5GRWA

Crystal structure of homo-specific diabody
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
229
structure length
224
Chain Sequence
VQLVESGGGLVQPGGSLRLSCAASGFTFRNSAMHWVRQAPGKGLEWVSSIWYSGSNTYYADSVKGRFTISRDNSKNTLYLQMNSLFAEDTAVYYCARFAGGWGAYDVWGQGTLVTVSSDIVLTQSPATLSLSPGERATLSCRASQSVSSNYLAWYQQKPGQAPRLLIYDSSSRATGVPARFSGSGSGTDFTLTISSLEPEDFAVYYCHQYSDISPTFGQGTKVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords homo-specific diabody protein
publication title Crystal structure of mono- and bi-specific diabodies and reduction of their structural flexibility by introduction of disulfide bridges at the Fv interface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 55
structure length 224
sequence length 229
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-08-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5grwA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5grwA01
2Z31C 2KKQA 4WJ5B 5E5RB 5CSBA 3IFOA 2NY3B 4RX4D 1AC0A 3GGWA 2YWZA 3BGFB 4Q0XH 2JKXA 3RGVB 4YDIH 4RGMB 4PRIB 5E94B 4LPTA 3IDXL 4BZ2L 1G7MB 2B1AL 2Z92B 2V7HA 2P44B 1AGDA 4NQCE 4IMKC 3MLSH 4JRWA 1D5MA 4GG6B 3MCLL 4MAUH 1IKFL 3B8YA 5GS1C 4R0LA 4GMSL 2YPLE 4H1LB 4K7PH 4NKOA 4NO0B 1YNKL 1X5LA 3WNMA 3TCLA 3X12A 2DIBA 1PZ5A 1P4LA 2G9HA 2GUOA 3AAZA 3K3QA 1NCUA 3BDYH 4MYWB 4L29A 1IGML 2XY2A 3SDYH 1J0HA 2XTJB 1LDSA 5HYSG 1S78C 2AXHA 1NMCC 5DJAB 1F6FB 4DFIA 2NY7L 3WKML 1OGTA 3L6FA 1CFSB 5D7KD 1ZHBB 3S35X 2AQ1A 1S7WA 4HUWA 5L6YL 1P9MA 1KIRA 1GPOL 1UH4A 2BVYA 5TDNB 2D9QB 5CEXA 4MWFB 4U2YA 4IIQC 3MACH 4C83B 4NM8L 4ZTOH 5I15H 1DQDH 3RZCC 4OF0A 4KKBD 1KB5L 5BS0A 3QUXC 4CJ0A 4FQ1H 1RZJH 4OZHA 4R8WH 3RAJH 4UI2A 3ORJA 1JJUA 4D9LL 4FZ8L 2HP4A 3ZO0A 2BFVH 1A7PH 1T4KB 4JZOB 5ISZA 5A2FA 5IFHL 3FQNA 4RDQF 4V1DE 2BNRB 4MD4B 3BP7A 4U1HA 1MCKA 1CFQB 1MH5A 1P4IH 1DBBL 2J6EA 2RB8A 4HC1A 3TV3L 3WDJA 1A2YA 5L9DL 2XN9B 4M9OA 1QRNA 5I1HL 3RVXC 5F1SA 1NC4A 4IBLT 3CDCA 1T1YA 1YEDB 4N8CH 3PWLA 2DI8A 5JIPA 3BKCL 2CQVA 1XCQA 3D25A 4YHKH 3QEUA 2GAZB 4NJ9H 3MMEB 4WV1B 3GUTB 5D93C 5FKPA 3L3KB 4F80A 2YPVL 1H5BB 1IBGL 1DEDA 3RWIB 1YEIH 3T3ME 5LVEA 3S9DB 5HYQB 4DKEH 5C8JA 4BKLA 3MV9B 1WFNA 2N56A 1EEUA 3EBAA 1WCBB 2JJTC 5I1JL 3TBSA 1KJ3H 2Z8WC 4U6XB 4CU6A 3TLRA 2EXWC 3FHQA 3GO1L 4LCYA 2R4RL 1ADQA 4YXHH 1WCQA 4TVPE 2PXYD 3SKMA 1Y0LA 4HUVB 1L4IA 5DJ0B 4G6ML 3IDJB 1QBMH 5KSAD 2LVCA 1YYMH 4K3JL 4WW2F 4K71B 3L3OB 3G6JA 3BZ4B 4P2QA 3JUZA 4ALAL 2VXTL 5GGRY 2C1PA 4AY0A 1MHEA 4M6AA 1Q0YL 4NKMB 4NNPL 2VR5A 5HYJA 2DKSA 1T22A 5I1EL 1QFHA 1CU4L 2NY3D 1YEJL 1GGUA 2CLRA 2VL5B 3O3DB 3HLAB 4K55A 4OGZA 1P1ZA 4PRID 2SEBA 5DT1L 4RBPH 4LCIL 4WDIA 4JR9L 4MA8H 5MP6L 2DD8H 4G42A 1DQMH 2Y6SD 3X17A 2XT1B 1Z5LA 2A6DA 3ZKMD 3H9ZA 5GSRA 5EZLB 5HYSA 4UINL 1YY8B 4NO0D 1RZKC 4UILL 3T3MF 3RIFF 5TDOB 4CMMA 1FQ9C 4YFLI 1JTPA 3DGCR 5DJZA 1RPQA 1NUDA 4P5TB 2FSEA 2VAAB 3EJJX 4NBXB 4EXKA 4HG4K 3R8QA 4PB0L 1EJOL 2EH8L 2NW3B 1T66D 2R2BA 3CDYA 1NCWL 3QWRA 3AAZB 2HFFA 1M05B 5DMKA 3X3FL 2I9LB 3MV8D 5L2JB 5JW5B 1YC7A 4NDMA 4DAGL 4PRBA 5I1GL 4WW2C 5CMAB 4E5XA 3IVKB 1HXMA 5DJYA 1INEL 4NP4L 4X5XA 4KRPB 2HTLC 3PV7A 4MNQA 4X80H 1FZJB 4HUWB 2DTSA 3QNXA 4PJEA 5K59E 3RPIB 3OQ3B 5HI4C 4GUPB 3ZYZA 2O5YL 4P9HL 3LB6D 3C5ZB 3EO0A 4PGEA 1I9JH 2YD4A 4QY8A 3AS0A 4M6NL 1XIWB 3OG6B 2AJVH 5EOCH 3VWKA 5H37H 2VE6B 4OFYA 4BFEA 1H0DB 4QXUL 4OB5H 1F2QA 2G2RA 1F6AB 3MRBB 2YXMA 5FGCB 3VMNA 3DVGA 5KTEL 4JFHE 2BNRD 4G7VL 1A9BB 4DZ8B 2OQJB 3DUSA 3RDTA 4PJXE 3FQNB 1T7YA 5KS9A 4GKSB 1IAIM 2ATPA 4JFQA 2XN9D 2G60H 3RL1A 4WGWB 4OF7A 3V4PH 2UWEE 1YYLH 3L5JA 4YX2H 2VITA 4LP5A 2ZPKH 1ED3B 1EEQA 4HKXB 2A77H 3BP4B 4ONHB 1K8IA 5TPWH 1NC4B 4F8TA 3CU7A 5IBTL 1EJ6A 4LNRB 5EO0A 1FLRH 1FYTA 3QUZC 4GLRH 5DQDL 3D9AH 5GS0D 2YSSB 3D25B 4KK8C 3QEUB 1J5OL 3FB7A 1CFNA 5F72S 3TYGL 5HYIA 2DL9A 2R69H 3LKQA 4HF5L 4Z76B 5D7IA 1Q94B 3OZ9L 3IDXH 4F7PA 4L4VB 1V3JA 4ODXA 1NAKH 4AH2A 1LEIA 4P46B 3DXAA 1A22B 1N8ZA 5L8JB 2XZCL 1IGIH 3PIQB 5IBLD 3MCLH 1S8DB 2HJKA 1FFNA 4JN1H 3B5GA 4JRYE 4PJDF 1DN0B 1EHXA 4I9WE 1SBSH 1E4KC 1NDGB 3ARQA 3JV4B 2ESVA 3WNNA 1SJEA 1JRHH 32C2A 5AAMA 3GJEA 3IAGC 4LP4A 5IMLB 4LKXA 2P8PB 1IGMH 1DJSA 5DD5H 3EGSA 2Y36L 5GGTA 1XF3A 4FFWD 4D0BA 1D9KB 3GB7A 3THMH 1JZ2A 4JPWL 1MAJA 2VZVA 3HE7C 3LH2L 5I66A 1FN4B 1K2DB 1RI8A 4OLZH 5ITFA 3GSOB 1S7XA 4EQ2A 3MFFA 4LARL 5BXFB 3O6MH 4DGIL 5M95B 1TCRB 4RISL 1BD2B 1BWMA 1R5VB 4O00A 4NQUA 2I25N 4PJAE 5IMOA 1X5JA 4RMSA 3HR5B 3Q5YA 2VNCA 4PRPE 3QQ9C 4Y2DC 1R3IL 3U0PB 3V6OC 5DR5H 2SEBB 5T33L 4KV5E 3G6AA 4MHHG 3HNTH 1KB5B 2DB8A 2VMFA 4NZTH 3RI5F 5D5ME 4R7DA 4IOIA 1YPZF 3ARWA 1ONQA 1RULL 3JWDC 5GSRB 5HYSB 1C5BH 4JREB 3VXUA 4LVOC 4P5TD 4AG4L 5C0CA 5IFHH 3MLPA 2VJXA 3U0TB 3LS5L 4CMMB 3RZWA 1Y18B 3L3GA 4GS7B 4DEPC 1IAIH 3F6IA 5DVOA 2EDDA 5IVXB 4JZNA 4KI5E 4XNYH 3TV3H 5LAXA 2R2BB 4WNQA 5I1HH 2W9LA 1BZQK 4BYHA 1WV7T 1DVFB 3QIWA 4JO4H 4KKLC 1LO2L 2OR8A 2OMNA 2ZWLT 1G9MC 4OGXL 4LAQH 3PGDB 4UV4H 1A7RH 4U3CA 2AJXL 4E5XB 2BXZA 5TQ0L 1CD1B 7FABH 2GJ6A 2NTSP 4J3XA 3WSQH 4PLNC 3OJ2C 1AD9B 3S96A 3O3BA 1PLGL 2VIRA 1BFVL 3D0VA 1BGXL 2HTKC 2YPVH 2VYRE 3AREB 2FHFA 2EDLA 3FO0H 1MRDL 2BDNH 4KJPD 1CL7I 1ZANH 2PTVA 1XIWD 4OIBA 1FFPB 4Q97A 3NPSB 1LO0L 5FA3A 1HKLH 4HJGA 5I17B 3FKUS 4HX1A 1K3IA 5I1JH 3PJSA 4PGEB 1DSFH 1KLGA 3T0BA 5DTFA 5EIQA 2X4NB 2Q6WB 5I71C 4U1LB 4XTRC 1YJDC 2GSGA 4HGWA 1YQVL 2NY0B 4Q2ZA 3MROB 1L9MA 1FORH 4OQ1A 1DBJH 4NSKA 3I6LE 4XCCH 4JLRA 5CJBA 4GT7A 2CDFA 5SX4I 3V4UL 4K3JH 4PY7B 5DVMA 5TE4H 2UUDH 1NAML 4JFQB 1J05B 3F7QA 4FQPA 4NO2A 3RL1B 3BAEH 3UJJL 1NC4D 1WBZB 2EDEA 3MOBH 3BW9B 4UT9L 4P2RA 1OB1A 5EPMA 2E6JA 1CU4H 1WICA 1A6ZB 3LKOA 2DQCL 1YEJH 4APQC 1K8IB 1VADB 2OK0L 5D1ZC 5EO0B 1UH2A 3MZTA 4JRXB 1T83C 3PABA 5D96B 2NLJA 4L4VD 2AAVA 1OP5H 5E6YA 5MP6H 2OR9H 2BCKA 5HDBE 1NKRA 4P46D 5DQJB 3ES6A 3Q5TA 2IGFL 2X89A 2Y25A 1S7UB 4KTDH 3LKQB 1HQRA 1DBAL 4HIHA 4TSAL 5DVLA 3MFGB 3FFDA 2A2QT 1HHKB 2JJWA 1JWMA 1RIVL 1LD9A 4QXTB 5IWLA 4Z7WB 1UM4L 2HJKB 1S7VA 2Z93A 4UAOB 1IGCH 3JWNC 1PW3A 2EYRA 1SJEB 32C2B 3O6FB 5JOEA 1D9KD 1XGTB 2EH8H 3MXWH 4X9BA 3FT3A 2ZKHH 1YEKL 5D1QA 5T3XL 3X3FH 2DLFL 3EGSB 1R5WA 2NZ9D 4NQDA 3D18A 4P5KB 3V7MA 1KOAA 1XF3B 4HKZA 4P2QD 4DAGH 3OXSA 3GB7B 5F93C 1JV5A 4LCCB 2JIXA 4FFYL 3L9RB 4JHWL 5FO8A 4EIZC 1QHPA 1BD2D 1NLBL 3VGAC 3BIBX 1H3PH 5HYJD 1FH5H 4MCYA 1TFHA 1INEH 3H7BA 2CH8A 3OB8A 5DD0L 5I75B 2ADJB 2HKHL 3TPUA 3VW3H 2L7JA 1U3HA 4ZOAA 3O4LB 2CRIA 4HLJA 4RWHA 4X6FA 2Y9RT 3PUCA 4I8DA 5DVKA 2CSPA 3HMXL 3P4OA 5I1LB 1JF5A 4GBXB 5F1IB 3ISWA 2O5YH 2P24A 1M4KA 5ELIA 4QF1A 4OAWA 1A3QA 1K3ZA 1ZA3A 4M6NH 3GI9L 4LHQB 5E9DB 1IE5A 5IIEA 1IAMA 4QXUH 2AKRA 1CFTB 2E6PA 1CDYA 2MMXA 3VU2A 1QR1A 4OZIE 5IB1A 1WUNT 4IOIB 3QXDA 3UTTE 3H42H 1ZT1A 2P46B 1BEYL 3MRMB 4KY1H 1CE1H 4DGYL 5DD3L 3WFEH 3OAYH 3P11L 1F02I 3C60B 2ZSWA 3ECBA 1RUPH 3P77B 1DVFD 4WTXA 2C3GA 4ZOBA 1PBYA 4H0HB 5D7SL 4W6XB 4XP5L 4TTDC 5EBGA 2F53E 4DN4L 5AAWA 1XGPB 4I4WB 4EIGB 2QKIB 2CRMA 1RURL 4Y88A 1OCWH 1WWAX 1DTUA 1CWVA 4KRLB 4TSCL 1WT5C 3ARED 4M5YL 3B43A 3DX8B 3UTZA 4IOFD 3VMPA 4K3EL 3PQYB 4UQ3B 5E2TL 5DLML 2X70A 3KPPA 4JKKA 1F2XK 1WZMA 2FRGP 3VWKD 2XZCH 1WTGT 4JPIA 3V0WH 4MD0A 2P5WA 5SWSB 4JQIH 5DUPL 3JV0A 3RU8L 2NY0D 5DTFB 3S35H 3V6FA 4ODSL 1NLDH 4A6YA 3OAZK 3G5YB 3HG1A 1UZ8B 5K33A 2GSGB 1RK1A 2FGZA 3WBDA 3QIUC 5GS3A 4NKIH 4QRQB 3FB5B 4S1DC 3RVVD 5F3BA 1X6NA 3OAUL 4JLRB 2IADA 2VXVL 2GJZA 3PGFH 3KXFB 1IQDA 2DQGL 3MBEA 3MRNB 4N5ED 3M1BA 3UBXI 5F7NC 2R1YA 3DMMA 4Y5YC 4MD5A 5IEKB 1OB1B 4OF5A 5GPRA 1EV2E 1IL1A 1EX0A 3ARUA 3TVMC 3WXWL 4WEBH 3MJ8A 4KXZH 4NCC1 2Q8BL 5DS8B 4NKDB 5C08E 5ID0B 4Y1AB 1CT8B 3TYFA 3IU4L 4MDJB 1R3IH 3BD3A 4P2OB 3NFSH 4RNRA 3RA7L 2DAVA 3QHTC 1QSVA 2G75B 4OFKA 1HQRB 1OP3H 2ADFL 2AJ3A 5GGSY 5F8RC 4PGCA 2ED7A 4LU5L 4M7LL 3QG7L 4AG4H 4NZRL 5TH2B 3O6FD 2AI0L 2X1XR 5FA4A 5HHME 4HAGA 1JHKH 1KJ2A 1S5HB 3VFVA 1MCQA 2ICWA 3O8XC 5E2VH 1M71B 3BDXA 1VFAB 5CWSB 3TJHD 5EBWB 2EDWA 1ZXQA 2L7UA 1E28B 4WWKC 3TBYA 1A3RL 1RIHH 3MCKA 1AFVL 1J0YA 2JIXB 5TQ0H 3HRPA 1UA6H 4U1IB 4KVNH 1PG7X 1LHZA 4LSUL 4YR6B 4DOHE 4HHAA 4K23H 4GBXD 3DSNA 3U7AA 5IMMA 2VISA 5IP4A 2YD8A 4H8WH 4KTYA 5CGYD 4F33B 1BLNA 4YXKH 1LO0H 1OAYL 3UTOA 2BY3A 3BYYA 4GSDL 5DRXA 5E7FA 4WO4C 1T1ZB 5DK0A 2Z35B 4F2MA 4KGLA 4F3FB 2F58L 1HHIB 1JGUL 1NGWA 3KLSA 4WU7B 1YQVH 5CCKL 1TMCB 3C60D 5IB1B 2VLMD 3VGDA 3P73B 1ZT1B 2FX8L 1JFQL 1OAQL 5D2LE 1N59A 3KPRA 3REWB 3UPCA 4NYLB 1IC5H 1N4XL 3RX7A 5JW3L 3ECBB 1AC6A 4JGJA 4M61B 4OJFL 3UP1A 4CADB 1T89C 2A9ML 1QBLL 4YAQA 5FYJH 4XBEH 3KPQB 4YHPB 3VA2C 5HPOA 1CGXA 3SY0A 1OAXL 2DLGA 2DQCH 2OK0H 4DW2H 4ZUWA 5LQBL 4JZJB 4FQQA 3PQYD 1FL3B 2FJFA 4QLRA 1OARL 5EO9A 3A0OA 2FL5B 2VXUL 4JKMA 4PRDA 3QA3A 3GSUB 4IJ3C 3HC3L 3BD4A 1X5FA 5SWSD 4DQOH 3KPPB 2BVEA 4HH9B 4PJ7E 4Y19E 5F70A 3ARDC 2CJUH 3UTQA 3ARFB 5MERA 4JPIB 3T77A 3QPXL 1TJGL 4HK3N 1K85A 3F7YA 1FGNH 1T21B 3QDMB 4E0RA 3TN0C 1FFQA 1RU9L 3K74B 5EBLB 5FUCC 5T3XH 1UKQA 1UM5H 3FO1B 4M43L 3KXFD 3GNMH 1WWCA 2BSRA 2JELH 3O0RH 3BXNA 1J0ZA 2D31B 4Y16B 1A1MB 1U8HB 4JHWH 2DBLH 2OL3L 5D2LF 1CDUA 3TM6A 1QKZL 2YA2A 4B7IA 4TVPL 1EAJA 1C5CH 5DD0H 4P23C 2VLRB 5EBMA 3DMMB 1P4BH 4JM2B 4R90H 4Y1AD 3DURB 2JB6B 4PJ5E 3H7LA 1SJHA 1MCNA 4LEXL 3MJ8B 3AS1A 4OV6F 1L7TL 5CUSH 4BFIA 2YHGA 3HPLA 3WFCH 4MA7H 1V3KA 3V5KA 3GI9H 3SKNB 4RGOL 3L1OH 3DX7A 2AVGA 1JYWA 3P4LA 5GS2D 4K7FA 4GRLC 4MSWA 3ARZA 3V0VA 3GMRB 1MREL 4HJJL 1KLFA 1RY7B 4MNHB 1LP9B 5CKGA 1NL0L 2CR6A 4NQXA 1DDHB 2AJ3B 1KNOA 1B9ZA 4HK0B 4X4XB 4DGYH 5CJXC 1F6LL 1YZZA 4MLIA 4P4KA 4QHUB 2ID5A 3HMWL 1U8JA 4PJ7F 3MRFA 5EULV 2DDQL 3VFVB 4LLQA 4ZAKB 3T0EA 2IQ9H 1PX3A 3OL2A 5J56B 3BSZL 3EO1B 4TVSa 5FDWB 5JDSB 4NQDD 1UGNA 1B2WL 4YZFF 5DF0A 4XP5H 3FT4A 2JIXD 4R7NB 4ELKB 4S2SB 4Z7UE 1CGTA 3P30L 2EZ0D 2NNAA 1RURH 3F5WB 4QOKE 1HSAA 4MCZB 4F7MB 1RZFL 1XF5B 3DHJA 4U1JB 5C71A 4GOSA 5J3HC 1IGTB 4NZDA 3C87A 3LKNB 3MJ9L 1MCWM 3RUGE 3NH7L 2HT3D 5IMMB 1YUHA 3GSWA 1EZVX 3GRWA 4OCYH 1JVKA 2C3VA 4L4TE 1T7ZA 4QGYA 4KUZH 3NIDF 1NMBH 1LNUB 5DUPH 5IQ7L 2R9HD 4GRMB 4NO3A 1T0NA 3F7VA 2V2TA 5CHNB 4H26B 1FJ1B 4JDTH 2QQQA 3NAAH 1NGWB 1NJ9A 3JWDL 3SDXE 1FHGA 1A6VL 5DEGB 5IR1A 3ULVE 3RNQB 2IBBA 4WI3A 2NY5L 4JN2A 3BVNB 4U6HB 3TJEH 4YHYC 4RRPG 3ZDXF 5FUOH 3FRPG 4QO1A 3V5HA 4WENB 2DQIH 1ZHNB 5FYKE 1MCHA 1BQHB 2RQ8A 3IFNH 1M7DA 2VLKA 1WFOA 1MHCB 4D8PB 2W65A 4AK1A 4XRCB 1CR9H 3RX5A 1XGQA 4XVJH 3BUYA 5ACZA 1AGBB 1X6LA 3IU4H 3I84A 3QDJA 1F42A 2I27N 4PB9H 4XWOD 3VFTA 4PR5B 3KR3L 4PIRF 3KYKH 2Y06L 1IM9B 1T0MB 4JO2L 3PWUA 2Q7NA 1QA9A 2ADFH 4WI2A 5KG9B 2P5WD 1S9WB 1Q1JH 2HMID 3RUGF 5DMGC 4LU5H 3W0WE 4NZUL 3HE6A 3MLZH 2QHRH 3HG1D 3NACL 1HNFA 1YJDL 1XF2A 4Y16D 1K8DB 2EEBA 3CSGA 2YZ8A 4O9HH 1JZ4A 2FD6L 3L7FB 3MBED 3SDXF 3ARVA 1I1RA 1OLLA 4RMWA 5C0BE 1QZ1A 3PNWB 4YDKH 3MNWA 3DMMD 5H37G 4JM2D 2A6JA 4R6UA 2BHZA 3L3IB 5C0EA 3ZTNL 2AQ2A 2FGWH 3QUYA 5EBMB 4P4RA 2H2SC 4JCLA 5ID1A 4OZGB 1KYOK 2K1MA 1FCCA 1I8LC 4QHMA 2D9CA 4FZEH 1V5JA 2AABL 1Q9LA 5SX5H 3EHBC 4MJ5A 2P8LA 3GFUA 1HIMH 4LSVL 4YC2C 4NRZA 3EOYG 3ESVF 3FQRA 3V0VB 2GFBB 2X7LB 5HHVH 3CJJA 3LKPA 1ACYL 1IGJA 3QI9A 1RZKH 1OGAE 1NCDL 3GSQA 1W8NA 1JFQH 4J3TA 4DCQB 1NUFA 4ZAKD 2CD0A 4U7MA 1PEWA 1WAAF 2FBJL 4XHJC 1DQQB 3MRFB 3NCBB 4CU8A 1MI5A 4LRNH 5F3HA 3LRHA 3VFGH 3EYSL 1EO8L 1MFCH 4PG2A 3T1FA 2BVQB 2A9MH 5IQ9A 1I1AA 3TH4T 2YK1L 2VQTA 3VXPA 1H3GA 3BPLB 4POYA 4LSPL 2FZ3A 4L8SC 1A0QH 2EE9A 2GK0B 3ULVC 4OFDA 3U0WL 5C0JB 1PJ9A 4OI7A 1JPGA 2LE9A 2I9TA 1K6QL 5T1MA 2B8OT 3NZHH 4MNGA 3ZE2F 1VA9A 3NABL 1UJ3A 2UZXB 3O2WH 4EDWL 1ZLVH 2CLZA 4U3XA 3RBSA 2DLHA 1RMFL 3QPXH 3VG0H 5C0AA 2YMXL 1CLZL 1M7IA 1MHHB 4PJIF 4ZUUB 4XH2B 3OSKA 4X6BB 4OFIA 4XMLL 1F00I 1RIUH 1RU9H 3ARPA 2E7BA 4G8EA 1IC1A 2DKMA 3SKJH 3FRPA 1NJ9B 4LDOB 3I2CL 5CEZE 3MJ7B 1DEEA 4MNQE 4AEFA 4EXPX 3NIFE 4G3YL 4PJEE 3C6LA 4JY5H 2OL3B 4KK9C 3WJLA 4QNPF 1KCKA 4TVPH 4XP9L 2MPAL 1BBJB 5HD8C 4BFGA 1J88A 1F4XL 1U8KA 2RAMA 1V7MH 5HY9B 4YDJA 2W65B 4YBQD 4LVNB 4Z0XA 1IM9D 2XKSA 3RVTC 5ICXB 3QDJB 4U1SA 4ZS7H 3QG6B 1FV1B 1DBKL 3MRGA 1FYHB 2V7NA 5KS9E 4Z7VB 1KCSH 4X9GA 2GK2A 2XXCB 1VESA 5HHNB 1JHLH 3IXAA 4NN6C 1SYSB 1W0VA 5MI0C 1CL7H 4LBEA 4WUUE 5CD3A 2EKSA 4LLMB 3O4OB 1RZ8B 4EBQL 4WFED 3QHFH 3T04D 1HWGB 5E5UB 1P84J 2QQKH 3JZ7A 4GRWE 3F12A 4QRSA 5E99H 1SYVB 3I02B 1BECA 3U4BL 2DF3A 3QQ3B 3O9WA 5SX4H 1G9NC 2AJUH 3NIFF 1JMZA 3MJ9H 4MXWL 4XAWH 4TSBL 5C0EB 2ESVE 5C2BH 2ZUSA 3MLRL 5LGJA 4AMKH 1PY9A 4QHMB 3EYVB 5A1AA 2ZNXA 3D39B 1KPRA 1KXVC 1H9VA 4JFDA 3GM0A 5GRJL 4MJ5B 5F7YC 5GGRA 5FM4A 3SOBL 1CGWA 3D3VA 2I60L 3FQRB 1JPSL 1OSPH 4P4KD 3HAEB 3ZE0F 5EH1A 5TQ2L 2IEPA 1UQSB 1XEDA 2EEDA 4G9DA 4NFCA 3GSQB 3CU1A 3QB7C 4JQXA 4URTB 5GZNC 1T5XB 3OKMB 1INQB 3RL2B 4OD3H 2VXSL 1WFUA 5I74C 4IMLA 1A7NH 3GJFH 1U8LB 2ARJA 5AZ2L 5KSVB 1MCPH 5DJ2B 4X83A 1FRGH 1FO0B 1I3GL 2BHYA 5IQ9B 1J11A 2YXFA 3IFLL 1T2JA 4PP2B 4CBPA 1Q72H 3AM8A 1G9MH 4X0KA 1FG2A 4GRWF 1V05A 4OV5A 2HYMA 5ESVB 2D3VA 4NWUL 3TZVA 3WN5C 5D8JL 5KZCB 2HVKA 2X6MA 5C0CE 1HQ4A 3ZKNC 1N6QL 2I9TB 4ZFOA 4LDLB 4HUUA 1CF8H 5F7UA 3SO3B 4Y5VA 1RUQL 4S11A 2WBJC 4PD4J 5IHBA 2HT2D 2VQ1B 4NQVA 4UB0H 4HFUL 2DJUA 4U6TA 3N1PC 3HNVL 4I77H 1ES0B 3P0YH 1PG7H 1YJDH 1Z9LA 1L7IH 1PX4A 2WWMC 5J1AA 4OGAD 3SQOH 2ZP0T 3H2WA 1I1FB 3CGTA 4PLOB 1ZSDA 1DUYA 1OAUL 4QHNB 1MJ7L 2M2DA 1DEEB 4YHZL 5DK2B 1U9KA 4NRXA 5EU6E 4IHOA 4YO0B 3RVWD 1FZMB 3WHE1 5HHOA 4YEEA 1AGFA 3C6LB 1AKJA 3GHBL 3DI3B 1O7VA 3EUUA 4O51B 2M1KA 5H94A 1LEGB 4KKAD 4DKFL 5E8OB 4XNUL 2X1QA 3RWCA 3FQTB 2QSCL 3L5HA 3V7AE 4L3EB 3WS6C 1A6UH 5JHDB 4EI5A 3QDJD 4U1GC 2C3HA 4ODTH 4WWID 2XWBA 3VD7A 4F9LA 1K4CA 5HVFB 4U1KB 2R8SH 4KZDL 2H9GB 5I1DA 3B9VA 4HDIB 2J8UE 4J4PC 1S7SA 1EZVY 4WFGE 3MRGB 1FSKC 1VGKB 4JFXB 1FVCB 2IPUK 4L3CA 1ACYH 3HC0B 5T1LA 4LSRH 1H3UA 2I5YL 1RZ7L 5H2BB 1W0YT 2FBJH 4WHDA 4XPFL 4F9PA 1KJMA 4HBCH 5DJCB 4KVCL 2PF6A 4CNIA 5C6WH 3EYSH 5BMFL 2IANE 4WUKH 3UDWC 1FVEA 2DMBA 3P9LB 1FZOA 3QUMH 1VKXB 1DLHA 4M1CD 5B8CC 1RFDH 1PG7W 2H6PB 4OIIL 2J88L 3O41A 5D71L 3U46A 1IC7H 3U0WH 4OD1H 3QUYD 4HCRH 4JFEB 1K6QH 4AL8L 5IUSA 4Y2OA 4FOMA 3IDNB 3SDCA 5KSUB 4JAMA 1R3LA 5F1NB 4PJHA 1CVRA 2X4OA 4CVZA 4QRTB 2UV3A 1ZGLP 2WAHA 4PJFE 4BUHA 1JNLL 4UZGA 5IV2A 3QCTH 2WUBH 3MRLB 4ONGH 1OSZA 2JCCF 5E08H 3VXRB 5HI3D 5F9WB 1X5HA 2Q86A 1Z3GL 5BW7A 4OZ4A 2LV4A 5DWUH 5GGRB 1JNHB 5INDA 3ZTJH 1VACA 5EN2B 3CLEH 3FFCE 4ZTPH 1I3RB 3I2CH 4HUXA 4CGTA 3LV3B 3OG4B 2YA0A 1ZLWH 5IW1A 3CX2A 4I5BA 3HN3A 1I9RL 1QQDB 1E4XL 2YKLL 4HWNA 4U31A 3VRJB 2EDOA 2FIKA 4XP9H 2MPAH 4XPGL 1OAKL 1G7HB 5DSCB 2C3WA 3S4SB 4TOYH 1HILA 3S88H 1FNSH 2CKBL 4ZUTA 4K94L 2P47B 5KZCD 1BP3B 1A64A 4G7YH 4NWTL 4YIQB 1B0RB 3CDGA 4XVSH 4FQ2L 1KEML 4R4FL 3TZVB 2N1KA 5JHLH 3VFOA 1YEGL 2AK4E 4LLYA 4J3VA 3TT3L 2VH5H 5DEFB 1JZ7A 4RFEA 4RMUA 3OKYA 1QEWB 4TUJA 4LCUB 3GBML 4KTEH 3KJ6L 4PD4K 2YBRA 3IF1A 4RFOL 5F7DB 3TIDB 4PRNB 2JJSC 1S7QA 2FJGB 3EYOB 4JFOA 4HS6A 1IZKA 3SGKA 4HUKB 1D5XA 1EXUB 5AZEL 3OX8B 3PXJA 2X4TB 3T65A 5CEYB 1ETZA 2FJHA 3WXVL 5ICYA 4MB3A 2AEIT 43CAA 1D6EA 3C6LD 3W2DL 5CJOH 1UFUA 3HFML 4L9LC 1CICA 2EH7L 3EYQD 3QDHA 4S1QH 4NRXB 1WVZA 3MLTB 4IHOB 3WD5L 1PKQB 3WJJA 1UEMA 1AGFB 1AKJB 3DOSA 3FOLA 3QCVL 4L3ED 3QEGH 2VDKH 4TSBH 3NZ8A 2OJZL 3LKSB 3G08B 3ZDZE 5F1KC 2P42B 4NQEE 1BPVA 5FOBB 4KQ4L 3CFIC 3I6GB 4KROC 5HYFA 4JFFA 1AIFA 3N9GL 25C8H 3VD4A 4J2XA 2R0LL 3DO3A 3MLRH 3ARXA 3EAKA 3QRFM 4QT5A 1DLFH 2NXYB 1J0JA 3LN4A 2A73B 2H1PL 1NBQA 2AXFA 4TPRH 1CLYL 1H3TA 5I1DB 1IGFH 5F88B 1G0DA 1AHWB 3CCHA 3NIGE 5D7LB 4YXLL 3DX6A 3C09B 3O11A 1NDMA 3ARGA 3QIBA 4OQTL 5DHXB 5BV7C 1TQBB 3V6ZA 3VWJA 4BM7A 3CFEB 3PV6A 4FQIL 3T0DA 3GMOB 1TETH 4GAJH 4RA0C 4MA1B 3GMLA 4J6RL 5AYUL 4FTVE 1VB9A 3LQZB 4S1RH 4RAVB 3WDHA 5T3ZL 1DE4B 4QXGH 1FPTH 5L8KB 5E4EB 4P3CH 2B39A 1IQWH 4JFED 5TE6L 3O9WD 2XICA 3VI4F 1KLUA 1D5BB 5K9JL 3TESA 5IK3A 3UTPE 2HWZH 3SDCB 1A1NB 1AO7B 4M3JA 5DXWA 3VXRD 1RUQH 2CO7B 4CVZB 4OF6A 1YEEH 4TTGA 2DWEA 3WLWD 5IV2B 2H3NA 1OSZB 3C5JB 4HFUH 4PLJC 1MLBA 3HNVH 3OPZL 3E0GA 5ABDE 2Q86B 1H15A 2FIRT 5KN5B 3UMTA 1AR1C 3PL6A 1A6PA 5CJQL 1B6DA 1QNZH 2GTWB 2IAMB 4PJCF 6FABL 3IXTA 3H3BC 4KMTL 4I2XA 5HHQB 1U8PB 1UWXH 2ZUVA 1I4FA 2R0KH 3NCEB 3LQMA 3MV7A 3CAFA 2FIKB 1U8MB 5J7CC 4PJBE 5B39A 1LO4H 1M6OA 5GRYA 2H8PB 2QSCH 1KELL 3TZVD 2VL4A 5DVNA 1SY6L 4FQLH 2ITCA 1NGYA 1QLRA 2FHCA 4K3GA 1BBDL 1CLOL 4XNQB 2JK5A 4X9HA 3STZA 2IG2H 4BH7B 1LE5B 4JY4B 1GGCL 3RVUC 4D9QD 3HZVA 2E7LA 5MEPA 4JANA 2CIKA 2KPNA 5FYKL 3FRUB 1WBYA 5BRZA 1KULA 4EUPB 3LN5A 5KVFH 3I85A 5E6ZA 1BZ9B 4XXCC 2Z91A 5D1XA 4HS6B 2EDHA 1MJUH 2P4AB 4KVCH 1FL5B 3GSVA 1I8KA 4U4BA 4I3RL 1KT2A 3PGCA 2X4RA 3VRIA 4RGNC 4XAKE 1NCNA 4MVBD 2XZQH 2IH1A 1UH3A 1XGUB 2UZIL 5ICYB 1T03H 4JJ5A 5HHOD 43CAB 1JMXA 1CG9B 2AJZB 1Z9OA 5D7KE 1AKJD 2W0FA 4OIIH 4PG9A 5IVZA 5F7EH 3KYNB 4HJ0D 1MWAL 3U4AA 1EA9C 4JDZA 4WW1B 4MJIB 2WQRA 5FEBA 5E8EB 2PO6C 3U30B 1RUMH 1EDQA 3AU1B 4RA3A 2NXYD 3MOAH 3LPGA 4CVXA 5CJ5A 3DBXA 4DWHA 3H9SA 5F6IC 4YHNB 3VXNA 2UY6A 4NN7B 1UB6B 3LD8B 2D7NA 3B2UD 1FE8L 1XCTB 1RV6X 1HEZA 4K3DH 3N50A 4MXQC 1KENL 2EXYC 2VZ3A 1BJMA 5CP7A 4KAQL 5GGVY 2QLVB 4JQVC 3UTSA 1CXKA 1RJYB 5FO7A 4XC3L 4V2BA 2V9QA 4FG6C 3BJ91 2OJEA 4R4BB 5F89B 2ZOKB 3QP3A 2ZSVB 5HPMA 3CCHB 1JGLH 3TT1H 3BKJH 3QAZB 3U9UB 1HOCB 3V6ZB 4K2UL 1I9RH 3QNYB 5GGQL 5GJSH 4NUGL 3B9DA 1YNLH 2RBLA 3BH9A 3T2NH 4W4NA 1ORSA 2Z8VC 2VABA 3MBXH 3MRCB 4TQEL 3AGVA 4PJ9A 5AD0B 4OCSH 5D2NE 4AQOA 2ORBL 1GZPA 4PJGB 4G80A 3FCTA 2HVJA 1CK0L 4PV9B 1YMHA 3SDCD 1AO7D 1KEMH 1VGEH 5I1CL 3PWNA 1TVBB 1YN7A 2XPGB 5FF6B 1U6AL 5DJ6B 1BZ7A 4LHUA 5KSBA 3K8MA 3WUWG 3KYMB 2BSSA 5JUEL 3GKWH 2ZCHH 4ELMF 2Z31A 3EOBB 4O2CA 3MRQA 1B4JL 3T0EE 3QRGH 2ZCKH 1X3DA 2DWEB 3B5TA 4RFOH 2CMRL 4P9MH 2ICCA 3DTXB 2BNQB 5J06A 3ZT6A 3AUVA 4PS4H 2NX5A 2IAMD 1FL6A 1KIQA 3VFNA 4IMKA 3CFCL 3WXVH 3PHSA 1G6RH 3ULSB 3OKLB 4ENED 5ANME 5GS1A 3IETA 1T04A 4G43B 5FK9A 5EZIL 3WIIH 3T4AB 2APWA 2WV3A 3CZFA 1U8QA 5IVOA 3BPOC 1EEYB 3QDGE 1Q38A 1I4FB 1SBBA 3MR9B 1YY9C 3D6GA 4CDHA 2YC1B 3VI3F 3HZKA 4GKNA 5J57B 3FT2A 3T4YB 1J8HA 3HUJA 4PRIE 1OWWA 5C3TA 3MODH 5CEZL 3STLA 2AS5M 3RQ3A 1A1OB 4HT1H 4UTAL 1MY7A 4GG6E 4KZEL 1QLRB 1OTSD 4PUBL 3RWDB 4XP1H 3KJ4C 5DMIH 5IG7B 3KDMB 3REVA 5I1IL 1CLYH 1IC4L 1GHFH 3HZVB 5IF0B 5MEPB 4WHCA 4JANB 3UO1H 1CDGA 2D7TL 3ZL4H 4IIQA 4PTTA 1J0IA 1L0QA 4YXLH 3VXMB 3VGBA 2O5XH 5BRZB 4PRHA 3RZCA 2VN4A 2XTJE 4M8QB 3GHEH 1BQLL 3QUXA 2V9RA 4QTHA 3CFBB 3OXRA 4M1DL 2DKUA 3P0VH 1SEBB 1QLFA 4QYOB 3KPSA 1ORQB 1F90L 1AP2A 5AYUH 3JV6B 1IEHA 4JPKL 4RWYL 1W0WB 3MRDA 5ETUB 1K5NA 4TULH 4QRPB 4HGMA 2VERN 4MJID 3O6LH 1U91A 5BZWB 3B3IA 5J6HA 2LU3A 4LCWB 3VFMA 4JO1H 4JDZB 3DO7A 1BM3H 3PF2A 3V79C 5CSGA 5C7XL 4K9EC 2NY4B 4XT1C 2GT9A 4OGYH 5D7JB 1UYWH 5D2NC 2P1YA 5F96H 2VDLL 5GQBA 2DQTH 3DBXB 4KI1A 4X9FA 4G8FB 2ERJC 1HEZB 3U4EB 5I1KH 4FXLA 1TZHB 2BNRE 3QHZL 1UWEL 4GG6F 1XGRA 5E7BA 2XQBH 3DV6B 4OM0L 3VWJD 2JJTA 4WFHD 1W72L 4X5WA 1A6TA 2DWDA 4TUKL 3D69A 4OCXH 5GJTL 2PXYC 3BWAA 2NW2A 2NQCA 4NM4L 1BAFH 3LEXB 1JBJA 4AT6A 5E2WH 2HG5B 2FX7L 2VABB 4U05A 2HJLA 5KSAC 1EGJL 2X41A 1EHNA 3FMGH 5GGSB 1R3KA 5DHYB 3ULVH 1SY6H 3EZJB 2IFFL 3MV9E 2YPLA 3UZVB 3K0WA 3WDIA 3ULUH 4LLAA 1BBDH 3OR7A 2WIIA 3AS3A 2NY3C 2BVOA 4R4ND 15C8L 3BGFC 2XZAH 1XH3A 5FYKH 3RGVC 2R23A 4O2CB 3MRQB 2EE2A 4JM4H 4J12A 3IAQA 1V7NL 4P2YA 1JYNA 5JA9A 2Y6SC 1JGDA 2DMKA 4X6DE 2DYPB 1F4WL 2VDNL 3PWJB 1KIQB 1ZAGA 3MRKA 1C08B 3A67L 3E6FA 4GKOA 1KCRL 4TN9A 1RZIA 1AQDB 5E03A 5I76B 3MLWH 5C6TH 1HHHA 4HC1H 1A6WH 1T04B 3CX5J 1WC7A 3NGBC 3MV7D 2F5AL 2XTJC 4Z7QE 4OCWL 2ADIB 3RPKA 3PP4L 1T66C 5EIVA 4X4ME 4E42B 3P9MA 1RHFA 4M5ZH 4XGZA 3SDDB 3G9AB 4JG1L 3BKMH 4GKZA 5C0AE 1KXTB 4GKNB 3UJTL 3FT2B 3TH3T 3FB8A 4WW2A 3RX8A 1NMCB 4ORGB 2GSIA 3NA9H 1TTFA 3MC0A 1RVFL 2AW2A 3DUUA 4M6OH 5DURB 4V1DA 3SKOB 2EDYA 1B0WA 2X4PB 2ZJSH 2AXGB 4UT6H 1KENH 1CZ8L 5F9JA 4PRAA 3L95A 3VXMD 5BRZD 5DD6A 4NGHH 3MA9L 3O3EA 5C1MB 1NFIA 3MNVA 4OCLC 3LB6C 2RGSA 4PLKD 3UJIH 5EOTB 2ZCLL 2DMCA 4CN4A 4H20H 2VDPL 1M7XA 3W9DB 3WS3A 4ZFZB 5BO1H 3P40A 1J1PL 4K2UH 4QTHB 5JXEC 4P99A 2DQDL 1OTUD 1KGCE 4NHCL 4Q6IB 4RQQA 5T3ZD 4QRPD 4X7SH 4IDJL 4GXUN 3MCG1 1TVHB 2IWGA 1U2CA 4LCWD 4O4YH 1I8MA 3N1FC 1ZHKB 4MJ4A 5DMJB 1FFOB 1CK0H 4UT7H 2I07B 5DJ8B 5FYJD 1B90A 2PYFA 1FNEB 2Z0BA 2NY4D 4D0DB 4GQ9H 2XWJA 4KK5C 5D7JD 5K9QG 1BIHA 1G0YR 2UYLA 1G9NH 2GTZA 4WTZG 4OKDA 5CIPH 1U6AH 3BWUC 4ONOA 3GIZL 1R3JA 3H9SD 2BSTA 3RNKB 1QBBA 4WV1C 2X10A 3QUZA 5GS0C 4X6CB 3ARBB 1H5BC 3A6CH 3BPCB 1HHGB 3WIHH 4TUOB 4H88L 4XPAL 1CGSL 3QQ4B 3PDOA 1N5AB 5D93B 1MELA 4FQHA 3WFBL 4PFEA 5EUKA 3R0MA 1Q9WB 4JGMA 3P4NB 4OFVA 5CP3H 3CFCH 2YEZB 1IEAB 3GDBA 2XKNB 4XHQA 4LLWA 3E2HB 3QEHA 1S7TB 5MEQA 5I73B 1E4KA 2GY5A 4DGVH 2R0WH 5E8PB 3WL9A 1YMME 3FL7A 3MUGA 4GXVL 5EZOL 3NN8A 1NGPH 4AT6B 2Y07L 4K71C 4FFWC 4HWZB 4U33A 3WUWB 4HIEA 4NQCB 4X7DC 1B4RA 4LLUB 5CEZH 5D72L 5A2JH 4HIXH 3HE7A 3QZWA 5SWQA 5HHXL 3EFDH 1D5IL 1J12A 1WSST 1NBVH 3MJ9A 3L5IA 3OR7B 4UIMA 1UWGL 1OVZA 1HI6B 3BESR 4X6EB 4Z5RB 1I9IL 5HGAB 2CXGA 2A6IA 2E27H 3NCMA 4KKCD 2DYPD 3EJYC 5M94B 1GGYA 1PYWB 4Y2DA 2NX5D 3V8OA 2V5MA 3ZT7A 5T5NG 3S5LG 3KWWB 4X7TB 1JGDB 3KLHC 1NGZA 1F97A 2EDQA 3IDIA 2W60B 2BY1A 5FV1L 1VENA 1KFAH 1ZEAL 3MRKB 1BFOB 1ITCA 4P5TC 5D70L 3UBXG 4GG8B 5FCUH 4ETQB 3TO4B 1AGEB 1BD2E 3LCYA 1S9VA 4H5SA 4JVPA 3RTQB 3SPVB 3CH8A 3OJMB 1KTLA 3CX5K 3SDDD 4XPBL 3WNLA 3GJFA 3O6KH 1DFBH 5CGMA 2YUZA 1S78D 3ZTJG 3QISA 5C7XH 5DURD 5ESAA 4GRWH 1ZS8A 4BQ9A 5T1DL 1F8TL 1Q9KA 4KRPC 1MUJA 1SM3L 5CAYB 5EWIH 2VLJE 3MLYL 1MCEA 3DUUB 1KIPA 1EMTL 2LAGB 3GBNL 1P9MC 3ZE1E 1JL8A 2ICWJ 2D0GA 3QWOB 3ZHDA 4ODBD 4Z95L 5EO1B 3C5ZC 4MQTB 1UWEH 4KJPC 4O5LL 1T5WB 5EIIB 1XIWC 5IVXE 4N1CA 1GGBL 5DGQA 3T8XA 2X4QA 3QUXD 2WMPA 4J8RA 3TCXA 5IHLB 3LEVL 2A74B 2BVPA 3VH8G 5JOPD 4TUKH 1W72B 3KPSD 2XA3A 2VDQH 4ZMAT 5JMRA 3BO8A 1YPZA 2PNDA 1J7VR 5ILTH 3X3GL 1UB5A 1NEUA 1J18A 1JI1A 1IEBB 5C07B 3V95A 5LCVH 4ZYKB 1Z6JT 3QO1B 4PJ8B 4LRIC 3TNNA 1XFPA 4FRWA 3G6JF 3KYOA 5C9JB 5CZVH 3QXWA 4GW1A 4JRYA 4AZ8A 3QCUL 2IFFH 1OQXA 5C3LD 4EI6A 2PYFB 2XI9A 3VDCA 5JO5B 3MXVL 3VCLA 1IAOB 4L5FH 2IQAB 2R15A 4W6YB 3ARBD 4Z78A 1BHGA 4N0UB 2ZOLA 5AG9A 5DJXB 2DBJA 3QJHA 5IJVB 4APQA 4K7PX 4M7JL 5D1ZA 4XWGL 5GIRB 1ZLSL 4DUVA 1KCVH 1T83A 2MCG1 1ACZA 3H9HB 2OSLA 1V7NH 3GK8L 1QFWL 5K9KA 1INDL 3B2VH 4P46C 2OI9B 4OUOA 4LHJB 1JNNH 2G5BA 5IEHA 1OPGH 4X5LA 3PDOB 2B2XH 5INCA 1TPXB 1QYGH 2R1XB 3MSPA 3LS4H 3U6RA 3FQUB 1NFDB 4ZQKB 5EG6C 1S9XA 2EXWD 3IKKA 3GM8A 4B7LA 3HRZA 4PJAA 1R0AL 1CFVL 3HI6H 3WNOA 4M4RA 5IVXF 1MCOH 4XXDB 4O2EA 1MFAL 4H25B 4PJHE 3B9KB 1D9KC 3RWFB 4JRXE 4NQCD 3MUGB 2ICES 4YUEH 4ZUSA 4JFZH 4K8RL 5D5MA 3VG9B 5C0RH 5MENB 2J5LB 2ICEB 3QUMA 1MHPH 2NZ9C 3JBG7 1OM3H 5JORA 1AD0A 4D0CB 3N0PB 1P7QA 1QSEB 1UCBH 3S5LA 3NTCH 4HCRA 4Z7WE 3BIAX 4WI8A 3VFUB 3ZDYE 3K7UA 5IESL 5LGKA 1T20B 1JPFA 3UBXA 4NJAL 2YD5A 1JWUA 3C2AH 2CIIA 4G5ZL 4P48A 3HI5L 1LK3L 4NRYA 2JCCB 5EC2B 5HSFA 1NGQH 4RMTA 4FP8H 3NFNA 3GMNB 4BQ8A 4NHCH 4KHXL 2FLBT 3TO4D 1S7RA 2QHLA 3KHOA 1KACB 3RTQD 4GS7C 3L3HB 3EOAB 4Z7OF 1Z9MA 2YD9A 1FNHA 1IT9L 3OGCA 1EFXA 3O4LE 5C9KA 3CH1B 1D7FA 1JPTH 4MX7B 1S9VB 3TBVA 3MGAA 2WZPD 4DEPB 5E8NA 3FJTA 1DVFC 1NMAL 3GJFB 2XKUA 5IHZB 2EYTA 2H26A 4LQ1A 2YN5A 3U7YL 3PXHA 4BH8B 3U9PL 5EU4A 5E9DE 1L6ZA 3R8BB 4YHIA 1NGXA 1VFBA 4HW6A 1F3JA 3GSNL 2FYYA 1A9EB 2CRZA 4PJXB 3AREC 3TBTB 3VH8A 1WT5A 3EFFA 1XGYL 2GY7B 1KN4L 4ZFGH 4HFWA 4WU5B 1BVLB 3NPSC 2MHAA 5D7IF 3S8WA 4IOFC 2O61B 2NY1B 5HI4D 5L2KE 1FAIH 2VLME 1CBVL 2UWEB 4Z7WF 2CGRH 3OKOB 3EDFA 2A38A 3EDDA 5IB4A 2X4QB 5KW9L 4E9LA 5BV7H 1KPVA 2BVTA 2NY0C 2V5YA 3RY6C 1H8NA 2ZUYA 3H0TB 3O2DL 1Q0XH 4G9FB 5I71B 3SDAB 3HI1B 4JFFE 4PJ8D 4FFVD 2VDMH 3QIUA 4JHZA 3EDJA 3L7EB 1VPOH 3RVVC 5F9OL 5FDYA 2MCPH 3O3AB 4PGJA 2CUIA 1OW0C 3U2SA 3PQYE 4DTGH 3W9EA 4XCYA 5JR1L 4GW1B 1YDPA 5IKCB 4HPYL 4Y5YA 1UXSB 3BP5B 5SWSE 4K9EL 2XA8H 1UWGH 2X1WL 5D96C 5LWYL 4OUUA 3TVMA 2V17L 1VCAA 3ZHLA 1JIBA 5D1ZB 1G0XA 1GGIH 2O5ZH 4X4ZA 5J4MA 2PW1A 2ZG3A 5DGRA 2OSLB 2WUCL 5JZ7C 3I75A 1WEJH 4IRSB 4CAGA 1UACH 2FO1A 2CR3A 4C55A 5LG1A 4CMHB 5E5MA 5E2UL 3KXFE 3VXOA 4HMEA 4FXGB 5JOFB 5D70H 5LXGL 1KBGL 3O6FC 2BOCA 1QFUH 3B9KD 1ERNA 4M03A 3HZMB 1DQLH 5MEND 2HFEA 4PRPB 4TRPL 4NO5A 1RZGA 4I1NB 3O8XA 2OP4H 4LCCC 3TJHC 3PWPE 4OZIA 4WHTB 2RFXB 4M93B 4Y8DC 1LDPH 3MUY1 3HE7D 5B3JF 4MJ6A 1QSED 5DDHB 3UTTA 4WWKA 5C86A 5T1DH 3E6HB 5I75C 5FYKU 4HQQL 4KRNA 3GBNH 3K2MC 3L5WA 4WCYH 3S5LB 2IMNA 4GBXC 5D6CA 3Q2CA 4YHML 4Z95H 5DYOB 3MRRA 4ZXBB 2V2XA 5CGYC 4P9HC 1MJ8H 4O5LH 4XBPB 4S10A 2F53A 1XZ0B 3OKDB 5E8DH 3MREA 4ONFL 3PHQA 1MIMH 2B1HH 3LEVH 2IPKA 4WO4A 3LMJH 2IPTL 1CIDA 3WUZA 2J1KA 3VFRB 3NFNB 3PWVB 5DHVA 4AIZA 4NN5B 3C60C 5E1AA 1NUNB 4JHAL 4CN6A 4PJCB 1NEZG 1LO5A 2XFXA 1U93A 4YQXH 1NFKA 3G5XB 3MLUL 2NY6B 3KPMB 4Y4KB 2QL1A 4HWEL 1T89A 4CW1B 5E70A 1BFSA 4PV8A 1JWSB 2H26B 4NFBA 3WLBA 4KKLD 3GMPB 3GMMA 4W68A 4PGBA 4OZFH 2XWTB 1AXTL 3MGTB 5KVEL 2DLIA 3MUHL 2D03L 2NY1D 2FYYB 5HGBB 2HTKD 3DRQA 3EFFB 3B6SA 1A5FL 4XCEB 2LFGA 2QQLH 4HFWB 5FUZL 3GSRA 3BN3B 2F19H 3CVHH 2VZUA 3D0LB 2YWYA 4UOW1 2A1WH 4UUJB 1P7KB 3GEWB 1U8IB 3V5DA 2BNUB 3ARDA 4N0FA 4G9FD 1R0AH 3SDAD 3FO9B 4XTRD 5KANI 3C9NB 4YHOL 5C08A 2E6QA 5E6IB 3WHXA 1KTDB 1MFAH 3OHXB 3TN0A 3SE8L 3VDBA 1NKOA 4C57C 1QPXA 4W4OC 5GRUL 4N0YH 5F7LB 1RHHB 1AGCA 2AJSH 3HTLX 4X7FC 2C4FU 3QIUB 6CGTA 3CPLB 4YPGA 4I48A 3G5ZA 5CILL 5IHUH 3KPLB 3UTSE 3LKRB 2DQUH 2HAZA 2AV7A 4KQ3L 4F57H 5BCAA 4OFPA 5EB9A 4P23A 2R39A 5I8KL 4MDIB 4FS0A 5D1ZD 3QDME 5IESH 2N7AA 4QRUB 4P2OC 1KEGL 5I2IA 2XYCA 3DGGA 4IRSD 1ZGLB 4RFNB 3HI5H 4XNXH 1FNAA 4L8CA 4ZODA 1CVSC 4HIJB 5I1AB 1I3UA 4PGDA 2AQ3A 4GRLA 4IRJA 3VD5A 1RK0A 4LSSH 1GC1C 3INUL 4QXWA 1U36A 1S9YB 4MS8C 2IH3A 2GIYA 3R1GH 4PRPD 2Q8AH 5CJXA 4XC1L 2VLRE 5FFLA 3MNZB 4M48H 2BOBB 4XP6L 1S3KL 3CC5B 5KSBE 1NMAH 2B0SL 1N64L 5TF1L 4KK6D 4FQCL 4ZDHA 1T1WA 4MXVF 3LRSA 4HPOH 4P59H 5J13B 1AY1L 2EZ0C 3UTTB 35C8L 2AJYL 5D2LA 5IB2B 1ZK9A 1LP9E 5I16A 4UDTA 3GSNB 2CKNA 4KI5D 5EOCJ 4C4KT 1ND0B 1XGYH 4ZXBD 3L5WB 2PTTA 4HXBH 1MQ8A 3UYOD 4K7PY 1KC5H 1SQ2N 2V2XB 2DJ4A 5HJ3B 4QRRE 4ELMB 3DUHA 1KPUA 3RIAK 4OCRH 1SVCP 1OAZH 4IDLA 2R9HC 4ODVL 1MVUA 3KPOA 2C4XA 2R0ZH 4M6ML 3QNZA 5EUOB 2FH8A 3TO2B 1JZ6A 1CI5A 3G04B 3H3PL 2PYEB 2NY6D 4Y4KD 3HCVA 1G6RA 5TDPA 5FKAB 3ARTA 3MA7A 1DUZA 4PJ7A 4Y19A 3E8UH 2FX9L 3KLAA 4X7CC 4X9IA 5FGSA 1U8NA 1U93B 1NSNL 5FECA 5IVNA 3EYFB 4TTDD 3LDBB 2EC9T 4JM2F 4CVUA 2EDNA 4PV8B 3WLBB 4ZFFA 1JTTA 3GMMB 3HNSL 1JYVA 2VZTA 4JZJC 3I6LD 4NQSA 43C9A 2H32H 4LVHB 1FVDA 1RJZB 4HMDA 1HK6A 1QVOA 3P4MB 1PSKH 3DRQB 3B6SB 1LP9F 2P8MA 1NH6A 3LQAH 2JB5L 3FONA 2XOTA 3ARFC 5H35A 7CGTA 1GAFL 1Z9SA 3M45A 3QEQE 4PJ5A 4U6YB 4YJZL 5KVDL 3UAJC 2EIDA 3FB6A 1F4YH 3CXDL 5IFAH 3VXQA 5TGBB 1JUFB 3NFPA 3L3JA 2EDKA 3QIUD 3IDYB 1C5DB 1QPPA 2Q76A 3DX9B 4Y16C 1MRFL 3SN6N 1J1OH 4ZD3L 4XMPH 2A9NH 5I8OL 1QLEL 4ISVA 1T7VA 2J6EL 5C2UB 1A4JA 5E2JA 5C92A 2Q7YB 3ILPA 3C5SB 4FABH 2Y5TB 4RBPK 5C0FA 2EC9U 4JM2C 2UVFA 1D6VH 4BSWB 4UU9A 2PCPA 3CFKB 3X14A 2AV7B 1HHJA 2BRRL 3AS2A 3GRWH 4FQXB 4HXAH 3TVMD 4N1EA 1G6VK 2W9DH 1NBYA 1T1XA 4YDVB 2Z4QB 4KHTL 5KAQG 3LIZL 4Z7UA 2YD7A 1I8LA 2OZ4L 4NT6B 4U6VH 4AENA 3C8KB 1EEZA 4KJYB 4QOKA 2AK1H 2HFGL 5BJTA 1I3VA 2HJFB 2IPTH 2P5EB 1TZIA 2MQ0A 4I18B 4C56B 4IRJB 3RUGA 4DOHB 4H1LH 1RK0B 1FNGA 3KPTA 4W70A 4Z9KB 1GCFA 2VDRL 1G7QA 4L4TA 2IH3B 4ZAKC 4ZPVA 2R56H 1SMOA 4HH8A 3I50L 3MLUH 5F6HI 4OZGE 1I7ZA 5AUMA 1JHTA 4I0PB 5J9PB 1U95B 4OCNC 3UTTD 1C12B 4JDVA 4WWKD 3W5NA 1UKSA 2PR4L 1ZT7B 5JIHA 5HI5C 3SDXA 3MV8B 5JW4Q 2XNAB 2LTQB 5DA0B 4HKBA 4L8SA 5KVEH 1SY6A 2D03H 1BOGB 5D9SB 1U92A 2JE8A 1NC2B 4DN3L 1F58L 4XNMB 1QSFB 5IMKA 1CE6A 1U3JA 2AEQH 4B41A 1T3FA 2FNBA 2VSDA 1O0VA 1LMKA 2X4UB 4IM8A 1NEZB 1RQ5A 5DJDA 4XCFH 4XI5D 2E9JA 1MPAH 3H8NA 4YHOH 3MQIA 4QHKJ 2IBGA 4ZO7A 2PYED 4NNXB 4PYHA 4LF3A 3J7HA 4OLVH 1G7LA 5ERWA 5GRUH 1HYSD 4UOJA 1KB9K 2EIZA 4P57B 3QWQB 3LEYH 1WAAA 4HKJA 3W0WA 5TDPB 5JQ6H 1AQKH 4MAYB 3NCYP 1H3XA 5HGDB 3KLAB 3Q1SH 1R5IB 1EH9A 3G5VA 3SE9H 1RAMA 1QO3B 3RWJA 1N0XL 3N06B 1MWAA 5FCSH 2X4SB 4OZGF 4R3SA 5GISL 4DUWA 2PTUA 4JKPL 4OT1H 5I18L 1A14H 3WKNA 4RIRA 5JPNB 43C9B 1KEGH 5GS0H 1WZ1L 1FVDB 2HRPL 2X1PA 1KG0A 2AV1A 4YBQC 4F58H 1N7ML 3CFDA 1N2RB 1DQJB 1QVOB 2FEDD 5C0BA 3FTGA 5IM7A 1XR9A 4WEMB 5E24E 1NPUA 2VSCA 4IS6A 2BMKB 3LPFA 1WTLA 3KPNA 4J3SA 5JW4N 4Y4HB 3MX0A 1AJ7H 2A6KA 1TXKA 4Y5XB 4NPYA 3ROOB 1MCFA 5ADPL 1G1YA 1DL7H 2Y23A 2W38A 4XPTL 5DD1H 5CSZA 2EDTA 4KPHL 5K9OA 1E6JH 5ADOL 5FO9A 5TF1H 2DTML 4GAYB 2APTA 5I8CA 1A4KB 2APXA 2KQMA 2F74A 3SJVA 1C16B 2DM7A 1OGAA 3BGMA 4Z7VE 1HNGA 4OD2A 3G9VA 4FQXD 1A4JB 4UQ2A 1E4WL 1X4XA 3EO9L 5I30L 1FIGL 2OTPA 3OJDB 4P23D 5C0FB 3EJZD 1EK3A 1CFBA 4UU9B 3K80A 2PCPB 1VFMA 1I1YB 2W1NA 4HLZH 5CIPA 1XMWA 3QFJE 1LEKA 1E27A 5CZKA 4I3SL 4JO3H 5E00A 3IFOB 2J4WH 2P5ED 3GGWB 4KC3B 4YLQT 4Z7UB 3BGAA 2HH0L 3WIHA 4CN1A 4AEHL 4C56D 4IRJD 4FN0A 2VZOA 5BJTB 1ZHLA 2V7HB 1AGDB 1QFOA 5J89A 1D5MB 1BREA 3H3PH 1EHAA 1FNGB 5CP3A 2EICA 4R0LB 4D9RD 3UPRA 2VDOL 1G7JA 4NKOB 3QXVA 3ALPA 1HXYA 4I0PD 4XX1G 3TCLB 3X12B 1JI2A 1MCDA 4U49A 2KDGA 4S1SH 4WHYH 1PZ5B 4KU1A 1P4LB 2G9HB 2GUOB 3V9FA 3DVIA 5GGTL 4KDTC 2D7OA 4L29B 3BPLC 4X8JA 3D39E 5C70A 5DRZA 2FB4H 3V6OE 4M62L 3RRQA 2E8ZA 1CXLA 1OGTB 3L6FB 1NC2D 4R26L 2WBWB 5J6GA 2QSVA 4HWBH 1U3ZA 1QSFD 4ZS6D 1S7WB 1QTYT 4Z7VF 4Q58C 3IDGA 1KIRB 2OTWA 4PJDE 4LSQH 3AB0C 4HS3A 2JB5H 1XF4A 3QXUA 5CEXB 5IOPA 2HN7A 3JVGC 1FP5A 2EYSA 5FV2A 4Q9QL 2AEPL 3VGEA 2WBJA 5DQ9A 1JZ8A 5E4IA 3TPKA 5BS0B 1N26A 1J1XH 1GIGL 2BJMH 4POZD 1MLCA 4OZHB 4PGZA 5JPMA 2DIJA 2X9WA 2UUDK 1MFBL 5F97E 2YRLA 4NKQB 1UCTA 3GIVA 5ISZB 4X99A 3BP6A 4MAYD 4LQFH 1MRFH 4BK4A 1BIIA 2EIZB 5ALBH 5GSVA 3RIAF 3BP7B 4U1HB 1NCBL 3V7AG 4OKVA 4M1GH 1KXQE 5BVJA 1MH5B 1G7IA 1WITA 4XVUD 4AM0A 3RVWC 1A2YB 1LGVA 1OP5K 4WUUA 5D4QA 3X13A 1QRNB 4JPVH 4AYFA 3DARA 5JXAL 1T1YB 5J0BA 2HKFL 3UYPA 3PWLB 3IJSA 5ACMA 4LVNC 1MCJA 1XCQB 4N0RA 3AROA 4RAUA 3WS6A 1YPZE 2OZ4H 4Y4HD 5FKPB 3STBA 2B20A 3FTGB 4BZ2H 5IM7B 2B1AH 1R3HA 5DO2C 2NTFA 5C8JB 3BZFA 4BKLB 3KPNB 4PJ5D 4HZLA 2A6KB 1IKFH 5A3IC 3TBSB 4GMSH 2VDRH 3O4OC 4NPYB 3CSYA 1YNKH 3IJYA 4LCYB 2VXQL 4ODWA 3SKMB 3I50H 5AWNL 2XG4A 1Y0LB 4PP1D 5K9OB 4L3EE 5JHDE 3BMWA 3TNMA 4JJHA 3MLVL 3UDWA 3TIEA 4M1CC 3CNKA 2R29L 2WANA 5B8CA 1I7RA 2NY7H 3WKMH 3BX7C 1EGJA 3G6JB 4P2QB 1OGAB 2C1PB 5FB8A 4F37F 1MHEB 1RJLA 2D2OA 3FZUD 3LSOA 5L6YH 2F54E 5HYJB 2OLDA 1MF2L 5DRWA 1GPOH 1T22B 1RSFA 1F58H 5JW4R 5FHBL 2CLRB 3WIFA 5M7QA 4NM8H 4FQJL 2CDEA 1P1ZB 4MA3A 2GCYA 3EHBD 4XCNA 4XZUA 1KB5H 5E00B 3CMOL 4WDIB 2OCFD 3OAYK 4G42B 5HI3C 4JB9L 2P49B 1Z5LB 4D9LH 2A6DB 4FZ8H 3SE4C 1U41A 3UX9B 1GC1L 5FYLD 1T6VN 4Z77A 3CSPA 2EO9A 4XHJD 3TEUA 4JFEE 3U36A 2NY5C 5DJZB 5L8LB 4JFPA 2FSEB 1DBBH 1HXYB 5KOMC 4PG2C 4P0DA 5L9DH 3F65A 2R2HA 5IB5A 2HFFB 5DMKB 2V2WA 4QWWD 2MSPA 3PP3H 2CUMA 4NDMB 3BKCH 4PRBB 3BEVA 3X11A 4JKPH 3VE0A 5DRZB 3ULVD 4E41E 1HXMB 2WP3O 5HHPA 4ODHL 3ULUD 5DJYB 5DI8A 4X5XB 5J6GB 1BF8A 1IBGH 4MNQB 5EU6A 3SO3C 1CXIA 3QNXB 1MIEL 4PJEB 4U1MA 3ZHKA 3WE6A 1B0GA 2FATL 5BS0D 3GKZA 2FO4A 3OKEA 5IOPB 2BZDA 3EO0B 2HN7B 3BFOA 1MNUL 1ODAA 2VZ1A 4QY8B 3GO1H 3VWKB 1BJ1H 2R4RH 5ISZD 4UV7L 4L8BA 1XAUA 2JJSA 5JPMB 2VLLA 5DFVD 2G2RB 4KPHH 3GBLA 8FABA 2QSQA 3DVGB 3LOWA 4G6MH 2DTMH 2J8UA 3GMQA 4OLWL 3W39A 2A0LC 3DUSB 3RDTB 5KS9B 3ZKSD 3C6LC 2ATPB 1QRND 4ALAH 2VXTH 4ERSL 3EYQC 3NCJL 4L9LA 4EOWL 1Q0YH 4NNPH 2VITB 3S97C 5I1EH 3FQWA 1JTOA 4ZNCD 2IANA 5J1SC 1KCUL 1OP3K 4QTIL 3IDUA 1FYTB 4I3SH 2EDXA 3QBTB 5DT1H 3RVTD 4LCIH 4JR9H 3UXFA 3BKYL 1X5XA 4J1UA 2ARWA 3FB7B 1CFNB 5TF0A 1FG9C 2J2ZA 3IU3A 2NY2B 5D7IB 4F7PB 4ODXB 3RBGA 4AH2B 1R3HB 2A83A 4OLUL 1VEPA 4UINH 3VFPA 1LEIB 2NTFB 2K9UA 3DXAB 4F7EA 4UILH 1N8ZB 3V2AR 3TFKC 1FSKB 1ZKAA 3IS1X 3QT2A 1PKQE 3CVIL 1FFNB 3QJFA 4PBXA 4A6YL 4PJFA 2ESVB 1A7QL 3CSYB 4JHBA 3GJEB 4PB0H 1EJOH 1T0PB 1NCWH 4LKXB 1TVDA 5EC1A 1UZ6F 5A40E 4UBDC 5B3NA 5I1GH 1OGAD 4D0BB 3DVNA 1VEMA 5BVPL 2P43B 4YDLB 5K93A 3FFCA 3N85L 5I66B 1EAPA 1CTNA 5ITFB 1S7XB 4NP4H 2OYPA 1K4DA 3MFFB 2YD2A 5MEOA 1EVTC 3QXAA 1RJLB 1CDHA 5D7LE 3LSOB 1MFDL 1C1EL 1YECL 4BSVA 4EN3C 2EDRA 3HC4L 4P9HH 5IMOB 4YEFA 4GW5A 1JP5A 4OBSA 3WLWC 3S37L 3JWOL 1UVQA 3C08L 1MEXL 4X4YA 3O45A 3G6AB 5B22A 1YN6A 3HB3C 5BQ7A 4KDVA 5DRNA 5BOPA 2D7PA 1CD0A 4R7DB 5KTEH 4G7VH 2DLEA 1ONQB 5EA0L 2AK4A 5C0CB 3VXUB 2VN7A 2K3TA 4WFFD 1KJ2L 5CBEA 3L5XL 1U8OA 3L3GB 3QWRD 2OTUA 1AO7E 3N1MC 4JFPB 3RKPA 4FMFA 2JF1A 4JZNB 3L3DA 5LAXB 4IRZL 4WNQB 3UC0L 1IGYA 3QIWB 4AEIL 2QR0A 5IBTH 1TNMA 1KN2L 5DQDH 3DRTA 3TZVC 3I3DA 4MNQD 2GJ6B 4LLDA 4LPYA 1J5OH 3TYGH 3S96B 3ZKND 3O3BB 2VIRB 3CLFL 4HF5H 5DI8B 3D0VB 3OZ9H 1MFEL 3T2OA 1HSBA 3RFZC 2Y7QA 4OLYL 4YWGL 1A6AA 3A6BL 5FA3B 4HJGB 2EDBA 4OFYD 4HX1B 3PJSB 4NQEA 5L88L 2M8XA 1KLGB 1FC1A 1V3MA 2PW2A 3S36L 1Q9OA 4XXCA 3BT2L 5AWNH 4LVEA 3RDTD 3T0VA 4HGWB 1N0LA 1GSMA 3MUZ1 4HEME 2VZSA 2Y36H 1MAML 1HE7A 4Q2ZB 3T0AA 2GI7A 3IFPA 3BISA 1N5YL 4NSKB 4JPWH 4MVBC 4Z7NE 1HH6A 2CDFB 3LH2H 3T2PA 4WUUD 2QQNL 3MYJA 4NO2B 4LARH 1RUAL 3BYTA 5IT2L 4P2RB 4DGIH 4O58L 4RISH 3BPNB 1FYTD 2DQFA 5EPMB 3NPZB 2OMBA 4M3KB 3KHQA 2PO6A 3LKOB 4FTVA 1XR8A 2WLYA 3VJ6A 2NXYC 4FQJH 4OZFA 1OD7A 3C6SA 3FN0L 2NY2D 1CIUA 2C1OA 3PABB 4HZAA 2NLJB 5T33H 1UXWA 3CMOH 2BCKB 3B2UC 4YGVA 3DXAD 3ES6B 5GHWL 3VD3A 3TWCL 5E56A 5GS2H 3RWEA 5FUCE 1KJVA 1PQZA 4HIHB 1AHWC 3FFDB 4JQVA 3CVHA 1RULH 3C09C 3B9AA 2F8XC 4LIQL 1FBIL 1JWMB 2ESVD 1GC1H 1LD9B 2Y72A 4F7EB 1WIOA 3Q6GL 4PREA 3LS5H 3LZFL 4B5EA 1S7VB 4MJIE 2Z93B 3CUPA 3O3UN 2EYRB 4MA1C 2QJDA 4M8VA 4DVRL 4LLVA 3FT3B 3VD9A 2ZG2A 4XVTL 5D1QB 5E4EC 2DQJL 1LO2H 1R5WB 4NQDB 3D18B 4OGXH 1X5IA 4HKZB 2CRYA 3OXSB 1JV5B 1ZWIA 1QG3A 2AJXH 2FWOA 5FO8B 3O2VL 2MWCA 4ODHH 4Z7NF 1ZVSA 2E7CA 4MCYB 5SWZE 1PLGH 3H7BB 1BFVH 1BGXH 3TPUB 1U3HB 3QXAB 3DV4A 1MRDH 1MIEH 4X6FB 1PVHA 5FHAL 1CQYA 3P4OB 4PY8I 3VGHA 3SO5A 3WFDL 4PJBA 3K1DA 2P24B 1UM6L 4WFHE 4QF1B 4OAWB 3VFWA 5CZXD 1ZA3B 3OKKA 3B83A 4RX4A 5IIEB 2G5RA 1A21A 4Y7MA 2AKRB 5C0CD 3VXUD 1EHLL 1QR1B 2EEAA 2B4CC 3CK0L 4PJGE 4PTUA 5IBUG 5JIKA 1LE9A 3OKNA 1AXSA 1FNFA 2IAMC 3QXDB 1GXEA 4XMKL 3QULA 2VC2L 2ADGA 2C7UA 1T2QL 4UIKL 3R06A 5GGUA 3QQNA 2ZSWB 3V4UH 4HIIA 1NAMH 2WNGA 2OTUB 3UJJH 1M1SA 3QIWD 4UT9H 4R96A 4JFYA 5KJRL 2IALA 2AP2A 1UG9A 4D3CL 5IFJA 2GJ6D 3OB0H 3BH8A 2KQNA 4H1LG 2Q3ZA 1KCUH 5DFWH 1IVLA 2CK0L 2BNQE 3EOTL 3QFDA 5HVHB 2IGFH 4Q9RL 3UTZB 5IB3A 1NBZA 2P7TA 4KJQC 4BQBA 1Y6MR 1DBAH 1OTSC 4TSAH 2WBKA 3QO0A 3EW3B 2X70B 1RIVH 2O26U 3IJHA 1UM4H 3C8HA 4MD0B 2P5WB 1JGEA 4Q0XL 4P49A 4NQEB 4YDIL 4Y4FA 1I8IA 4YZFE 1A7QH 3V6FB 4A6YB 3HG1B 1Q9OB 4NZJA 2P48B 4OF3A 1RK1B 3MGOA 1F4AA 1YEKH 4MAUL 2DLFH 2EIEA 3AMLA 5F3BB 4K7PL 4PJGF 5SV4A 4FFYH 3VXSE 2GHWB 4P2RD 2IADB 1NLBH 3N85H 1BVKA 3HS0A 2GJZB 2LU7A 3MBEB 1IQDB 1GZQA 2E3VA 1TENA 5ICZA 3BDYL 1CXFA 2C9AA 3M1BB 5SX5K 3U30C 3SDYL 2HKHH 2R1YB 4MD5B 3NIDE 1MFDH 1C1EH 2CDGA 3HMXH 1IL1B 4KROD 3LD8C 5CS7A 4FTVB 3VJ6B 2H32A 5D2NA 1IRAY 2X89D 4F7TA 3TYFB 4R2GB 2C1OB 1F3RB 5A16A 3MOQA 4RNRB 3GSXA 3ZKQD 4UDUA 5T3ZE 4QRPE 3BIKA 4PGCB 3CVHB 1QRKA 3MACL 4ZTOL 3QAZC 1BEYH 1DQDL 3CXHJ 2KL6A 5DD3H 1X7QA 4WVRA 4LCWE 3P11H 4PREB 5FA4B 4FQ1L 1RZJL 4R8WL 1YNTA 3RAJL 3L5XH 3H9YA 1KJ2B 4LAJH 3ZDXE 5HDOA 2NR6D 4L8DA 5D1QD 3DROA 2ICWB 1W2KT 4I3GA 2BFVL 1A7PL 2PXYA 5D7SH 4IRZH 5KBNC 4BJLA 4DN4H 2WP3T 9CGTA 5B21A 5JQHC 3LAFA 2HLFC 1JK8A 4K94C 3TBYB 4EDXA 4BZ1L 3FOMA 1DN2A 5KSAA 3MCKB 1ZLVK 1P4IL 4TSCH 1U3HD 5BZDA 3S98A 4M5YH 5ANMA 1WIPA 1WIUA 4HHAB 3IGAA 3RJDA 4N8CL 4K3EH 5E2TH 2VISB 5DLMH 3QDGA 4WJ5A 1BJ8A 1BLNB 1ZVHA 4NJ9L 4TYUA 3NMEA 3RGVA 5L88H 3OWEA 3RU8H 5DRXB 1C8PA 4PLJD 4PRIA 5E94A 5DK0B 2ZUQB 1G7MA 4ODSH 5C0ND 1YEIL 4LL9A 4A2MA 2Z92A 4F2MB 2AK4D 2RCSL 4MZ3A 4DKEL 5AG8A 5B4MC 3BT2H 4GG6A 1MCSA 3MJ6A 4PTUB 4HUMB 5KOVC 1KJ3L 4HLZG 4H1LA 4NO0A 1N59B 1IKNC 3KPRB 3OAUH 5LGHL 2VXVH 1SHMA 4YXHL 3R06B 1FO0L 2DQGH 3MPCA 1RUAH 4U0RB 1L0XA 5IT2H 4LPXA 4YAQB 1CQKA 5CKAA 5DJAA 2YZ1A 4F15B 4LPWA 3WXWH 3SY0B 2Q8BH 1CFSA 1YYML 4LOUC 4ZUWB 1ZHBA 1ROWA 4FQQB 4KDWA 2FJFB 2R2EA 4X7EC 5EO9B 3RA7H 5TDNA 1VFUA 4CU7A 4H8WC 3RVUD 3TWCH 5IB3B 4MWFA 4PRDB 2P7TB 3QA3B 3SGJC 2YUWA 1WAAE 4C83A 4NQED 3KJ4B 4M7LH 1E4XI 1SMAA 3QG7H 4NZRH 3UTQB 2AI0H 4MA8L 5MERB 2DD8L 3T77B 4PLKC 5DUML 1WQVT 1DQML 3F7YB 2W9EL 3R4DA 3DETD 4E0RB 2E5EA 2X1OA 4Y4FB 1T4KA 4JZOA 1LQSR 5JXEA 1OTUC 2RHEA 4U7KA 1ZTXL 2BNRA 4MD4A 1A3RH 4Q74A 1CFQA 2BSRB 3BXNB 1AFVH 3BDBA 2VR4A 3ZE2E 5F1OB 4KXZI 4LSUH 5ICZB 2NY4C 5J11B 4YE4L 3ILQC 5D7JC 2CK2A 4FTVD 4PBVC 3EZ8A 2QV2A 4PJIE 1SJHB 4R2GD 4YNYA 1EO7A 1DQTA 1OAYH 2VQUA 3MMEA 4WV1A 3GUTA 4BFIB 4KJWD 3HPLB 4GSDH 3L3KA 4X8XA 1PDKA 1H8OA 1H5BA 3V5KB 4MXQD 2EXYD 3RWIA 4X80L 1RD6A 3DX7B 5F71A 1CDBA 4K7FB 3JV5A 2F58H 1JGUH 3MV9A 4MSWB 3GJFK 3SJVE 1DZBA 1WCBA 3ALWA 5CCKH 1EERB 4UDUB 4NQXB 1I9JL 1KNOB 2N7BA 1MQKL 2FX8H 1OAQH 2VC2H 2AJVL 5EOCL 4P4KB 4QNPE 4UIKH 5F7MC 1N4XH 3W11D 4OB5L 1U8JB 5JW3H 4J7RA 4HUVA 3GZKA 4G6KL 4OJFH 4LLQB 3T0EB 2WLZA 2W07A 1QBLH 4Q9BA 3IDJA 2CLVA 4X6CE 4MLSA 4X6DA 3FT4B 4JEGB 3K4AA 1OAXH 5CJ8A 1JK8B 3BZ4A 3HUJF 2G60L 2NNAB 2APFA 3ABZA 3R0NA 2X44D 2YD6A 5LQBH 3V4PL 1HSAB 1CS6A 1OY3B 1OWRM 1OARH 1YYLL 4YX2L 5ANMB 2AGJL 3VGGA 2A77L 3QDAA 2VXUH 3HC3H 1YUHB 3GSWB 2VL5A 3HLAA 1FLRL 4M9PA 5FOJA 4X4MA 5C0DA 2C3VB 2KZ1B 3QDGB 3D9AL 3ZYOA 4LASL 2OXGA 3BRDA 1MCWW 1TJGH 4KKCC 3CMGA 2R69L 4NO3B 1T0NB 5EDXA 3F7VB 2V2TB 1NAKL 5EZLA 4QKXB 1YY8A 5I9QB 3KPRD 5F7KC 1IGIL 2FEEL 5TDOA 4AIOA 4JN1L 4K3HA 4M43H 2NYYD 1TJHL 1SBSL 4NOBA 4P5TA 5IR1B 2VAAA 1JRHL 4HG4J 1UKTA 3FAWA 2OL3H 1CDIA 4JN2B 2NW3A 1PKOA 1F5WA 4YBLB 1OT2A 1QKZH 3SDDC 1M05A 4EVNA 1YY9D 2I9LA 4X98A 3NGBB 3IRPX 5DD5L 5JW5A 4YFLF 5L2JA 4M7ZB 3THML 1DANU 5CMAA 4XAKD 3V5HB 3IVKA 4LEXH 1M7DB 2VLKB 4X6CF 1L7TH 4OLZL 3NCFB 1HCFX 1XGQB 3BUYB 5ACZB 3O6ML 4RGOH 5HGGS 1FZJA 3ZE0E 4HWBA 3VFTB 4ZFOL 3RPIA 2R2EB 1MREH 4HJJH 3G6DL 2DIAA 3F62A 1NL0H 3ALXA 3PWUB 4GUPA 3BQUC 1QA9B 3C5ZA 2BC4A 1XIWA 3HE6B 4Y4FD 3U48A 2VE6A 5DR5L 3T08A 1H0DA 3HMWH 3HNTL 4NZTL 3DLQR 1F6AA 3MRBA 4Q6IC 2DDQH 1XF2B 3BSZH 5GRWA 1A9BA 4DZ8A 1B2WH 1C5BL 2OQJA 1BQUA 2LU4A 4OI9A 3P30H 4GKSA 1IAKA 4BZ1H 1IAIL 4G8IA 4BUGA 4LRIA 3MNWB 1RZFH 4XNYL 1ED3A 4HKXA 2A6JB 3S3PA 3BP4A 4ONHA 3NH7H 4JO4L 4LNRA 3QUYB 1YMMA 4P4RB 4LAQL 4UV4L 3ARBC 5F21B 5ID1B 2YSSA 1A7RL 5CD5D 4YNYB 2H45A 7FABL 3RY5A 3WSQL 1Q9LB 5IQ7H 2OZ4A 4Z76A 1Q94A 1AXIB 4L4VA 5C07E 2P8LB 1ZLWK 1V3LA 3FO0L 2BDNL 3HAEH 4NRZB 4P46A 2RCSH 1ZANL 3RJQB 3PIQA 3JWDH 1HKLL 1S8DA 3LKPB 1IGJB 3QI9B 1A6VH 1DN0A 3RKDC 1DSFL 3E2HC 1L6XA 5I73C 1NDGA 3JV4A 4Z6AT 3SGEI 3T0ED 5LGHH 1P7HL 2NY5H 4M7KL 2KBGA 4N0CD 1FO0H 5IMLA 1MI5B 4N0UE 2P8PA 5F3HB 5FAAA 4OLXL 3IAPA 5I19L 3T1FB 1I1AB 1D9KA 5JMOC 1FDLL 1FORL 2VO5A 1DBJL 2CLVB 4XCCL 3VXPB 2WW8A 4X6DB 3P2TA 1X5KA 3BN9D 3DPBA 1FN4A 1K2DA 2FZ3B 5TE4L 3GSOA 5BXFA 3BAEL 2CPCA 3MOBL 3GI8L 1TCRA 1BD2A 2O93L 1JPGB 1R5VA 3KR3H 1NFDE 2Y06H 3QDGD 5T1MB 4JO2H 2ZZUT 4MNGB 5EZJA 5KANG 2WK2A 3HR5A 1UJ3B 1V8HA 3RGVD 4NZUH 2CLZB 5C0DB 3U0PA 2OR9L 5DUMH 5C0AB 3NACH 1M7IB 1KB5A 2W9EH 4KTDL 3ZKXB 5MENE 1DCLA 3ME0A 2VLJA 3OJVC 2B4CL 4G8EB 3HA0A 3TO4C 4Q6YA 4N9GA 3U0TA 1Y18A 1ZTXH 3RTQC 1QSEE 4Y8AA 3KNBA 3WCYA 1IGCL 2FD6H 4YHLL 2UVEA 5IVXA 2XTJD 3NCYS 3MXWL 2DICA 2ZKHL 2NXZC 4EVNB 1DVFA 3ZTNH 2VLKD 4X98B 4YE4H 1LILA 3PGDA 4YK4B 2JCCE 1U8KB 1CN4A 4M4PA 1TQCB 4MMZC 1CD1A 1H3PL 4L4JA 1FH5L 4YDJB 1AD9A 2AABH 4Z0XB 4FA8A 3MRJA 3B8SA 3VW3L 3AREA 2GJJA 4U1SB 4G8GE 4LSVH 3UYRL 2V7NB 1FFPA 3HE6D 5I17A 2D0FA 5C09E 1NFDF 4AQ1B 1NCDH 1MQKH 2BC4B 2F8OA 3IXAB 2YR3A 1W0VB 2X4NA 2Q6WA 2XQYG 4KMLB 4U1LA 3PE9A 4LBEB 2RR3A 2C5DC 5CD3B 2EKSB 5JXED 4G6KH 3RY6A 1EO8H 1P84K 1EUUA 3H42L 2GYSA 3MROA 3BMVA 1G1CA 3WV0A 4KY1L 1CE1L 2YK1H 4PJ8C 3F12B 4QRSB 4FFVC 3WFEL 4LSPH 4PY7A 1RUPL 1IAKB 1J05A 1WBZA 4G8IB 1OW0A 3BW9A 3LHPL 3BUTA 4KK5D 3O9WB 2AGJH 3LN9A 3IYLW 1A6ZA 5FGBC 1VADA 3TBWA 3NABH 1ZV5A 5JDJA 4JRXA 1YMMB 4EDWH 1OCWL 2OXHA 4N90E 2H2PC 4LASH 5LGJB 3PG2A 1RMFH 2OI9C 4G9FE 4RMVA 2YMXH 1CLZH 5DQJA 3MV9D 1S7UA 1KPRB 3SCMC 4JFDB 1TPXC 4XMLH 5GRXG 3QI9D 5EFIA 3M8OL 1HHKA 1WBXA 1UWXK 3D3VB 4QXTA 2X5PA 4Z7WA 2Y4SA 3V0WL 2J3SA 5K59F 1CCZA 1OF2A 4FFZL 4XB7A 1MI5D 1TJHH 4G9DB 4JQIL 4XNZB 5J12B 2C3XA 4UNUA 3S35L 3O6FA 1NLDL 1HYRC 3B9KC 1I1AD 4G3YH 4IMLB 5JW4M 1XGTA 2ARJB 2V5SA 2F8VA 3VG9C 2J5LC 4NKIL 1F3DJ 4P5KA 1BMGA 1F4XH 3AMKA 4LCCA 4J23A 3L9RA 3I3BA 1D5ZA 4X0KB 3UZQA 1FG2B 5EU3A 1MCBA 4OV5B 3PGFL 4M7LT 4PJXF 2ADJA 5DC9B 3DIFA 3O4LA 2HVKB 4N68A 1DBKH 1HQ4B 5CBAA 4MQXD 3T09A 3G6DH 5B39G 3WO4B 4ZFOB 5I1LA 4GBXA 2UWEF 4WEBL 4HUUB 5F1IA 1T6WA 2X09A 5EZJB 1B6UA 5C0AD 2VTFA 4Y5VB 2QEJA 3EJYD 5E9DA 4MQSB 4NQVB 5HDLA 1CFTA 3NFSL 2DI9A 4EBQH 1IFHL 3KLHD 4OF8A 2VLJB 4DK3A 2OR7A 4YFEA 4ZSOE 1KV3A 5J1AB 2EE3A 3MRMA 3TA3A 4N9GB 3VI4E 3C60A 3I3EA 5L2KA 1JHKL 1ZSDB 1DUYB 3KNBB 3P77A 1KTKE 3U4BH 3S6CA 4ESKA 5E2VL 5HHOB 1ZOXA 1KGCD 1XGPA 4MXWH 5H94B 4I4WA 2QKIA 3RWCB 1RIHL 4KRPD 2H41A 5J8OA 4EI5B 1UA6L 2XWBB 3DX8A 1U2HA 2K7QA 4KVNL 1K4CB 2NY1C 4K23L 3MRJB 1F11A 3PQYA 4UQ3A 5GRJH 5MHSE 3C5ZD 5IROC 4H8WL 3SOBH 1S7SB 4RGNE 4PJCE 4YXKL 2I60H 1NCCL 1JPSH 3QXTA 1I75A 5TQ2H 4L3CB 3KVQA 4LNVA 5SWSA 2E7HA 5T1LB 5F7HA 5F9DC 3HPJA 4PJAF 1F45A 2VXSH 5BOZG 3G5YA 4M7KH 3SDAC 5LKNA 1UZ8A 5AZ2H 4NC1E 1KF9B 3OGOE 1KJMB 3D1MC 4KV5F 4CNIB 4OLXH 4ZG1A 4QRQA 1I3GH 3FB5A 5I19H 4W4OA 1FVEB 3WHE0 1FZOB 3IFLH 1FDLH