2ESVD 1EK3A 2VO5A 5LG1A 3QUMB 4RMUA 4GW4A 3P9MA 5K33A 4MB4A 5JLZB 5C0RL 3PHQA 1L6XA 2COQA 4LSPH 3EZJB 2ADGB 1HYSD 4KPHH 1AQKH 2XQBH 4FN0A 1PZUB 1CK0L 4ZTOH 2Z4QB 2BSRB 3VGHA 1FRGH 1BFOB 5SWZD 2YKLH 3DETC 4Z0BL 4D3CH 3ALXA 2R15A 1VFBB 4MNQE 3N85L 4D94A 3NZHH 4MNGA 3MCLL 3BSZH 4F58H 1VGKA 3SEPA 3VFVB 4CVZB 1R5VA 4GQ9L 4P2RB 2ZCLH 4PS4L 4XBEL 3IAGC 2GEEA 2X1OA 3U1SH 1VSCA 4GRMA 4O2EB 1OGAA 1QP1A 1A47A 3QA3B 5D5MB 4NC0B 1AI1H 4PJFA 3SE3C 5H37H 4HKZA 4Q74A 1MFAL 1ZHNA 3L5XH 4XP1L 4PB0L 3SBWA 3W39A 1OTTD 3SJVB 3S96A 1JPTL 1HH9A 4OIIH 3IU3B 5F7MC 3MRGB 4P2OA 2BNRD 4QXGH 3DSNA 3TN0A 1SY6H 3D25B 3HUJB 2HFFA 4RGMB 3IRZA 5T3ZL 4LLDA 5HI5C 4S1RL 1OOAA 1V5JA 3O6KL 2VL4A 2X1PA 1KJ2B 5LWYL 1B0RB 2ZOLA 3SDDB 1ZHBB 1YEFL 3VWKB 1KJ2L 3WD5L 1N6QL 4Q6IB 4UIKH 4X0KA 3KDMA 3GBLA 5JORB 4HAGA 2E6JA 2VC2L 3SDAC 1FFOA 3WFCH 3FQUB 3RA7L 3ULVL 3DWTA 4Q9QL 4I48B 1MFBH 2EDXA 5AG9A 3B5GA 4UQ2B 5CJ5A 4ENEC 2ZUSA 3RJQB 5I2IA 1MCLA 2RIKA 1V3MA 4N5EC 3TO4B 3TVMA 3PDDA 1J8KA 3MRHA 4HCRL 1MCDA 1CDBA 1R3IH 1T7VA 3LRHA 1OP3H 1JZ3A 3X11B 3BX7C 5DWUH 2ZSWA 3B8SA 3BGFB 3GJEA 1AHWA 4NQDE 3O3UN 3BO8B 3X14A 2FB4L 4LIQH 4UBDD 3Q6FB 4RFOL 8CGTA 4O5LH 1QA9B 1MREH 2ZUQC 3REVB 2IMMA 3EYFA 4G42A 1PAMA 1W0WB 2NNAA 5J11B 4RNRB 1YEJL 4NNPL 3U7YH 4ELME 4CN1A 3MLWL 2LTQB 3S3JA 1TXKA 4PJCA 2EDQA 4M00A 4ODSH 3O41B 3EOAA 1FZMB 4GT7A 3FB6B 3LEYH 4L29A 3S37H 4ISVA 4NO2B 2FWOA 5FYLH 3TJEH 4HMEA 5E9DE 3KLAA 1FYTD 4L8BB 4HPOH 2GK0B 3D87B 3RPIA 4LAQL 4X7TA 1I4FA 3D39D 4MSWB 3TNMA 3MGTB 1ZT7A 4LSUH 3M8OH 2DI7A 3G6AB 3MLUH 4Y7MA 1JE6A 4AG4H 4D2NA 5GS0D 4OGXL 2R2BB 2VN4A 1KELL 1CLYL 4PJDF 5DHVA 1NC4A 3WYRA 3O2WL 4R4BB 3L3IA 3L95B 1UEYA 4GBXC 1UJ3B 1QSEE 4XVTH 3AGVA 2Q20A 1S9WB 4Z7UA 2FEEL 1BLNB 5GGTH 2GY5A 3BEVA 4AIZB 4U7MA 5IR1A 4Z0XA 1FCCA 3MA7A 5JQHC 4P2QB 3V4PL 4LF3A 1BECA 2R56L 1ZANH 1RUML 3QDJD 1M1SA 5BZWB 1QD0A 4MB5A 3W0WB 3ZKMC 1CICB 1R0AL 3VFGL 1NFKA 4KK6D 4GSDL 4U3HA 2FEEI 3D3VB 4ZS6C 3QXWA 1UFUA 5CBEA 2MQ3A 5IM7A 4JKKA 4GRLD 4PTUB 2P7TA 1RU9H 1HSBB 1F3JB 3WLWD 5CJQH 3BRGC 4XC1L 3IDJB 3GUTB 1JRHH 4U1SB 4YHIA 1W72B 1A6ZB 2MNUA 1PG7L 5HYIA 2J1KA 4XBPB 1A7OH 1IM9B 4P3CH 1OTSC 2XTLA 4EN3A 4HBCH 1IC7L 4UZGA 3WSQL 2WANA 2FX7H 4DGIL 4U1JB 2ZUVA 3LKRA 2VLLA 1AJ7L 2DQUH 4DW2H 1RUPH 3AM8C 3AY4A 1UWGH 3RL2A 3ROLB 2O93L 3K1DA 4AL8H 1W0VA 2FYYA 4PTTB 3S35L 1DLFH 3CK0H 1K6QL 4TNVK 2QJDA 2XTJB 4JQVC 4TSCH 2UV3A 3SDXB 2O61B 1AXSB 1WFTA 4JKWA 4KRNA 4OD1L 3RNQA 3T4AA 2Q7YB 3MROB 3T2QA 1BAFH 1T1XB 1P84K 3H3PL 3HAEH 4FRWA 4G43B 3RJDA 2QR0B 3ESVF 2CUMA 3IXTA 5C09B 3ZDXF 5D6DA 2A9NH 5I1KL 5HYQB 1LEGB 4Y16C 1YPZE 2P42B 4NRXB 1CF8L 1KPRA 4PJ8B 3JWDL 1P7QB 3SKMA 4F7MB 4P9HL 5ERWB 2Y5TB 4UMGA 3CDGB 4LPXA 2IH3B 3OXSB 4PD4K 1F90L 1J8HD 2BHYA 2VABA 5I19L 2KUTA 3UTSA 3MV9E 1CVRA 5EG6C 5EU6D 1NAML 3VFRB 1JGEA 4ZAKD 4CJ1A 3DGCR 1TPXB 4U3XA 4Z9KB 3HZVB 4CKVX 4QTHA 1JPST 3MNWA 2PYED 1DQTA 2CDFB 4CRPA 3ZHKA 2WM0A 1IGFH 5EU4A 2O5ZH 2FX9H 1N3NB 4S1QL 3GMMB 4IDLA 5GISL 5ACZB 3ROOA 3ARZA 4C56A 2RFXA 1IAII 2NY0B 3HFMH 4NZTL 5DD5H 3S37X 3SE8L 3FQWB 3KPNA 1OARH 4M61B 1CGXA 1J11A 1XF2A 4R7NA 3O6MH 4KZEH 2MHAB 1OPGL 4G6KH 4WI9A 4HX1B 2GFBA 4OUUB 1LK3L 5HHMB 4JFXA 4D9QD 4HEPG 2UY7A 4PRHB 4NWUL 4WI4A 5I15H 2W0FB 4WU5B 2XKNB 4JCLA 5I0ZA 4V1DD 1RK0B 3DXAB 4AT6A 1JNLH 1DE4B 3CXDL 3WIHL 4Y1AB 2VDNH 1S7XB 2A6JB 4B7IA 1RJLB 1DBAH 1T22A 1WC7B 5I74C 3I6LD 4MA1B 1CDJA 1FFNA 4LSRH 3RDTC 4QXUL 1YEEL 5CEZH 2YRLA 4RIRA 2I9TA 3DETD 2CXGA 5LAXB 3LD8B 3CXHJ 5H37G 3HNSL 2BVPB 4APQA 3KPOB 1YY9C 4P3DA 5SWZE 1ZLSL 3ARFD 5D70L 1K2DA 5KTEL 5FK9A 2Y36H 4K3DH 1K4DA 1A02N 2CJUL 5EZOL 4NKMA 2J8HA 4PGEA 4OAWB 1JWSB 4OCXL 3K2UL 4AZ8A 1MJUL 1KJMB 4JHZA 4ZODA 4NO5B 4P46A 4X9BA 1KIRB 1G6RB 4BELD 3MV01 2EC8A 2NYYC 4JFEB 3WV0A 2FNBA 4P99A 3VFNB 3IFOB 3QUMA 3PWPE 5JLZA 1OB1B 3WS6C 2BDNH 3VRLF 4GS7B 1N8ZB 4XNYL 1YEIH 5L6YL 25C8L 2DF3A 1MJ8H 5E8EB 5GGSY 4Z7OE 1KC5L 4X80H 1FFRA 1U0QA 4GAFB 5FGCB 5AWNL 4LVEA 2Z4QA 1NANI 3HE7B 2BSRA 3BPLC 2FH6A 4XAKD 1BFOA 3WDHA 2JB6B 2EIZB 2H3NB 1E4WH 4GO6B 2E5EA 3O81A 3SDAD 5DMJB 3MCKA 1U6AL 1A4JB 1VFBA 4XNXL 4JPWL 3VFVA 4ZUVB 4JQXA 4CVZA 4XNZB 4P2RA 1R3LB 2FHBA 4WUUB 5IHZB 4LLYB 4NZRH 2VXTL 5DHYA 5D5MA 3I9GH 3QA3A 3I3BA 4N5ED 4NZDA 4EIGB 3BESR 4ONGH 3GK8L 3MXVH 4L5FH 1G9EA 4MNHB 3RVXC 4I2XA 5EBLB 3SJVA 4UI2A 1Z0NA 1U93B 2FX8L 5A2IH 3SBWC 3IU3A 3U9UB 3UXFA 3MRGA 5T5FL 1VEOA 1UCTA 3D25A 3RTQD 1IRAY 3HUJA 1FSKB 1IGCL 1YY8B 4P2OC 3V6FA 4FFYH 3TN0C 3O8XB 3K4AA 3BKMH 5I8CA 1HILB 3GRWL 1IZJA 5D9SB 4I2XE 4XMLL 3NCJL 3PL6D 1B0RA 1TIUA 3LRGA 4BH8B 4HPYH 4KKBC 1ZHBA 1RV6X 3VWKA 4Q6IA 1F8TL 3ARTA 1KCSH 2D31A 3GSNB 3KYNA 4ALAH 5JORA 2OI9B 4HWBL 1IC4H 4JM4L 1D5ZB 3QUYB 43CAB 3GSNL 5DTFB 3FQUA 5C07D 2HT4D 1EFXA 4I48A 3RUGF 2RAMA 1UYWL 3T3PF 3ILPB 2PETA 1GPOL 5F1IB 1VADB 2DQDH 3VCLB 3PP3H 1T3FB 4FOMA 4MLSA 2YR3A 3MRLB 1YEGL 1O0VA 5I9QB 3T65B 3O4LE 3TO4A 5TDNB 5JOPE 5EBMB 3PJSB 4BZYA 5JMOC 4X8JB 5DMKB 3TA3D 1BQLH 1CXEA 1LO0L 5DC0A 2VTFA 1QEWB 3X11A 4GBXD 3D2UD 2K3TA 3BDYL 3QUZB 1BJMA 1Z9MA 1D6VL 4JG1L 4BUHA 4IRJC 5D71L 2D4FA 2C4XA 4QHNB 3U2SB 1QA9A 1BJ1H 1V7ML 3REVA 4RA0C 2ORBH 1X4XA 1I3UA 5DLML 4RNRA 1CL7H 1RZ8B 4QKXB 4JFDB 3OKLB 4FTVD 2VDML 1PDKA 4KMTH 3EOYG 4Q9RH 5IB3B 4K7PH 1UVQB 3GMPB 1P9MC 1RURH 1FZMA 2J2ZA 3NIDE 1OP5K 3FB6A 3FO0H 3BT2H 4GMTH 3U4AA 4IOIB 1N0LA 4YX2H 4ZS6D 4NO2A 1H3WM 1DFBH 5K9KB 4L8BA 2CKBB 2GK0A 4J8RB 3ZT7A 3TT1L 4MSWA 3N1GC 3NIFF 2CKBL 3MGTA 4J12A 3G6AA 3FT2B 2Z31B 2C3HA 2R2BA 4QEGA 1IFHL 3RIAF 2B2XL 4R4BA 1OTSD 5C0CB 3L95A 1A6VH 4DGYL 2Y6SC 1UJ3A 2V5RA 3MRIB 4C4KO 4DVRH 3PDOB 3TNNB 5C9JB 2HKHL 4CUCA 1A22B 5HYJD 2DQHL 4XCEB 5D7SH 3EYVB 1QNZL 4QRPE 3HAEG 1BLNA 1S78D 4AIZA 1INEH 5IVXE 5I1EH 3TGXA 4XVJH 5C0GB 2MCPL 2J8UF 4RGNB 2XV6B 3FOLB 3WNKA 4IRZL 2NY2B 4KMLB 5KOVC 5BZWA 3W0WA 1CICA 1DL7L 1NGQL 2EH8L 1AO7B 4N90E 4TUOB 1JTPA 1P4IH 3D3VA 5IESL 4PJEF 5GJSH 4W81A 4WFEE 2A77L 2QL1A 4Y16D 3RHWF 4PTUA 3LS4H 3QAZB 5I8EA 1VCAA 1AE6H 1HSBA 1F3JA 4BA8A 4K9EL 2LU4A 4PRIE 3A6BH 4YAQB 5T33H 1Q1JH 2CD0A 3IDJA 5DQDL 4U1SA 3GUTA 1W72A 1A6ZA 2HJLB 4MAYD 3CH8A 1EGJH 4RGOL 4XBPA 4OCSH 4X7FC 5HHVH 4LRIA 4XPHH 3IKKA 5KVFH 2XA3A 4D0DB 2P5ED 1KB5B 2I26N 2H26B 4U1JA 1MCRA 1KB5L 4TVPD 4NN5B 4EN3C 4OCYL 1KJ3L 4GH7B 4EVNB 5KW9L 2RHEA 3RVVC 4TUKH 3VXUE 3PWNB 1GC1C 4PTTA 3AY4C 3GI8H 3SDXA 3BZEB 2O61A 1E27B 1FZJB 4ZXBB 2Q7YA 1RZFH 3HMWH 4JRXD 3ELAT 3EYUH 2W0PA 3LSOB 1KN4L 1T1XA 4G43A 5I8KL 4KRPC 5C09A 2L4OA 1U2HA 1FNSL 1KEML 4YH6A 5HYQA 1LEGA 1N4XL 4LPUA 1S3KL 5L2KB 2LU7A 4NRXA 4ZFGH 1JHLH 1P7QA 1TZHB 4F7MA 5CCKL 4ONFH 5ERWA 2Y5TA 3MODL 4U1LB 3T0EB 2VQTA 2IH3A 3OXSA 3TC9A 2AJSH 5C08E 2LABA 3CMGA 3ZE1E 4Z7VB 1K3ZA 1AGFB 2ICWI 1WBYA 3VFRA 1ZGLB 4G6FD 5E4EB 3D85D 2FECI 3HZVA 4HJ0C 4OV6F 1MCIA 2J6EA 2WINB 1YY9D 5C6TH 4LP5A 4K7PX 1N3NA 5CZKA 2YD1A 3FO9A 4WWKB 5ACZA 2ZPKH 3WFHA 3ZDYE 3JTSB 4ZOEA 4CGTA 3VWJB 2X4PB 3KYMB 4DWHA 4M61A 2C1PB 1NGZB 2MHAA 4WTXA 5FO9B 2FO1A 3ZYJA 1NAKH 4HX1A 3TO2B 4OUUA 3QXDB 4HBQA 5GGRY 1LGVA 2AKRA 3AMKA 5B8CB 2NYYD 2W0FA 4WU5A 2XKNA 3WNPA 3VMNA 1RK0A 3DXAA 2C4FT 2CO7B 3HE6B 1DE4A 4HT1H 2PKDA 2V9RA 4Y1AA 1MHEB 1CGWA 1S7XA 2A6JA 2AJUH 4YDIL 3PIQB 3V6BR 1WC7A 4JFPA 5HHOE 2FR4B 4XPTL 2OR9L 3GFUA 1S7UA 1X5YA 5D7JB 2B4CC 4KK8C 1BFVH 3K74B 5D1XB 1PSKL 3UBXA 1LE5B 5LAXA 5CJOL 5F7NC 5FCUH 2PO6C 4ODUA 2BVPA 3KPOA 3A67L 4WIQA 4F33B 3CH1B 2IALB 4I0CC 1B4JL 3KLDA 2E9IA 1CIDA 4DK6A 3FRPG 4PB9H 4Z8FH 4OAWA 4DOHB 1JWSA 4GKZA 5JW4M 1UENA 1OP3K 1OGAD 2O5YH 5KVGH 1KJMA 3MR9B 4NO5A 5DEFA 2DAVA 4UNTA 5TF1L 4WI2A 1KIRA 4G3YH 2EDLA 1G6RA 2NY7L 4JFEA 4Z18A 1NMAH 5MP6H 3VFNA 3IFOA 4P46C 3PABB 4M1DH 3JTTB 3NN8B 1AXTL 1DQMH 4K94H 2AAVA 3IVKB 1N8ZA 3JZ7A 5E2TH 1T0MA 4P2OD 3PXJA 3TN0D 5E8EA 4G9DB 4HIIB 2BRRL 3BKYH 3DX8B 5AYUL 5F71A 4KKBD 3HE7A 3VFUB 4KKCD 3O2DA 5ICXB 2JB6A 3MJ8A 4PGZA 4NNYA 5EDXA 1A4JA 4ZUVA 1JGVH 1R3LA 1AP2A 4WUUA 5IHZA 2CIIB 3RVUD 3I2CH 4K8RD 4CW1B 4LLYA 2OP4L 4PLKC 4JFQB 4JQXC 1MF2H 1NDMB 1WAAE 5GGSB 2GSGA 5DD3H 1NMCB 4MA7H 1MHCA 5EU7E 3K81A 1MCOL 3IYLW 1QVOA 4OLYL 3TVMD 5DA0B 5EBLA 3G9VA 4FQPA 1O7VA 1U93A 3E6FA 3P0GB 1I1CA 5HDBE 5GS0H 3HMXL 4LEOB 1WEJL 4GRWF 1YY8A 5E2JA 4YNYA 1IM3B 1KT2A 5AUMB 3O8XA 1KCLA 2NMSA 1HILA 1NFDB 4RGMC 3B2UD 3DUHA 4BH8A 2IPTH 3CU7A 4S0SD 32C2B 3P73A 3L3OB 3DO7B 3G6JE 3GSNA 2NY5C 2YD2A 5MEPB 4S2SB 3NCEB 1D5ZA 3QUYA 4R4ND 43CAA 2DDQL 5DTFA 3VWKC 1U8LB 3QIUB 5ISZA 4NQCB 4PRDB 1J1OH 3BPOB 3RWGB 2FRGP 3ILPA 4Y19E 4JFHE 5F1IA 1VADA 3VCLA 1T3FA 3SE9L 1IEBB 2WBJB 3MRLA 4GW1B 3T65A 3OBAA 1TENA 5TDNA 5EBMA 3PJSA 3LZFL 5SWQB 2IQ9H 4X8JA 4GRWH 3RY5A 4U4BA 3HN3A 3A0OA 3MBEB 2E8YA 5ALCH 4NPYB 4JPVL 1QBLL 1M4KA 1QEWA 1BBJB 1EVUA 1DVFB 5ITFB 2JCCF 3EO1B 5TE6H 2NX5E 3OZ9L 3PQYB 3QUZA 3MMEB 2GIYA 3BD3A 5H2BB 3E6HB 2GJ6D 1OF2B 5JNYB 4QHNA 5EN2B 3U2SA 5HYJE 3SGJA 3VGBA 3HI6H 3KLHC 1RZ8A 4LSVH 4JFDA 3OKLA 4U6HB 5FEBA 2C9AA 1X7QB 2LV4A 1WICA 1CGSL 5IBTL 1T5WB 5HDOA 5IB3A 1P6AB 1UVQA 3GMPA 3OGCB 4ODXA 4JEGB 5T5NG 2LTQC 4RBPH 3LKNB 1KUMA 2OZ4L 2R1XB 4PJGE 5CGYC 4IOIA 5H8DA 1U8PB 1XCTB 4JVWA 3C87A 2C7UB 4LHUA 5K9KA 4TQEL 2A1WL 4J8RA 1JP5A 2AXJA 1UM5H 1UH4A 2DLFH 4PP1C 1CU4L 3BKCL 3ARWA 3FHQA 5TQ2L 2B0SL 1X5KA 2Z31A 2IH1B 3QCVL 1F02I 4XT1C 1UQSA 4GAJL 4KKAC 3DVNA 5C0CA 4TPRH 2WSKA 5CJBA 3MRIA 5E8DL 4WFHD 1O7SA 4PYGA 4KROB 3PDOA 1A8JH 4YE4H 1DTUA 5DRNB 3WFDH 4EN3D 1UM4H 4XCEA 4I9WD 4ODVH 4M7LT 3EYVA 4HZLA 2XZQL 4X4ME 3RX8A 1JWMB 3R0MA 1KPUB 4K3EL 4TVPE 5EFIB 4H8WH 2BCKA 2IFGA 4CMHC 1A9EB 2R0WH 5C0GA 1CG9B 1UM6L 1P53A 3T0XA 4F9LC 4NRZB 3AFLA 4HG4K 4XMKL 4JRYB 2UWEB 4JGJA 3SO5A 1T83A 4B53A 4NYLB 2PW2B 4U1KB 3ZDYF 1NC2B 4TUOA 3LEVL 4KRPD 5HGAB 1BD2B 2EXYC 4L9DA 1J5OH 1CICC 4H0IA 5HYFA 3P30L 4FFVC 1A1NB 1IGML 1HHHB 4QRSB 4M1CC 1JHTB 4XPBH 1GGBH 3ZE2E 3MGOB 3DUUB 4D0DA 2UVEA 1SJHB 3V0WH 2H26A 5E5UB 3UTSD 1NCWL 1VPOH 4LRIC 4ODHL 3VXSB 4BSVB 5B38A 5D2LB 5C86A 1AR2A 1DN2A 1D9KC 4EVNA 4Y4KB 1OAQH 2EICA 2D7PA 2WK2A 4YBLB 3PWNA 1CXIA 3GGWB 1BVKB 5IFAL 3BZEA 1E27A 1FZJA 4ZXBA 3O2VL 3SDCB 4MXVE 4C56D 4FA8A 4LASL 4NFDA 4WUKH 3R8QA 2R29H 3LSOA 4LL9A 1D7FA 2OQJB 4WRLA 4LGPB 1IJ9A 5F7YC 4ODTH 3T3ME 5T3XD 2HMIC 2IANA 4YWGL 3X13B 5JW4Q 3T08A 1ADQH 2CPCA 4HUWB 3C08H 1EHLL 2FJGB 1TZHA 5A2FA 3P40A 4U1LA 3T0EA 1L7TL 2OBGA 3L1OH 3LPGA 4JREB 1RZ7L 3HPJB 1R3JB 4YXHH 4LCWE 1JIBA 4Z7VA 4IIQB 1AGFA 5FYJD 2IANE 1RZJL 4URTB 5BRZD 3U4BL 5C0JB 2YC1B 4NM4H 4Z5RB 2VDPL 2AXGB 4H26B 2DJSA 1HCVA 1TPXC 4XCYB 2YEZA 2WINA 5DSCA 1RZKC 3ARUA 5HPMA 4WWKA 2PXYD 3JTSA 4APQD 3T2OA 3P0VL 4XP9L 2R4RH 1IC5L 3VWJA 1FG2A 2X4PA 3KYMA 3GBNL 3CSPA 4UNVA 4DKEL 4ZTPL 2O5XH 1NGZA 2EDKA 2NCMA 3TO2A 2BC4B 4ZD3L 3QXDA 4DUVA 1X5AA 4MMZC 1T2QH 5B8CA 1FCGA 2KL6A 1ZA3B 4LLWA 3PWVB 4HFWB 4I8DA 1JMXA 2DI9A 1MHEA 2VDRH 1RFDH 3PIQA 4OCWL 3TBVA 1PEZA 1HQ4B 1HEZA 5IMLB 3QI9B 2V5MA 2FR4A 5D7JA 3TBYA 4MA1C 4QRQB 5D1XA 2W38A 2EDRA 5ANME 1LE5A 4QRRB 1XIWB 4DZ8B 1KN2H 5GGRB 3VFMB 5I30H 4F33A 2EIEA 2ED7A 3CH1A 3LD8C 2VAAA 2IALA 4Q9BA 4UUJB 1RPQA 4HWNA 1ZOXA 4MJIA 3F6IA 1MCEA 4P2RD 2ZSVB 4KQ4L 4NDMB 4X7EC 2DBLH 4LKCB 4TULL 1J05B 3EFDH 3MR9A 1DQJB 1U8MB 1T2XA 3HRPA 5EU5B 3QG7H 4A6YH 3S88H 2X4SB 1YNKH 4MJIE 3SJVD 3JTTA 5K9QI 3IVKA 4G6AC 1IT9L 1YYMH 4F7TB 4ZUWB 2V5YA 4M02A 4G9DA 5T3ZD 3C09B 2GW5A 4HIIA 1U3JA 3DX8A 2DBJA 1I7UA 4PPTA 3NTCH 5DUBB 1MY5A 1OP9A 3CGTA 3VFUA 5HDLA 4ODWB 2YPKB 3QQNA 5J6HB 3SDDD 3AB0B 3VJ6B 1RD6A 3VWKD 4OLWH 1CR9L 2B1AL 2B1HL 2HVKB 4TYUA 5CZVL 3L5JA 4OQTA 4ZSOE 4M7KH 5EU7C 2CIIA 4NUGL 4AM0B 4CW1A 3ABZA 5CINL 4MXWH 4R26H 5FM4A 5J56B 4LU5H 4XNZC 5DD1H 3WJJC 1NDMA 2EDNA 5GGSA 4AEHH 2V5TA 2IADA 3H9ZA 3FO1A 5JUEH 5ADPH 3TO4D 1JPSL 1X44A 3NA9H 3D5OF 3OTTA 5BV7B 4F7EB 4D8PB 3F12B 3QO1B 4LEOA 4P23C 5DJCB 2W9DH 4CVXB 4G7YL 5LGHH 5CSGA 3L3JA 1SBSH 4K3HA 2VDQH 3P9LB 1S8DB 5AUMA 5E2WL 4YJZL 5F9DC 1KIPB 1U8QB 1NFDA 1CXFA 3U7WH 1RUQH 3QCUL 4N1HB 5FKPB 3RWJB 2XICA 32C2A 2W07A 3LB6C 3L3OA 5F7EH 3DO7A 3JBG7 4C58B 5IBUG 4B50A 4YR6A 4BZ1L 5MEPA 4WNQB 4OJFL 2AQ1A 1U8LA 5GGQH 5HYSB 4JJHA 3GMNB 3MJ9L 4PRDA 2EXWD 1NCCH 2VLKB 2E3VA 3RIAK 3QUYC 1QACA 5SX5H 3C2AL 1JFQL 4NOFA 2W0KA 5GHWH 2WBJA 4KI5E 5FGSA 3WE6B 4GW1A 3PE9A 3F5WB 1YZZA 3FFDB 3TWCH 5SWQA 2WWKO 1RIVH 4G5ZH 4U6TA 5I9QC 2XI9A 12E8H 4KKAD 3ECBB 4OLXL 5IMOB 4OZIF 1BBJA 1PZ5B 3MOBL 2DQEH 5ITFA 1REIA 3EO1A 5J89A 3PQYA 1D5MB 4LPCA 5JQ6H 3RI5F 4LGSB 2X10A 3MMEA 5IQ7L 1WWCA 4OFPA 5T1KB 5H2BA 1HOCB 3E6HA 3QUZC 1OF2A 1MPAL 3B2VH 5EN2A 5JNYA 3T0DA 1TQCC 2W1NA 4I9WE 4P59H 1P5VA 1DEDA 3MUJA 4TVPH 3MREA 5TH2B 4U6HA 3WUWG 5LXGH 3SGJC 4EQ2A 5HY9B 3RHWK 4P2QD 1N64H 4YHMH 2J8OA 1G7QA 2HG5A 1MQKL 3MQIA 3IRPX 3LKNA 3RWIB 4XBGB 5C3LD 5IVZB 4FXKB 3IS1X 2R1XA 4R8WL 1ZE3C 5FM5O 2FLBT 4XWGH 4JFYA 3ZZ1A 1U8PA 1XCTA 2GHWB 2EXYD 2C7UA 3W0WD 1UWEH 1CICD 1GSMA 1YEHH 5F96L 4BKLB 4Q7DA 1WITA 4HQQL 2B5IB 3D3VD 2H1PL 3OB8A 5IG7B 4NSKB 4F8TA 1P7HL 1GAFL 2IH1A 4G7VH 4J4PA 2OJZH 2E6QA 1TQBB 3IF1B 3MRQB 2X44D 3QNZB 4HXAL 3NCMA 2P24B 3S97C 3QBTB 5EC1B 2DQIL 1XCQA 1UB5B 1IM9D 3OKKB 5DRNA 3QXAB 4YIQB 1P4LB 3RWCB 2HRPH 3HCVB 5IBLD 1JWMA 1P1ZA 1KPUA 4X6DB 4YDJB 5FXCH 1WIUA 1R5IB 2J5LB 4F80A 1KEGH 3BZFB 4GQPH 1A9EA 5JW5B 4WHTB 2JJSA 1CG9A 4NRZA 1LP9B 5L9DL 2XTJD 4YPJA 1EO8H 2UWEA 2MWCA 3MC0A 1IQDB 1N7ML 2DOCA 4RGNC 1RHFA 1T89A 4NYLA 2PW2A 1YEDB 4U1KA 1NC2A 3UZEA 1ZLWK 1WQVT 4LK4A 4NN6B 1BD2A 1JGLH 1KG0B 1N6VA 4NT6A 3PWLA 2HMID 1T83C 3KR3L 4KAQH 4EDXA 3T1WA 5IEHA 1A1NA 5C09D 2DQGH 1HHHA 4YXKL 4QRSA 3G08B 4UV4H 3JWNC 4UT7H 3PWJB 4OT1L 1GGCL 4MWFB 1JHTA 4PJ7E 4PJ8D 4MJ2A 3SQOH 4TUJB 3VXMB 1T1YB 3MGOA 5DF0A 1T03L 3SGKA 4KI1A 3DUUA 4PJFF 1W0YT 2G5BB 1SJHA 3MJ7A 4KTDL 3LEXA 5CIPB 2F5AL 3VXSA 1Q0YL 4BSVA 1T7XA 5D2LA 2DL2A 4YDKL 1IE5A 1GIGL 1NCAH 1E4XL 3PWUB 4Y4KA 2VNCA 5BRZE 1NH6A 3CFJA 4IMKA 4TNWF 2V2WB 1U95B 4NN5C 4GUPB 4C55A 2BNQB 3GGWA 1BVKA 2A9ML 4GG8B 1YQVH 3I02B 3OMZA 3VGDA 1FP5A 5JZ7D 4DN3H 1UA6H 5DVKA 3SDCA 3VGAC 1MRDL 1LDPH 2NY0D 4ZXBC 4KVCH 1ETZB 4TSAH 5KSBA 2OQJA 3SGDH 3DVGB 1U41A 1E4XI 5D93B 2QHRL 3H42L 3C60B 5FGBA 2G75B 5DVOA 2R8SH 1RIUL 5F1SA 5TPWL 3X13A 4HUWA 5E1AB 4OV5B 5HHMD 5A43C 3GDBA 2FJGA 2BNUB 3QFDA 3BAEL 5D8JL 3L6FB 2QSCH 1A1MB 1YJDL 4CAGA 1VFUA 1OL0A 4PRHD 3O0RH 5KSBE 4JB9H 3IAQA 4YC2C 3WXWL 1B3JA 3DXAD 1R3JA 5EZLB 5K93A 4Y1AD 3WLBB 2Q76B 4U1GB 1OQOA 5C0JA 2YC1A 4OLUH 4EUPH 4Z5RA 3QFJB 5DMYA 2AXGA 4H26A 4XCYA 5E4EC 3DI3B 3JSSA 5JXAH 4GW5B 1PQZB 4HMDA 1ULVA 2DTSA 4U1IA 2XQYK 1FNLA 1A3LL 1P7KB 4V2BA 2CDGA 1T20B 1MCPH 3STLB 4JY5L 3UAJC 1KENH 1MCFA 4WWKC 2BHUA 2R4SL 1WGOA 4QOKB 1QLEH 5H35B 3VWJC 2H2PD 4PJCF 1MQ8A 1MAML 4K8RH 2BC4A 4AH2B 2D4DA 4OZGB 1YYLH 1XR9B 5HD8D 4NC1E 3IFPA 1KTDB 4C83B 2HT2C 1ZA3A 2W65B 3PWVA 1G9NL 5FGRA 4HFWA 5JHLL 4PJAB 4G6AD 1JBJA 4HC1H 4JFED 2X4NA 1KBGH 2MOVA 2K7QA 5EUOB 4NQEB 1QHPA 3L5WB 4Z7NE 1HQ4A 5DUPL 3KYAA 1TDQA 4HK3N 5IMLA 3GMRB 1OCWH 3QI9A 3CJJA 4JKPL 1OAKL 1DEEB 1ED3B 3OKDB 4QRQA 3AREB 4QRRA 4DZ8A 3HE7D 3ZTNL 1N5YH 3VFMA 4CNIB 3C8DA 5D1XC 2APBA 4QF1A 2XFXA 3R8BB 1KPVB 1KLGB 4Z7UF 1G9MH 1PY9A 4UUJA 5HHXH 3GNML 4AEIL 4N8PA 3ULVE 2ZSVA 4NDMA 3EYOB 4WUUD 3UCRA 4QYOB 1JHKL 2APFA 2OXHA 3DMMA 5D1ZA 1J05A 1DQJA 4YK4C 1NLDH 1U8MA 3VG0H 2OL3L 5EU5A 2W9EH 3NGBC 2X4SA 4FP8L 1XGUB 1SJVA 3WFEL 4MXQC 4H1LA 3JUZA 2WP3O 1OY3B 4K2UH 3VXTB 4KJQD 3KPSE 4F7TA 4ZUWA 1KJVB 4L1DA 5CP3H 5DVLA 3H9SB 4HS3B 3O8XD 5CBAB 1NBVL 3LB6D 3ME0A 1ZTXH 4LHJB 4ODWA 2YPKA 5J6HA 4M9OA 3VJ6A 1S7SB 4ZUSB 2HVKA 2DQCH 5C2BH 5J1SC 3QUYD 5I6XC 3JWOL 4I18B 3BI9X 4AM0A 1EVTC 1OVZA 1GGUA 4KHXL 2BJML 2Z8SA 1KGCD 1JYNA 2ZNWA 3Q0HA 2ZWLT 3DSFL 3L3KB 3DECA 4M48H 2QQLH 5T1DH 1TTGA 5F3HB 2UYLB 3GBMH 4F7EA 5J13B 4D8PA 5BO1H 1NMCC 1MAKA 2WQ8A 3F12A 1FL5B 1IGYB 1FNEB 5DJCA 1OSPL 1T66C 4CVXA 1XT5A 2YPLA 3O11B 1TNNA 2YBRB 5CJ8A 4FXGB 3QUZD 2APXA 3P9LA 1OTUC 1F58L 1S8DA 2EEDA 3GJFK 1CYGA 5FUZH 2AEPL 4PJIB 1U8KB 3G5ZB 4EBQL 2CRMA 1F2XK 3DVFA 3QUXA 4XP6H 1QYGH 4OZHF 5AZEL 2WW8A 5DJAB 2YPLE 4JFDD 1U8OB 1XMWA 3VE0B 3RVTC 4WNQA 1PKQB 1IVLA 4KI5C 1DQLL 5HYSA 4P2QE 1KCUL 1HDMA 2IFFH 2VLKA 5C1MB 3GSUB 4F9PA 1HINL 1X5LA 4KUZL 4DGVL 1QRNE 1F97A 3BPOC 3WE6A 3MUZ1 4NJAH 2XWBB 4JHAL 3MRCB 3FFDA 5KSVB 3MOAL 4KFZC 3MXWH 2VR5A 4WVRA 1QSVA 2AV1B 2YD9A 3WEXB 2F53B 4JO1H 3ECBA 4XH2B 2X4RB 5IMOA 5C0AE 1SMAA 4U05A 2Z31D 1PZ5A 4HIEB 5FUCE 3VG9B 4JDVB 3ZYIA 1D5MA 1H8NA 4O9HL 1I85A 5C0CD 3CMOL 2F58H 2YUZA 4PJ7F 5EOTB 5ITBL 2DM7A 1HIML 5T1KA 3RBSA 4U6VL 1HOCA 1XF1A 4L8SB 2Q8AL 3KJ6H 4JN1L 1RVFH 5TH2A 4CBPA 3EYQD 3MPCA 2H6PB 3GEWB 3G9AB 1K8DB 3O6LH 5HHQB 1FAIL 5M95B 4QHKI 5HY9A 2PW1B 3KHQA 1DQDL 4G9FE 4ZOBA 2MPAL 4DEPB 3EO9H 1EV2E 4RGND 4IDJH 4LVNB 4XBGA 3RWIA 5TFSL 4FXKA 5DRWB 5KSUB 5D96B 4OLEA 4FZ8L 2NY2D 3F8UB 4S1DC 3ZHDA 1XFPA 3ZL4H 1S7VB 1AO7D 5IG7A 4NSKA 3IFNL 3V5KB 3WFBH 5GRUL 4XZUB 1GHFL 3C5ZB 2MQCA 3FQRB 3NFSL 3IF1A 3MRQA 2P24A 4M6MH 2Z35B 5EC1A 4J4PC 1KCVH 3U36B 3UP1A 3T04D 1UB5A 2EDJA 3UYPA 3MLPA 3AC0A 3QXAA 4YIQA 1P4LA 4LLAA 2NZ9C 3B8YA 4M62H 1WISA 3HCVA 5A3IC 3QPQC 4KROC 5FYJH 4LCIH 3N9GL 4YDJA 5EIVA 4X6DA 3V0VA 1R5IA 2W91A 4AJ0A 3BZFA 4YFLF 1B88A 1T4KB 3KPRB 3ZKXB 2FATH 2ZKHH 1DBJH 1HWHB 1ODAA 4FQ2L 1LP9A 4XPFL 1MIMH 3UO1L 5MENB 4QXTB 3SKJH 1IQDA 5HJ3B 3QEUB 4ZXBD 2PR4L 2FD6L 2VWEE 5AD0A 1YMHB 1YEDA 4PJXE 4JAMB 5E2UH 4JHWH 3IDUA 3LDBB 4NQXB 1QBMH 2BXYA 2EECA 3KXFB 1KG0A 3QDMB 4R90H 1MFCL 1T89C 4Z77B 3ZTJH 4JO3L 3W81A 1T7WA 4U2YA 3HNVL 5DJ8B 4EUPG 3DRTB 1ZEAL 3G08A 3PWJA 4QWWD 1SEQH 5E8OB 1MWAH 2XPGB 2XY1A 4MWFA 3LVEA 4LSQH 3ARDB 5L2KD 1U3HB 2W59A 3QEQB 5MI0B 1V7NH 4TUJA 1JF1B 5D5MF 1T1YA 3T0ED 1GJIA 4KGJA 5C71A 2G5BA 4R97B 5C0RH 5CIPA 1TCMA 3R4DA 1E6JL 3UDWA 4HLZH 2W60B 3S7GA 1LNUB 3PWUA 1QLFB 4JFOB 1GOGA 5IF0B 1ZA6B 2APWA 1AKJB 2V2WA 4L4TB 1U95A 4GUPA 4ZO6A 1CK0H 2BNQA 3L3DB 3RVWC 4GG6E 5JIPA 3TPKA 1Z6JT 4GG8A 3HUJF 3I02A 4YBLC 1JTOA 4IMKC 5DMGC 4Z0BH 2R0LL 5GZOC 4WWKD 5KANG 1A6TB 3G5YB 3N85H 3MCLH 3MV8E 3VWJD 5CILL 1EBAA 3ARQA 4GQ9H 3DVGA 4PS4H 4XBEH 3UPCA 2ICEB 5D2NE 1NGPL 3C60A 2G75A 3SE4C 1MY7A 4LLUB 5E1AA 4OV5A 2BNUA 1MFAH 4Z7WB 3L6FA 4XP1H 4PB0H 1A1MA 4WHYH 1F4HA 3GJFB 3K8LA 1JNNL 4QT5A 1JPTH 4FG6C 4UT9L 5EZLA 3HE6D 2DQJL 3ZKSD 4H88L 3WLBA 3J7HA 2F54B 5AYQA 3N0PB 1DUYB 5T3ZH 1FDLL 3QFJA 2E7HA 4S1RH 3O6KH 5D7JD 1BPVA 4GW5A 1PQZA 1HE7A 5D1XD 5LWYH 4NHCL 5EOCJ 3RU8L 1E0OB 1F4YL 1FNGB 3RGHA 1P7KA 1YEFH 1KJ2H 3WD5H 1AGCB 5HVFB 3STLA 3FN0L 3LKOB 4HJJL 2VC2H 1IAIM 1QZ1A 1ZHLB 3RA7H 4MX7A 3ULVH 4YHOL 4QOKA 2G5RA 5DMIL 5IHUL 4Q9QH 5H35A 1IGTA 4QHUB 2NZIA 2VQ1B 5E94B 5F70A 4AH2A 4HUXB 4OZGA 1XR9A 2DLIA 2CGRL 4M7LL 5F9JA 1K5NB 2IWGA 3LQAC 4XAWL 4HCRH 4C83A 3QG6B 4PJAA 5DGQA 3UJTL 5GGVY 1FAKT 5EUOA 4NQEA 3L5WA 4JFFE 5C0BB 5EOQL 2YMXL 4Y89A 3GMRA 1LD9B 2DRUA 2FB4H 1ED3A 2AEIT 4OKVA 3OKDA 4RFOH 1NPUA 1B90A 3NIGF 3RWHA 3QI9C 2HFEB 3AREA 4CL7A 5HYEA 5JDSA 2EEBA 1DUZB 3EJYC 3GM0A 1YEJH 4CNIA 4NNPH 2R2HB 2VXSL 3B3IA 3GO1L 1QFWM 1CZ8L 1KLGA 3U7AA 3OR6A 3ZE0E 2ED9A 1HXMB 3EZ8A 1A7NL 3SPVB 2P5WE 4I3SL 2VDOL 3EYOA 4GXVL 2P4AB 4L4VE 5J3HD 4QYOA 3BYYA 1HWGB 3L7FB 3OL2A 4N0RA 4LAQH 5K9JL 3DMMC 2VSDA 5D1ZC 4XVUC 3ULUE 1D5BB 1JVKA 3DI2B 4BQBA 2VZOA 2DL9A 4KVNL 1XGUA 4ZNCD 1KELH 2NTFB 4HWEL 3O2WH 3VXTA 4FQHB 3VGGA 2X41A 1OTUD 1KJVA 4ZFFB 1E28A 1G84A 1NMBL 3H9SA 4HS3A 4R7DB 4N0UB 2HLFD 3ZMRA 1WZ1L 1XH3A 3VI4F 1J0YA 1BGXL 2LFGA 3FFCE 3RVTD 4Z76B 1TNMA 4X6EB 4ZUSA 2EYRB 5EO0A 4DN4L 3BPNB 3V4PH 3V6OA 4PJ5E 1SY6L 2R56H 3TJHC 1EO7A 1ZT1B 2AJVL 3GHBL 3K1KC 3AB0C 1RUMH 1JL8A 3QIUD 4I18A 2X42A 4X6CE 4NQCD 5E6ZA 4UV7L 1R0AH 1U91B 3VFGH 3BN9C 3RI5K 2J4WL 4ZPVB 3TZVC 4GSDH 3SDXF 3P77A 4JR9L 4YBQD 5DDHB 2VR4A 4PY8I 4UT6L 3L3KA 4NHUB 1KLUB 2WBJD 3I6KB 5F3HA 2ZUQB 1RUKL 2UYLA 1TMCB 3AS1A 3WIIL 2PN5A 3WFCL 1FL5A 4XC1H 1J86A 1FNEA 3MBED 2DN7A 1I8IA 5CLWA 5BV7C 1PG7H 2DJUA 1DVFD 2WQRA 3O11A 3RIFF 2YBRA 3E8UL 2BY3A 2HFGL 3KHOA 3PQYD 4FXGA 4TSBL 5DEGB 4KY1L 5J4MA 1IC7H 3WSQH 4DGIH 1U8KA 4K7PY 3G5ZA 1QUNA 1AJ7H 5FIEA 4MCYB 4RMVA 5DEZA 5DJAA 1U8OA 3VE0A 1JNHB 3S35H 2NY1C 5DWUL 1K6QH 1PKQA 3QUXC 4QHLB 2BVEA 1DANU 2N7AA 5DJ0B 1GZQB 4S1DD 1CFBA 5CS7A 3GSUA 5FAAA 2ZCHL 1CXKA 4Z7QE 3RZCB 2VDKL 3V95A 3QWRA 4LCCA 3H3PH 2XWBA 3MRCA 5KSVA 1HZHL 3K8MA 5I1KH 1UACL 3WEXA 4NO0B 1WZLA 4FMFA 1C1EL 4XH2A 2X4RA 4WGWB 1BZ7B 1CF8H 2VLJB 4HIEA 3JWDH 1JZ4A 1BP3B 4J4PD 3TFKD 4JDVA 4P9HH 4JZOB 4XCNB 4P0DA 3CVIH 4MVBC 1SEBA 1F90H 5MEOB 5T1LB 5L8KB 2AI0L 5A3ID 5I19H 4KROD 4L8SA 1NAMH 4M5ZL 4LSUL 3C8HA 4L4JA 2JJTA 3QPXL 3ALWA 2H6PA 3LN5B 1K8DA 3ZTJG 2DWEB 5HHQA 1MCQA 4FQCL 2HTKD 2BVOB 2PW1A 3C5JB 2FLRT 4HLJA 4KK9C 4WTWA 5GRJL 4FQJL 1MIEL 1UZ6F 2EIDA 4KJWD 4N8CH 4S1QH 5F21B 2LAGB 5GISH 5DRWA 5KSUA 1PD6A 4JRYD 2X7LB 4PJBE 4NZTH 4XCCL 3SE8H 5A16B 5TDOB 1S7VA 1NC2D 2EC9T 1JI1A 1WBZB 4YGAB 5FHAL 2ITDB 3ARBA 3L3GA 5EIIA 5E56A 1BD2D 4HLZG 1OPGH 5KOMC 3S34L 4XZUA 1LK3H 1OWRM 3MLTA 5I1CL 3C5ZA 4FZEL 3RQ3A 4ZFOL 3FQRA 4RRPG 4RFNC 1CDCA 4TNWK 5SV3A 2J88L 4NWUH 3U36A 1TQBC 1OAXL 1Y18B 4J3VA 3CXDH 4XNMA 3WIHH 3ULSB 5D7IE 3LIZL 3VXSD 2WUBL 5L7XL 5EOCL 4PJHB 5JHDB 2MQ0A 4QXUH 3LN4A 1YEEH 2Z8VC 4Y4KD 1T4KA 3KPRA 5DMGD 4HMCA 2VWEC 3BFOA 1QQDB 3JUYA 2XN9B 4OD3L 4LDEB 1S7WB 2HN7B 2J5LC 3HNSH 5MENA 4QXTA 1VKXB 1ZLSH 3QEUA 1Z3GL 4IHOB 5D70H 1DJSA 5KTEH 4P5KB 1YMHA 4YHKL 4PRPB 3SDCD 4JAMA 2NR6D 2GAZB 4NQXA 1JI2A 2CJUH 4K7FB 4QCIB 5EZOH 3KXFA 3O3BB 3M17B 2VITB 4Z77A 2VLRB 1CFNA 4OCXH 4J3OC 3K2UH 5E7BA 5DJ8A 1WLHA 1OQXA 4ERSL 2I5YL 1BJ1J 3DRTA 3EDDA 1MJUH 5LJYH 1A14L 3MV7A 5E8OA 2X89A 1A9BA 3ARDA 1KB9K 1U3HA 3QEQA 4FG6D 1RJYB 3CX5J 4FQQB 1JF1A 1PG7X 3KPMB 5IMMB 3KYKL 3HAEB 2IPUK 1TTUA 4XNYH 5KZCB 5FOJA 5L6YH 25C8H 2ZCKL 2W60A 1E4JA 1LNUA 1QLFA 5B39G 1KC5H 1ZA6A 4L4TA 3ES6B 3UDWC 3L3DA 5AWNH 1I8KB 3S35X 1MCWW 2Y9RT 5D2NC 2Q6WB 4XNXH 1A6TA 1MH5A 3G5YA 1YEKL 1CFQB 4JPWH 4PJ9C 2AEWA 4B0MM 5E2VL 5F6HJ 4JY6B 2ICEA 2FJFB 2G2RB 2VXTH 4HH9B 3OJVC 3RDTB 4LLUA 1Z0MA 3G5VB 4JQIL 4N9OB 3GK8H 3QUKB 3PGCB 3C60C 4BFIB 4JDZB 4LQ1A 4MGXA 3BQUB 4OLVL 4FABL 1EUTA 4UILL 4O51B 4CU7A 1VERA 4YHLL 4NJ9L 3QQ4B 4UOW1 3U30B 2FX8H 1FNAA 2MMXA 5T5FH 5FYKL 1Q8MA 2F54A 1IGCH 4G6KL 4U1HB 5GGUB 1DUYA 2FBJL 4Q2ZB 2RGSA 3GRWH 4GKSB 4XMLH 3NCJH 4QRRD 1XIWD 5KAQG 3LKOA 1F8TH 4HWBH 1HSAA 4JM4H 4P2YA 4HIJB 3GSNH 3K46A 4OF0A 3SN6N 1XR8A 1KCKA 5K59F 1UYWH 2VQ1A 1GPOH 1JYXA 5DD0L 1RJZB 4HUXA 1JPFA 2B7DT 2VH5L 1YEGH 1U8JB 4NWTL 5EPMB 1K5NA 3VXQA 5DHXB 4MNQB 2Y23A 3G6DL 3QG6A 3HZYB 3V2AR 1LO0H 5CEYB 1Y6KR 2I9LB 4M03A 1TJIL 5C0BA 3BDYH 3DOSA 5I8OL 1D6VH 3BDXA 2NXYC 4JG1H 3MRJA 4JPIB 1LD9A 1CD1B 3EJZD 3QDGE 5D71H 1VGKB 1ZLUK 1L0YA 2HFEA 1V7MH 3B5TA 4OF5A 5DLMH 5BVPL 1OWWA 1DUZA 4L3EE 5KS9E 3J8F7 1C12B 2ICES 2R2HA 2VDMH 3QISA 4QLRA 2CR6A 5BW7A 3AREC 3QO0B 4PIRF 3SPVA 3BJLA 2FIKB 2IGFL 2QTEA 4M6AA 3FB5B 5FOBA 3ULUC 5GGVL 4NQCE 4XRCB 3L7FA 2B8OT 1OM3L 5HDQL 2R69L 4I0KA 1EAJA 3Q5OA 5INDB 2FZ3B 3TT1H 2CKBH 5CWSB 5ALBL 3V79C 1D5BA 4WWID 3EOBB 4M3KB 2GKIA 1IGJB 3P0YL 2NTFA 2B2XH 5DC9B 3UJJL 1MLBB 4FQHA 1VEMA 4DGYH 3FO2B 3L5HA 2C26A 4WTZG 3OKYA 5HGBB 2HKHH 2OS7A 1F6FB 1QFHA 1A7PH 2DQHH 3QIBB 4R7DA 5IW6B 4N0UA 3RKDD 1QNZH 3CSBA 1MI5E 1JZ5A 4Z76A 1SY6A 4X6EA 2EYRA 3PGFL 2JF1A 4NQDB 2MCPH 1ZT1A 3GHEL 3C2SA 1CBVL 3HB3D 1H3UA 4M4RA 4ZFZA 4IRZH 3V6OC 3BOVA 2EZ0D 2P44B 2VLKD 1DL7H 4NOBA 5TE7L 1NGQH 5I73B 1U91A 4MMXC 2EH8H 4ZPVA 5BQ7B 2PTTB 4ELMB 4I18C 4IRJB 2ZSWB 5IESH 4NHUA 1KLUA 3GJEB 1U9KA 2A77H 1ERNA 4NCC1 3MRRB 2RCSL 1VB9A 4K9EH 1EX0A 2BZDA 1AR1C 5DQDH 4MVBD 5DA4A 4KHTH 5E9DB 4BZ2L 2NNAB 1HHIB 3GSWB 4RGOH 4MQ7B 1QR1B 2YZ1A 5DEGA 4NKQB 4LEXL 3SQBA 4ZPTB 4BQ9A 5FDYA 5T1KD 1J88A 3WMSA 1KB5H 3U0WL 1J7VR 3BH9A 4OCYH 2A73B 5C0EA 1KJ3H 5KW9H 4MCYA 5I18L 4KK9D 1VEPA 2V17L 4UU9B 1JNHA 1GZPB 4Z7VF 5E5MA 5FV1L 2YA1A 3DROB 1QSEB 4OBRA 4QHLA 2OX5A 4HUUB 5DJ0A 4DVBB 1GZQA 1B6UA 4Q58C 5IHLB 3RZCA 1UXWB 1NC4B 1KN4H 2C3VA 3U0TB 2ORBL 2DS4A 2VIRB 1J1PL 1LO5B 4D0BB 5HGGS 5DJXB 5GZND 15C8L 1FNSH 1KEMH 4LIQE 4QHKJ 4LCCC 4NO0A 2HWZL 1N4XH 2E7BA 1QBBA 1S3KH 5GRYA 1BZ7A 2OK0L 4WFGD 1PVHA 5C0DA 5CCKH 2JELL 3C6LB 3MODH 4XCNA 2X9YA 1H8SA 2DLGA 4GMTL 3BVNB 5MEOA 5T1LA 4PBXA 4JZNA 2Y4SA 1DFBL 3TYGL 2EDEA 1IAKA 1G7IA 1MCCA 4U0RC 2XZCL 1EHAA 5TE4L 3V4VL 1I1YB 3LN5A 2DWEA 3CFBB 2BOCB 2HFTA 4PRBB 2BVOA 2JJTC 3C5JA 4X5XB 5DO2C 3NVQA 5F3BB 3CFEB 1J0HA 1A6VL 4OZFG 2EKSB 4Y5XB 4OF6A 4F7PB 4YXLL 4Q0XL 3KPQB 2WBKA 3NCYP 4LVNC 5A16A 4TRPL 4LOUC 5TDOA 2EDWA 5IJKC 5D96C 4LFHD 4Q97A 2G60L 1WBZA 1D6EA 2ITDA 4E41E 1J18A 2X1QA 3W82A 3IJYB 4XCFL 3ARBC 3EYSL 1CGYA 1JUFB 1GC1L 5GRVK 3C5ZC 3VXMD 2FYYB 4XX1E 3ULSA 3CFDB 5JW4N 4YDIH 3WJLC 1MRCL 1YPZB 5KBNC 4PJHA 3EGSA 2BHZA 5DFTA 4QHMB 4XPTH 2OR9H 3N1PC 5T33L 2ZUTA 1QQDA 1PSKH 1V3JA 2DB8A 2XN9A 5CJOH 1ONQB 1S7WA 2HN7A 3MV9B 3IXTB 3A67H 3U4EB 1VKXA 4PJDE 4N0FA 4IHOA 3ESUF 5L8JB 4P5KA 3MLVL 1B4JH 2HA1A 4PRPA 4KWUA 2QQQA 1DBML 1DBBL 1MFEL 4QCIA 1GH7A 4K7FA 3D0LB 5EO9B 2NY3B 3ZHLA 3O3BA 4N1EA 2VITA 5ENWB 2CUHA 4J23A 3LDBC 3C60D 5DQ9B 2K9UA 1GGTA 5D7LE 3U46B 2ZJSL 1UJTA 4YBHA 5TF1H 1RJYA 1T6VN 3DIFB 1KYOJ 2GK2A 3WKML 4KDVA 3QSKB 4HK0A 2NY7H 5JPMB 5IMMA 2C1OB 1VA9A 4OKDA 3HAEA 5E6YA 3U9PL 3ARDC 5E6IA 5MI0C 1TETL 3GSQB 2A0LC 1AXTH 1Q94B 1IAOB 1BBDL 5F7FA 3ROOB 1BWWA 43C9B 4R97C 2BRRH 5BXFB 4Y5VB 5AYUH 1IKFH 2AK4E 3ES6A 3QFJD 1JHLL 2AJYL 1I8KA 1NGYA 5DK3A 1T1WB 1LVEA 4G80B 4DK3A 3GKWL 1NEZG 2Q6WA 5T3XL 5J0BA 1PLGL 1NFDF 3VXRE 1SJXA 1I8LA 3OAUL 5ESVA 4ODBD 2G2RA 4QOKD 4AT6B 4HH9A 2OP4H 2AABL 3QIWB 4OTXH 2DLHA 3DURB 3IDYB 3IU4L 5SWZB 4GKOA 3HZKB 3G5VA 5FM8A 3QUKA 4D9RD 4BFIA 4JDZA 2Q8BL 3BQUA 1WZKA 4K23L 1JGDB 5IQ9B 1MCOH 3UYRL 4OLYH 4O51A 2B4CL 1AGEB 2PO6B 5J1TC 3NCFB 3QQ4A 3WL9A 1WK0A 1B9ZA 3HMXH 1WEJH 3QNYA 1K8IB 3OQ3B 2Z91B 4K3GA 2VUOA 2OLDA 3CSGA 3F58L 4YHNB 4NQED 1GCFA 1BM3L 4DTGL 4Q2ZA 1K4DB 3ZDXE 4R4FL 2R2CA 4MJ6B 5LBSL 4MJ4A 5E1HB 3PWPB 2XZAL 1JCKA 3ARED 1X9QA 2BRQA 1UCBL 3MNVB 2DTMH 4HIJA 1BVZA 1KTKE 2DDQH 4POUB 4FQXB 4P46B 5EORL 1YECL 4XTRD 4LKXB 1G7LB 1RJZA 5LQBL 1L7IH 3SE9H 3KVQA 3QUML 1U8JA 2KDGA 4JM2B 5EPMA 1XAUA 4MNQA 2X5PA 2X40A 4UAOB 3LZFH 5E