5GRVL

Crystal structure of homo-specific diabody
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
123
structure length
123
Chain Sequence
VQLVESGGGLVQPGGSLRLSCAASGFTFRNSAMHWVRQAPGKGLEWVSSIWYSGSNTYYADSVKGRFTISRDNSKNTLYLQMNSLIAEDTAVYYCARFAGGWGAYDVWGQGTLVTVSSGGGGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords homo-specific diabody heavy chain
publication title Crystal structure of mono- and bi-specific diabodies and reduction of their structural flexibility by introduction of disulfide bridges at the Fv interface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 30
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2016-08-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5grvL00
5IF0B 4PBWD 2VQUA 5EU4A 3O4OB 1I1FA 3FCTB 5D5ME 1XR8B 5C0ND 5INDB 2BP3A 1DN2A 4G43B 3MJ8A 5K9OA 4KZDH 3GFUA 4KUCD 4OZHF 1TETH 3RL2A 1OSZA 4HCRH 3VW3L 4H0HB 3QI9C 3O0RL 3MRJA 3S3SA 1DDHA 1UWEH 4X6BB 2FZ3A 3CZJA 5I9QB 2R9HD 2XQYG 1NH6A 3JWOL 4Z7WA 1HE7A 4PRIB 1DANU 2HLAB 4N9OB 3LIZL 5JORB 5DK0B 1XF5B 2P5WA 2XACC 3QCVH 1IKNC 1Z5LB 4JY6A 5F88B 1T2XA 5DJ0A 1OGAA 1JFQH 1S3KL 3FOMB 3NN8B 1HQ4A 3SE4A 1U8LA 3BI9X 1P4BL 3NAAL 4YHLH 3SGDI 4M03A 3QNXB 1NDGA 2FRGP 3WIHH 4ONGL 2GSGA 4GW5B 5EU5B 1N3NB 4K3DH 4L29B 2FH8A 2CKBH 1NAKH 3STZB 3TP4A 1Q9KB 1OAXL 1VCAA 3DI3B 5D1XA 2ESVE 5DJ6B 3QEHA 2ZJSL 2VXUL 5CP3A 3QWOA 4QRUA 2ENSA 3L3DA 2DS4A 4XPTL 3HZMA 5I2IB 1JPST 4M7ZB 4XT1C 1R0AL 2DL2A 5FO9A 1K6QL 4R90L 3C9NB 4YHPA 4LL9A 1AR1D 4QF1B 5IB2A 5EPMA 1TMCB 4IRSA 1KXQE 3JVGA 4XP6H 3DURA 1ADQH 1SJVA 1MVUB 2ZOKA 3MGTA 5IESH 3BPCA 4OF0A 2YXFA 3QPQC 5F7DB 5JUEH 5EIVA 1CD0A 1HI6A 2F5BH 4M48L 5MP6L 2ZUQB 4X6FB 2X9XA 1NDMB 4Y2DA 5DUMH 3RWHB 3RTQC 3D2UD 1RUAH 2A6IA 1NAML 2NY6B 2AEPH 3CK0L 2VLLB 3QBTB 2R56H 1QRNA 3PQYA 3VH8G 4HIEB 4GOSA 4NKMB 3AXLB 1NFDF 1VFUA 5EZLA 3QDGA 5GS2H 4R96A 4OGYL 4TTDD 2ESVD 3RY5A 3H9HA 3O6FD 4XC1H 4KVCL 4LGPB 4EDXB 1ZEAL 4TSAL 4Z7VE 5TFSH 3VA6A 3H2WA 1OHQA 2PR4H 2B20A 2WP3O 2XNAA 3LD8B 3VXUE 3NBNA 2WWMC 2J88H 3U0PB 4Q97A 2GYSA 1YEHH 1J5OH 5IEHA 2BNRA 1I1YA 4AM0A 5IVXA 3A67L 3LRGA 1UGNA 3QG7L 1RZKC 4MCYA 3NCJH 2AJXL 5D96C 2F9BT 1OSZB 3I3DA 5AWNL 1D5BA 2H41A 4WHDA 4Z7VF 5MERA 3CDGB 1FG2B 1JNNH 2XWTA 3MRJB 3CFJA 3CXDH 4KXZI 4TRPH 1DDHB 4U0QB 4JG0H 2Y36L 4XBEH 1FE8H 3H9ZA 4YR6B 1OM3L 2ARJA 4Z7WB 1T2QL 1RZJL 1CN4A 2X09A 4F15B 1Q1JH 3G5ZB 3P3YA 1E4XI 1WZLA 2DQUH 1MFCH 2VISA 5DJ0B 3RHWK 5KVFH 4MVBC 4Z9KB 2GKIA 1BZ7A 2FL5B 4JAMA 1KIPB 3QHFH 4AEEA 1U8LB 5CBAA 1OP9A 2WWKT 3DJ9A 5L88H 4NQDE 4P57B 3V4VH 3MLYH 5D6DC 3G6AA 3BKYL 3RGHA 2ICWJ 5FUCC 1S78C 1JNLL 2ZWLT 3JV6A 3VXUD 4EXPX 5CEZE 3FQUB 4IRJA 1G7JA 4YXLH 3BPLC 4S1RH 4Y16B 5FHBL 4ZTPH 4MZ2A 5SV4A 3VD4A 2W9EH 4F7EA 4CAGA 1KACB 3MSPA 4H25A 4XCFH 4JPIB 4ODVH 4L5FH 1IC4L 1GVIA 3VFGH 4ODHH 2CO7B 1BAFL 3EYVA 4JKLA 4HUNB 4JM4H 2YUZA 3M8OH 5C0GB 2VJXA 4PRHB 3RUGB 4I5BA 2HWZL 3LQAL 3W9EB 2HJLB 5IB2B 1FAIH 4LKCA 4PR5A 3GGWB 1PG7W 1WT5C 3OF6A 1IC5H 4J8RB 3PF2A 4TSCL 2XN9B 4JY5H 2EH7H 2C3VB 1DQLH 4XMLH 5JR1L 4JDVB 4ZTOL 5DR5H 4NQDD 1ZT4A 1LO5A 4ACPA 2HLFC 1B90A 4MD5B 1YC8A 4RFOH 5ALBL 5CEZD 2BFVL 3WV0A 2DM2A 1NCUA 3PQYB 4ZSOE 4U31A 4LQFH 4FTVA 5E08H 4QGYA 4HX1B 1T89A 3QDGB 5E56A 4ETQA 5E2WL 3H9HB 2V2XB 3QEQB 4P5TD 3FB7A 1XF2B 3LZFL 4ZD3L 4D9RE 4F7MA 1YEKL 4JZJA 1HH6A 1P7QA 1PY9A 2EIDA 4WY7H 4XNYL 5DRZA 1QOKA 4U1NA 2Q76B 3O8XD 2BNRB 1I1YB 5ADPH 3WXWH 4YAQB 1M71A 3V5DA 2VXTH 4NCDA 4GXVH 1EAPA 2DB8A 3KXFA 4EJ1C 1D5BB 1NJ9B 3CFJB 2D3VA 4WEMB 3W5MA 3S4SA 1G9NL 2N1KA 4DGIL 2ARJB 1A3RH 1UT9A 1OT1A 2F58H 5KOVC 4KRLB 5TPWH 1LP9F 4GG8A 1OAKL 1CXLA 1I85C 5DQ9A 3RKPA 3SE9L 2QL1A 4A6YA 2R0KH 4KUZL 4P2YA 3PL6C 3RVXC 2GCYB 3KGRA 3H3BC 4OTXH 4N0YL 3HE6D 4KVNH 2FNBA 2XG5A 4F8QA 1BFVL 4D9RD 3WD5L 4NN7B 1EEYA 4F7PA 5GGTL 5A1AA 3AMKA 3R1GH 2R4RL 4PJ5A 4DVBA 1G1YA 2B1HH 3THMH 4BZ2L 1KUMA 3UJJH 4PJIB 2QHRH 4YO0B 3UX9B 4F7EB 1SY6L 4JFEA 4DKEH 5IVOA 1JHKH 4PRNA 4CADA 5HHME 2GJ6B 2ADFL 4H25B 1YEJH 3EW3B 4WU5B 3MJ6A 3SOBH 3ZHKA 1BBJA 4DGVL 4MJ4A 3TFKC 3IDYB 5ICZA 2BSSA 2NY3D 5HGAA 5HPOA 4I5BB 4OM0L 3EOYG 2NW2A 1P1ZA 3WE6A 3I75A 5CUSH 5BMFH 5HYSA 2AI0L 4NNYB 2FJFA 2NXYD 3DROA 5HHVL 3R06A 3JSSA 2BNQE 3LH2H 3GIVA 4JCMA 1JPGA 1NFIB 2R1WA 3QUYD 3SKNA 4YHIA 1ZT4B 5IJKA 4QTHB 4RX4D 1LO5B 3BKJL 4X4YA 3OR7A 3WLWD 3LKOB 3EKCA 4HS8L 5LAXA 3ZTNL 3SCMA 1FNSH 1F4HA 1KJ2L 1JPFB 3BUTA 1R5WA 1KELL 2LAGB 1KC5H 4X8XA 4Y19A 4ETQB 2A9NH 5DHVB 3RU8H 5MENA 3O9WD 4U2YA 2APFA 1FGVL 4TSBL 5HHMD 2GUOA 4DTGH 4GSDL 4GKSA 4XX1G 1IZJA 1VFOA 4MLSA 3S36L 3CSYA 4PLKD 2X44D 3MLXL 3CVIL 2VDLL 5MEOB 3U6RB 5F70A 3MBED 3ULVF 1Z2KA 5JZ7D 4LPWA 1QYGL 1EA9C 4WFHE 4J3VA 3DTXA 1ZGLB 3FO0L 2BNQD 4GRLA 1X3DA 4KDWA 2JJUA 3ZYZA 2ZKHL 4UZGA 4WI2A 1CICC 3D18A 4G6JH 4U49A 4XP1L 3S4SB 4B50A 5CEXA 5GS0L 3CUPB 4FABH 3RNQB 5TQ0L 4JDTH 3ZDXE 1BX2A 3F7QA 1RQ5A 2NXZD 2NTSP 1K9TA 5DQ9B 1ZLSL 4A6YB 1JMXA 5KSUA 1CQYA 1FVEA 3L5WA 1Q9LA 5KN5B 3CFKB 4MCZA 2BC4B 4G6AD 4L3EE 3SDDA 2V17L 1L0XA 3VFWA 4CL7A 2HFGL 1I7RB 3KPMA 4OFDA 4WTXA 1S8DA 3GNMH 4P2RA 1OL0A 3O41A 4M8QA 1EEYB 1UA6L 4J12A 5H2BB 2MPAH 4M3KB 1U8QB 4GAFB 1G7QA 1J0KA 3QFJB 4ZQKB 3WN5A 1CLOH 5GGSB 1AO7B 1XGQB 3ALXA 5HJ3A 1E6JH 3EYUL 3U9PH 3S35L 4MXVF 2BNUA 4MD0A 4WFHD 4P9HC 2XZAH 2N56A 5IIEA 4X6CE 1NCBL 2IPTH 3GSWB 1YPZA 4WNQA 1ETZB 5F9JB 4WO4C 3OG4B 4YIQA 1UB6A 2OXGA 3DYPA 5L0QB 5DFWH 1JZ6A 2ATKB 4Y1AB 5HGAB 2X4UA 2MCPL 1LDPL 3WFEL 2NW2B 1P1ZB 4GJTB 3GIZH 3NIGE 1XZ0B 1DANT 3BZFA 3DUHA 4MNHA 4NWTH 1GGBH 1NMBL 2IPUG 3R06B 3Q3GA 7CGTA 5F6IB 3VXTB 3B9VA 4X6CF 4WEUD 1CDBA 1CU4H 1IGML 1J1OH 3UC0H 2IFFH 4JKWA 4L3ED 2YK1L 1DZBA 1X5AA 3PJSA 1KTKE 2F54B 1NBZB 3HI5H 4XPAH 1IAIL 3LS5L 3UTSE 2EO9A 5IQ7H 1A7BA 3C60C 3TJEH 1BIIA 5E7FA 5C2BH 4MNQE 2IMMA 5SX5H 4L1HA 4Q9RL 4OLVL 4Y19B 3OHXA 3H8NA 1QPXA 3ALWA 2VLJA 4LOUC 1QFPA 1J0HA 4JJ5A 1UEYA 4ODTL 1FIEA 2H26A 3G5VA 3CSYB 4YBLC 2JCCE 4YUEL 2DQIH 2P5EB 3U1SH 4WJ5B 3TNMA 3WO4C 2VDPH 1YEIL 4N8VG 4H26A 1G7PA 5E4EC 1OTUC 3ZE1E 4EUPA 3TYGH 2DQEL 5AAWA 3AM8C 2DAVA 4GRLB 3BO8B 3O2DH 4NQTA 4UMGA 4NRXB 2FSEA 3ZZ1A 1YYML 1ZVSA 4YWGL 4XHJC 5ID1B 3LDBC 1DBMH 5FYJH 4OFVA 1WTGT 2Z31C 4I18B 3UTSD 4CUCA 5F1SA 3FAWA 1S5IH 2B2XL 3EHBC 4OGAC 3BP4A 2IAMD 1OD9A 3ZE1F 1YY8A 1OAZL 4MNQD 2DOCA 4HJGA 5L2JA 3N9GH 1XR9A 4K3JL 4NNPH 5F44A 3KR3H 2YUVA 1WBYB 4M1DL 4HUVB 3DXAA 3O41B 1ORQA 3QG6A 3DI2B 3KJ6H 3VFPB 2FX8H 3BRFA 4AL8H 4N8CH 3B3IB 4BSVB 2QADD 1YEGH 1LE9B 3MV9B 4Q0XH 3EDDA 2BNUB 2JJWA 1ND0A 5BW7C 5DUPH 3MPCA 3KYKH 3O6MH 3LN9A 5IROA 5C09E 4FQIH 3IXTA 2LV4A 4B7LA 1QLRA 3H3PH 4PJEA 1EEQA 4OLXL 1KCKA 2R2CA 3B6SA 5KJRL 3TIDA 1W0VA 2BK8A 4LP5A 3NTCL 4XBGA 4QGTA 1CGVA 4M6AA 3HG1E 2HH0H 1FVDB 4KY1H 3QHZH 5I17A 3ARGD 2ADJB 5T1KA 4N5EC 4PLJD 1MRFL 2XKNA 2AJSH 5C0IA 1PG7X 1TJHH 3W39B 3HUJE 5BV7L 4F7CB 5HI4C 1MHEA 2KH2B 1LILA 2CR3A 2FBJH 4XPFH 1QFHA 2X10A 5A3ID 1QFUH 4JJ5B 2FO4B 4PJ9C 4C54A 5C09D 4B5EA 3O45B 1CCZA 1MCWM 3SDYH 4YDKH 5CIPB 1FH5L 3U83A 4HKXB 1S7WA 4ZPVB 2PETA 4UOW0 3HUJF 1J7VR 5CGYC 2A1WH 3GO1L 4H26B 1XF4B 3QJFB 4G6KH 4KK9C 5J56B 5EZIH 3VFTB 1KJ3H 1OAQH 1KTRL 2O26U 4TUOB 3HG1D 4YHML 5I74C 1T5XA 3OKOB 4WWKB 2APBA 4O5LH 1WBXB 4QY8B 4JKKA 3ULUL 4GRMA 3NVQA 2AQ1A 1G0YR 3T0AA 1R3HA 4JRYE 3GSXB 4X99B 3HLAA 5I18H 3CFBA 4KMLB 4JKMA 1A7PH 4HJGB 4UU9A 1XR9B 5K9KB 3ZE0E 3NGBB 3OR6B 2CRZA 3VE0B 3DXAB 3O4LE 5HVGB 4E42A 3G04A 4UINL 4F2MA 2GI7A 3E0GA 1YYLL 5DF0A 2EKSA 4M4PA 3MV7A 3IRPX 4BFBD 1ND0B 4OB5L 5EO0B 3ZE0F 1UKSA 1ROWA 2UZIL 1WFOA 3HPJA 3TVMC 5DMKB 4KJQC 4Z5RA 2PW2A 3CMOL 1GL4B 2Z92A 5E1AB 3VW3H 4PJEB 2Y25A 1CGTA 3O0RH 3B6SB 4KROD 1F6AA 1TTUA 3GMMA 3MLSL 3P0GB 3JWOH 4JRYD 2BVOA 2UWEE 4K2UH 3V6OC 3ARBA 3VFOB 3LIZH 3Q6GL 3X13B 4LLUA 4ZO9A 3LN5A 3HMXL 2YPLB 1QQDA 2R2BB 2VLKA 3U82B 3HPLB 3O4LD 1S3KH 1CDCA 3LQZB 3UTPE 3IJYB 5D2LA 1P4BH 5I1AA 1BLNA 2AKRB 4S1DD 1BVZA 2XV6B 4EI5D 3NAAH 5C07E 3ILPA 2PF6A 3NFPA 4D9LL 1T21A 2B7DT 4X7EC 3S3PA 3DO3A 4R8WL 3AS2A 1UWXK 3T8XA 3ECBA 4BSWB 1T0PB 4NQSB 4Q6IC 5L8KB 1F8TL 1I4FA 4HWZB 3GSVA 5GS2D 4GMTL 2FBOJ 2VXUH 3KPPB 5IB3B 3E8UL 4PD4K 4BKLA 5F8RC 4XPTH 2XXMB 3FB8B 3BZ4A 3I9GL 3Q5OA 1R0AH 5CJ5A 1K6QH 4YHZL 4R90H 3UTQB 4PJAE 1MHCA 1T5XB 2GSIB 4EN3D 2XKUA 3MRPB 2CXKA 1T1YB 3FT4A 4ZFOA 5BXFA 3ARSA 1FL6A 1N6QL 4M48H 5MP6H 3UTPD 1T6VN 1BQHB 1SJXA 2MQCA 1B0RB 2VITA 1R3HB 4Z76A 4Z18A 4ZODA 1NAMH 2VUOA 3CK0H 5C07D 4PBVC 1T83A 2BRRL 3FB5A 4NUJB 4PJAF 4XNZB 1RZ7H 3DV4B 4G5ZL 4HGKC 4OQ1A 1D7FA 1MCPL 4OCSL 2X6MA 4E42B 4OGYH 3TBVA 4KVCH 4JRXE 3O3DA 1ZEAH 4NO0A 4TSAH 1JYWA 1MJJA 3MRBA 2EKSB 5BZWB 5FM8A 1J1XL 4MNGE 3DLQR 3MV7B 1QSEB 3FONA 4OZGE 5MEPB 3ARPA 3OBAA 1N64L 1YC7A 3VG0L 3TBTA 1LHZA 3A67H 5EO1A 1MWAA 1EV2E 2AJXH 5GGSY 1JV5B 3W5NA 1LDSA 4UIKL 3TO4B 4Y5XC 4R4FL 2QR0A 5AWNH 5EZOL 4OAWA 3BPNB 3BFOA 5DZOA 3U2SB 3FQRA 2Y36H 3KNBB 5GSRA 4OZGF 1JRHI 1OM3H 3TT3L 4F33A 3F6LA 1T2QH 1RZJH 3QQ3A 3ARBB 5HI3D 1C1EL 1UM4L 3RGVB 1YUHA 3MOBL 3LN5B 1JWSB 2EEAA 2V5RA 4G8EA 4PV8A 1QQDB 5EWIL 4ENED 4LSSL 3D2UA 5J11B 4OD3L 3TN0B 1U8PB 2LTQB 4JRXD 4JM2F 4P4KA 3BKYH 1KXTB 3T1FA 3VWKD 1JNLH 3NFPB 3UJIL 2ESVA 3O6FA 1WTLA 3AY4A 5FHBH 3MA9L 3T8XB 3ECBB 2W92A 1HWGB 1F42A 2X5PA 4OLZL 4P46C 4M1CC 4J3OC 1JHLL 1S9XA 2CIKA 4BKLB 1TCRA 1J8HE 1IC4H 5DTFB 3TBWA 1KLGB 5JW3L 1BAFH 2NX5A 1BM3L 3OXSA 1IEAA 2FX9L 2R1XA 2I9TA 4K3EL 2HWZH 3WS3B 1NFDA 3LQAH 4IIQC 1A9EA 1E6OL 2DDQL 3IAPA 4U7KA 5B38B 4UNTA 1U3JA 2HVKB 1YZZA 2VKXA 1FL6B 1VFAA 4TSCH 1AGCB 5DURD 5JR1H 1UM6H 4ZTOH 3V9FA 2EICA 5F8QC 3EO9L 1XIWC 3HI1A 3AREC 4PGCA 1H8SA 3SJVA 1WVZA 5ALBH 2BFVH 4OZHB 5K93A 3MYJA 3VGFA 1GC1C 3G5XB 4V1DE 3ESVF 4H1LA 3LRHA 2NY6C 3QXAA 4DOHE 3K1KC 3MRDA 4KMTL 4JE4B 5E2WH 4X6DF 2HYMA 3REWB 3LZFH 3MV8E 5A2KH 3O3DB 4GMSL 4ZD3H 5L2KE 4DKFL 1QPPA 1MLCA 3QQ9D 1YEKH 5ISZA 4NO2B 5D5MB 8CGTA 4N90E 1J8HD 3T65B 4LFHG 3RZCC 4FOMA 3FONB 4XNYH 1T4KB 2H3NA 5DJ8B 1H8OA 4K07A 4UUJB 4HF5H 2AS5M 2NYYC 4RZCA 3HR5B 1KSRA 5EO1B 1MWAB 3LD8C 4U6XB 1K2DB 2H32H 3TA3D 5D2NE 4JVUA 4X5WB 3A6OA 4ZPTB 3HZVA 3WFZA 2E6JA 5I1EL 2GK0B 3K81A 4O51B 5EBLA 1G9NH 4S0TD 4DGIH 3MLRH 1CF8L 2HRLA 3VI3E 5EUOE 1NGZA 3QQ3B 3U4EA 2H9GB 1VERA 4HS3A 1OAKH 3P4OB 3C8HA 3SDAD 3BRGC 1V05A 3SE9H 4JEGB 4PV8B 1FNGA 4V1DD 4KUZH 3I3EA 4AK1A 4NQDA 1FLTX 2FB4L 5E8EB 2W9LA 3RL1B 4N0YH 4EBQL 3ZDYE 5L2KD 3MV8D 4OSUL 3WD5H 1RK1A 5GGTH 4NQVA 3VI3F 4N90D 4D0BB 1A4KA 2VH5L 2R4RH 3S96A 3SE4C 5EU7E 3IS0X 4ZUUB 1S9YB 4HZAA 2ESVB 1CFNB 3BH9A 1A1MA 1BZ9A 5CAYB 4PGZA 2EXWD 4BZ2H 3F7RA 2IF7A 2IEPA 4LF3A 1IC7L 4CVZB 4BELD 4U1SA 1SY6H 3D87B 2BVQB 3ZDYF 3NIDE 4Y16C 2ADFH 4YDVA 1ZKAA 3RKDD 3R0NA 1EVUA 3TLRA 1QLFB 1NCAL 5D1XC 5SWZE 5J06A 4DGVH 4UV4L 1PLGL 1CTNA 3QUKB 4WW2B 3BOVA 4PG9B 4BH7A 4PJDE 1EMTL 1HN1A 3CFCL 3VXQB 4OM0H 2DD8L 1T5WB 2IG2L 1Q9OB 4JFOB 1KCRL 3VFNA 3TV3L 1TZIB 4QCIA 2AI0H 5HHVH 4L9LB 3NIDF 1QFWM 2ZPKH 4D9QE 2YN3A 2JB5L 4UQ2A 1Y18A 4IRSC 3JVGC 4LLMA 5EB9A 3VXPA 2JJVA 4WUKL 2Q87A 4PJDF 3BKJH 5HDBF 3GMPB 4KK6D 4MAYD 2WUCL 4Y2DC 4P4RA 4HS8H 5D7LE 3ZTNH 3KS0J 4Y89A 2JIXA 3WJLA 1AGFB 3OAZH 1KJ2H 2E7BA 3GMLA 4Z7VB 5EBGA 1KELH 1JWUA 2MNUA 2ATPA 3ARFA 3VXUB 5B39A 1FGVH 4OM1L 4TSBH 4GSDH 4O2EA 5DRNA 4DCQA 3HA0A 4KHTL 5SWZD 1LP9A 3S36H 5I1LA 2AV1A 3QR2A 5MI0B 3MLXH 1K4DA 3CVIH 2VDLH 5DO2C 4XCEA 3PWJB 3QUZA 4KDTA 5EOQL 4EI6A 1QYGH 3DRTB 4EDWL 2IC2A 3ROOA 3FO0H 5HTSA 4D9QD 2X7LA 3HZVB 4G42B 2ZKHH 4WCYL 4K7PX 1I3UA 3QYCA 4XP1H 5EBLB 5GS0H 5JW4Q 2HN7A 1RJZA 5TQ0H 2Q3AA 1A1OB 3U4EB 1AGDA 2BJML 1EERB 2VR5A 5D7LD 5E5MB 1ZLSH 3O3UN 1OP5H 1FNGB 3PWVB 2GW5A 2EZ0D 4NQDB 3X17A 2V17H 2HFGH 15C8H 3LEVL 1IQDA 5T5FL 1HSAB 1CDJA 3T3PF 5BS0E 3L95B 1UA6H 5FYJE 2QTEA 1WQVT 3BP7A 3C5JA 1KCSL 3B9KD 3QIWA 4MGXA 3S96B 1KYOJ 1CDGA 1CT8A 2OZ4A 3MJ7B 4NRYA 4Q6YA 4P5TB 4NN7C 3O9WA 2VDNL 3EYUH 1OQXA 1A2YA 4U6VL 3S35H 1Q0XL 1V3KA 4DUVA 4IRJC 5CKGA 1AXTL 3K74B 4YDVB 4M7JL 1NCBH 4MB5A 3O8XB 1EO5A 2FX7H 4P9HL 4P3CL 1OF2B 5F1OB 1AY1L 2HVJB 2VLME 4YBHA 2MCPH 3A6BL 3WFEH 4YXKH 4CVXA 1LK3L 5ETUB 4Q9CA 3NA4A 4QCIB 1NMBH 4FZ8H 5IW3A 3U4BL 4OCLC 4RIRA 1T7VA 5DJDB 2HT2D 1IGMH 2G75B 1Y18B 2CO6B 2YK1H 1EPFA 3BMWA 2WW8A 1N2RA 4NFDA 4FQCL 1IAIH 5BS0D 3LS5H 3BP6A 4ZSOB 43CAB 5FYJD 3RX7A 1P69B 4P4RB 4MZ3A 4CMHB 1TLKA 4HH8A 3HE6B 1G7IA 5K33A 3L7FA 4Q9RH 3TJHD 2CDEA 4OLVH 4FQLL 3UEZA 4HUUB 3O11A 4OUOA 1J0ZA 4XGZA 4ODTH 4AEFA 2WBKA 2FD6H 3GSQA 5DRNB 3EJZC 4KV5E 1T89C 4YDIL 1SJHA 2W60A 5LGJB 3MGAA 3HE7A 2AV1B 4YUEH 1BGXL 2VLMD 4UAOC 4JZJC 5HHXL 5ESVB 1YEIH 1JZ4A 5AAMA 4PY8J 4JREB 2IGFL 1A7RL 2DQEH 5MEQA 5DJZA 5JDSA 4MJIE 2P49B 4KV5F 2NY3B 3BGMB 5HYSG 1E4WL 2C7UB 1YYMH 4YWGH 2I5YL 4RGNC 3PDDA 2NXYB 4KKBC 2BXYA 2D7TL 5HVWA 4MQSB 3MODL 5B4MC 1W72L 2DI7A 2B2XH 1IGFL 4CVUA 3MRKA 5HHQA 2V7NB 1QSFE 1MREL 3RWCA 3QUYB 1OAZH 1MCLA 1IQDB 4K3JH 2RAMA 1PKQE 2EDNA 4M1DH 4ZOEA 4K8RC 4U7SA 1F2XK 4RAUA 4PP1C 5ICYA 5JW5B 1CT8B 4YPGB 1YN7B 2FATL 1W8NA 4BQ6A 1A1NA 3O9WB 2DLIA 3TC9A 3S37X 4X6CA 1A2YB 4JRWA 2DWDA 4KRMB 3ZKQD 5GGRB 4NO3B 3VD3A 1ZTXL 2X4NA 1Q38A 1A3LL 3M17A 2AXFB 4MJID 5H37H 5I8KL 2BVPB 3BIKA 4ZS6C 3MBEB 4JZOB 4OLXH 2BY2A 4PJHE 1U8NB 4YFDB 3WO3B 1MCFA 3RVWD 2D4DA 4X9BA 5F21B 5KJRH 5GRUL 2BNQB 5E0QA 1A6AA 4M9PA 3RFZC 2HG5A 2DLEA 3NTCH 5DK3A 4CMMB 5C0EA 2NY0D 1VSCA 5L0QC 3T1WA 3T2NL 4U6HB 5TE7L 1QSFD 4NFBA 1N59B 1OGTB 2XWJA 1WAAE 3W2DL 3UTSA 1MRCL 4UQ3B 2NXZB 2Y6SC 2ZCLL 5J6GA 2IFGA 3BP6B 4ZXBD 4PJHF 3C09B 4PRBB 4RA3A 3GI9H 3D3VE 3FZUD 1MRFH 1I1AD 3ARYA 3FOLA 1HHJB 4I0PD 4RBPH 3U9UA 5D1ZD 1QKZL 2W65B 4LDEB 5IJKC 5BV7H 4MX7B 5DGQA 1KPUB 3IXAB 4L4VE 1U8JA 1WAAF 1HK6A 1XAUA 3SCMC 4HJ0D 2BOCA 3EYQD 2GY7B 3O11B 2YC1B 3KPTA 4JFDE 1MCDA 4MQXD 2PTUA 1FZJA 8FABA 1MCOH 1FZKA 4WFGE 1F6LL 2CUIA 3SE3A 3EBAA 1FH5H 5K9QG 4U1HA 1E4KA 3GO1H 1LO2L 1RY7B 2Q86A 1QTYT 1NANH 3QIUD 2FECL 5IB1B 2R15A 4KKLD 3JUYA 1PZ5A 1ZANL 5IBLD 4YHMH 4K9EC 1H3VA 3TBYB 5DRXA 2HMID 1M1SA 3ULUH 4GRLC 2E7MA 5F9WB 3D3VD 1ZHKB 1T0NB 2H8PA 4DZ8B 4M7LL 4L3EB 4MS8C 1GGIL 4NBYB 3ILQC 2XWBA 4G9FA 3RWIA 5JXAL 2ADIB 4L4VD 5ADOL 4YNYA 3ZYOA 2WBJD 2V7HB 1F5WA 2IADA 4JFDD 1WF5A 3P0VL 1F4WL 4UINH 1MCHA 5JNYA 2YPKA 4WFGD 3FN0L 3RWGB 1YYLH 3V95A 1DQML 4JFFE 3MGOA 4ONHA 4X9FA 4HMDA 3T0EE 4X6CB 2DWDB 2FGZA 4G6FD 3LKSB 5TDOA 5E5UB 1KCUL 3WN5C 3MOAH 4OB5H 4TNVK 3L3GA 5EN2B 3KLAB 5B3JE 3C87A 1AP2A 3CMOH 4PGBA 5I16B 1IGCL 5L7XL 2ITCB 2OR7A 4EUPG 4FQQB 1RZGA 1MUJA 2A38A 5F3BA 1HHIA 3EOBA 4HKZB 2VAAB 3S6CA 3N1QC 4ZUWA 3QO1A 4L3CA 1A6AB 3MLSH 4C59B 4OFKA 5C0EB 3HG1A 5IHBA 1KIRA 4HCRA 5F1IA 3Q6GH 3WFHA 3T4AB 2XWJB 5B3JF 3UTSB 3N1PC 3HMXH 1NGXB 3E6HA 3I02B 2IAMB 4NNXB 4NKDB 5FXCH 3HUJA 5JW4M 4PJ7E 4MNQB 4NCC1 5BVJA 3MV11 3KWWB 2XXCB 4JFFD 1NEZA 1YN6B 3T0ED 4JGUA 1SYVA 1EGJL 4D9LH 1JP5A 4R8WH 2JCCB 4LSQL 3BESR 1F8TH 3ZKMC 1MF2L 5C6PB 2QADB 1AGEA 4GMTH 1BFSA 3BT2L 1X7QA 5KSAD 3E8UH 1TZHA 1W0WA 1JYVA 2CKBA 4U6YB 5D7SH 1P6FA 1AE6L 3I9GH 4OLYL 4NC0B 1TFHA 3DVFA 1G7LA 2Q86B 2CLVB 3C08L 3SDXE 3V6FB 2XFXA 4PB9L 4LVNC 4YHZH 5FM5M 1SQ2N 3GKWL 1PZ5B 1GZPA 1UENA 5DA0B 5TJWK 4HHAA 5DRXB 4LPTA 4FFVD 4JRYA 1N6QH 4RQQB 5F1KC 1SEBA 3TWCL 1MH5B 2VYRE 5SX5K 3PWLA 4KPHL 5DJAB 1FNAA 3OKNA 4Q2ZB 4R97B 5CJXA 3UPAA 2QKIA 3SDXF 5DWUL 2XWBB 1WFNA 2VLRE 3WIFB 2BRRH 3KVQA 3ARGB 5ACZA 4G5ZH 1CXEA 1FP5A 2Y72A 1DLFH 4OZ4A 4ZYKA 1MCPH 3T3MF 3CLFL 2NLJB 3U46A 5JNYB 5FA4A 1YY9C 4MHHI 1J1XH 3MGOB 4AMKL 3RY6C 1C08A 5C09B 5IQ9B 5F3HA 1N64H 5DS8A 4NO5B 3VG0H 5IMMA 2OR9L 1I3GH 4GW1B 1AKJA 3OXRB 4UIKH 4I2XE 4R4FH 3CFDA 5EZOH 1HHIB 4L8CB 5JHDE 3K4AA 5IROC 1I9IL 2W0LA 4WGVB 1S7QA 5DHVH 4CJ0A 4L3CB 1G7MB 3QUXA 3TT3H 3DUUA 2VZ1A 4EN3A 1C1EH 3P0YL 1UM4H 5F1IB 2VLRD 3MOBH 2YD8A 2L4OA 5SWQA 3N1MC 5EWIH 4LSSH 4CN4A 4OD3H 4J23A 4U4BA 3HZYA 5C07A 1PQZB 5D8JL 1NBYB 3P4NA 2DTML 3UYRL 4OIIL 3GSNA 1OD7A 1UKQA 1I9JL 3UJIH 2BERA 3P9MA 3MA9H 4BK4A 3T04D 2NZIA 3HZKB 1FYTA 1N4XL 2FO1A 4BUHA 4GUPB 4X0KA 4OLZH 1LEGA 1JHLH 4PG2A 4FNLL 4AIZA 3TF7C 1N5AB 2W38A 5JHDD 1WJ3A 1BIHA 5E6IA 4L3AA 2CKBB 1HEZB 3FFCE 5I1DB 1K3ZA 5JW3H 2PNDA 3CMGA 4O4YL 5HHOE 2R29L 5CEZL 4NSKA 1G7LB 4PJAA 1NL0L 1BM3H 2OL3L 2FX9H 3PIQA 4K3EH 3WKNA 3KPQB 4J2XA 1E6OH 2DDQH 2FYYB 2R69L 3TH2T 4KROB 5FYLH 3OB0H 3TH3T 3V5HB 1VHPA 2GJZB 4JRYB 3X14A 5IFJA 1KLUA 4DAGH 4JANA 2IPKA 1SEBB 3UTZA 1AGBA 3HTLX 1YQ2A 1GOFA 3L5XL 3EDJA 3EO9H 4Y4KA 3TT1L 4QRPE 1U92B 3REVA 2QSQA 4YDLB 5D7IE 2PYFB 5DQJB 3O4LB 1CZ8L 3BD5A 1H3UA 1WZKA 1YEDA 5ACZB 5IMKB 4JRXA 4HG4K 2P48B 4OZ4B 2H2PD 3LV3B 4HZLA 4ZYKB 2HJFB 4EI5B 3ARZA 4XVJL 4KMTH 5JHLL 4APQD 4MXQD 3L5HA 4GMSH 5FA4B 4DKFH 1X5GA 1J18A 4DVRL 2IALA 1AI1H 3QEUB 2VZUA 3CDCA 5IOPA 5D7IF 2F19H 1CGSL 3FFCD 1UJ3B 5HHOD 2AK4D 4O02L 5F3HB 1QVOA 4BQ8A 3QA3A 3JTSA 3C6LD 1HHHB 3VD9A 1CQKA 4KKCC 2PXYA 4NN6B 2YSSA 4JM2A 1JPTL 1GCFA 3VMPA 5LJYH 5GGRY 2UWEB 2ITDA 2VC2L 4YHNB 5I1EH 3ZYJA 1FGNL 3TO4C 4ZDHB 2AJVL 3DUUB 4QEGA 2AJYL 5L8JB 1CF8H 4KRPD 4QRPD 1CLCA 3QWRD 4XWOC 1LMKA 4E0RA 5SWQB 1CG9A 1A6VL 4WI6A 3DUSB 4ETYA 3ARBC 2FB4H 4M8VA 1T2JA 3NH7L 4GG6E 4EBQH 3HI6L 5C07B 1ZVHA 4S0SD 4OSUH 4XCYA 4IMKA 1WZ1H 2IANB 3FB6A 3UBXI 5J11C 2VH5H 3CDFA 3TN0C 5GS1A 2B5IC 4PJ8D 4TUJA 2X1PA 3S5LB 4B7IA 3P9MB 5FF6A 1KT2B 3QIBD 4M7KL 4DEPC 2QQNL 1HSBB 1IC7H 4N0CD 1OTSC 1J8HA 2E9JA 4GG6F 1BOGA 3PDOB 5JQ6L 5GGUA 4IM8A 4PGDB 1OTTC 1NCAH 4LP4A 2R23B 3MLWL 2G2RA 4UV4H 1PLGH 5EBMA 1U95A 3V7AE 5KSBE 5GZOD 2ZUVA 5C2UB 1EMTH 3CFCH 3FFDB 4HGWA 2DD8H 4R9HA 1KCRH 3TV3H 2FIRT 2BHZA 1YMHB 2J5LB 4X6DA 3ELAT 5TGBB 5I1HL 5KVEL 1R3JB 4PUBL 3V7MA 4M6NL 1R3KA 3ZE2F 2JB5H 5IFJB 4LHQB 2Z35A 3UYPA 3ULSB 3UTZB 4U6TA 4EOWL 1DBBL 4A2MA 2AJ3B 5KSBF 3I3BA 4WUKH 4KC3B 5GS0D 4C4KO 2R9HC 5IVZA 1A6TA 1A4JA 3VRIB 4U7MA 1E27B 4Q58C 2WUCH 2YD3A 4UILL 3FHAA 5DFTA 2P45B 2DKMA 3MV8A 4JRXB 4M93C 4HZLB 3RI5F 4HWEL 4R3SB 2ADGA 2Q8AL 4MNGB 3VWKB 4OZGB 43C9B 2ICCA 2Z8WC 3OJ2C 4KHTH 5IOPB 1UH4A 3UP1A 3CH8A 4WW1A 1A7QL 4UDTA 4XP9L 1JZ3A 5IV2B 4UT6L 1CBVL 1SVZA 1EIBA 3PHSA 4G8IA 3EJYC 4NHUA 3QA3B 5D2NA 1FFNA 3KPOB 32C2B 3JTSB 5EOQH 3PGFL 1MCBA 4MMXC 4EDWH 2YSSB 4MQ7A 1WBZB 4KJYB 1NMCC 4MJ5B 5FOBA 2CLRB 4F37F 5CILL 1GZQA 1PG7L 4D8PA 2ZZUT 1WCBA 4WCYH 1N0LA 3BXNA 4BFEA 1QD0A 3K2UL 3T0WA 5IMLB 4JZNA 4N1CA 3MROA 2WP3T 2BJMH 3LHPL 1RZ8B 3BPOB 1L6ZA 5GSVB 3RWFA 5DURB 3QJHA 1HILA 2I9LA 1M7DA 1RPQA 3R8BB 3O6KL 3D0VA 3HC0B 3LEVH 5T5FH 4I13B 4K71B 2YMXL 4H1LG 5B8CA 4GKNA 3FB6B 1JGEB 1XGTB 4HLZH 1L4IA 1KCSH 1JGDA 1NGYA 1NMAL 4H20L 3OKDA 2P8PA 1JZ2A 4OLWL 5A16A 4EQ3A 1Q8MA 2FCBA 2VDNH 5FF6B 4ELKB 3TH4T 1Q0XH 4PJXE 1J8HB 5SWZA 4TTDC 3PXHA 1BOGB 2Q7YA 3BUYA 2LFGA 1AXTH 3O6FC 4PIRF 4JDZA 3AY4C 4M7JH 4PJDA 1RIVL 2G2RB 4YDJA 2EYRA 4P9HH 1TNNA 2E9WA 4RMRA 1YEFL 1AY1H 1AIFA 1NSNL 3TA3B 1CE1L 3A6BH 1ZVYA 1J05A 5T1MA 3P11L 1LK3H 1D5ZA 1XGPB 4PJXF 4U05A 3KPNB 5TDNB 1T7WA 3BDBA 3U4BH 1A9BA 1YNTB 3BZEB 1K8IB 2AXHA 5I8OL 3D6GA 5L6YL 3BVNA 5D7LA 4L9LC 2VZVA 1CYGA 5CJ8A 3SDAB 4FQCH 1HWHB 1A6TB 4V1DB 4WENB 4NJ9L 5KW9L 1JNHA 4DOHB 1G84A 3IDIB 3PGCB 1K5NB 5L2KB 4LCCA 5F96L 3FO2A 4ODXB 2ADGB 3JXAA 4FQLH 1FNLA 3HB3C 3QWQB 1F97A 2H2SD 3QQ4B 4PV9A 1JN6A 4BZ1L 4YDIH 4WW1B 3RY4A 4UDTB 3O3AB 4Y4HA 4DN3L 1BGXH 4MDJA 3L3OB 5F71A 4HWNA 2DLHA 1QO3B 5CJOL 5D2NB 5HHXH 4GAYA 4ESKA 4KHXL 3S36X 4OLUL 3FQXA 1KTLA 2IGFH 1BVLB 4MQ7B 1A7RH 2VRAA 4PJFE 2D2OA 5BO1L 4FQ1L 3K1DA 3LEYL 5D6DA 5EUOB 1I3RB 1WCBB 1E4WH 4L8DA 1J12A 5K59F 2I5YH 1D9KD 1T80A 5JOFB 1DUYB 4WI3A 2D7TH 1QZ1A 5HD8C 3MROB 3MODH 1W72H 5CSGA 1T1WB 5LKNA 3O2DA 1IGFH 3Q5TA 1FZOA 2I9LB 4CDGC 1P5UA 2VZ3A 4JFYA 1MREH 5C8JA 5FFLA 2V9QA 3AAZB 2ED7A 1C5CL 4R7DB 3ZMRA 3RNKA 4MAYB 1D5XA 1B0WA 1BFOB 5JO5A 5DFVD 3RJQB 1KIUA 4KI5E 1HCVA 1BEYL 3ULUE 5EFIA 4BFGA 5FDWB 3B43A 4GKZB 5FB8A 2P8PB 5B39G 4GAJL 4DN4L 2FATH 2PCPA 3BQUD 3CSGA 4K8RL 2CUHA 2LAAA 3RBSA 3J7HA 5FHAL 5SWZB 2GITB 2Q7YB 3MV01 4HEME 1A3LH 5DD1L 4NHCL 4ZUVB 3RUGE 1X6LA 1BQLL 5I8KH 3CX5K 1RUPL 3ULUF 1JTTA 4YDJB 3C2AL 3UPRA 2EYRB 3VFVB 3WHXA 1T22A 1EXUA 1VACA 3S35X 3VXME 2BOBB 1PJ9A 5LGHL 3KYMA 1K4CB 4Z7UE 5GRUH 5IVNA 1D5ZB 1EUUA 2OI9C 3L6FA 4CNIA 3T2NH 5TE7H 1F13A 3RUGF 4KK5D 4LIQL 3CXHJ 3IJHA 4ZNCD 3W2DH 1MRCH 4S11A 5LXGL 3PWUA 1LQSR 4POYA 3TZVD 1SJEB 5D7LB 2ZCLH 1ZT7A 5IBTL 5FK9A 4KI5D 3ULUD 4Z7UF 1HOCA 3KPSE 1JNHB 1CD1A 1NCWL 3DSFL 1QKZH 5M94B 4PTUA 4CMHC 1D5MB 3WJLC 3B9KB 2VDQL 1UQSA 2G60L 1JN6B 4J4PD 5KANI 3T77B 1I3VA 2X70B 3ARFC 4HDIA 4JJHA 1I85A 4MDJB 3VXMD 3MRFA 1WC7A 2GAZA 3PL6A 1LO2H 5DQDL 5EO9B 3K8LA 3WEXA 5KVDL 1FN4A 2W0FA 1S7VB 1U8IA 4IBLT 1MI5E 3QUZC 4KDTC 1DLHA 3QAZC 1ZANH 4Z77A 2DMCA 5GZND 3KDMB 5I71B 2MKLC 3OAZK 4WVRA 3V0AC 4PRDA 3MMEB 2PO6A 2NY3C 5J1TC 3KPSD 4K9EL 4M7LH 1H9VA 5SWSE 1IAKA 3VD5A 1GGIH 4F3FB 1IAII 2NXYC 5C8JB 1BF8A 5JXAH 5BS0B 5ADOH 1GSMA 2PTTA 5E8DL 4X4XB 4XNMB 4KQ4L 2BY1A 2LABA 3VD7A 3VDBA 4I0PA 3QUYC 3P0VH 1F4WH 4FFYH 3GMOA 5GJSL 2C4FU 1FORL 3WLWC 5J57B 3FN0H 1DQMH 2GJ6E 3ARXA 1V3LA 4OFPA 1XF3B 2R2HA 3QIWC 1EJ6A 4S2SA 2Q6WA 1KCUH 2QSVA 1OLZA 3IDGA 3O9WC 1MI5D 4PJHA 5JPMA 3AU1A 1IGCH 1T66D 5L7XH 3WHXB 5FECB 2F5BL 1T22B 5CSZA 3UPRB 1RULL 1G6RL 4PLKC 3GDBA 2X1OA 5I73B 4KAQL 1OP5K 3V0WL 3MRIA 3NA9L 5DJXA 4X4ZA 1EO8L 3FTGA 3KYMB 1GYAA 1B3JA 3BP5A 3BE1L 3L6FB 4CNIB 1WAAA 5SWSD 5JZ7C 1FVCA 2J8HA 1UC6A 3I84A 1J88A 3X12A 1KLFA 2K7QA 1FFOA 3IU4L 4HV8B 4I4WA 3QUML 3CZFA 4OIBA 1G9EA 4QRTA 5EH1A 5DVMA 1TQCB 1I8LA 5FGSA 1HOCB 4L4VA 5E1HB 2X4PB 2WBJA 2GJ6D 1KNOA 3RI5K 3C09C 4P23D 2YD5A 4JFDA 5T3XL 1XGUA 3ULVC 3CVHA 1EGJH 1QBBA 1ONQB 2BRQA 1RURL 4G6AC 1GPOL 4LSQH 4WV1B 5CZXC 1MF2H 1B4RA 1JNNL 3BT2H 1F3DJ 2HJKB 2M8XA 3MRFB 3QDHA 5CS7A 5IHLB 1KN2H 1KEGL 1VGKB 4F57H 4K94L 3OPZL 4MJIB 1AE6H 4OLYH 3HE7C 3WEXB 4N9GB 4G9DA 2W0FB 2FJHA 3E3QC 1U8IB 4PB9H 5E8PA 4HT1L 1TPXB 3TNNA 5KVFL 1DLHB 3GKWH 2WWMD 4E9LA 4Z77B 3VXSA 5GIRA 1FZMA 2YWYA 3LRSA 3ES6B 4RWYL 2NY0B 2NY5L 4XCNB 4NKOB 4GBXD 3V4VL 3TWCH 5DSCB 4L4TE 1QSFB 4QHLA 4KPHH 4C83A 1IAKB 4CVWA 1KG0A 4KJWC 5E4IA 4ODUB 5DWUH 2APTA 1PKQB 4DZBA 3T2PA 5F9WC 4ZXBB 1HYSD 2PTTB 4EQ2A 5FYLE 2EDFA 1I1AB 1EFXD 2H1PL 1DUZA 5J13C 4I0PB 3MRQA 5D1ZB 3CLFH 2NR6C 4JFFA 4J3WA 1F02I 4ODVL 5CLWA 3GMOB 1UVQB 5ICXA 3PHQB 1LE5B 4G7YL 5F9AC 5T1LD 4LPVA 3MRMB 3P77A 4AMKH 3KYOA 4DW2L 1KPRB 3PABA 3UBXA 1OY3B 2Q6WB 2NY1D 1BJ8A 4ELMA 1S7XB 5KSAA 3UTTA 5J6HB 1K8DA 3TIEA 5ANMA 4MDIB 3SKMB 5F72S 4QHKI 1NANI 3EO0A 3C60A 3PHOB 5EIIA 1ZGLP 1IZKA 4B53A 5DJXB 3ZHLA 1I9IH 3FTGB 1IMHC 3QIUB 4L4TD 4CW1B 4XZUB 1IM3A 3VGDA 2F54E 4O9HL 4UT9L 2O5ZL 3P0YH 3C8KB 1UXSA 1FFOB 1JUFB 1A6UL 1UXWB 3B8SA 3CZFB 3D3VB 5FO8A 4OV5B 5FYLD 4YQXL 4QRTB 3DX8B 2WZPD 2BSTB 2YEZA 4B0MM 2BSED 2EDWA 2VDKH 4N0FB 4L4VB 5D8JH 4KH2A 3VCLA 2IQAB 2WBJB 2DTMH 3P73B 1PKOA 4OIIH 3UYRH 3C2SA 1I9JH 4JFDB 3K8KA 5EU6E 1X5LA 4K7PL 4IHOA 4ZFZA 2B4CC 2P5EE 2ED9A 2L7JA 1N4XH 3BW9A 5I8CB 2EC8A 5EOTA 1JF1B 3N1GC 4U1IB 2ZCHL 5ABDE 4FNLH 3LKPB 4G6FB 3OX8B 4TULL 3HNSL 4DJMA 2VL5A 4O4YH 1OCWH 5BZDB 2R29H 1FQ9C 5IK3A 2F54D 3GSUB 3SE3C 4NFCA 1NL0H 2OL3H 4NOBA 3D0LA 4O58L 1HDMA 5HVHB 1IKFL 1EUTA 2YRPA 5CMAA 5CWSB 2R69H 5IB4A 4RGMB 5GIRB 1C8PA 5D1QA 1JBJA 2J6EL 4RBPK 1G6VK 1T03H 2P8LB 5DJ2B 5FKAB 1U8OB 3L5XH 1I7ZB 1KG0B 1YNLL 3TT1H 3WNLA 2CSPA 2RR3A 4FS0A 4DZBB 1WEJH 1CZ8H 5EU6D 4C55A 2YA0A 4R97C 2P5ED 4I48A 1AD9A 2ZSVA 1NEZG 4NQCB 3HN3A 4G8GE 4JLRB 4PY7B 4XVJH 5JHLH 4JFFB 4PREB 1CIUA 3T0EB 4ZFFB 1NAMB 1PY4A 4BQBA 5ICXB 4HUWB 4DVRH 3MNWB 1B9ZA 2R2EA 4QHNB 3P4MA 1IBGL 4MAUL 5ID0B 1MCEA 2XRAL 5JW4N 1CGSH 3MRNA 4MLIA 4O02H 3UBXB 1OLLA 3DGCR 5HGHA 4I2XA 2P24B 3MLZL 2RCSL 1RZIA 2E6QA 2WINA 3TPUA 3IDJA 1K8DB 3MCKB 4W6WB 5JHDA 3LMJL 3ZTJH 1FO0H 2EDDA 1BVKA 1I9EA 1T0MA 1JPTH 1DEEB 2PYEE 3SHSA 2VC2H 4R4BA 2CRYA 1FGNH 2OTUA 3F7PC 1N6VA 5BRZB 2KL6A 2AJVH 2ZUWA 4IRZL 2AJYH 4HAFA 4K7FB 2ICEA 3EUUA 2H32A 5HI5C 2LE9A 5H94A 2B0SL 1UXSB 1A5FL 4NBXB 5I15L 1WITA 5KZCD 1L9MA 1FPTL 4PJ7B 1A6VH 4DQOL 4XH2A 3WUWB 1HH9B 1YDPA 4G8GD 1SYSA 2X4QA 3NH7H 2D31B 3HI6H 4QRRE 4P3WA 5AD0B 3VCLB 1RUQL 3AUVA 4MXWL 5FCSH 3D85D 4QLRA 1DVFD 5IUSA 3F7VB 4Z95L 3L3HA 5E70A 1JMZA 1N7ML 2FIKA 4R7NA 4A2LA 2Z9TA 3IJSA 3QNYA 4M7KH 2QQNH 1CFTB 4LSVL 2OCFD 5GGTA 5T1DH 1FL5A 5JQ6H 1KB5A 4M5YL 4JO2L 4QWWD 1Q94B 2PYED 4KJPC 3MLWH 3SDXB 5DI8A 4OF8A 1P53A 5IEKA 2A6JB 4NQEE 4N0RA 3C6LA 2VABB 4KK8D 4X83A 2RHEA 1SY6A 3FAXA 1PGRB 3QQNA 1HDMB 2Y1VA 1IGYA 5CMAB 5DD6A 4L8BB 2X9WA 3D25B 5I1JL 6CGTA 5I1HH 5KVEH 2CIIB 4LHUA 4JY4B 3NPZB 4PUBH 2ZUTA 4M6NH 2PUQT 5GISL 3S37L 5D7IA 3V5KA 4EOWH 2OSLA 4QRRD 1DBBH 4M61B 2VLRB 1S9KC 2NY7L 4GXUM 1IAOA 3VJ6A 3DIFB 4HK3N 4BH8A 3GJFH 4XX1E 4HH9A 4R0LA 1AR2A 4UILH 1P7KB 2D0FA 5ITFA 1CICD 3OQ3B 1TTGA 5C0AA 1I8MB 5CJXC 1VEMA 1AD9B 2ZSVB 4JHZA 4YDLC 2Q8AH 5IG7B 4MA3B 3FQNB 2DQGL 3DX6B 1LEIB 2ZCKL 4M5ZL 3NPSB 1PBYA 1GXEA 4ZNEA 5JW4R 4S1DC 3MR9A 2C5DC 3MO1A 1A7QH 2I07B 3QIBA 4XP9H 2RFXB 4N0UB 4NQED 4XAKE 4UT6H 1CBVH 2Z4QA 1MJ8L 4I2XB 4P59L 4HIHA 1L0YA 4LDOB 3TPUB 5JHDB 3PGFH 2QEJA 4Z78A 1KTDA 4LVOC 2BSRB 4WU7A 1T0MB 1TVHB 3IDMA 4FXGA 1F11A 4U1GB 2UVFA 5CILH 1PG7H 4R4BB 1LNUB 4WI8A 3HS0A 3K2UH 3VFUB 5IQ7L 2XQYK 4YFLF 4C58B 4FXKB 2ICEB 3LHPH 3AC0A 4GG6A 2YXMA 2CDFB 3DVGA 1NKRA 3BWAA 1R24B 4UTBL 2R1YA 4Y2OA 4EN3C 3I6KA 3WXVL 3O6KH 3V6ZA 2M26A 5CD3B 5HGBB 5C70A 3OKEA 2YMXH 5IR1A 4PYGA 1NMAH 3MNZA 3NFNB 4H20H 4XAKD 5C0DA 4AIXA 4OLWH 4APQB 4PGEA 2DLFL 2WQ8A 4GS7B 5DMGD 3WMSA 3QNYB 4RNRB 3ZDZF 4D0CA 4AH2A 1DQDL 3FFCB 2YZ1A 2KZ1B 5HHOB 2Z93B 2AK4B 3DX7A 5KSBA 1MLBA 4LCYA 5AZ2L 5HY9B 1RIVH 4Y5VA 1MIML 3GMRA 1UZ8A 3C6LB 1L7TL 3RJDA 4LOUD 4DK3A 3WS6A 1QFWL 4CJ1A 4YLQT 1NSNH 3VRJB 1U36A 1O7VA 1CE1H 4OT1L 1IGYB 3P11H 1CR9L 5E6IC 5DD6B 4XVTL 3VRLE 1LVEA 3FRUB 5TH2B 3KR3L 4KRPB 4I8DA 1LO4L 4LLQB 4QRPB 2J7LA 3V5KB 5I8OH 3FT3A 5L6YH 5J12C 3VXRA 5AG9A 2FDBP 3C5ZD 3VJ6B 5A2FA 3PWNA 4AL8L 3MNVA 4NJ9H 5HI3C 5IF0A 5KW9H 1YQVL 1OAYL 2VN4A 3FCTA 3SGEH 1JCKA 1XR8A 5F96H 1T20A 4ENEC 3BGFB 4HMEA 1V7ML 1N0XL 5INDA 4G43A 3EHBD 1VKXB 2BCKB 4PJ8B 3U0WL 3LPGA 2DYPD 4MMZC 4BZ1H 2AJUL 2CH8A 1MQKL 3MR9B 5ELIA 1KJ2B 1FV1B 1H3XA 3QIBB 4DN3H 4X6BA 3OB0K 2Z4QB 5CJOH 4PJCE 4ONFL 4HIHB 4PRIA 2YA1A 2HLAA 4HFUL 2VE6B 3LN4B 4KHXH 4OLUH 5JORA 5DK0A 1XF5A 1KTDB 4C56E 5F88A 4FXGB 1F11B 3OTTA 4YK4B 4FQ1H 3LEYH 2EIZB 2Y5EA 2CMRL 5IHUL 3FOMA 2RJMA 4X98A 4JM2C 4JB9L 4S1SL 1A22B 5DJCB 2VZOA 3VG9B 2X4SB 1A14L 3QNXA 3KHOA 3ARQA 3UPCA 4GG6B 5INCA 3X11B 3GMNA 4GW5A 2FBJL 1N3NA 2XTJC 4UIMA 3HC3L 1C5CH 1Q9KA 3DECA 2L0DA 3V6ZB 4OZFH 4HUXB 3G5YB 5DJ6A 5C7XL 2EXYD 3QO0B 2A74B 3CSPA 4YDKL 1BEYH 4ERSL 1X44A 4WGWB 4IS6A 4NYLB 3LOWA 4DKDC 1BWMA 4GAJH 5C0DB 4DN4H 5I2IA 3K8MA 4IOFC 4IMKC 4K8RH 3DVNA 5D9SB 2XZCL 2QHLA 1II4E 4MD4A 5ACMA 4G3YL 1KJ3L 5GS1C 5FHAH 3IVKB 4QF1A 4J7RA 4C56D 5KSBB 3DX7B 5DD1H 1MLBB 5C0CE 4LCYB 1MVUA 5HHPA 5IW6B 1BQLH 5F7DA 1KENH 1RUPH 3C2AH 3N50A 4RFEB 4X6FA 1NDMA 3VXNA 3RWHA 5E94B 5LGHH 4PJ9D 1J0YA 5DT1L 3EYSL 5JMRA 1MCJA 3T0BA 2FGWL 3JBG7 3N85L 2YD9A 3GB7B 4HIEA 4X7SL 1D9KA 2VOTA 4LIQH 4FFWC 4NKMA 3GEWB 5CGYD 4AY0A 5LXGH 4OF5A 2OQJA 4KK9D 5IBTH 3KS0H 4EDXA 3V4PL 1AHWB 4P2OD 2ICWI 2KZWA 1NCWH 3DSFH 3U0PA 2P47B 3KPRE 1EEZA 1A64A 1T20B 4OCNC 3O2VL 3OAYH 4POUB 3BYYA 3OWEA 4I3GA 2VDQH 1P9MA 2G60H 5C0CD 3JWNC 4Q74A 2NCMA 5FA3B 1TXKA 3CDGA 1RJCA 1FG2A 1BP3B 1GOGA 1CXFA 1R3LB 2YBRB 3TCXA 5JIIA 5ESAB 5HGGS 4YR6A 5D5MF 1EX0A 4K2UL 2EXWC 5DQDH 1V3MA 5KVDH 1XCTB 2BVYA 3G5ZA 1ES0A 5D2NC 1UB5B 2W9DL 4WTZA 3PUCA 2EYTB 5HYJE 3KG5A 4M6ML 4P5KA 2FL5A 4PJBB 4X98B 3RP1A 1KIPA 1P2CA 4NWUL 1C16B 3QDME 4P57A 3CX2A 3TVMD 1FSKC 1MAML 4KJQD 4P48A 4K9EH 3WFDH 5FKPB 2FLRT 5DD3H 5INCB 3GMNB 3FQUA 2NTFA 4J3TA 4P3DB 5J4MA 3KPRD 1HQRA 3L3JA 4UIMB 4Y16A 3DYMA 2Q7NA 5FOJA 5E8DH 2KDGA 4YFLI 4KQ4H 4WDIA 3UDWC 3OKKB 4W6YB 3NABL 4JPIA 1OAUH 4IS6B 5GJSH 4KK6C 1FORH 5IW1B 4PJXB 4LNVA 1TQBB 5EU7C 2QSCL 4X8JB 5B8CC 3DVNB 1HHGA 5C0GA 4PRHA 2XPGA 1M05A 3RUGA 4MD4B 4AG4L 4KQ3L 2DMKA 4HKBA 5DYOB 1ZAGA 3LKNB 3W9EA 2HJLA 4J4PA 1INDL 3GGWA 5DEFA 5HHPB 3VXMA 1PEWA 4PJGB 4J8RA 5HYJD 4Z7UA 4D2NA 2XN9A 1RULH 1G6RH 5GRWA 3SN6N 2C3VA 4PP2B 4KAQH 3VXNB 4JDVA 3V0WH 3NA9H 3QDMD 1EO8H 2DN7A 5C9JB 4JO1L 3BE1H 1A3QA 4MD5A 1V3JA 1G9ML 4WW2F 2FLBT 1GGUA 2P4AB 1FJ1B 1RZ7L 5J9PB 2PW1B 1D9KB 1J86A 3IU4H 3DRQA 4Y8DC 3QUMH 2ZUXA 3H9SE 4HX1A 3QNZB 2V2XA 3QEQA 2OQJB 1XF2A 3IRZA 1GAFL 1B4JL 1JGLL 5I75B 5I6XB 3F62A 5E2VL 2DWEA 1EEZB 2Q76A 2YR3A 5T3XH 4YAQA 4FRWA 3HAEH 1RURH 5C0BE 3MRCA 1GPOH 5I1KH 5CGTA 1QFOA 4LCCC 3BQUB 5DHXB 1NJ9A 1T7YA 1NC2D 5BV7B 2VDML 1RMFL 5HVFB 1KEGH 5LWYH 3X3GL 1F00I 3OPZH 2Q1EA 4K94H 4PJFB 4Y4HC 4NPYB 3O2WL 1QHPA 2J1KA 1ES0B 2DJSA 3MXVL 4LASL 4HT1H 1Z9OA 3FT2A 4AJ0A 3H9SD 2GCYA 3X3FL 3UZEA 4LRNL 4P5KB 5SWSA 1P2CB 2V5YA 3SQOL 2Y07L 3DGGB 4WHYH 4RWYH 2NY5H 4LEOB 4G80A 3MUY1 4LSTL 5TQ2L 4EUPH 2NTFB 3TZVB 3KLHC 4F9LA 3L9RB 1HQRB 2V5MA 2E27L 3L3JB 3W0WE 3V2AR 3BYTA 2M2DA 4PJIA 2HT2C 5C0BD 3BJ91 4YO0A 1I8IB 3G6DL 4WDIB 4JQVA 2H1PH 2GHWB 3V79C 3QXTA 3MA7A 2GJ6A 4WIQA 4WU5A 3NCMA 4U33A 4G7YH 4NM4L 3BDYL 4R2GB 5DDHA 5LGKA 5KS9E 1HHGB 1GGCH 2DBLL 1M05B 2W1NA 2XPGB 3NCEB 4DW2H 4HKBB 5HYQA 3EDKA 3TJHC 4BK5A 5IFHL 3EOTH 3MBXL 4NNYA 4ZUSB 3QFDA 5DEFB 2AQ3A 3VXMB 4WI5A 4YC2B 4Z7UB 1NFIA 1UM6L 4LCWE 2FECI 5KS9F 4ZG1A 4HQQL 4Y8AA 4QTHA 3RWDA 1RK0A 4KZEL 4LVEA 4M1CD 5BOPA 3LKOA 4O9HH 1EVTC 3DPBA 4UT9H 2IPUK 2O5ZH 5C92A 4IMLA 3LEXB 1JPFA 3W0WD 3DRQB 1A6UH 3QH3B 4YQXH 3WIIL 3KPSB 1ORSB 5DHVA 1VADB 5C0JA 1TCMA 1H0DB 3QI9B 4PTTA 2HFFB 3DO7A 1BBDH 4M3JA 2DWEB 4HF5L 5MEOA 2XZQH 4XP5L 3U6RA 2NZ9D 4K7PH 4X7TB 3MRCB 1J87A 1XH3A 1XIWD 3PWPE 3ARED 1ZGLA 4FQHB 1WV7T 4HS6A 2UYLB 2B4CL 2ZCHH 4HIJA 4HKJB 5J89A 3MLPA 3CUPA 2NNAB 4LCWD 4TULH 5BVPH 3HNSH 3RNQA 4RSVA 4KI1A 3MLRL 3CSBA 1MI5B 2P5WE 2DBJA 3MJ9L 4OFYD 4O58H 1OGAE 1IKFH 4ZOBA 3O3BB 4EZMA 3RZCD 3FT2B 5KN5A 3CFKA 2BC4A 5TE6L 3WDJA 3N1FC 1I7RA 5SWSB 2J6EH 1ZA3B 3BZDA 1FAKT 2NYYD 3BEWA 5KSVA 3PV7A 3RVWC 5H2BA 4RDQF 4G80B 1U8QA 4KKAC 1OQOA 4U1JB 3QFJA 4ZQKA 2N4IA 1YNLH 1U8HB 5GGSA 3LKQB 1AO7A 2NY0C 1XGQA 2PO6C 4HWBA 5I1GL 1RI8A 2J8OA 1DQQB 4LVHC 3VXOB 3PWPD 3MA7B 2X4RA 3F12B 4P23B 2KQNA 5C0RL 3GSWA 1ETZA 1I1AC 5F9JA 5DDHB 1T1XB 1IBGH 4I0PC 1OSPL 4MAUH 2XRAH 5D1ZC 5FM5O 5JA8B 2ATKA 2GFBB 2P5WD 4Y1AA 4BA8A 1D6VL 3B9DA 5D70L 3D9AL 2C1OA 5HYQB 3GBLA 4J1UB 3IFPB 1XZ0A 4HJ0C 1OGAD 3QFDB 2KUTA 3MLZH 2RCSH 2Q20A 5JXED 2ZPKL 3MFFB 4MQXC 3VXTA 3LMJH 3OKYA 3IFLL 3U0TA 3GM0A 1X5HA 2WLZA 4NQUA 5D93B 1RJLB 2F54A 1NBZA 3U4AA 3RWDB 1RK0B 3VGAB 1S7UA 4MSWB 1QRNE 4IRZH 4O2FB 4IMLB 2B0SH 3U30C 4LSRL 1A5FH 5D1XD 5HXMA 5I15H 3L5IA 1B6UA 2D7NA 4GBXB 4KKLC 1FPTH 4DQOH 5IBLC 1ZHLB 5D96B 5C0JB 2RB8A 4PTTB 1U93B 3ROLB 2HFEB 4MWFB 1HINL 1PFCA 3DO7B 5DRWB 5T33L 1RUQH 4MXWH 3NZ8A 2P5EA 5IVXE 4WJ5A 3JWOC 4PFEA 1EFXB 1I8LC 4U2ZA 4IRSD 1MJUL 1LO0L 2YUWA 4F9PA 4Z95H 3RIAK 2WBJC 4X4MA 1XH3B 1N7MH 5KG9B 5T1LB 5E00B 3IDNA 4Y2DD 4LSVH 4HS6B 3UBXG 5CEYB 3BO8A 4NRXA 5C0FB 4HIJB 4M5YH 4I77L 4JO2H 3HRPA 2NY1B 5ID1A 5IVXF 1QR1B 5T5NF 4I18A 1F90L 1QRND 3IKCB 1QRKA 3VH8B 4FXLA 2P7TB 1OARL 2IH1B 5I1JH 4L4TB 4NKQB 3MLTB 5DO2D 2JF1A 15C8L 5HVHC 2VZSA 3MQIA 5KBNC 1WBYA 5GISH 2OJZL 3BEWB 1ZGLM 5KSVB 4HUVA 5D4QA 3S37H 3ZDXF 2NY7H 3VFPA 3MZGB 2DKSA 2AAVA 3B3IA 4BSVA 3S88L 1MELA 2UUDH 3M45A 2X9YA 1LE9A 2CD0A 3MV9A 4QRSA 3MRLA 1JZ5A 1XGRB 2R0ZL 3BIAX 4WEBL 2FHCA 2GTZA 2X4RB 4XVUD 2DQGH 2ZCKH 4M5ZH 3JWDL 2FX7L 4POZD 3VDCA 4XHQA 1MNUL 4HIIA 4TOYL 4QHMB 3VWJD 2OYPA 2C1OB 4YXKL 1MJ8H 3DMMD 2NY2D 4OQTL 4P59H 3SKJL 4G7VL 2IBZX 4FZ8L 2PYEA 2CDGB 1B6DA 3U0TB 5KSAC 3LB6C 1FVDA 3V8CA 2O61B 4GO6B 1T04B 1S7UB 2ADJA 4IRJD 1H3GA 3QPXL 2BY0A 1ACZA 3NIGF 3T2QA 1JTOA 1Y6KR 3L3IB 3W39A 4F7CA 1RAMA 3CH1A 3HCVB 3MUJA 1TVBB 1J1PH 4UTBH 5D6CA 5IKCB 3W9DB 1MFAL 2DIJA 4RWHA 3WXVH 4FFVC 5CSBA 3V52L 2FO4A 2FD6L 4HWUA 3BEVB 4Z6AT 1QLEL 3O45A 4M62L 5EU6B 4EVNB 5DVKA 1INQB 1UFUA 3UMTA 2WUBL 3KYAA 3NZ8B 3DHMA 5CIPA 1Z0NA 2I25N 4HPYL 1RZJC 1ULVA 4HKXA 4ZPVA 2XT1B 3KXFE 1EBAA 1CLYL 3OF6D 2DLFH 1Z3GL 4RGNE 4H0GA 1XF4A 4WTWA 3QJFA 1LK2A 1DQTA 3IDNB 3VFTA 3ET9F 1DQDH 4TUOA 4IDJL 4NQEA 1P4LA 4TNWF 2V9RA 3OKOA 3SKOB 4WWKA 5AZ2H 2JCCF 1WBXA 1MIMH 4QY8A 5C3LD 3RIFK 1L7TH 1QFWH 3CLEL 3H6JA 2G5BA 4W4NA 1H15A 1FNHA 4OT1H 3EJZD 1CR9H 3GSXA 1RD6A 4X99A 4XVTH 3HFML 5IM7B 3VGEA 2VKWA 2CLZB 2Y5TB 4OCRL 5K9KA 1LO4H 3OR6A 3VE0A 3F7YB 1P7QD 5IB5B 2E9BA 3MRGB 2Y7QB 4PJ5E 3RY6A 5D1QC 4U1MA 1DN0B 5KZCB 3WNOA 1MCWW 2IH3B 1YQVH 1OAYH 4G8GB 4JFEE 3LQAC 3KXFD 4QRSB 3MRLB 2E7LA 5ECJE 3LSOA 4RGND 3G08A 5EO0A 1URLA 1V7MH 1N0XH 4LIQE 5B4MD 3UAJD 4CDHA 2GTZB 4LQ1A 1AC6A 2ZSWB 2JJSC 2C3XA 3E6FB 3D85B 3QCTL 5DMKA 3U0WH 5CINL 1DVFB 5E1AA 4FQJL 2AJUH 5EZJB 1MQKH 4HIIB 4HAGA 5BJTB 5FUOL 4ORZC 4H1LH 4K8RD 4ONFH 4PP1D 2PYEB 3QT2A 3WNPA 3G9VA 4HFUH 5DD5L 3VFOA 2P1YA 3EYOB 1YJDL 3X13A 3NCYP 3WL9B 2ZOLA 1GJIA 2YPLA 1AD0B 5GPRA 4O00A 2VQTA 2WQRA 2R2BA 5E2TL 2DLGA 2SEBA 1EBPA 3HPLA 4UTAL 2CMRH 1XGYL 5IHUH 3LQZA 3GI9L 4PJ5D 3IJYA 2JK5B 4LHUG 4JB9H 4MJ6B 4S1SH 3EZJB 2AKRA 3STLB 4ZS6D 1A14H 2KQMA 2UZYB 4JFED 3CH1B 1EHAA 4KU1A 3ZHDA 5MENE 4QRRB 3U79A 2OTWA 5D6CB 3HC3H 3C5ZA 1EH9A 1T7XA 1P4IL 5JIKA 4BSWA 1IVLA 4NQSA 3ZSSA 3QULB 4HWZA 5C7XH 3MCLH 3BIBX 1MCOL 1CICB 3KPPA 5IB3A 5EDXA 4ERSH 3B2UC 4PLNC 2J3SA 3FB8A 4GXUN 1KJVB 1Q9WA 2Y6SD 2ICWB 2XZCH 1LK2B 2DYPA 1F3JA 2H2PC 4G3YH 3IDXL 4YBQD 3UTQA 3F5WB 4MXQC 4NQEB 1F4AA 1P4LB 4MYWB 2GSIA 4GS7C 3MRPA 1KV3A 1T1YA 1O7SA 5EC1A 3WNKA 4OI7A 3SCMD 1I75A 1BQHA 4H5SB 1FBIL 4PRAB 2G5BB 1H15B 2BMKA 1B0RA 5C08E 4D0DA 3QHTC 2GIYA 2WNGA 5DT1H 3EYSH 3GM8A 3C6LC 4HFWB 4LLWB 5MEND 2FGWH 1QA9B 3N85H 5F89B 4NUJA 4P2RE 4YEFA 3DV4A 5ENWA 4X7SH 3OJVC 1ZA6B 3SO3C 1FIGL 2WSKA 3JZ7A 5FUZL 3CCHB 4U1MB 4WO4B 3V4PH 4KRPC 4QKXB 2AJZB 5BZWA 2YWZA 4MA8L 3WJJA 4FN0A 1QSEA 5C9KA 1B88A 5MEPA 3LSOB 2Y4SA 3G08B 4OJFL 3MOAL 4R0LC 4XC3L 3MTRA 3O2VH 4YH6A 2A9ML 2OTPA 5JDJA 3FO9A 2E7HA 1JV5A 2XKSA 3QB7C 4AEHL 3TO4A 3P4LA 3PNWB 3BGFC 1JYXA 3IETB 2R4SL 2X4OA 3U2SA 2K3TA 4LDLB 1U58B 5HYIA 4ZUTB 2JJTA 4C4KT 1HXYB 3KNBA 4OV6F 5C08D 3SGJA 3I6GB 2XZZA 3ESUF 1JWMB 3SDDD 3QIBC 5T3XE 3RGVA 1CFQA 4N0CC 2OMNA 2BY3A 4AIOA 2ZOLB 4P2RD 2MCG1 1JWSA 5KANG 2ERJC 2A83B 2W9DH 3GJFK 2SEBB 4KKNA 4FA8A 2BHYA 4XNXL 4M6MH 3TN0A 1U8PA 4YBLB 4XBPA 4NWUH 4YK4C 1MAMH 3WO4B 3WDIA 2UWEF 5JMOC 2VLJE 5FYKL 5F6HI 2OTWB 5E4EB 3C5ZB 1UCBH 2IANE 3BGAA 1HNGA 2MQ3A 2C3GA 2B39A 4XPGL 5F9OL 4P2OA 3DYOA 1W72B 3SGEI 3WFBL 3NABH 2ZNWA 3LDBB 3CPLA 2Z31B 3TCLA 1CLZL 2EIEA 5DTFA 3CC5A 1HXMA 2QBWA 1KLGA 2PN5A 5D7SL 1Q9WB 2QSCH 3ARRA 5CJBA 1L6XA 4D94A 1QEWA 2DYPB 1F3JB 3OKLB 4KQ3H 4AG4H 3WS3A 3DBXB 5T3XD 1V7NL 2DICA 1INDH 5B38A 4XMPH 1CFSB 2OJEB 4XXDA 2HVKA 4BYHA 5EC1B 2QQKL 1X5XA 4JN2B 1AGCA 4ZO8A 1TTFA 2BMKB 4GKOA 1A6ZB 5AZEL 4D0DB 4JO1H 4Y5VC 3AFLA 2VLJD 1G9MH 3WS6C 2J8UB 3GMQB 2YHGA 4OZHA 1YECH 2KPNA 5LVEA 5ENWB 3G5XA 2IAND 1DLFL 2MKWA 4N8PA 2HAZA 1EHNA 3WNMA 1J11A 1G7HB 3BWUC 3REWA 1GAFH 4U3CA 1B4JH 5EBWB 4NO2A 3GRWL 5D5MA 4HK0B 1JGLH 3T65A 3AB0B 1T4KA 5DJ8A 4N8VB 5IGXL 1U3HD 2R0WL 5E2VH 3OGCB 4RCAA 4UUJA 3HR5A 1I3GL 3IYLW 3W11C 1CDYA 3FO9B 4V2BA 4U6XA 1S5HB 3O4OC 5CFHA 1K2DA 3S97C 5I1CL 4X5WA 2MHAA 3L7EB 4ZPTA 3ULVH 4PJCB 1RZKL 2X4OB 2FR4A 2VDMH 2GK0A 4O51A 1RMFH 1EGJA 1HKFA 4C56B 3X3GH 3EGSB 4EIZC 2H9GA 4GFTB 1CFQB 3O2WH 3P4OA 5I9QC 5BOZG 1UZ6E 1CE6B 1YY9D 3MXVH 4LASH 5H35B 3B8YA 4PJ9B 3QDMA 1C12B 4OD1L 5E8EA 3X3FH 3B2VL 1LEKB 4LRNH 2Q8BL 3RL1A 2EIBA 4XBPB 3SQOH 2Y07H 1UH2A 1VB9A 1GHFL 5BCAA 5CLTA 2AGJL 4D0BA 4LSTH 5CBEB 5TQ2H 2Z0BA 4NKIL 1DFBL 1U91B 4ZUUA 2N7AA 1S9YA 1CFNA 1OPGL 2E27H 1UZ6F 4RMQA 3RPIA 4CVZA 3G6DH 4P2OB 2BVQA 3GSRA 2HP4A 3J8F7 3T0XA 3B5HA 3CPLB 1QLFA 3RWJB 3TCLB 3CC5B 1H3WM 1HXMB 4NM4H 5AUMA 2AV7A 3QUKA 4WW2A 3BDYH 2WMPA 4FQ2L 4G6ML 4PG9A 5EULV 1E28A 5JIPA 2DBLH 5C0CB 1QEWB 3U36B 3VXQA 2HRPL 1T5WA 2YD7A 3CDYA 1Q9OA 4JFOA 3WKML 5IFHH 5JTWA 1TZIA 2C4XA 3MBXH 4TNWK 2F8XC 3BISA 5FYLL 4L9LA 4M7ZC 1C7TA 2ENYA 4XXDB 1AXIB 5T1KD 5DEZA 4DAGL 4YGVB 2BHUA 1UM5L 3MREA 4TQEL 2X4TA 4WTZG 4HQQH 4KZEH 3GMPA 1X5KA 2ZUQC 2HKHL 3SBWA 1ZOXA 5E8OB 1AGFA 1LD9B 2VB5A 2F5AL 4LCIL 1DP0A 4Z7VA 3TVMB 4LLDA 1BQSA 5J8OA 1ZSDA 3WIIH 2FWOA 4E5XB 2FEDC 3VXUA 1D9KC 4J3UA 3GJEA 1AI1L 3KPRB 1Y6NR 1VDGA 1M7IB 2F19L 4AQOA 1RIUL 5DMIH 4HPOL 2QLVB 1MHHA 3PWJA 4LARL 4XP5H 3BH8B 3P2TA 3QXDB 1TJIL 5F9DC 3DRTA 5I75C 1JE6A 5E6ZA 5DFVC 3RA7L 2YRLA 1RVFL 2MHAB 3LKRB 2GQHA 4DGYL 4LAQL 2B4CH 3K46A 4G42A 2FR4B 2V5TA 1H8NA 3VFMA 1P9MC 3VDAA 3MRRB 1A1OA 5DHYB 5BV7C 3MJ9H 5HYJB 2VLKE 4JHBA 5E5MA 2VXQL 2IQ9L 2APVA 3PWVA 5GGVL 1FNEA 5F7YC 4Q6IB 1ZT1A 3QDMB 5D2LE 4F15C 3GBNL 5TE6H 2K1MA 3Q0HA 1HSAA 1SBSL 1PX4A 3O3EB 3FRPA 2JB6B 2VAJA 3L95A 1WZ1L 2G5RA 5EUOF 1EDQA 3OAYK 4KKCD 3H0TB 4NT6B 1F3RB 2WIIA 3BDXA 2EYSA 3MJ7A 4IOIA 4P5TA 3NIFE 4OZIB 1UJTA 4KK5C 4Z7OE 2IWGA 4HD9A 3UXFA 5I1GH 5D2LF 3MUHL 4YHOL 4AEIL 2V2TB 1J0JA 3RPIB 1GH7A 4H8WC 5FM4A 3GSRB 3L5JA 4TNVF 5KS9A 2YD4A 3GSOB 4CN1A 3ULUC 3O8XA 5C0RH 1ZE3C 5AUMB 2AV7B 1OF2A 1R5VB 4LCUA 3EOAB 1OSPH 1E28B 2HVJA 3FQWA 3NIFF 1D6VH 5D70H 3VFRB 3D9AH 4Z7OF 5ETUA 1NC2B 1ZWIB 1AQDB 2VLKD 5ILTL 2CXGA 4Q9QL 5DJDA 2JTDA 5FAAA 2G75A 3IFLH 3S8WA 4J4PC 3MREB 3F6IA 2X4TB 4OFYA 1IGTB 1BPVA 1JPSL 4XRCA 4ZSOA 5SX4H 43CAA 2DKUA 4YC2C 5EUKB 4F58L 3ARDD 5E8NB 3H9SB 1DBKL 1PX3A 1OTTD 3ZLQC 2LQRA 4Y5YA 2MFNA 4LSRH 3HE6A 4LLDB 4F7TB 3SE8L 1ZSDB 3NACL 1JF6A 1PYWB 2FWOB 1HYRC 3OJDA 4X6EB 1KXVC 4HUUA 4LLYB 4Y5XB 3TPKA 5GZNC 1RSFA 3GJEB 1CGXA 1HINH 3OKMB 1GIGL 1AH1A 5DUBB 5T33H 3RRQA 3T4YA 5LGJA 2DL9A 5C0BB 2C1PB 1B0GA 4Z0XB 2D4FA 3PWPA 1MHHB 3WHE1 4O2CB 3PDGA 1MJUH 1LO0H 5ESVA 4R4NC 2HT4D 5E6YA 1MRDL 1F3DH 1RZFL 1DE4A 1FRGL 2A73A 4UBDD 2P44B 4QTIL 2PKDA 3WBDA 3BGMA 3VFMB 2C7UA 4I77H 3EO1B 3IFOB 5TDPB 3PP4L 4U1KA 1RUKL 2VR4A 3CVHL 5TF1H 3G9AB 5JXEA 1F90H 2Q3ZA 3DETD 4L9DA 5GGQL 3NCYS 3QXUA 2V7NA 4NRZB 1FNEB 3QUYA 5B3NA 1ZT1B 3EFFB 1OARH 1X4YA 4RX4A 4LAJH 5F1NB 4NO0D 1T66C 4P46B 3EJYD 2OJZH 3KJ4B 1NCTA 1NUDA 2OL3B 1U8KB 3W0WB 5CJQL 2WIIB 2EYSB 5JW5A 4YPGA 1YN7A 3S88H 1BQUA 4IOIB 1KJMB 3M1BA 3QCUL 4X80L 2AXGB 3ALPA 1I7TB 1MCSA 4IIQB 2NPLX 5J0BA 5GGRA 4NGHL 2CQVA 4NO3A 4F9LC 2R0ZH 1XMWA 2UY7A 4YEEA 5KS9B 3D48R 4WEBH 3HMWL 1F2QA 2AXFA 5HHNA 3GJFA 1ZK9A 1FFPB 2BVPA 3JWDH 3MBEA 4JZOA 2NX5E 4JQVC 2RQ8A 4LCUB 1MNUH 2EE3A 2A6KA 4TOYH 1NFDE 1XIWB 1U8NA 3D39E 3AREB 3KYNA 3F8UB 3FQWB 4P23C 3O6LL 4LNRB 4JFXA 3UZQA 2W0KA 2BNQA 2CGRL 3S4SG 4OQTH 3HNVL 4CMMA 3SKJH 4G7VH 3IDYC 3Q1SL 4U6HA 4LCWB 1M6OB 1N59A 3DNKA 1OGTA 1RJYB 5C6WH 1BF2A 3RVTC 4HULB 2DQHL 4UQ3A 4P4KD 4RFNB 1PD6A 2AERT 3SJVE 5EG6C 4XRCB 1ZHNB 4PRBA 4XTRC 3RZCB 3QPXH 5D93C 1SVCP 4GRWB 1HHJA 1FO0B 4Y5YB 1UEMA 1A7NL 2W65A 1NC4B 3VGAC 1JK8A 3EDEA 4MX7A 1KPUA 3IXAA 4XI5D 1YA5A 2QQLL 2EE9A 5EU4B 3INUL 1FC2D 1I1FB 3OJDB 4Y4FD 1MFAH 3U7WL 5ISZE 2D0GA 2P43B 2YC1A 3V52H 4JFQA 4GBXC 2EKJA 4CU8A 3MJ8B 5K9OB 3MLUL 1QLEH 4M62H 3T4YB 2NX5D 3TEUA 3RL2B 2WUBH 1B0GB 2EH8L 4HPYH 3PWPB 3D39D 1B2WL 3F65A 1A8JH 2FZ3B 1HYSC 1CLYH 1G0DA 1Z3GH 3FHQA 3RWEA 2I24N 1DE4B 2A73B 2E5EA 2F74A 5GHWL 4DKAA 5IB1A 4IDJH 3VWJA 2P5WB 2BVEA 4JY6B 3CNKA 3GSNH 5E2JA 3TBYA 3DMMA 2AEQL 1OGAB 3SJVD 4U1KB 3FN9A 3HB3D 5I30L 1ZHKA 3CLEH 2OLDA 1HQ4B 1IEBA 1T0NA 4DZ8A 3HRZA 4L3EA 1L9NA 2NY1C 1NDGB 2XQBL 3HFMH 2ADIA 3B4NA 2GSGB 2V7HA 4OCRH 5ISZD 5ACLA 1Z9SA 1I1CA 4JPKL 5D1XB 3B83A 3ETBF 3QEHB 3HR6A 3QWOB 4QRUB 1RU9L 2WAHA 3RWGA 3M1BB 3KHQA 3L3DB 1PVHA 4TYUA 1HIML 3HZMB 2NW3A 5CD5D 3AGVA 3LKSA 3H42L 3R8QA 5EN2A 5HD8D 5FO9B 3KLAA 3QCTH 4YHPB 5HHNB 3GJFB 3LCYA 4X5LA 5EPMB 4IRSB 5I16A 2ITCA 5CINH 3DURB 1UWGL 5HSFA 3CJJA 4XNQA 2ZOKB 3MGTB 4FQJH 4FQQA 1QHOA 3BPCB 2A6KB 3RVVD 1FC1A 3T0DA 4HKZA 3WDHA 2VAAA 1HI6B 4PBXA 1BD2E 3KYNB 5DA4A 5FUOH 4JFXB 1FFQA 1QSZA 4Y2DB 1H3PL 3SDCD 2A6IB 3S9DB 5DD5H 1I1RA 1YJDH 3T4AA 1R3IL 2HTKD 1Z0MA 1FCCA 1QRNB 1NGXA 1PW3A 4P2CG 2D7PA 3I02A 5E2TH 4UTAH 3QXVA 5F6IC 2BDNL 1XGYH 5EZLB 2IAMA 4R96B 4NNXA 4W6XB 4NKDA 4MNQA 2UZXB 4EKXA 1GGTA 2OX5A 3KWWA 2W0PA 1JK8B 1YN6A 1MCNA 2XNAB 2OXHA 2KBGA 5DLML 5IEHB 1P4IH 1BJ1J 2JCCA 4AM0B 1LP9E 1FHGA 4JFQB 5IVXB 4DK6A 2MWCA 4MCYB 1K85A 5MERB 1BD2D 2XWTB 2OMBA 2VQ1A 2LU3A 4U6YA 4OZFA 3RWEB 3ZYIA 2CLVA 3V6FA 4JFHE 4NP4L 2F74B 3IDXH 4F9PC 1ZLVH 3VWJB 2AK1L 3CFEA 2VISB 3DMMB 2NY2B 3JV0A 3WCYA 1MPAL 4RQQA 1BZ7B 1MH5A 4UI2A 2JIXD 1FBIH 5AYUL 4JAMB 1IEBB 5DJAA 5CBAB 3HRZB 4Q2ZA 1S7TA 1WK0A 3ARTA 3G6AB 4I18C 1OT2A 1KB5L 3ARFD 3JV6B 3WIFA 3ARGA 4IRJB 1G7JB 4W68A 5EC2A 1FIGH 3GBML 5D7JD 5FUZH 1BZQK 4FFYL 4ZMAT 2NLJA 4NQCE 3QUZD 4MA8H 1VESA 2IJ0C 1SBBA 2CPCA 2NW3B 3SY0A 3EYVB 1TZGL 5C09A 5IQ9A 4OJFH 4NO5A 2EDLA 4JFHD 4XC3H 3S7GA 2A9MH 4GW1A 2OK0L 3OXRA 2QJDA 2GTWA 4AEHH 2UY6A 3GHEL 4LKCB 4PR5B 4XNQB 4HC1L 4EXKA 4ALAL 4L8CA 2R4SH 4LPCA 3A6CL 1TJGL 2EDHA 3KPLA 4HLZG 3GKZA 3N0PB 1DVFC 1G7MA 5F7HA 1IQWL 5HDOA 5J1SC 2F53E 4H0IA 1U9KA 3NCFB 1OWRM 5BRZE 1QFWI 1NFKA 5IT2L 3S34L 3EFDL 5HBBA 2WV3A 4FTVB 4HSQA 4P5MA 4QWWC 1IRAY 3ULVE 3QIWD 4XNXH 3QDJE 2UUDK 1BOYA 1U2HA 4KK8C 1PQZA 3FB7B 4CKVX 4YHYB 3SO5A 4NQCD 3Q2CA 4F7MB 1NBYA 1IJ9A 4UAOB 4JZJB 1U2CA 3QISA 2W91A 2GT9A 1HH6B 1P7QB 5DRZB 5FYKH 4U1NB 1MSPA 3HZKA 4LLVA 1M71B 4XPGH 4M7LT 1KEML 3V5DB 4GUPA 5F9OH 5HDLA 5IHZA 1C5BL 1EAPB 3E3QE 3KXFB 1JTPA 4PJ7F 2Z8RA 3WFBH 3WIHA 4RGNB 2EC9U 1N5AA 1CLZH 1CL7L</