5GRYA

Crystal structure of disulfide-bonded diabody
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
231
structure length
226
Chain Sequence
VQLVESGGGLVQPGGSLRLSCAASGFTFRNSAMHWVRQAPGKGLEWVSSIWYSGSNTYYACSVKGRFTISRDNSKNTLYLQMNSLTAEDTAVYYCARFAGGWGAYDVWGQGTLVTVSCDIVLTQSPATLSLSPGERATLSCRASQSVSSNYLAWYQQKPGQAPRLLIYDSSSRATGVPARFSGSGSGTDFTLTISSLEPEDFAVYYCHQYSDISPTFGQGTKVEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of mono- and bi-specific diabodies and reduction of their structural flexibility by introduction of disulfide bridges at the Fv interface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords diabody
total genus 51
structure length 226
sequence length 231
chains with identical sequence G
ec nomenclature
pdb deposition date 2016-08-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5gryA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5gryA01
5ALCL 2FX9L 5IW6A 1LO4H 1KEML 4Z0XA 1NCTA 2CLRA 1JRHH 1JJUA 4RAVA 3C2SA 5FYJE 3RVTD 1V7NH 1NAMH 3GHBL 5CZKA 3EAKA 4MS8D 1HSBB 2YPVL 4I3RL 2BCKA 4HIXL 4ZUVB 5I1CH 1OOAA 3VFVB 2P5WE 4E41A 3MFGB 5TF0A 1P69B 3QR2A 1Q94A 5FB8B 1KULA 1MFEH 3IXTB 1J1PH 4RNRA 2IAMC 1AI1L 1YECH 2JIXA 4MAYA 1CVRA 2AK4A 2W65A 3QI9A 3BX7C 5HYJB 4B50A 4L3CA 5DMGD 1C12A 4PTUB 3UJJL 5IMMB 4ODSH 2HFGH 1AGFB 3AXLB 1MCBA 5I8CB 1VFBB 5LWYL 4V1DD 5J6GA 1ERNA 4K3EL 1ZT7A 3RKPA 1FFNA 2H26B 3NCMA 3PV6A 3HR6A 5I73C 2P7TB 4I5BA 1ZLUK 4L4VE 3SE8L 1OWRM 2LAAA 2D31B 1ADQL 3GSVB 4IMKC 4OB5H 3CU7A 4G3YH 1MOEA 5HYJD 2DB8A 3BIKB 4U6XA 1KENL 1WEJL 2QSQA 1FL3A 1I3GL 3A6CL 3X12B 3BQUB 1NGWB 3IDJB 3SGJC 5CD5D 4AH2B 4PYHA 1RK0A 5GSRA 3LCYA 3MLYH 4JPVH 1RIHH 1N7ML 2BMKA 4F58L 1MCRA 4OM1L 2C5DC 3DX9A 5IGXL 4CRPA 2YR3A 3LQZB 3QNXB 3D5OF 4IJ3B 4OLUH 3V5DB 2ICWI 4FQXB 1LE9A 4ZUWB 2WWKT 4Y5XB 4KI5F 1RPQA 2CH8A 3ZHKA 3ZTNL 1CLOH 1ZA6A 1ZVYA 3R4DA 1ZWIB 2IBZX 1C16B 1FFQA 1HEZB 4F7TA 1S3KH 3C2AL 1OARH 3PXHA 3D39B 3QXVA 3V2AR 4W70A 2VDMH 5LAXB 5BS0B 1XR8A 1HINL 1MI5D 3T65A 1NJ9A 3MBEA 5ITFA 1U8HB 2XTJE 5D72L 5B22A 3TLRA 1VFBA 5CP3A 4FFWC 4HUKB 1HHHB 4FXGB 4P46A 4OLZL 1NGYA 2C7UA 1UWXK 3MRHB 5C07E 5ID0B 2QEJA 5HHVL 35C8L 4LSRH 4WI2A 3WLBB 4PB0L 5JIIA 1BZ9B 5C0RL 1KEMH 2PYED 4WW1B 3V52L 3QUXC 3Q3GB 5D1ZC 4XCEB 3K8MA 2QSTA 1NUDA 5EBLB 3GHBH 1R3KB 3WNKA 4OZGE 1WBXA 5T5NF 4G80A 3IT8D 1R5WB 5INDB 7CGTA 1H0DB 3RKDC 5FUZL 4LPXA 1GXEA 4RZCB 4M6ML 4PLKD 5HHXL 4FQXD 4P0DA 3O41A 1PQZA 5J11C 4PJ8B 1I3VA 1JTOA 2NXYC 4UAOC 2Q1EA 1G6VK 5TGBA 2YA2A 4QEGA 4CADA 1J86A 4APQC 4E0RB 5D7KE 5DD0L 1KG0A 2HMIC 3E1F1 2IANA 4F8QA 3D39A 1MAML 2ZOKA 4WU7B 1YNLH 1FNEA 2EDXA 2BRQA 1WZLA 1XGQB 3VDBA 3VFPB 3VWKB 5IF0B 3GI8L 3HB3C 1ADQH 2ZG2A 4JFYB 3WJJA 5JW4R 1IM3B 4PJAE 1HQRA 4RGNC 4BFEA 1J5OL 1EFXB 4K7PH 3CFBA 1MAJA 4LCIH 4QRQB 1H3GA 1INQA 1X7QA 1YNKL 2A6JA 1MFDL 2QTEA 2HT4C 3DX9B 2ARJQ 2YRPA 3WD5H 5HD8D 2IH3A 3BH8A 2XPGB 2VDOL 3SDXF 5ALBL 2BMKB 4OSUL 1ZLWK 4OZFH 2FGWH 5DEFB 3TT1L 4MJ6B 4C57C 3JWDH 1WT5C 1CU4H 5HVWA 3QI9C 1FYTD 2YS4A 2C3GA 5IGXH 3FQUA 4XC3L 3DUUB 1G7PB 4ZFGL 2EH7H 5JTWA 4Z7QE 5SWQB 1KCSL 2W38A 3SKMB 2ADFH 5KW9H 3G6AB 2HT3C 3ARGA 1CTNA 4QXUH 2DKUA 4YHOH 4R96B 3RX5A 4MZ2A 3DX6B 1DBMH 4J7RA 1JGVL 2EDKA 3SCMD 4KV5F 4LCWE 4OLWH 4NBXB 2BOCA 1MCEA 4JRWA 1NBZA 2ORBH 3HCVB 1KJ3L 5E6ZA 2GFBA 2VZSA 3MV8B 4G9DA 4XNZC 4Z7VF 1VERA 3W82A 4HMEA 3G5ZA 2NTSP 4NRZB 3KXFD 1J8KA 4UMGA 3GZKA 5LWYH 3E3QC 5JXAH 1S7RB 4HXAH 5DJ0B 2MHAA 3QIUA 4JM2C 1RJYA 3MRIA 4S1RL 1A5FH 4ZXBB 1E4XL 4FQ2H 3JSSA 2CDGA 3QPXH 2P8PB 4FFYH 4GQPH 5TH2A 2NY1B 2P8LA 1LEGA 3DYOA 4YXLL 1A14L 1BECA 1WEJH 4N9OB 4X9IA 4YHIA 5JUEL 5BQ7A 4WWKB 3RWCB 2ICCA 4DKFH 4JRXD 2C4FU 4HKZB 4OKVA 2BNUA 2Z93A 4XP4L 4PJ7F 4X0KA 1JNLH 5C0BD 5CCKL 5JZ7C 3VH8G 1MCOH 1NQBA 3CX2A 4AEEA 3OXRA 5I1GH 3CGTA 3GO1L 1SYSA 3QUZC 4XC1H 5C86A 1EBAA 1Z9OA 4M6MH 1CCZA 3L3JB 2EDNA 3ECBB 3F12A 1AJ7H 1BQUA 2BSTB 4JDTH 1MIEL 3CVHL 1NMBH 2PR4H 1CZ8L 5B21A 4MB4A 5HHMB 5BRZE 4ZQKB 4P3WA 4R4NC 3BPNC 4GMTH 3KPNB 5BVJB 3MRBB 1KTLA 4GRLC 5CILL 4OLVH 4JZJB 1D6EB 1B6UA 3BKCL 5FK9A 2Q86B 4CNIB 1S7WB 2FECI 4RISH 2YPKA 4JZNB 5LBSH 1AO7D 1LO3H 4Z18A 3NFNA 2DJ4A 3BAEH 2G2RB 5IVZB 1L0QA 4NCDA 4BJLA 3QEQB 4WUUD 1FE8H 3GMRB 4PGCB 4GXUM 1JF5A 1MFDH 5FK9B 1JPSL 5BV7H 1M7DB 3T3ME 3OJVC 1WC7A 1SJEA 1UXSA 3GSNA 3QQ9D 4IRZL 2BRRL 5DQ9A 3QHZL 5FFLA 2GTZB 4NKOB 3V52H 5IHZB 1MQ8A 2YUVA 5F7NC 2WANA 3VFTB 4O58L 1IFHH 2BSTA 4LMQI 1IM9A 1G9MH 1ZVSB 4GSDH 4NDMA 4PJ5D 3S9DB 2E9WA 3OJDA 5DWUL 2HFEB 4Q6IC 3JUYA 5JXED 1D9KA 3L7FB 1U8IB 4M7JH 2M2DA 1V5JA 4FHBD 5GJTL 3MLZH 5EBWB 1CG9A 2HVJB 2R2EA 4QRSA 4DEPB 1T5XA 2QSCH 2Z93B 2A38A 1G9MC 2DMKA 4GKOA 4XP1H 4X4YA 1C5DA 1J87A 4K8RL 3U0WH 3SDAB 3SY0B 1S7VB 5IW1A 3WIHL 4XNXL 4OD1H 2P8PA 3G08B 4PREB 3WXVH 1P7QB 4P2RE 3SDYL 5JQ6L 4PJ8D 1EZVX 3S36X 1D5IH 2Y6SC 4ZTOH 3VFOA 1YC8A 3EOYG 4D0DB 5TGBB 1HKLH 4NQCE 4G8FA 4Z0BL 3PDGA 4GRLD 4MLIA 4X4YB 2BSSA 3OSKA 3CVHH 3BN9D 2BERA 4XAKD 1U8JB 3ARSA 3EO9H 4GG8B 1MFBH 5EC2B 4PJ9A 2HRLA 1KXTB 3F7VA 4AEFA 4Q58C 2DQJH 1AKJB 4WW2A 1TJHL 2OI9C 4EI5A 5HHPB 4K9EH 4LSVH 3EOAB 4JO2H 4LF3A 4NDMB 1JNLL 2G60L 5BO1L 3M07A 4HPYH 3H7LA 3T3PE 1GGCH 1IEAA 2R0KH 1A0QL 1PGRB 5H37G 1TZIA 4BSVB 3VRLE 4JJ5A 1K4CA 1Z5LB 3D9AL 3NCYP 3DX7A 2VNCA 2CDEB 1ZA3B 3MYZA 4M8QB 5FO9A 4PJCA 1KV3A 3I02A 5BV7B 1MLBA 4I0PC 4XB8A 2BNRD 1WIOA 2VKXA 3KS0J 3WS3B 4N90D 4XBGB 1VA9A 5AD0A 3IFPB 2V9RA 4WIQA 1S7TB 2RFXB 5M95B 2FEDC 4WHYH 1Q0XH 5C0AD 3KPLA 3F7YB 3LEYH 2G5BA 5HHOB 2EZ0C 1L7TH 3CCHA 3VI4F 3F58L 3U7WH 3PABB 1SM3H 1CLOL 3IDGA 4HUUA 4KJWC 2VXUH 4XWGL 5E6IB 1Q9OB 3H9SB 1UEYA 1P84K 1A7NH 5L9DH 5TJWK 1XF3B 1BAFL 4KRPD 5IB1A 4OUOA 3EKCA 1FGNL 4BA8A 3DMMA 4KDWA 2X4PA 1F3JA 1JK8A 4N8PA 3D25A 2LU4A 4ZSOA 3DMMD 1OAZL 1A14H 5C2BH 4YQXL 1ND0A 5TFSH 15C8H 4JFZL 4GBXC 5C07A 3IDIB 4O58H 5B3JF 1J8HB 3P4MA 3ZSTA 3O6FC 1HXYB 3SE4A 5F1SA 4MJ4A 1P5UA 4CUCA 2NW3A 5TQ2L 4PJAA 4JQVA 5I1IH 1T1YA 3INUH 4Y4KA 4Y5XC 1VFAA 2OTUB 2MKLC 1X44A 5FUOH 1I1AC 3T1FB 3WS6C 4DVBB 4JG1H 1OTTC 4FABL 3IDYB 3MNWB 2HKFH 5BZWA 4DK6A 1X5XA 1N6QL 4KAQL 4JCMA 1E4WL 3U0TB 5IIEB 4Y7MA 3ZKQD 4PB9H 1DDHA 2D7QA 2F74A 4PS4H 4I3SH 5BJTB 2AS5M 4WFEE 1DLHB 1NEZB 3CFDB 3G04A 4ODWB 4EDWH 2R0LL 1OD9A 4F2MB 3JWDC 3GSOB 1BZ9A 4MA7H 4DGIH 1QKZL 5DYOA 4K3JL 5KVDH 1INDH 2GSGB 5CGMA 4POZC 5INCB 4MA1B 2V5RA 1JPST 2AK4B 2VDPL 3ILPB 5LBSL 4KKBD 2LE9A 5DYOB 1PEWA 2A74B 4XH2A 4CW1B 5I66B 4L29A 3W9DA 3B2VH 4U1KB 5E1AB 4ZO6A 5KS9B 3RVVD 2R1WA 4HWBH 2LTQB 1LO2L 3F6LA 4OUUB 1IGIH 4R4FL 4UIKL 3DLQR 3T0XA 1XGTB 5A2IH 1CGSL 1TVBA 4P5KB 4OCLC 3FTGA 4JFEE 4UDUB 3U0TA 4HQQH 2VLJB 3LEYL 4L29B 5CJBA 4KRPC 4F7TB 1GHFH 5BCAA 1ZVHA 1NCBH 2PXYA 2M8XA 3NIFF 1GAFL 5F3BA 2WLZA 4Y4KB 2NY0C 5A40E 4NZUL 5GGVH 5I1AB 1MNUL 5D1XA 2Z8RA 1AQKH 2FR4B 1DN0B 2V2TB 4S1SL 5IWLC 3P4NB 2CGRH 3CVHB 2PW2A 4QHNA 4MQ7B 3MXVH 2AEWA 3SGEH 5D5MF 2UY7A 2DQGH 4P57A 5DWUH 5JHDD 5F9WC 5I16A 3HAEH 1AP2A 2F74B 4JFFE 5BJTA 3NN8B 5C7XH 2GY7B 1XIWD 5J6HB 3C5ZB 1ONQB 1EFXA 1NLBH 5F6HJ 2X4PB 2OK0H 4LLWB 5GSRB 4HEME 2NQCA 2X70B 3MREB 3C5SB 3MOAH 4JQIL 4OFYA 2CJUH 1AD0A 2AXJA 2OTUA 4Z95H 5E2TL 1RJLA 1MJUH 1XCTB 4JM2A 3TIDA 4B0MM 5IBLD 3P4MB 1QSFE 4DFHA 1KG0B 3VFWA 4M93C 1ZLWH 2PKDA 2YD6A 1D5IL 3OX8A 1YNTB 4RGNB 5I8OL 2ZJSH 4HC1A 2J8HA 3VGGA 4Y19E 1SEQH 5EU5B 4TUKL 3SDAD 4G8IB 4P5TB 1AGFA 4L3CB 5E99L 3I02B 3WUWA 5F7MC 1Y0LA 2HJLB 3QUZA 2R4RH 2JLLA 1I1RA 4I4WA 2DI9A 4KPHL 1S9KC 4X8XA 4FZ8H 3HTLX 2JJUA 3REWA 4U1IB 3DYMA 5F9JA 3U46A 2FD6L 1FPTH 4R6UA 3TO4D 1RD6A 4E9LA 1P9MA 5HHPA 2E6QA 4NNPH 1RAMA 5J57B 4WO4D 3B8YA 2DM2A 4E41E 2PUQT 4BQ6A 1ZMYA 4FTVE 3I84A 4XI5D 1DR9A 2R1XA 2CKBL 5I1KH 2C7UB 1F00I 3FQNA 4Y4FD 1HHHA 4TSAH 4YHMH 1NDMB 4HKBA 4HUXA 3HPJB 3F7RA 1OAKH 1N59A 2AI0L 2NY7L 3BZFB 2DIJA 4YBHA 4TSCH 3WHXA 3LMJH 3WMSA 5AG8A 1N26A 4JPKL 1NCNA 3DRQB 4QYOB 5LGKA 2JTDA 4KK5D 1WISA 4P4KD 4YE4L 1BAFH 4JQVC 5I74B 1UQSA 1FAKT 1G0XA 3T0EB 3ZE2E 2VABA 1JPGB 3VWJB 3RUGE 4ALAH 4JN1H 1EFQA 3ME0A 5HYEA 1IC1A 5HGHB 3QNXA 4XVUC 4QYOA 1IGFH 5EH1A 5I15L 1QR1B 3ZKNC 2HT3D 5IJVB 2BOBB 4PJFB 5IMOB 1CQYA 3FCTA 5JPMB 3KXFA 3OGCB 4QF1B 4F37F 1N59B 3DETC 1KELL 3ILQD 4XAWH 2ZKHL 1FZJA 4PRAA 3ZT6A 1T83A 1DEEA 3FQNB 1PLGL 3LN4B 2A83A 1VEPA 1Z9MA 4FG6D 4O4YL 3UJJH 3UTTD 3X12A 1F4WL 4P9ML 3FZUD 3HLAA 5D2NC 1A2YA 1TETH 3GIZL 1J05B 1UM6H 4NNYA 5DK0A 1XF1A 4M00A 2J6EL 2Y6SD 1I8IA 1JWMB 4Z7NF 2X9WA 2VR9A 4H0GA 5J6GB 4OKDA 2I07A 2X40A 2LTQC 3NVQA 5IMMA 5E2WH 2OYPA 2HFFA 1LE5B 5D8JL 4F33B 4NHUB 1U2CA 2EKJA 1LO5A 2DF3A 2R8SH 2W0PA 1ZHNA 4KI1A 5F1OB 3LKOA 4NO0B 1UXSB 4X6EB 4LHQB 1WC7B 1DUYB 3Q6FA 3O81A 2VLLA 4IMKA 4D9RD 3WFDH 2I07B 1UZ8A 1S7XA 3U30B 3VXQB 1KF9B 1ODAA 4OLUL 1JBJA 3P77B 4OGAD 4NUJB 2FIRT 1A4JA 3BDBA 2GI7A 5HXMA 3ROLB 4EIGB 1GGBH 5DFVD 4NRXA 3UTTE 1SYVB 1W2KT 5CD3B 2YPKB 5IB2B 5F9AC 2N56A 5JA9A 3DI2B 1KJ2L 2FB4L 3DVIA 3Q6GL 4RDQF 2W1NA 1E4JA 4LAQL 5GZND 1GZQA 4NZTL 3HA0A 1GGIH 4PP1D 3P9MB 3LQAL 3W0WA 3RZCA 1HSAA 5GGQH 4KKNA 4DKDC 3O3DA 3R1GH 4MNQE 1BQHB 3T4YA 1T03L 3KXFB 3LIZH 4ONFH 4FXKB 5HGAA 4OCMC 1CBVH 1BX2B 3D0VB 4KFZC 1AC0A 4OFIA 1ORQB 3TJHD 2YZ1A 3W0WB 3LAFA 3OXRB 4PRHB 2NY4C 3WKNA 4JGJA 3PWVA 2VQUA 1JWSA 4PRIA 2B39A 1CLCA 2VRAA 1FH5L 1JPTH 3DURB 4OFDA 4WWKA 3RWCA 3QIBA 4ETQA 4X98A 4FTVD 3TJEH 5HBBA 1F8TH 1N6VA 2ZCHL 4X6CE 4N8VA 4XMKH 3SGKA 4HD9A 3P77A 1P9MC 3B3IA 4RFOH 1J88A 5IQ7H 5E1HB 4MWFA 3EYUL 3QDJE 2P5EE 2CDFB 4Q9RL 4U1KA 5KS9A 4Y4KC 1H5BA 5GRYA 4G42B 2JJWA 1QFWI 2MCPH 4PRBA 3WS6A 4CU8A 1NAML 3MCLL 1J0IA 5ESVB 3PWLA 4X8JB 3O2WL 4FFZH 3L3HB 1WIPA 3QUYA 3ZDXF 1IQWH 2G9HA 1JUFB 2K9UA 1G7MB 2HLFD 5ID1A 4O9HH 5DFVC 1J0YA 1DANT 3BIAX 5GGRA 2DBLH 2LVCA 3BP6A 2NXYD 1BZ7B 4KGJA 1MJ8H 4NUGL 1J05A 3IFNH 2H1PL 1VB9A 3FO0L 5C8JB 1HDMA 3BEWB 2GJ6E 3S34L 1QA9B 4X5WA 5TDNB 1AGEA 4APQA 4X4ZA 3DROA 2AXFB 1W0VA 1B2WL 3ARDB 1CE1H 5HSFA 1P84J 1T4KA 5CEXB 1BPVA 4ZS7H 3QNZB 3MJ6A 4P2OB 3VW3H 4J6RL 1TLKA 4U7MA 3RY6A 2F54B 5FM8A 2VXQH 3MRQB 3K74B 4RQQB 4PJXF 5D1XC 1U0QA 4P99A 4AEIH 4NCC1 5IWLA 1FORH 2UZIL 5DVLA 4C56B 4BH8B 1K4DB 4WGVB 1FDLL 1EVTC 4MHHG 5FCUL 1YN7A 4C4KT 1YDPB 3MJ8A 4G80B 4LPUA 3NN8A 3HNSL 5DZOA 3MLPA 1G7HB 3T0VA 5T1LA 5FO8A 4HXBL 4ZNEE 1KN2H 5IEHA 3RGVA 1NANI 4XHQA 4NZJA 4HWEH 3WIIL 5EU6E 5GIRA 1KNOB 1R3IL 3FO2A 4WTZA 2AKRB 2Y23A 1J0JA 4HMDA 1AQDB 4FXGA 4LPYA 4UTBL 2EDWA 3BESR 4KGLA 2XICA 1ZEAL 3ZSSA 5A3IC 5KBNC 4XCYA 4MHHI 3W81A 1QPPA 3NFSL 4NN5C 2FHBA 3I50H 4U33A 2VSDA 3RA7H 3V0WL 1DVFC 2EEAA 4OIAA 3ULUL 1YN7B 3R8QA 4UAOB 1D7FA 3FAWA 4BH8A 3O6KL 3MJ9H 1MRFL 4XPHL 1PSKL 2ESVE 1U8OA 2DQUH 1P1ZB 2I25N 4RA3A 4YHYB 5CJOH 1OPGL 3ES6B 4JHWL 3SKNA 2IAMD 3LY6A 4FQHA 4HZLB 4K71C 5IMKA 1JZ4A 1AD9A 4POYA 2CMRL 1J10A 3IFOB 1D5ZA 4WO4A 5AYQA 3ZL4L 2P5ED 1FAIH 1DBBH 4Q9QL 3G5XB 1QLFA 3C09B 4WY7H 2X09A 1RK0B 1X5LA 5GHWH 3KS0H 3KR3L 4PRPA 4LU5H 4JHAH 1BWMA 1JGLL 4JKLA 4AENA 3MFFB 4W4NA 3C5ZA 2NXZC 4XCCL 3FN0L 3RI5F 4K7FB 5FCUH 4I2XE 3PV6B 2NY2C 4OCWH 5DRXB 4P5MA 3S36L 2Y06H 4NQDD 3L3GB 2AQ2A 1BFTA 5SX4H 4IIQB 5HHVH 2AAVA 4GO6B 3RWIA 1D5MB 3QWOB 2ED7A 3RGHA 4OT1L 2F5AH 3DV6B 2H32A 2GK2A 4X8JA 1KLUA 5FKAA 2R29H 4HJJL 4ERSL 5ADPH 3KLHC 3ALXA 3N1MC 4IHOA 3L7EB 4U1GC 4ZAKC 3VFSA 4RNRB 4X6DE 4O2EA 1M7DA 1YJDC 4TSCL 1LWRA 4MQTB 4P5TD 4C59B 3H3PL 3U36B 3BKML 2VDOH 1WZ1L 1TJGL 3NZ8A 3PABA 1XGTA 3CCHB 4YK4B 2R23B 3MRNA 4XCYB 1QSFB 3HC3H 2I9TB 4QOKE 2VZOA 4X98B 2Z8SA 4DZBB 5I8EB 3TVMD 5FM4A 3RDTA 2MWCA 2Z8VC 3AXLA 5KOMC 2Z8WC 4Y4HC 5FYLH 2BHYA 3MRRB 1KJMA 2J8UF 1H8NA 5IW6B 1IVLA 3F7PC 3OL2A 3NZHH 3WIHH 2Q6WB 4OBRA 4QRUB 4M3KB 1R3JA 4LSQL 2VJXA 2IPKB 3NPSB 3P4LA 1IGCL 4YGVA 4L9LC 1FYTA 5HGGS 4WEBL 1WK0A 3AS0A 5JR1H 4JREC 4D9RE 4HH9A 4HBQA 3TNMB 3T0WA 1UACH 3WXWL 1JHTA 1KYOK 4HUVB 2EEDA 3RZCB 4XXDB 1Q0YL 5A3ID 4ZOEA 4Z9KB 4YBQC 3HHRB 3CDGB 3SPVA 5JNYA 1PYWB 1XGPA 3GIVA 5D5ME 2JJSC 2NY5H 3CXDH 1T1YB 1UM4H 1FLRL 2FWOB 2IQAA 1J8HA 3QIUD 3MRLA 3UBXI 4UDTA 4PGDB 4UTAH 2YN5A 1GVIA 4NZRL 4O51B 3WKML 3HI6H 1PZ5A 1T21A 2NW2B 4R0LA 3QCTH 2AQ1A 2H2PC 3DUHA 1T0MB 1PG7L 3VFNA 1TCRA 5IQ9A 5LQBH 5HHQA 5I19L 1ES0A 3VXSB 4G6KH 2EE6A 3WBDA 4KMTH 2SEBA 5DS8A 3A6OA 1XF3A 2GEEA 4PP2A 3LKPB 2FIKB 3B6SB 3OJMB 1XGYH 2BK8A 1NBZB 1BFSA 1IGJB 2PCPA 5F7WC 2B1AH 5KS9E 3E2HC 4ZUUB 3W9EA 1X5KA 3VRIA 2GT9A 1I8IB 2J12B 5DFTA 5F6HI 1TNMA 3GNMH 4OZFG 5D7LD 4GG6A 1S7TA 2RFXA 1DVFA 4U1JA 2QLVB 5AZ2H 5D6CA 4JKMA 2DYPA 1DEDA 4O5LH 4M02A 3S96A 4NQDB 4MNQA 2WBJC 4ZXBD 2L7JA 4WWKC 5DEGB 3GSNB 4QHUA 1UCBH 3OKEB 1PZUB 5J4MA 1OHQA 3QDMD 3VI3F 5L8LB 5MI0C 3U83A 4EI6B 3O8XC 4U1JB 5CMAB 5LGHH 2APWA 1YEJL 4GG6B 5JPMA 5JIHA 2VL5B 2ZUQC 4NT6A 2OTPA 3DSNA 4WO4C 2CSPA 2GT9B 2V7HA 4OIIL 4HLJA 1I3RA 1S7SB 4QRRE 3QDGE 5FUCE 4K3DL 3ELAT 5CCKH 3DMMC 4WW2B 3WDHA 1JPFA 3PDDA 5FYLE 1BVZA 2H9GB 5DMKA 3TO4A 2EDLA 1RUQL 3OAUL 1UQSB 2DLGA 5EDXA 5IUSA 4Y4HD 4ZQKA 3T1WA 5GGTA 5HHQB 4MCZA 4WFFE 4TPRH 3QIWA 2OJZL 1ZGLA 4TRPL 1T0MA 4DOHE 1DANU 1K9TA 2R0WH 4FQLH 1SJHA 1U8LB 1VGEL 2BXZA 3C60D 4NQCB 1NGQH 3KAAA 4GG6F 1A7QH 4X6CA 4L1HA 3RIFK 5GS0D 1NKOA 2Z31B 4WENB 5F8QC 4EI5D 2AV1A 4H5SA 3C5ZD 1PYWA 1XGPB 1D9KB 3L7FA 1PKQE 2WUBH 4NN5B 3AM8C 3P4OB 4LLUA 4A6YB 1J1XL 1IT9H 1QO3A 1QUNA 2FBOJ 1A4JB 3O2DL 4OZIB 4IRSB 2CRZA 3DTXB 5CLTA 2D0GA 4NN6B 4GAJL 1U91B 3G5YA 3K2UH 2IBGA 1DTUA 3VFTA 1IKNA 1HNFA 3BP5B 5KVGL 4FG6C 4X5XA 5CJQH 1AKJD 1OQXA 5BOPA 4X6EA 2FZ3A 1ZHNB 2FBJL 1SJVA 1RZJC 4YDJA 2E7LA 1QSEE 4TUJA 5HJ3A 1QHOA 4KMTL 4M5ZH 5ADOH 2VXQL 4I1NB 1CN4A 2PXYC 3FONA 5DRWB 3FB7B 5C0RH 3MRMB 2EYSA 3QNYB 3HC4H 4L9LB 1XR9A 1Z9SA 1OT2A 4L3EE 2LU7A 3UXFA 4ETYA 1I1FB 1SBBA 4JZJA 3SKOA 1H15B 3TEUA 1Y6KR 2PYEB 4OD1L 1IC4H 4ISVA 5DTFA 3LB6D 5FGBA 3HI1A 3DGCR 4U31A 1ZKAA 4PRID 4XP6H 3EDJA 4ORGA 5L2KA 1FL6A 4ODBD 2DQHH 4ZFGH 4RMTA 4U1HA 4MSWB 4YPGB 3FB8B 1INQB 2ATPB 5EFIB 5LGHL 3X11B 5IT2H 3O4LB 4GAYB 1K3ZA 3HI1B 3CH1B 4MJIB 5DMJB 3WFBL 1JGVH 5F1IB 4F57H 3PL6C 5DK2B 2QBWA 3IU3B 5CJ5A 5ESQB 5IESH 2EYSB 4NWTL 3I50L 3HG1E 2CR3A 4GXUN 1N3NA 4XT1C 5D2LA 1G6RB 4ODTL 5K9OA 1KYOJ 2HH0H 5DLML 2OJZH 4AIZA 5JXEA 3TYGL 3LRSA 2DLFH 3ZDZE 4LLYB 4IRJB 4Q0XH 3G5ZB 3HE7B 1IM9D 2EXWD 2BVTA 3RVXC 4PS4L 2BOCB 1ZE3C 1B0GA 2P47B 5DO2D 3V7MA 3WDJA 1M7IB 2VC2H 1CLZL 2DLIA 1I9EA 1SMOA 2CIKA 1U91A 3G5YB 5EPMA 5FIEA 3WHE0 3MBXL 3FL7A 4CMMA 3TO2A 2WWMC 4ZFOA 2X4SA 3MJ7B 4XCEA 1Q9KB 2C1OB 1ZHLA 1SMAA 3P4OA 5KS9F 4QOKD 3HFMH 3TO4C 4XNYL 5KN5B 4LCWB 3VFUB 4DUXA 5FYJL 2I5YL 5C9JA 5KVFH 2EE3A 4WV1B 4LBEB 2RR3A 1KBGH 3BWAB 5AEAA 5CJQL 1MHEA 2HLFC 3W11D 1HXYA 3KJ4C 1JYNA 2FB4H 4L8CB 4H8WL 3NACH 4KY1H 2VDKH 5IEHB 4UT9L 3VGHA 4ZS6C 1AH1A 2X1XR 5EO9B 3HZMA 1CD1B 3HMWL 3AREC 3RL2B 1HIML 2IFFL 5J8OA 4UILL 3CUPA 3BKYL 1U93A 4Y16A 3HS0B 4XCNA 3NIFE 1N6QH 2E8YA 3NCFB 4M1CC 4P9MH 4PRHE 4WTWA 2CGRL 4P3CL 4KROD 1KTKE 1J8HE 3FFDA 1P4BH 2RBLA 3RWGA 5SWZD 2HG5A 4WFGD 4F7MB 1I85A 1EHNA 1FNLA 4Y5VB 4KMLB 5DRZB 1LE9B 4HIIB 5SWSD 2VXTL 3IVKA 3PHOB 3P0YL 3LB6C 2DYPD 4R97B 5J1SC 3OZ9H 1FVCB 3UC0L 4MD0B 5D1ZA 1FLTX 4Y5YC 1AGDB 2DWDB 4QCIA 2X4UB 4V1DE 4XNUL 4LBEA 3QEHB 1WLHA 3U4BH 1OSPL 4ONHB 1QA9A 1WAAA 3TYGH 4GRWF 1H0DA 1HDMB 1FG2A 3BIKA 4NM4H 2P45B 3VD5A 4BFBD 5CILH 2VYRE 3T8XB 5SV4A 1TVBB 3WXWH 2X4NA 3AAZB 4M5YH 3WFEH 4OUUA 2Y5TA 1CFQB 5A2JH 1KJ3H 1TZHB 3PGCB 3WIFB 5SV3A 5BZDB 2F15A 4NYLA 3VXUA 1AHWC 1JF1A 4OGYH 3RNKB 1FNGB 1T7ZA 2ZZUT 5EC2A 2YSSB 2IG2H 1EX0A 5GRVK 2BSSB 1KB5A 4LP5A 1LILA 3MV9E 5ACMA 1EAPB 5KSUB 3CFDA 2XA3A 4MWFB 1TMCB 1DQDH 1HSBA 1YNLL 4Y88A 2VXSH 4QO1A 3VFGH 4ZS7L 4LSRL 5C0IB 4FQXC 1ZANH 2G60H 5BO1H 2CLVB 5JOFB 3QZWG 1A0QH 4NC1E 1H9VA 1OW0A 1JPTL 2UVEA 1ZWIA 5F96L 3D39E 4M7JL 2YUWA 4QRSB 4OB5L 5I8OH 1NC2D 5DUPL 4M62L 5CLWA 2AJ3B 4JFOA 5JDSB 3IDNB 5MEPA 4J4PD 4X5LA 5HD8C 4UIMB 4AEIL 4QGYA 2KBGA 3N9GH 2OR9L 3G5VA 5F7DB 1TXKA 1NCCL 4PJEB 4HKJA 4YWGL 3MBED 4F57L 5JHDA 4MX7A 3O2WH 4BSJA 1NGWA 4K8RH 1A1OB 3FN9A 1AE6H 3S37H 1A7BA 1KPRA 2GJ6B 2XWJA 3BVNB 1HH9B 1R3IH 4NKIH 2D31A 4WI6A 4I5BB 3KPRA 2H26A 2G5BB 5HHOA 1V7NL 3FT2B 3AVEA 4RBPK 5I71C 2YUZA 2ZKHH 4M7LH 4QLRA 3ZDXE 4FNLL 3M1BA 3MACL 3RY5A 3QUYC 5TE6L 5C0BE 2PW1B 1MLBB 3MNZB 2GJ6A 3BVNA 3L3IA 1FZOA 4QRRA 2AI0H 4JFHE 5J9PB 3LKOB 4NO0A 4JO1H 1INEH 2R0ZH 1YZZA 2VQ1A 2DAVA 2B1HH 5JPNA 3QWOA 2R2CA 4ORZC 4HDIB 3CJJA 4UB0H 2AJZB 4YDVB 5FUOL 4U6VH 3O8XB 5F7KC 5HPOA 4OFYD 2VLMD 1G7QA 4DKFL 3EO1A 2QSCL 1QBAA 4QRPE 4UIMA 1KACB 3QG6A 5SX4I 3MLTA 4F7PB 1K3IA 4G6JL 4JN1L 1XIWA 2BVPB 3EDDA 3GMNB 3EO0A 5MHSE 4OV6F 4YPJA 2W60B 2A83B 4XMLL 1KTRL 3B9DA 5E24E 2PNDA 1FIGL 1OAYL 3OR6B 3TBVB 5JORA 2GYSA 1A6WL 3NBNA 5BRZA 1BVLB 3KLSA 1W72H 1RHHA 3TIEB 3ZYIA 1GGUA 5IEKA 3QXDB 4S1QL 1CFSA 4YHKH 1ADQA 3HE7C 4X6FA 2FX9H 1F6AB 1A3RH 1YPZE 3B9AA 4P3CH 4CKVX 3G6JB 1UFUA 3QUKA 1F6FB 2GITB 4FQQA 4BK4A 4N0UB 3TF7C 3EHBC 3R06B 4HG4J 3LSOB 2Y5TB 4G9FD 4CU7A 5DUPH 3VD3A 4DEPC 2CKBA 3LEXA 5EA0L 3CFCH 5CMAA 3ARGB 4IMLA 2X1OA 2D4FA 43CAA 1TPXB 1U95B 3TP4A 3ZKND 3MRPA 3BZEB 3Q5YA 1JRHI 2NX5D 1AXIB 3S6CA 4ESKA 3LZFL 4OLYH 3BGMB 1WZKA 1AJ7L 5ISZE 3D48R 4UT7H 5T1MA 2VAAB 4AY0A 3SGDI 1IGMH 4MAUH 3MRKA 1FP5A 4TVPD 2V6HA 5JXEC 3W9EB 3KYOA 4XP5L 3JWOH 5FCSH 2Q7NA 1IGJA 5FKPB 3IKCA 4NQEB 4OM1H 2R2BB 5IVXA 1T1WA 3MYJA 4CN4A 5H37H 1DVFD 4DKAA 2QR0B 4YXHH 5BVJA 3WUWB 3MACH 1ROWA 5FGCE 4Y16B 2WBWB 5IJKA 4XRCB 1DQDL 1E28B 3UBXB 4KKCC 2FJHB 3KPPB 3CDYA 5ETUA 3SO3B 1R3LB 3EO9L 4N0UE 1HOCA 3VFWB 2NPLX 4NN7C 3VA2C 1DQLL 4F3FA 5IM7A 2XN9B 4WJ5A 3QZWB 2GIYA 4AMKH 4EDXA 4PJXA 5C9JB 3W0WE 4QXWA 43C9B 4L3EB 2XG5A 3LKQB 4PJCF 4NCC2 1RZFH 5IVXB 5FA3A 2EIZB 3EFDH 5FKPA 4QXGH 4RMWA 4M61B 3BWUC 4H8WC 2GAZA 2XFXA 2OMNA 5D71H 5CZXC 2QL1A 5D96C 4O2FA 4GW4A 1OGTB 5LXGH 1GC1L 1FO0L 4LCYA 3P9WB 4ZO7A 3VG9B 1B6DA 1B0WA 2JE8A 4LLYA 4KVCL 1VDGA 4MS8C 3H9ZA 3V6ZB 2PO6B 1VGKA 4M7KH 5SWSA 5E5RB 5JW4M 2P8MB 4PJIB 3IFNL 4PJHE 4XPFH 3C8HA 3GMOB 1OAUL 1NANH 2PTUA 3ZZ1A 5GS1A 5L7XH 5JO5A 3OKDB 1T04A 2P8MA 1JCKA 5E7BA 3R06A 3Q5OA 3KWWA 1I9IH 4TNVF 1UM4L 1EGJA 4K71B 4AM0A 1EXUA 1KFAL 4UBDD 1EEQA 2HLAB 2Y7QB 1PW3A 4PRHA 1NFKA 4OZHA 4Y5XA 3BYYA 4OGXL 4YIQA 4IIQA 1FJ1B 1NCDH 2OSLB 4X6FB 3PJSA 4U1HB 1HNGA 2JJSA 1GCFA 5HGBA 1BQHA 1RQ5A 3QO1A 2J5LC 3DO7A 1RJCA 2WSKA 3FZUC 1G9ML 4QKXB 1LEKB 4YLQT 1P4IL 1GZQB 5EZOH 2NY3D 3F62A 1F45A 3VXPA 4NQDE 3ARBC 1XGRB 3IAQA 2WQRA 1WUNT 2E9BA 5SWZA 4HGKC 5TE7H 4OQTA 4ZFZB 5ILTH 4YH6A 3ZTJH 3GBNH 1JFQH 2EXYD 2JB6B 5DJYA 5E8NB 4GG6E 5C0GB 1BIHA 4UV4H 4PBWD 5A2FA 1IGFL 1UZ8B 3NIGE 4HGMA 3D69A 3SKNB 5I15H 2EH8H 1OW0C 2ICES 3WXVL 3TGXA 3DGGA 2IQ9L 2MQCA 1MRCH 3AROA 4MAYC 1X9QA 2EKSB 3QBTB 4NQSB 1A9BB 1VADA 2NCMA 1J0ZA 2PW1A 1CXLA 4D0BB 4JANA 5DUMH 4JFDD 4OZ4A 3M1BB 2Y36L 3L3KB 2AJXH 2FX8L 3QO0A 1I7RB 3OKOA 4M6AA 1VFMA 4JR9L 3CU1A 5C3TA 5LCVL 3VWKC 1CGUA 4OLXL 3S3PA 4XPFL 5DQJA 2HMID 1AQDA 4YHPB 1FVDB 5C09E 3U9PH 3ORJA 1XCQA 4L8SB 1KNOA 5TF1L 1H3XA 3VI3E 1IAIM 2D9QB 4YO0B 2R8SL 4JFHD 1P7HL 3ZL4H 1T7XA 3KHQA 5CEZE 5C6WH 2NX5B 3ZKMC 1MCOL 1INDL 3OB0K 4L1DA 5EIQA 1IEBA 5JLZB 1JN6B 3T2OA 3RKDD 3MO1A 3VDCA 1UWGH 2WUCL 1JGDB 1S7QA 1ACYL 4LGRB 3TM6A 3VI4E 1N6UA 5CINL 5GJTH 2EYRB 3O2DH 2APVA 4PGEA 1MH5A 5F89B 2VKWA 4N0CD 1TZGH 5A2LH 3UBXG 4KK6D 32C2A 1KB9J 1WF5A 3H7BA 3SDCC 1T03H 2V2WA 2JK5A 3HNTH 4MQXC 2OQJA 1W0VB 3VU2A 3QT2A 1LP9F 4JO1L 2L4OA 5TDPA 3VA6A 1WWBX 4QXTA 2OL3B 3STLB 4X5WB 4GW5A 3RWJB 2FGZA 4CJ1A 1FNSH 1GGTA 3T2PA 4Z7QF 1DQQA 3P0VL 5JMOC 1JF1B 1I3UA 2KKQA 5D7JC 2P5WA 3MCG1 4ZPTA 1JGUL 3VGBA 1TZHA 3PGCA 1F97A 1T0NA 5B38G 1XFPA 2WBJB 2HVKA 2IPUK 3CNKA 1RUPH 1B2WH 3QDME 2HWZH 4GRMB 4G9FE 5J3HC 4K9EL 6CGTA 4LLVA 4JANB 1I8LA 3IXAB 2LVEA 2VQ1B 4MA8L 2YPLA 3QUZB 3IFLH 4KJWD 2XZQH 4RGOH 3C60A 4OTXH 2VE6B 1FZOB 1NGXA 4G42A 4GJTB 3IXTA 1YEIL 2X4UA 3SO3C 3T4AB 2V2WB 3VFNB 1JNNH 2ICEB 1H3PH 3VCLA 4E41B 4KZDL 2MPAH 4S2SB 2OL3H 4KJYB 2BCKB 4NFDA 1TJIL 2VLRE 4ZUVA 3RVUC 3MMEB 1UM5H 1ITCA 3CPLA 3IDMA 4XNXH 3WEXA 3HC0B 3KLDA 4HWBL 5JOPD 3DURA 2FX8H 2PO6D 3DVGB 3NMEA 5DR5H 4XP1L 1RZ7L 1AD0B 5HGDB 3WL9A 3FO9A 2X70A 4RX4D 4WUUE 1K8IA 5K59F 1A7NL 2WLYA 2Z92B 5HPMB 3DPBA 3VFRB 5CEZH 1U8PA 1RK1A 4MD4B 4JRXE 3S5LG 2EZ0D 1LNUA 3PHQB 3ARBB 5D2NA 5GQBA 1BX2A 5DRNA 4HK3J 4KXZH 1FYTB 2J8OA 4QWWD 5E2UL 4KHXL 3VXME 3ZT5A 4LHUA 3KPTA 1YUHB 1LD9B 2FATH 4PV9A 3ARXA 3FRUB 3S3SA 1WT5A 1YQVH 3FO9B 3WLWC 3T77A 4AQ1B 4F7CB 1DN0A 2Q8BL 1F4HA 4HC1L 3GJFH 1QNZH 3E8UL 4J4PC 5I1AA 5GS3A 5HYSB 3HNVL 1A6UL 4UUJA 1OP9A 3GNML 4P23A 1LDPL 1JWUA 3WEXB 2HN7A 1MIML 4YDLB 4OCSH 4P5KA 3ARRA 3MRDA 3ILQC 4S2SA 5FYKU 1N5AB 1T89A 5CJOL 3GB7A 1S7XB 1H3VA 3MGTB 1RUMH 4PD4J 5KSUA 5E8EB 4NJAL 2QQNH 3HRZA 2DQFB 4DQOL 4CW1A 2K7QA 4KI5D 3EYSL 1VGKB 4JM4H 4O2EB 3IF1B 2VMFA 1RV6X 3SCMA 5JW4N 2VE6A 4TSBL 2QJDA 4KVNL 3OKLA 4BQCA 4HWEL 1OTTD 4V1DA 1R5IB 2YRLA 4WI3A 2GFBB 3PGFH 4G9DB 5KSAB 1QFWM 3JXAA 2E9IA 5ERWB 5IVXE 4OIIH 2DBLL 2IH1B 2BZDA 2YXFA 5E03A 2HJFA 1IAIL 2AK4D 1WAAE 5CKAA 3L3GA 1G0DA 4B53A 4PG2A 2HVKB 3BZDA 1SM3L 5CZXD 3PWPD 4I18C 4P5MB 3FB6A 3QHFH 4D8PB 4PJ5E 5DA0B 3TZVC 4UNTA 3MGAA 1UG9A 3AB0C 5IIEA 4NM8H 1QQDB 1C7TA 1MFAH 4UU9B 3QQ4B 3SKMA 2P44B 4HUMB 1GGIL 3TBWA 2X4TB 4ODUA 1T66D 3UMTA 4YFDB 3VGDA 1N4XH 4XVTH 5DQDL 1DEEB 4LFHD 5EU4A 5GXBB 5I76A 1WFTA 4NOBA 1NMCB 3AMLA 3E6FA 5T1KD 4NKQB 3MLRL 4MCYA 3QO1B 3UYOD 3O4LD 3VGFA 5GS1C 4P4RA 2W0LA 1YEKL 2WIIB 4Y16C 9CGTA 5IBLC 2EIBA 3HG1D 1FSKB 2VLKA 4UNUA 5GS2D 5CZVL 5GSVB 2VLKE 5EBGA 4U2YA 1U58A 4KTDH 5D7KD 4HZLA 3BQUD 4L4TA 1EEYA 1E28A 1JNNL 4PGBA 2DI7A 1XEDA 3CFJB 1N0XL 1DBKL 1NGPH 1G9NC 2NLJB 1MI5B 2W0FA 3T2NL 3DXAD 2YD7A 4N68A 3RPKA 4BQBA 2UUDK 3IJSB 2H41A 5MENB 5BXFB 1DLFH 2Q7YB 1XR9B 4JGUA 5K9JL 4DZ8A 2LABA 4KROB 4C55A 3DRQA 2DD8L 4N5EC 1KN4L 3PUCA 2DDQH 4XPAL 4FQIL 5KAQG 5IFJA 1NC2A 4CADB 4RWHA 4P3DA 1M1SA 3BZFA 4F15C 2VZTA 3NABH 1UJ3A 4EQ3A 5DJCB 1I8LC 4OCSL 2H32H 5FDWA 5FUCC 4MNHA 2H6PA 1RVFL 3ARDC 2WM0A 1BF2A 1I4FB 4U6HB 5JR1L 4RA0C 3C60C 3P0VH 1LO3L 5T3XE 4NKDA 2E27L 3ZDYE 5GRJL 1CGTA 1F4AA 3HUJF 2Z4QB 4MNHB 2B0SL 2ICWJ 5I1LA 1MJ8L 1MF2L 3P3YA 1C5CL 2MQ0A 3F65A 3O3EB 1U8KA 4CMMB 2BJML 3REWB 1GIGL 2ZPKH 3MJ9L 1WWAX 3DI3B 5FA3B 1MQKL 2OM5A 3RY6C 2R56H 2VDNL 3EYFA 5T3ZD 4MB3A 4NQSA 1Y0LB 7FABH 1MI5A 3G6JA 4U1SA 2VC2L 3ARFA 1VACA 3HZKB 4HULB 1QSEA 4IDLA 1F4YH 3WSQL 3B2UC 3CFJA 3DVNB 3K1DA 1BBJA 1HOCB 4HKXB 5IB3B 5JZ7D 1Z3GH 4LMQE 4IOFC 1ETZA 3ZDZF 5ITFB 4LHUG 3PWJB 4H0HB 1FFRA 1A1NA 1P7QA 5SWZE 5GISL 1QFHA 3GMMA 1YMME 1NUFA 1FZKA 4YBLB 5F1KC 3GI9H 1JZ5A 3QDJB 4GS7C 4Y5VC 3UDWC 2O93L 4PLJD 1OB1A 4OQ1A 1CD9B 1K2DB 4GUPB 2D03H 2BSRB 4GMTL 4Y1AE 3JBG7 5HHXH 3SGEI 1QPXA 2ICWA 1AP2B 1IQDA 5J6HA 4GBXD 1SVCP 3B5GA 3KPOB 6FABL 1JHLH 3IJYB 4WI8A 3IU4H 4GOSA 4GW1A 4X7SH 4JB9H 4WCYH 2ITCA 3BGMA 2M1KA 3EJZC 4LFHG 2FCBA 3TNNB 4ISVB 5EUOA 1JTTA 3M8OH 2GK0A 5EU7C 4K3DH 4RIRA 1U6AH 4JFFD 1AR1C 2VXVH 3MNZA 3TFKD 5LKNA 1U95A 1OD7A 3X3FH 3U2SA 1H5BB 4HFUL 1U3HB 4LQ1A 1BOGA 4IMLB 4MLSA 3GMRA 4I3GA 5D72H 5KSAC 3GMOA 2P7TA 1I9RH 2ZSWB 1YMMA 2I60H 3GBML 3RVWC 3T08A 1CXHA 3QIBB 2DD8H 1YN6A 2X7LA 4X99B 3ILPA 3GGWA 1SJXA 1F42A 3PWVB 1U3HD 4PJDA 4PJBB 5T3XH 3T0AA 1EMTH 1FFPA 4AK1A 2P24A 2N4IA 4LNVA 3P11L 2YMXL 4W6XB 1HYRC 4WWKD 4CL7A 5J56B 1G84A 3P9LB 4GKSB 1RZKC 3K7UA 1YY9D 5JW3L 4G6ML 4YC2C 1Q0YH 4O00A 4P46C 5DHXB 1BVKB 4XWOD 1RK1B 2NY6D 1EUUA 4DW2L 1FFOB 2VAJA 3RWHB 4Z7NE 4JEGB 3I6LE 1AGBA 1VFUA 3O3AA 2XKUA 4X4ME 3K2MC 2NXYB 2AV1B 3K2UL 4H5SB 3SJVB 4NPYB 4PJAB 4U05A 5T1LD 4WW2F 3U6RB 3P0YH 3HUJE 4NOFA 3WFCH 5IB2A 1HHIA 1YEJH 4NC2B 4MA3A 5HHMD 3T77B 4F7CA 3RWHA 4FQ1L 2BNQB 3QFJA 4PJ7E 1R3LA 4NQCA 2ZOLA 5DJ2A 1BIIA 4G6AD 4WTXA 4XVSH 1PX4A 2MFNA 4IM8A 2VN4A 4JO3H 1O7SA 5IFAH 4ZYKA 1CXEA 1U8NB 4LSSH 2R15A 1IC5H 1QBBA 1BOYA 5C08B 3H3PH 1VKXB 3ARED 1A7PL 1MCFA 2HTLD 3GGWB 4M5YL 4ZO8A 3GI9L 4RAUB 1BQSA 4TRPH 4AEHL 4JPKH 3LV3A 1S9WA 1NCUA 1I3RB 1S7SA 2XZAL 1G7JB 2W92A 3CVIL 3F7QA 1UXWB 1QLEL 4R2GB 1IAKB 4L4VA 1YJDL 4HEPG 4ZPTB 4GBXB 3NTCH 3OKNB 4RDQG 4HWBA 1NBVL 1FG2B 3NOIA 2OZ4H 3GSWA 4UOJA 1T1ZB 2DQCL 1R5VB 3NIDF 4FOMA 4OCWL 4WTZG 3TNNA 1I1AB 4P9HC 5ISZD 4RGMC 5KTEL 2JK5B 4L4VB 5EOCJ 3WFBH 1TZIB 4OLWL 5C0EB 3TV3H 1RI8A 3ZHDA 4YHZL 5GGQL 1OAXH 4B7IA 1QRNE 3H42H 4OI9A 1L6ZA 4Y5VA 3UDWA 2DI8A 2GITA 4PY7B 5CIPA 4W81A 4MQXD 4S0SD 4CDGC 1DQQB 4IS6B 4MNGA 1A8JH 1TJGH 3U9UA 3C8DA 1RMFH 2DLEA 2IPTL 4K23L 2H1PH 5GRUL 3V4PL 2OL3A 4XCNB 5CBAB 3UTOA 1S5IL 3U0PB 1U8NA 4G8FB 3G5XA 4JY5L 1IGYB 1MRFH 3UYRL 2DQDH 4LSPL 4TOYL 2NXZB 3K4DA 1Z9LA 4LLMB 4PV8A 5EO9A 2DM4A 4JDZA 2D7MA 3WJLA 4F9LA 5ICXB 4G7YL 1E4WH 4Y8DC 3RHWK 5BRZB 3CSYA 3AS1A 1MELA 4K3EH 5IMKB 1MJUL 2W59A 4FQHB 4S0TD 5MI0B 1C5DB 2FNBA 1MVFA 4ZUTB 3PV7A 4KQ4L 3DARA 3QIUC 2VTFA 1KT2A 1XZ0B 3O4LE 2EIEA 1DBBL 1FNGA 4KTEL 4RZCA 2MCPL 2DICA 4N0YL 3RIFF 4MB5A 1HYSD 4U1GB 1GL4B 2E6JA 3RWEA 2HFEA 3UO1L 5H35A 4Y2DA 2C1OA 2X9YA 3QFDB 5EZLA 3O8XA 3U46B 4K55A 3L6FB 2NY5L 5DJZA 4BH7A 2NX5A 1BFVH 1FC1A 1N7MH 4XVTL 4D0BA 3D39D 5HVGB 2VDKL 2ZP0T 4GRWB 2PYEE 2Y06L 1D9KD 1OQOA 2R1YA 4XXCA 1TQCB 1X5ZA 2NZIA 3LOWA 4ELKA 5CJXA 1U2HA 3W5MA 5DQJB 1AGDA 1GH7A 4G8IA 3RDTB 4JFPB 3QXTA 4CMHC 5IR1A 1QSZA 3HRPA 1NJ9B 1NC2B 4FZEL 4XNMA 3RNQA 4KDTA 3BZ4A 1BFOB 2A9NH 3O9WB 1R0AH 1S9WB 4JGMA 4LHUD 3UTSB 5FOBB 2AVGA 2DMCA 3V8CA 3FFDB 3LS4L 4HWZB 1CE1L 4KUCD 1UWGL 4MX7B 4MXQC 1KPUA 1ACYH 2V2XB 3ALPA 3ZMRA 4UNVA 2P1YA 5I1JL 3MRQA 2FO4A 2DN7A 4ZUWA 1QEWB 2I27N 5K9QI 2DQUL 4QY8B 3ZT7A 5GSVA 1NL0H 1QFUL 3ABZA 5KTEH 4KRLB 2ICWB 2XIDA 4MQ7A 1QRKA 1MFCH 2DLHA 5MEPB 3DRTB 1A3LL 3ARFC 3QPQD 5AUMA 1X6NA 4OZGB 1JMXA 5TDNA 5IESL 3OPZL 2PXYB 1C5BH 4AJ0A 5FHAH 5ALCH 4I8DA 2J1KA 1P5VA 2UYLA 3KR3H 4N1EA 3CXDL 4Q6IA 4MDIB 3MV7D 2IPTH 1JGLH 3FQRB 3D6GA 4ZXBA 2DLFL 4X83A 1HXMA 5DD5L 3T0EE 1MY5A 3QXAB 4E5XA 2IH1A 3MLSL 1M05B 4OV5A 4V1DB 3N85L 1YY8B 2J6EH 4RSVA 4DAGL 3C5JB 2CXKA 3VXSD 3O4OB 3S7GA 1XT5A 4HF5H 4FABH 4K94C 5MP6H 4EUPA 4N0YH 5IMLB 3FQRA 4JKWA 1T1XB 1U8KB 3MRDB 1J5OH 4URTB 3C8KA 1NFDE 4CDHA 4PJIA 2EIZA 5I1LB 1JV5B 2WP3T 5BZWB 5B39G 3AGVA 2N7AA 1V3MA 5I1GL 4WW2C 1KCRL 1NDGA 5JOPE 1NLDL 3GKWL 2ARWA 4LQFH 4P4KC 4PJXB 3UEZA 4D9LH 3BMVA 4R7NA 1I4FA 2NW3B 3SN6N 3GSXB 2O26U 4WUUB 3SO5A 3D18A 3ESUF 5DEFA 5B8CB 4JPIB 1FVCA 4UILH 4PJIF 1ZHKB 3VFMB 3PQYA 4I2XB 1C1EH 3X13A 1FZMB 4GKZB 4OLVL 1ZGLB 3CFBB 5D4QA 1OAQL 3J7HA 5FA4B 5C0AE 2YN3A 3AU1A 1FO0A 4I0PA 3BDXA 1RZFL 3MRFA 4LGPB 3LD8B 4N90E 1MCWW 1XGQA 1OB1B 3HZYA 1JI2A 2ZOKB 2IEPA 2X42A 1JPFB 3AU1B 4NQXA 2O61A 5IM7B 4NRXB 2WQ8A 4I2XA 4OCNC 4PUBL 4E0RA 2QADC 2UWEF 3GRWH 1OGAA 2NY6C 2JB5H 1A21A 4GRLA 4N0CC 1F13A 3INUL 1U9KA 4O02L 5IVXF 3TVMA 1A9EA 4WGWB 1NL0L 1QFUH 4YXLH 1NDGB 2CDEA 4BZYA 2XZCH 4NJAH 1S9XB 5KN5A 1VHPA 3VXNB 3QFJD 4OLZH 3IXAA 2EDHA 4E42A 4ZMAT 4CGTA 1LE5A 4X4XA 5JW3H 3BP5A 5C6PB 4GT7A 2BNRA 2WP3O 3QEQE 4P2CG 1UVQB 3KYOB 4EUPB 1WGOA 1IRAY 4G8GD 1QLRA 3LQMA 3MOBL 4NNYB 5DK0B 2Z4QA 4OJFL 4LVOC 4KMQA 1JYXA 2YD9A 3FN0H 2GSIB 3SDYH 2SEBB 4UQ3A 2EDRA 2G75A 2NY2B 4PRBB 1ES0B 3QXAA 3KPRD 2VWEE 3HKFA 4IBLT 5FECB 2OQJB 4J3TA 4JZOA 4LVEA 3HMWH 3KYKH 1VPOL 1I85C 1RHHB 1HQ4B 4RAHA 2VUOA 2NW2A 4POUB 3QAZB 4H26A 3OB0H 2B7DT 3MLRH 5LAXA 4LSTH 4J2XA 3MZGB 3HR5B 2I24N 2EC9T 3KXFE 1F90L 1DP0A 1DBAL 2XZZA 3MLUH 4XAKE 5GPRA 5JUEH 1TTFA 4BSWB 1JZ6A 2NLJA 4Z7UB 2FYYA 2J8UB 3O8XD 2HT4D 1JFQL 2NY4D 3JWNC 4UV4L 1C08B 3KNBA 2UY6A 3O3UN 5CSZB 2J3SA 3D0VA 4Y4HB 4BQ9A 1FL6B 3QH3B 1KJ2A 1BVLA 4LPVA 1BF8A 1YNKH 4JQIH 2X89A 1W8OA 3BGAA 3O3DB 2ADJA 3C6SA 1TQBB 4JFDB 5CINH 5AWNL 3BPOC 5DDHA 5E5MB 4I9WE 4M93B 3BKJL 2HRPL 4HK0B 4CMHB 1A64A 3OAZK 2XRAH 1EHLH 5E8DL 1UA6L 5GGSA 3QG6B 1D6VH 5HI3D 12E8H 2F54E 3FB7A 1RUKH 1UXWA 2NY3C 1X5FA 4FQCH 1JGEB 2ADFL 5KW9L 4HV8B 3N1QC 5IHLB 3QDMB 3KPRB 2RB8A 3VXQA 4U1IA 2CLZA 1OSZA 1S7WA 2EC8A 4JLRA 5I17A 2B1HL 4Z7VB 3Q6FB 1YEGL 4NO2B 4OCRL 1HKLL 4NUGH 3GHEL 2EKSA 4AYFA 3U4EA 1U3ZA 1MCWM 4YEEA 4KJPC 3RWIB 2F5BL 5J13B 4P4KB 1QSED 1PG7H 2HWZL 3LS5H 4Z8FL 1T2QL 3ECBA 3NFPA 4R9HA 5FM5O 3SDXE 5I1IL 1DBKH 5KSVA 1OTSD 3GMQB 4MA8H 1SYSB 2XTLA 3QDGA 3FHAA 3PHSA 5BMFH 4J6RH 1S5HB 2Z35B 3KPMA 1GJIA 1X5GA 5IOPB 4NPYA 3P30H 3LPFA 3NCEB 5LXGL 3RWJA 3CMOL 2NY7H 2C3HA 4E41D 4ZUTA 5I71B 5F7LB 4OSUH 4QRTA 4XP5H 3IJHB 5FYKE 4QRPA 4HH9B 2J4WH 3WE6A 1CK0L 3NH7H 3RBGA 5I2IB 4PR5A 1RJYB 5EZJA 5D1QD 2GCYA 2IMMA 4LKCB 3QUXA 2YWYA 5D7LA 4LVNB 5HVFB 1L9NA 4YIQB 3ES6A 1Q8MA 5JDSA 2V17L 5L2JB 4YHLH 2FYYB 4Z0BH 1G7IA 1P7QD 4JM2F 3V6FB 3ARYA 1IAOB 4KK5C 3CFKB 1QRND 5IT2L 2EYTA 1UJ3C 4U1MB 1B9ZA 2VZVA 3TA3A 2P48B 4G6AC 1WFNA 3CPLB 4P49A 5E9DB 3MUY1 5GGSY 2D7TL 2WWKO 3PP3K 1QSFA 4RISL 5MEND 2D0HA 3KJ6H 3KPSA 1I1CA 4NHCH 2B20A 2YD4A 1P2CB 2A74A 4XH2B 2AEPL 4WFFD 5SWQA 3V6OE 4R4BA 5D2LE 1E4XH 2VERN 1VEOA 4CVXA 3AFLA 3L5IA 3O6KH 5IV2B 1PG7X 1UENA 4GAGL 4XPHH 4MD0A 3BPLB 5D1ZB 1RJZB 3ROOA 1DBML 3IJYA 3NCCB 1E4KA 4JG1L 3WNNA 1EMTL 4BYHA 3WJJC 5HYJE 2NYYD 3HE6D 3R8BB 2JKXA 3PHOA 2CJUL 1T3FA 3ARDD 2B5IC 2NNAB 2H3NA 4WNQA 3RWGB 4Q9RH 3QEGH 4LDOB 1MREH 5HVHC 3UCRA 3C08L 4YUEH 1XGUA 1G6RH 4QXTB 5BS0E 5K59E 1JNJA 3PWPB 1I7ZA 1KCLA 3LH2L 3CMOH 5L2KE 3WDIA 2JJTA 4HH8A 1BLNA 1HI6B 4Q7DA 2JB6A 5FV1L 1MFAL 4HUWB 5E94B 2FJHA 3OG6B 1KXQE 1RU9H 3PNWA 4KQ3H 1WCBA 3ZHLA 3HZVA 1JK8B 1DCLA 5DQDH 4U0RB 3K8KA 3BW9B 1VENA 5FYLD 1I7ZB 3UPAA 1CGSH 1JVKA 4JM2B 3TIDB 3AUVA 1AGEB 2W9DL 1FBIH 1HH6B 1OCWH 4Z7UF 4LCWA 5CP3H 4YAQA 4XC1L 4YHLL 4GMSL 5C6TH 2KZ1B 2VLRD 4J1UA 3T0BA 3BXNA 4NZDA 4JKKA 4NJ9H 1R3KA 3X13B 1T3FB 1R24B 4RWYH 3IRZA 4LVHB 3T0DA 2NY4B 4KK9C 5HI4C 4OBSA 4ODHH 4H1LA 1OAYH 4HS3B 4P2QB 2OP4H 3QUYB 4S11A 3RZCC 3S4SG 2G5RA 1FQ9C 2XRAL 4NKDB 3PWLB 2YMXH 2P5WD 3DUSA 2WUCH 3TJHC 5JIKA 3ZKSD 1EJ6A 4XNUH 5TE7L 2F53E 2MOVA 3HE6C 3PGDA 2QADD 1PEZA 4CJ0A 4JY4B 1U3YA 3C8KB 4M4PA 4R8WL 4UINH 3JV6B 5AAMA 5EORL 1E6JL 5BS0A 5KVEL 1BGXL 4OZ4B 5KOVC 5F6IB 1BM3H 3W9DB 1QACA 3MJ8B 3TWCH 4UV7H 3IJSA 5MENA 4W68A 2XQYG 3RWFB 1K4DA 1SEBA 2XKNB 1BP3B 1S78C 4RMQA 1N8ZA 2GJZA 3TBYA 4Q97A 4PBVC 2XWBA 3QEUB 1C5CH 2ITDA 3VXRA 4BKLB 4HPOH 3V0VA 5EUKB 4HT1H 4LKCA 2JIXD 3TN0B 3FQWA 3CDFA 3RHWF 4WDIB 4P2OA 4KPHH 3TBSB 1W0WA 2ERJC 3QUZD 4JCLA 1O0VA 4FXKA 3A67H 1IC5L 4Q2ZA 7FABL 2XTJB 5ESQA 1ZT4A 3EOBA 4OZIF 4IEFB 3QYCA 4I48A 5DVKA 4G8EA 5K9JH 4GQ9H 4J3VA 4U7KA 3S98A 1NMAL 4XNQA 1QZ1A 3TA3C 1XIWB 2BVPA 3V7AE 1I7TB 3JWOL 1Y6MR 1MHHA 5JQ6H 3GI8H 5GRZA 4X9BA 4PB0H 2ATKA 3VJ6B 3GJEB 5H2BB 1ZT7B 4K7PL 4KK8D 3H2WA 5DUBA 1QEWA 2OZ4L 3VXOB 3DVNA 1IJ9A 3NCJH 4HJGB 4JO4L 3DMMB 4XPBH 2F8XC 3RDTD 3P40A 3RL1B 2AJSL 2L7UA 1R5IA 4LRIC 3DWTA 2E6PA 1CVSC 4HWZA 5E8OA 2IGFL 3RWFA 2AJXL 1WWWX 1PJ9A 3BE1L 4MJ2A 5E8EA 2R0KL 3SQBA 4D94A 3WFHA 1HCFX 2R56L 3FT2A 3NIGF 4F7EA 4JFPA 3CZFB 3SDDA 4OD3L 3H9HA 3M45A 5T33H 1MJJA 4PJFE 4BFIA 1JTPA 3OHXB 3RWDA 1MY7A 4HK0A 3TWCL 3S97C 4TNWF 4WWID 1DQML 2IADA 1K6QH 4MXWH 3W39A 4LP4A 5D5MA 5HYFA 4XMPH 1LO0H 4DGVH 4Y5YB 2A0LD 1MHPH 4PJEA 1CD8A 3NPZB 3QFDA 4HT1L 1QR1A 5CSZA 1XF4B 1OP3H 5BV7C 3QIWB 3AC0A 1NAKL 5C0CB 2UWEE 3QRGL 3LPGA 4YUEL 4QGTA 2D7PA 3SJVE 4KAQH 1JPGA 2ZCHH 4BSWA 4PB9L 2R39A 3B9KA 3LPWA 3DVGA 1I7UB 4U4BA 1EEYB 1BJ1J 5IHBA 3O2VL 3SEPA 2F58H 4XPTL 3ZE1E 4HUNB 3KPPA 1Z0MA 4P4RB 4MAYD 3DHMA 3WFDL 4JY6A 3MV7E 3MUJA 3ULUF 3Q1SL 2X5PA 3FHQA 4NFBA 3FO1A 1T2XA 3QIBC 3L3OB 4K07A 4KHXH 3ARBD 4KZEL 3N1PC 1IQWL 4UQ3B 1UB5A 3MXWH 2AJUH 5KVGH 3MYJB 1LO5B 1DQLH 1VEMA 3RNKA 4WFGE 3TT3L 3HE6A 1REIA 5D6CB 4Q9BA 4Z5RB 3IKCB 1K85A 1S7UB 3VD9A 1N4XL 1CFVL 2HH0L 4NZTH 3EJYC 4QOKB 4U49A 1HN1A 3HB3D 1A22B 1I8KB 3QDHA 4XI5C 4EVNA 1DBJH 2V9TA 3DECA 5DC9B 4U3HA 4XVJH 4F80A 5DD1H 5C70A 1ACZA 2HFTA 3ARWA 4S1SH 3ZKXB 4GKNB 3S4SB 2DQIL 5I9QC 5CGYC 2FLRT 4H20L 3LN4A 1H3PL 5T33L 2Q3AA 4YK4C 1EO8L 3C6LC 5EIIB 3MRPB 1HKFA 4JRXB 4NKMA 4RGNE 2DWDA 3RBSA 3CLFL 3PGFL 4MXQD 5EORH 4W4OC 5I0ZA 2QSVA 4PJFF 2D7OA 3QQ3A 5IJVA 4DQOH 4JFEB 2CUMA 3TCLA 2H8PB 3ZTNH 2IBZY 4KJQC 4U1LB 1KLGB 4U1NA 4PJGB 1IC7H 1IBGH 2PXYD 4NIKB 4PGEB 4QRQA 5KJRL 3OTTA 3LN9A 1X5AA 2AXGB 3O11A 2ZNWA 4RAUA 5HYSA 1OF2B 2C3XA 25C8L 5FHBH 3CAFA 3DO3A 3QRGH 2L0DA 1WBZB 1KJ2H 4ACPA 1MCHA 5E95B 4WHTA 1ONQA 5I2IA 4LKXA 5HGAB 3F8UB 3SBWC 2E5EA 2NY5C 4Y5YA 3U9PL 2X05A 5EUOE 1I1YA 5CEYA 4A2LA 3FQTA 1N5YL 4XBPA 1HHIB 3JTTB 2RHEA 1J12A 3GSRA 3WYRA 4DAGH 3P0GB 1WBYA 1RZ8A 1YA5A 4X0KB 4LLDA 3RUGA 3MNVB 5F3BB 1AGBB 5CSBA 3ZE2F 1YEKH 2F19H 5KANI 1SYVA 5CD3A 4XXDA 1ZT1B 2M26A 1CDHA 1TFHA 3LZFH 1Q9KA 2YD3A 2I9TA 4PG9B 3EYSH 4TPRL 1PX3A 4OGAC 5DXWA 3L3KA 2RGSA 4P2YA 3CIQA 2VLLB 1AHWA 4CVZA 2MHAB 4I4WB 4LLQA 3C6LD 4C58B 1CIDA 3UO1H 1GC1H 3D3VA 5K9KA 4IRJA 4DVRL 1S9YA 2APXA 4B5EA 1FG9C 3DGGB 1KN4H 3X14A 2OL3L 1LK3L 3LKNB 3PP4L 3R0NA 4ZTPH 4FTVA 4WHYG 1L7IL 1YN6B 5IFHL 4HX1A 3EIFA 1QFWL 4YX2H 4KXZI 2KL6A 1IZJA 2WNGA 3VWJD 3SDDD 4PJ8C 1A2YB 1XGRA 1U3HA 2BJMH 4PP1C 5KSBF 1FVEB 1P4LB 3UYRH 1A6VL 5CEZL 4PPTA 5EUOB 1LEKA 2B0SH 1KLUB 4Z7WE 4Z7UE 4JN2B 3CH1A 4MJIA 3ZLQC 1MCLA 2NY0B 3DO7B 1OLZA 4LAQH 4OCXH 1HILB 2X6MA 3RTQD 1KJ2B 3D85D 1G9EA 2XPGA 4P23C 4XAWL 2V7NA 4QY8A 2ZCKL 2CO7B 1PDKA 5EO1B 4LGSB 1W72B 2MNUA 5JW5A 4KDVA 1A02N 3FMGH 4OZHE 1NC4B 3AY4A 3QDAA 4AENB 5DI8B 3X17A 3C5ZC 1NBQA 1HZHH 2UZYB 4F7MA 3HNVH 3WN5A 2Y7QA 1N8ZB 2MPAL 4I18B 1I1FA 3SKOB 1EO7A 1NCCH 2XTJD 1LMKA 1QYGH 1U93B 4QXUL 1UWEL 2HT2D 4OQTL 3ZE1F 3O9WA 1KC5H 2Y9RT 3FTGB 3MUGB 4H26B 5F44A 1AIFA 1U3JA 4JY4A 5IHUH 3UTZB 3HMXL 2LV4A 4LCUA 2NYYC 4LVHC 4YO0A 2VLRB 2CQVA 3WS3A 4ODXA 4QHMB 4NSKB 1EAJA 1QSEB 4HBCH 1XCQB 3QB7C 5FO9B 1P7KA 1KB9K 2GSGA 3VFUA 3FO2B 4GRWE 4PJBF 3VXUB 2YD2A 5E7FA 5C71A 4HS3A 3FT3B 5EU3A 3ZKXC 2VB5A 2VWEC 1ZHLB 1LK2B 1KCVH 1CWVA 1H3UA 4HS6B 5EO0A 3W5NA 1GYAA 5CBEA 1FGVH 1TNNA 1LEIA 2B2XH 2C3VA 3H0TB 2F19L 1ZTXL 1DDHB 4NFCA 1I9IL 3EDKA 3KYMA 3PDOA 4LF3B 2F5BH 4J1UB 4A6YA 4YEFA 1I9RL 3RWEB 4FMFA 5B8CC 3T1FA 3PIQA 4F8TA 2AJVH 5LCVH 4PJ9B 3JV5A 4ZOAA 3QZWA 3VH8B 2A1WH 4OIBA 4RQQA 5DFWH 4F3FB 4EJ1C 1T83C 5AAWA 3IDIA 1WCBB 5D9SB 5F8RC 2DTSA 3IAGC 1ND0B 4NO0D 3WFZA 4LCCC 5C0NC 1CQKA 4JDZB 1YYLL 4OCXL 5KJRH 3IVKB 3QNZA 3MUGA 1T66C 4XMLH 2ERJB 2P4AB 1O5DT 3SDAA 1HEZA 5AYUH 1QFWH 1MCJA 5KG9A 4QTHB 3K4ZA 4JRYE 5F1IA 4IOIA 2NY6B 5J11B 5F72S 2NNAA 1YEHH 1U8IA 1G7LA 2A73A 5TPWL 4L4TB 4G7VH 4TUOA 5HGBB 4J3OC 2E9JA 2F54A 2VL4A 4ZFFA 2UV3A 4PRIE 2XT1B 4JZJC 3S5LA 2J88L 1SBSH 1LO2H 4LEXH 4JHBA 4R4FH 1UCBL 4XBGA 5AD0B 2VLJE 4OCRH 4ZNCD 4F9PA 4O2CA 2X1QA 3B9KC 4ONGL 4R4BB 5DQ9B 2IFFH 3QJFA 4Y1AA 3BKYH 3BQUA 4L4TD 2VISA 3GSNH 3UTPD 2Y36H 4RMVA 1MHPL 4U6XB 4YFLF 3TBTB 2X4TA 3B5TA 4PJ5B 5D6DC 1IAKA 3EYUH 3TESA 1A7OL 3B3IB 1J7VR 4NQTA 1BZ7A 3QWRA 3CLEL 2APTA 1QTYT 3FB6B 1V3JA 4EKXA 5T1DL 5ICYA 1HHKB 2ZG1A 3FT4B 3PL6A 5EU6A 4FQQB 4JZNA 2XI9A 1DLFL 2IC2A 1IAOA 5TF1H 3HUJB 4XPGH 1GGYA 2W65B 3QI9B 4KV5E 5LQBL 3WNLA 4ZPVB 5F7YC 1NBVH 4GRWH 3QAZC 2PN5A 3MOAL 2OTWB 5IFHH 3IF1A 4NRYA 1MI5E 2F58L 4Z95L 5E2TH 1YEFH 3UYPA 4F2MA 1IZKA 4L5FH 3VFVA 5F97E 4N8VB 2HKHH 3LH2H 2EDQA 5CKGA 3T3PF 5E56A 5J7CC 4P23B 2F9BT 5I8KL 3WN5C 3TBVA 2AXHA 3P9MA 3QIWC 4U7SA 3BN3B 3EYVB 4EDXB 4Z0XB 3LEVL 3NACL 4KY1L 3V9FA 3ULVC 3MUZ1 4IOFD 4F7PA 4DN4H 2XYCA 3V0AC 1KN2L 5CEYB 5D70H 3T04D 1OCWL 3JUZA 3TNMA 1UJTA 4EN3A 3NFPB 3HNTL 3QA3B 3EHBD 4AMKL 3W11C 1PAMA 4XCCH 1LNUB 3PHQA 4C54A 3PQYE 2FD6H 1B88A 1F3JB 1M71B 2P42B 2V2XA 3Q48A 2Y07L 4XZUB 5C09A 5CZVH 2IADB 4NRYB 5C0ND 3WO3B 1KPUB 2X4OB 1DUYA 1WBZA 1HWGB 4NGHL 4WU5A 5HGDA 4OM0L 1D5XA 1ZANL 3DIFA 3MODL 3IB4A 4YC2B 2NXZD 5DMKB 4X99A 2R2HB 4R97C 4BFIB 1A3QA 1NFDF 1UH2A 4LAJH 2CO6B 1BFOA 1UADC 3AREA 1RUPL 4KK8C 4U2ZA 2DQTL 2VL5A 3BUTA 4MYWB 3U36A 3B43A 4XGZA 2NMSA 3SE3C 1LP9A 2FGWL 3TT1H 2DWEB 3VFSB 3NAAH 1YEIH 2FJGA 1KTLB 2XV6B 4N0FB 3BJ91 1TZGL 4TVPL 3DV6A 2AJYH 4HJGA 2HFFB 4GFTB 4PJDE 2CKNA 4NWUH 4ODVH 1EGJH 2Q3ZA 3ALWA 1MCSA 1XAUA 4OF7A 4JFZH 5MHSD 1ZGLP 1CT8B 3VXTA 3K8LA 3EUUA 1BMGA 1QO3B 3OKKB 3V4VH 4QOKA 1YEGH 1MCPH 1YEEL 4XHJC 1AI1H 3BSZH 4JFOB 3HLAB 3IAPA 4M7LL 4GUPA 2HT2C 4OGXH 4PP2B 4Z7UA 5FXCH 4V2CB 1QOKA 2A1WL 4RCAA 3U79A 1CL7L 4OD2B 3GMPA 4X6CB 5TDPB 2KDGA 3OJ2C 1U42A 2GTWB 2AGJH 4EDWL 3QXDA 4YHNB 3QUMB 1SY6L 3D3VD 2BOBA 4PJFA 5IMOA 3S3JA 4JZOB 3TCXA 4X7FC 5CHNB 3O0RH 1YEFL 4ZDHB 4PJHF 4UDTB 3LN5B 5DJ0A 3O3BA 4PRPD 1I7UA 1KB5B 2Q76B 3ZTJG 3CXHJ 3X3GH 4U6TA 1MFCL 3O41B 1T5XB 3TO4B 2VABB 3MV8A 2WIMA 5BVPH 3RZCD 5EBWA 5GRXG 2OR9H 3CDGA 4TSBH 2GHWB 2DQEH 2Y25A 3OR7A 1JGDA 1JHTB 4YXKH 3VGAB 1BFVL 1CFQA 1RUML 5D7SL 4KU1A 1VFOA 3BEVA 2IALB 2VDQL 2X4NB 1LDSA 1IT9L 1WITA 3ESVF 4MJID 5E00B 1CICB 1OT1A 1BBDH 3V6OC 2F5AL 1LK2A 1KBGL 4M43H 2DKSA 1R3JB 5D5MB 5ENWA 4HJJH 5ADPL 1NAMA 2XA8H 1MJ7H 3NZHL 4NZUH 5GGVL 2Q87A 3OKEA 2HJLA 1MWAH 2FL5B 4TQEL 1E27A 3FQUB 5D7JD 4NQDA 5ACLA 3LS5L 5DHVB 4U6YA 4HPOL 2ZUTA 3DETD 2D7TH 5DHVH 4MJ6A 4Z7VE 2YRZA 5GZNC 4HJ0D 5GIRB 5IKCA 1OAXL 4KRPB 3Q2CA 2ZSVA 3E0GA 1Q72L 5L88H 4LCUB 3BDYL 2IH3B 1YQVL 1AIFB 3R1GL 1FC2D 3D0LB 1X7QB 2A6JB 5HI3C 1VESA 3MGOB 4M9OA 1IARB 3L1OL 3R0MA 3EOTL 3MLYL 4AL8L 3HZYB 3VFPA 5F7FA 4G6FD 5FKAB 3MREA 3MRCA 1V7MH 4JKPH 2KUTA 3I6GB 4UT6L 1KJVA 3VRJB 3WN5B 4WU7A 5EWIL 1FO0B 4I0PB 1JZ3A 1S78D 3BUYA 5DI8A 3BD5A 1T5WB 4WEBH 1ZLSH 5EO1A 2H45A 4PTTA 1PZ5B 4FA8A 4QNPF 4ZSOE 2JJVA 4Y2DC 1TQCC 3U4BL 4JO4H 4XPBL 3P73A 1A6ZB 5B8CA 1F4XH 1KCRH 1G0YR 3C09C 4GSDL 3V5HB 3VD7A 1DSFH 3MLVH 2Q20A 4MDJA 4WEMB 2ADIB 1H3TA 4PLNC 4DN4L 4CVWA 4OZHF 4PGJA 1FFOA 3X3GL 8FABA 2BVEA 4QHLB 5L6YH 4NZRH 1JV5A 3WKMH 1MCCA 2P8LB 3O6MH 4UI2A 2ENYA 1C1EL 1PVHA 3TO2B 1UYWL 1KEGH 4HCRA 4U3XA 5L8JB 2X9XA 4OF3A 4ELMF 2BP3A 1V3LA 3EYOB 2HJFB 4UT9H 4GAJH 3UAJC 2FR4A 2V2TA 1DQJB 1P1ZA 5C0CE 3OQ3B 5K9KB 1I8MB 1ULVA 3WIIH 5DSCB 5HDOA 2YHGA 4ZOBA 4Y19B 4FZEH 1DZBA 4FS0A 3WIFA 5TQ0L 5BZDA 5K9OB 4ZNEA 1RY7B 5D2LB 1GIGH 1QBMH 4RMSA 5I1EL 2A77L 3ZKMD 3G6AA 4K2UL 4CBPA 1RULH 1JWUB 2BY1A 4PGZA 4A6YL 3L95B 3BQUC 1G7PA 4TULL 2XY1A 2YUXA 3ULSA 4UT7L 4OAWA 1YEHL 3FRPA 1WBYB 3RUGB 4OJFH 3V5HA 4FXLA 4P2QA 3FQTB 2XNAA 1FNHA 1CDBA 5HI5C 4FQXA 5JW5B 5C07B 25C8H 3B5HA 3E6HA 3TH2T 5GISH 1CD0A 2V7NB 3IGAA 3OGOE 5L2KB 1ZLSL 1HILA 2ENSA 5B3NA 3ARZA 3T4YB 5ABDE 1JNHB 1K8DB 4KUZL 4FFVC 1IM3A 2BSRA 3MNWA 4RFNC 4IOIB 5FHAL 5DTFB 3SQOL 4HLZG 4LCIL 5HDLA 4QTHA 2ADIA 4JB9L 5L9DL 1JIBA 1MCQA 3FAXA 2B4CH 1BQLH 1DFBL 2ID5A 1UKQA 3BW9A 3QNYA 1BHGA 3GKZA 4JQXC 4OFPA 3HZMB 5TE6H 4HUWA 5E94A 4UTBH 1FFNB 4JFEA 3TCLB 5SX5H 3KYNA 2CK0H 4NC1C 4PRDB 3V6OA 4ZSOB 1AD9B 1A7QL 3ARFD 4HX1B 3VCLB 1DBAH 3MLUL 5DD3L 1NEUA 3VMOA 4GQ9L 5F93C 3KPSD 4D9QD 1CGVA 3VXMB 1KCSH 4N9GA 3Q5TA 5DHVA 4YZFF 5F3HA 4R90H 1RUAL 4P2QE 4X4MA 4H1LG 1Q9WA 2ZUYA 5C8JA 1L6XA 1CR9L 4H25A 5DJZB 2C1PB 2X4RA 5DVOA 1EHLL 2D9CA 1F3DJ 4JHWH 4UV7L 4TTDD 1LEIB 5D93B 3O6LH 5DGRA 5EPMB 4WW1A 3ZDYF 3UTTB 1NLDH 3AMKA 1C5BL 3O6ML 1XMWA 5I74C 2NY0D 2VR4A 5F7EH 5CUSH 3SE9L 1XZ0A 1AO7B 4A6YH 3GSRB 5GHWL 3A6BH 4WUKH 4I77H 5K9QG 3LRSB 4ODXB 5C0DA 2VLRA 5FDWB 4Z7WF 4M1GH 2F8VA 1K4CB 5I18H 2V5SA 2ZUQB 1XIWC 2BNQE 5MEOB 3H7BB 2FX7L 3T65B 4FQ1H 3OMZA 1G7HA 4Z76A 5B39A 2BY3A 3N85H 3V5KB 3D1MC 1FN4A 2Z0BA 5FGRA 4ENED 1D3CA 5ITBH 2EYTB 4U1MA 3LKSB 1UACL 1ZXQA 5C0JB 2A9NL 1NCDL 1F11A 1KPVB 4Z7OE 4JPWH 1BJMA 2Q76A 1F8TL 3H9SD 1TVHA 2VLKD 3A6CH 4I9WD 3FB8A 1HK6A 3V5KA 1INEL 4XVSL 3OKKA 5HDQH 3GSQB 3HAEA 1GC1C 1IEBB 5JLZA 3UJTH 1CFNB 3BP4A 3CSPA 3G08A 4PREA 5ICZB 1CE6B 4G6FB 4LK4A 1TITA 4QRTB 2DQDL 4LSPH 3REVB 3ARDA 1CK0H 3DXAE 4JRXA 1HSAB 2OXHA 3BE1H 2OK0L 1MPAL 4G7YH 2W60A 4KI5C 4MXVE 3RWDB 3JZ7A 3EO0B 4BM7A 3GSVA 3BRGC 4PJXE 2Y1VA 3DV4A 5EZIH 1CL7I 3ROLA 1UGNA 5DHYB 2EH8L 4JFXB 3THMH 4JM2D 4LCWD 3CFEA 1A7RH 2AK1H 5I9QB 5ID1B 3DBXA 3FO0H 2BNRE 2VDML 4P46D 2QQKL 1ED3A 3DHJA 3O45A 3CD4A 2DQJL 1MUJB 5JOEA 2FJGB 4N0FA 1CGXA 2X4OA 3H3BC 3L3IB 4DOHB 1CLZH 1A4KA 1F2XK 2JB5L 1X4XA 5K93A 1ED3B 3QISA 4Y2DD 1UB6B 4OCYL 4JY6B 3BO8A 3GB7B 5I1EH 3O0RL 1NC4D 4R0LB 1CXFA 3CFEB 4JY5H 1BZQK 1T6VN 1OGAB 4K8RC 1F90H 5GGTH 5DD1L 3C87A 3NFNB 1MCKA 2HN7B 1I1AD 4EUPG 2W0KA 2XZCL 3N1GC 5D1QA 3I9GH 4XCFL 3VXPB 1BJ1H 1RJLB 4F37K 2Z31A 5EULV 1GPOL 2C4FT 5KZCD 2DIBA 3HI5L 1PY4A 1LD9A 2IANE 2VSCA 4YNYA 1T7YA 2UVFA 1FO0H 4GKZA 1XGYL 2R9HC 3F58H 3U7WL 2EDJA 3VWJC 1WVZA 1IBGL 4LKXB 5I16B 2NZ9D 3HAEB 4KZEH 2V17H 5AWNH 4Y16D 3L3JA 4KZDH 5T3XD 1IGML 4MAUL 3WD5L 4KQ4H 4BKLA 2R0WL 4FQLL 3BPNB 2PTTA 5GGRY 4R7NB 3TPKA 1NGQL 3TBYB 3OHXA 1OAQH 2H9GA 5DD6B 1EXUB 5ITBL 2QQLH 3FT4A 3PL6B 3HC0A 3C6LB 1LEGB 5TFSL 2A6DB 4UDUA 3RJDA 3QXUA 1QRNA 1YMMB 2MJWA 2XWTA 3ULVF 2CDGB 1DL7H 3QQ3B 2AEPH 3MRNB 1CXIA 1HQ4A 3WHXB 4YFEA 2YK1H 5I1DB 2ICEA 5E1AA 1UB6A 4PJ5A 1YEDB 4HUXB 5SWSB 5DEZA 1OGAD 1F5WA 1KELH 4GS7B 3IETB 3ULUC 1YY8A 4LPWA 5DD5H 4Y89A 1M05A 3EW3B 2ITCB 2VH5H 1DVFB 1MLCA 5DUBB 1NMAH 3DBXB 2OR8A 4LEOB 4OF6A 1LHZA 3VJ6A 3I6KA 1UVQA 4K7FA 3N1FC 2BNRB 2ZUVA 1L4IA 4DVRH 1EEUA 4E42B 1A7RL 2AK1L 4DVBA 5C3LD 12E8L 4LCCA 4FQCL 3L3OA 1EHXA 4M6NH 1OAZH 2XN9A 4WV1C 1XF5B 4BZ1L 1LQSR 3SDAC 2XQBH 1S9VB 1CFNA 3BP4B 4GRLB 1A1NB 1PY9A 2D2OA 3VFGL 4LNRA 5TE4L 2XG4A 4OCYH 4TUOB 3V0VB 2D7NA 4M9PA 1HQRB 1QBLH 1JHKL 2CIIA 2CPCA 1VACB 1PD6A 3G6JF 4JFYA 4ODSL 2CR6A 4OI8A 2A6KA 1H3WM 4QTIL 5DVMA 2OI9B 3C5SA 1SY6A 4KHTH 8CGTA 3HS0A 4HIEB 5C0CA 1TCMA 3MGOA 2IANB 2AP2A 1XF4A 4FNLH 3D0LA 4WFHE 3FMGL 2NY3B 2VXVL 5EOQH 3IGAB 3I75B 3BP7A 4HFUH 3GO1H 2CD0A 1KIUA 3Q3GA 1RJZA 2VAAA 1NCAL 2Q6WA 4NO3B 1UC6A 1QHPA 3GSXA 4WUUA 5LJYH 4MVBD 35C8H 5D6DA 3BWAA 5A16A 5D1XB 2QHRL 5I1HH 4LIQL 3TH4T 5J1TC 1YYMH 3LDBC 4HIHB