5GRYA

Crystal structure of disulfide-bonded diabody
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
231
structure length
226
Chain Sequence
VQLVESGGGLVQPGGSLRLSCAASGFTFRNSAMHWVRQAPGKGLEWVSSIWYSGSNTYYACSVKGRFTISRDNSKNTLYLQMNSLTAEDTAVYYCARFAGGWGAYDVWGQGTLVTVSCDIVLTQSPATLSLSPGERATLSCRASQSVSSNYLAWYQQKPGQAPRLLIYDSSSRATGVPARFSGSGSGTDFTLTISSLEPEDFAVYYCHQYSDISPTFGQGTKVEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords diabody
publication title Crystal structure of mono- and bi-specific diabodies and reduction of their structural flexibility by introduction of disulfide bridges at the Fv interface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 51
structure length 226
sequence length 231
chains with identical sequence G
ec nomenclature
pdb deposition date 2016-08-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5gryA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5gryA01
1N5AB 4PJHB 4PRID 1RI8A 1B2WH 4KKBD 2B5IC 1JNNL 5HHOA 1IE5A 3QIUD 1T80A 2HJFB 3TYGL 3OR6A 4QCIB 3ZLQC 1NGYB 4H26A 3P3YA 3H3BC 1BFVH 3O4LE 3T3ME 4ZPVA 4NYLB 1FN4A 1LO5B 2P8PB 4I4WB 2RJMA 5HI4C 1F4WL 1UXSA 3EZ8A 3RUGB 3LB6D 3VXRE 1I3GH 1YEGH 3G5XA 3IRPX 3CXDH 3PP4L 4Q97A 5DYOB 1JPSH 3KPMB 1IKNC 4HW6A 2D7TL 3MLVH 1I1YA 4ZODA 2ZSVA 4OZ4B 1LO2H 2BVEA 5MENE 5F70A 3C08L 2P5ED 1A6VL 4GXVL 1QSEE 5SWSE 5GGTH 1IAMA 5D7IB 4GKNA 4PYHA 2H9GA 4JPWL 4NO2B 3PV7A 2ATPB 1XR9B 3B9KD 2BHYA 1UM4H 1PG7L 1EHAA 3EDEA 1YMME 3GSUB 1SMAA 3F7RA 1UWEL 5FKAA 5LGJB 1XF1A 2BVUA 2R2HB 3JSSA 3U82B 1U9KA 5IMKB 4WI9A 1QFWH 4M62H 4MXWL 1FHGA 1NFIA 5KSUB 4YGAB 1I7UA 2IBZX 1WZ1L 4UUJB 1KF9B 3IVKA 1UGNA 5CJ8A 1T1ZA 2X09A 2JJWA 1LNUB 5FA3B 2YMXL 1Q94A 3RU8L 2V9RA 2XZCL 3HPLB 1II4E 4KV5E 2XZAH 4BM7A 5ANMB 1FL3B 3ABZA 4M7JL 5I2IA 1AP2B 4NHUB 3VCLA 3HFMH 1WAAA 3D0VB 4F2MB 1T4KB 4PY7A 5JW4N 4LSSH 3HS0B 1UM5L 1F13A 2C3XA 4L4TB 1ADQL 4OF7A 3I50H 1AIFB 1T5WA 1XZ0A 4WEUD 1FNGA 2CKBL 1OQXA 3LQMA 4XP6H 5FYJD 4WFEE 2NY4D 3TT3L 4WI3A 3WLWD 3NCBB 3CCHA 3MLUH 1SY6L 3BIAX 2ARJB 5F7HA 3MV8E 2MTPA 3MXVL 1RHFA 2D7PA 3AY4A 4UT7H 1OOAA 1NLBL 43CAB 3TPUB 2BNRD 2ESVD 4G8FA 5CMAA 1YN7A 2C26A 3D85B 3KR3L 2BHUA 5HYSA 3ARDD 3SDYH 3D3VE 4RAVA 3P77B 2DLGA 2Q3AA 4OAWB 5EH1A 3JUYA 5EBWA 1SEBA 2R69L 4K3JH 3VFSB 1OAUL 2BZDA 3FT3A 3MREB 4LCWD 2VDRH 1HYSC 2GJ6A 5IW6A 3FQRA 5AUMB 1EBPA 1J5OL 3VW3L 1AR2A 4LPVA 4F7TA 2OJEB 4YLQT 5GRUH 1BJ1J 3FOLB 5TF0A 3M17B 4XRCA 5ESQB 2QKIA 3EYQD 4P9HL 3VU2A 3L3GA 2NY3D 5KVGH 4Y4KD 2NW3B 4PY8J 5GS0D 2VN7A 5FOJA 3K0WA 5SWZB 1QSFA 4JKWA 3RY6A 3UTSD 1RY7B 5KSAC 2FX9L 2XFXB 5HGDB 3UAJD 4YGVB 3KPRA 4HKXB 4AH2A 4WIQA 1IZJA 2VLJB 2BSED 1P7QB 4DN3L 5DRWB 4P2CG 3IDXH 2R1XA 2A2QT 1HI6A 3HE7B 4NBZB 1B0WA 1Z9SA 2P5WB 4JKLA 1IAIL 1KIRA 1CG9B 1IKFH 4JFEE 1RFDH 3TO2A 1I8MB 1NGPL 1A3RH 1ZVHA 2HT4D 1RIHH 2XRAL 2O26U 3VFGL 4L8SC 5J89A 3FN3A 2ADIA 4BZ1H 3HMWH 4IDLA 3MA9H 4KTEL 1VPOH 4IRSC 2W65B 2MQCA 4QYOB 2V6HA 4KKLC 1P84K 1BOGB 3CC5A 4R8WL 1OW0A 2NZ9C 3MNZA 4BH7A 5GJTH 2I24N 1ZWIA 4YNYB 2WQ8A 4X83A 4K7FA 2OR7A 5J11B 4JO3H 4OFYA 3MRQB 1EZVY 5SWQA 1AKJB 3VXOA 1FNHA 3W0WE 4WW2B 4GKZA 5D1QB 4MQ7A 5DD5H 1T3FA 3BP6B 3HB3C 3QFJB 5BRZA 5IM7A 2DQEL 1NBZB 5CJOH 2FJHA 1OAKH 4NO5B 3WSQH 2APBA 5ERWB 3RWCA 3FRPA 3CX5K 1BWWA 1F42A 1M7XA 4OZHB 3ZZ1A 1RZ7H 4F7CA 5I9QC 1MCWW 2A73B 2IANB 5DD1H 1EEZB 1FLRH 1D6EB 4NQVB 2IBGA 2IH3B 1TIUA 2RGSA 4LCUB 3M8OL 2FYYB 1YEKL 2VRAA 2FLRT 3CPLB 5T1KD 4P5TA 3H9SD 5ITFB 4LRIC 4XMLL 4PJGE 5IVZA 3WFDH 4JHWL 3GSWB 4PJ9B 1WBZA 1AHWC 4P46C 3CMOH 3TBTB 3IKKA 3GHEH 3HNVL 1YPZE 1KXVC 1RIUL 2XICA 5JZ7C 1JVKA 1K3IA 3CDGB 4YFDB 2C4FU 5FDWB 4AEEA 4DK3A 4LU5H 2GCYA 1DN0A 1BLNA 5GGSB 2VC2L 3O2WL 2ZZUT 3HZKA 4G9FE 5ILTH 3GRWH 3VFWA 3JTSA 3ZE1F 4F7MA 1YNLL 2Y5TB 1S9VA 2P44B 3SBWC 4XCEA 3MOQA 5ACZB 2BY3A 3SJVA 3A6OA 4PJ8C 1S9YA 5DFTA 4ELMB 1RZIB 1CZ8H 2CDGB 4A6YB 1J0IA 1JHLH 3QWOA 4H20H 4PV8B 3BPLC 5D8JL 5DEZA 2ZPKL 1X7QA 4HXAL 5E5UB 5KSBF 2RB8A 4U0QB 1ACYH 1MY5A 2W59A 3VFPA 4K94C 1K8DA 1MIEH 2AKRB 3VXPA 4R26L 4GW1A 3T0ED 3ARFA 4IRJD 4G9DB 1CN4A 1X5ZA 1UVQA 2WZPD 4MA8L 4XP5H 3UZVB 4WWID 1ZOXA 1D5XB 3D69B 4OIIH 5GHWH 2XNAB 4R0LA 3F6IA 4RDQF 4XNXL 2H6PB 5F3HA 2PYFA 4TSBH 4YBHA 1ZHLB 3N50A 3V7MA 4AENA 2HH0H 4ZFOL 1JHKL 5F7MC 2CMRL 4XC1H 3T0WA 3D2UB 4AG4L 3LH2L 5DS8A 4ETQB 4HX1B 5C0AE 4GBXC 1CFTA 4JR9L 4RQQB 4LHJB 4M1CD 1CICB 4JG0L 5FHBL 5E56A 4PJ5A 5FM4A 4U05A 4MVBC 4DTGL 3HPJA 4JN1L 1U58B 4N0UB 1MREH 4FQ1H 4J1UB 3GJFK 3SOBL 1A7OH 2X4QB 5JW4Q 1OPGL 3IS0X 3O6KL 3VXMB 4HHAB 2F53A 4PRPA 1DN2A 1P2CB 4RGNE 3W11C 4MQSB 5F88A 1LK3L 1QLFB 4I18A 5J3HC 5HVWA 3DOSA 2GEEA 4HJJH 3F8UB 3INUL 1GOHA 3FO0L 1JGVL 4P4RB 4X6DA 1FZMB 3LSOA 1RULH 5KTEL 3C5ZD 3L3KA 1A6UH 4UDTA 5LAXB 3QIBD 1A0QL 4Z95L 4NGHL 3RJDA 1XGYH 3AMKA 3STLB 5T1LB 5C2UB 3ARGC 3STZB 4JM2C 1UENA 4DCQB 5TH2B 5J4MA 4JHAH 1ULVA 1PYWA 1CR9L 3BGFB 1SVCP 1IILE 1R3KB 5IB5A 1CDHA 3FO1A 2Z8SA 5JLZA 3RZCB 3O3BA 4R4BA 5JNYA 3T2NL 1NDMB 1ORSB 3B8SA 3ULUH 5FB8A 1Y6MR 1MFCL 4MNQD 5CP7A 3ZYZA 3ULUE 2AI0L 5H2BA 3O81A 3VD3A 3JWOC 4Y8AA 5IFHL 4JPKL 4YPGB 1ADQA 2DWDA 2K1MA 4JZNB 5HHVL 3T4YB 1AD0A 4Z7VF 1Q0XL 1DVFC 3E1F1 4G7VH 3J7HA 1BJMA 2W91A 5K59E 1U8OA 2VLRB 4KAQH 4XT1C 2JJSA 5HJ3B 1CE1H 4JFHD 5EDXA 4QGTA 2CDFB 4MYWB 4OD2B 5EO1A 3VI3E 4WFHE 1SY6A 3VGAC 3FKUS 1JTPA 6FABH 1FNEA 5DHYA 4J3XA 5D93B 4MS8D 4E5XA 1T2QH 1JCKA 2VE6A 1FG2A 5C0RL 2IC2A 1BF2A 4HSQA 4I2XA 3CJJA 1N3NB 2XA3A 3EYUH 4JQVC 4TNVK 1IEBB 3UO1H 4CVXB 2R23B 1RV6X 2A74A 1WK0A 1QLRB 1WF5A 4LSRH 5IBLC 5IESL 4M5YL 5C08B 1KNOB 4UDUB 5DTFB 4M5ZH 4FQQB 4G8IA 1R3JB 2BC4B 4U1IB 3OKEA 5KS9B 4C58B 1MI5B 3PP3K 4TVPH 1FH5L 1MQKH 4ONFH 2H1PH 4CRPA 5FM5M 1J9CT 4MDIB 2A6KB 5EU7E 3PQYD 3WFHA 1YY9C 2E9WA 5HVHB 1RZJH 3CDFA 3TGXA 3DX8A 3ILPB 2P47B 2WIIB 3MRPB 3JV4A 2YSSB 4RMTA 4JKPL 2VH5L 5DMYA 4N0RA 2SEBB 4XXCA 4RGNC 1LDPL 4X6EB 3K3QA 4J3TA 3FTGA 5AAWA 3LV3B 1DBAL 4OLEA 4JFZL 5JDSA 5E2WL 4PJDE 1FFRA 1MFEL 2AV1A 1Z3GH 2ZUQC 2Q86A 3BZDA 1LEGA 2UYLB 3NH7L 3IJHA 5F7KC 2HFFB 1INEL 3QA3A 1DDHB 4OI9A 4ZUSA 3VRLE 4JFOA 3RGVA 2YXFA 3N1MC 4KJPC 5SX5H 4Z9KB 4TULH 4EIZC 4K7PX 4OZHF 4QRPA 1C16A 1WAAF 4FG6C 1JGDA 3RWDB 4L4TD 4DWHA 3WFCH 3AU1B 2X70B 3UXFA 4Z7NF 4TQEH 3VWJB 3VG9B 2F54E 3H9HB 1DSFH 2R2BB 5GS3A 4G6AD 3QXUA 3ULUC 4EUPA 3P4NB 5IW1B 4JDZA 2ADGA 3HI6L 1JZ5A 1SJHA 2BXZA 5HPOA 1FZKB 4G6JL 4PJCE 3GKWH 3IJYB 1G7PB 4PIRF 3TBYB 3TVMA 1ZT1A 2OXGA 3GSRA 4XHJD 3MRKB 3HI1B 2WAHA 1HZHH 2QR0B 2QSTA 3D85D 3GSQB 4NQDE 2EZ0C 4YDVA 3TZVB 2F5AH 5EUOA 4OCYL 5AWNH 3T3PF 5FDYA 3OKNA 4M8VA 1QBML 1X4XA 2P43B 1RK0B 4PJEB 3QHFH 1S9WB 1XMWA 4ZXBC 2MWCA 5L6YH 4BQCA 1FC1A 4K3EL 2AJZA 3MSPA 4X5LA 1J1OL 2JB5L 4XPGL 4IHOA 5T3ZL 2EXWD 3QUMB 3QXDB 1A6ZA 1RJYA 3L1OH 1KEMH 4WV1B 4NQTA 5BQ7A 2NPLX 4ELMF 2Q7NA 1A4JA 1MCLA 5CJBA 5T33H 4Y2DB 1FL5B 3BMVA 1I85A 4U6VL 3RWFA 3D39E 4LF3A 5FYKD 3SDDC 2VWEE 2VL5A 5SWZD 2V5TA 1MQ8A 4XNQA 2HJKA 1AGDA 2OL3L 2BNQE 3ARTA 3PWLB 2DRUA 5CGYC 4X0KB 3PGFH 1A8JH 1K4CB 3QPQC 4BFIB 2VLJD 1P7QD 2DQIL 3QNZA 4YXLH 5C1MB 4E9LA 4ZUWA 4LCCC 4UT9H 3TBSB 4OLWL 4HV8B 2XKSA 5EOCJ 3HE7D 1ED3A 4Q9RL 5EU7C 4L8CB 4PRAB 2YRPA 4HUVB 4XPBH 3L95B 3RWEA 1J1PL 4P57A 5DGRA 1RZJC 3HMXA 3RVUC 1I1CA 2F8VA 5D1ZB 3MR9A 4N90D 2DLHA 4JFYB 2VN4A 5C6PB 4XXDB 4ERSL 1QRNA 3P30H 2AXFA 3TIEA 5A2KH 3BP5A 4LAQH 4YUEH 1RIVL 5T5FH 2QQKH 5IHUH 3DX6A 4MJIA 4I48A 1I3RA 5IMOB 3WNKA 4OF5A 3N0PB 3SDAB 1KIQB 4WFFD 5JHDB 2ADFL 2GT9A 3SCMA 2OX5A 1H15A 3BSZH 2IPKB 1X4ZA 1JHTB 5K9KB 4ZFOA 4FQXC 5CSGA 1JWMB 3W39A 4X7CC 1UXWB 1AKJD 1C08B 1YEJH 3U9PL 1S9XB 4NQSA 2YA2A 5FYLH 3O45A 4NZDA 5D1QD 1P84J 2FBJL 2YUZA 1PZ5A 2PTUA 4KK6C 2NX5A 5FYLE 4ACPA 3MUJA 4GMSL 2R1WA 3SO5A 3FB5A 2Z8WC 2R0WL 1QHPA 2YPLE 2UV3A 1NEZA 4L5FH 4XNYL 2IAND 3ARBB 1O7SA 1IGYB 3IDNB 4ENED 3EO0B 1EERB 3U4AA 3ULSB 1RJLB 4PJXB 5MHSE 5GRJL 1FJ1A 2DMKA 2J6EH 1J8HD 2AJXL 4OZIB 3T0BA 5EBLB 3C60C 4JFDB 4PR5B 4G80A 4NUJB 1I9RL 1JPFA 4F7EB 3CX5J 4JLRA 3FHAA 4JRYA 4PJ9D 1PVHA 3MFGB 1KB5B 3S3PA 3UPAA 2J8UA 4R7NB 4X99B 3L3JB 2QSCL 4ZUUB 5HGHA 2ORBL 4U1MB 3VJ6A 3OX8A 3KJ4B 2DQCH 4ZS7L 5DHVA 5D70H 2CRYA 5B21A 1F2XK 3CFIC 3A6CH 2EDBA 1A1NA 1U42A 3QDGA 3C2AH 1DBKL 2DQUH 4OCXH 5I19L 3CSYB 4M6OL 5JO5B 3UTZA 3ZKXB 4Z7WE 4XC3H 1B9ZA 2LVCA 2WWKT 4M6ML 4XNZC 2VWEC 4HJGA 4MA7H 1EUUA 4GMTL 4NJ9H 4WUUA 3AVEA 4YAQA 2AK4A 3L5WB 2R0LH 3MBEC 2VXTL 1FFNB 1LO3H 1JZ7A 4U1JA 1ETZB 4OKDA 4JO2L 2YD8A 2MCPL 3UTQB 2ERJB 1KCUH 5GRWA 2BVQA 1UKTA 3V4PL 4Z78B 1OSZA 2HT3C 4X6FB 4S0SD 3DROA 2BCKB 3NCMA 2WBJD 3IF1B 4JY6A 4NDMB 3B6SB 1JZ2A 1H0DA 2Z91B 3MJ8A 1DQLH 3D2UD 4KU1A 1TJIH 3SQBA 5IIEB 4PRIE 2HLFD 4U1HA 3NIGE 2O5ZH 2ZUSA 1N7ML 1CICD 5HYJE 4X7EC 3MGTA 1A6PA 1MAMH 2LFGA 3GMNA 5T5NF 1A1OA 4Q0XL 1KJ2B 1TCRB 5DD3L 4N1EA 4UINL 1BM3H 5HHQA 1BQUA 5IV2B 1T6WA 4L8DA 5MP6L 2UVEA 4OCRL 1M6OB 1CD0A 3VXMD 3DBXA 4G8EB 2P45B 2Q76B 5DR5H 2EEBA 2Z0BA 3WXVH 5CJXA 2C3VA 3MRJA 3FOMA 2V17H 1A5FH 4NZTH 5HDOA 1DEEB 2P5EE 4U6HB 2YKLH 5AYUL 5T1MB 4GG8A 3O8XC 3VD9A 4K7PH 1DCLA 4KKCC 4YHKL 3D25B 1JBJA 2JIXA 5C9KA 1UACL 4LKXA 4X6DF 3U1SH 3S8WA 5DVMA 1HHGB 5H94B 3TF7C 1DLHB 4N9GA 1V7MH 5TQ0L 3PDOB 4NHCH 5JDJA 4LFHD 3HG1A 3WFZA 5T1LD 3HR6A 4EXPX 2NY2B 5D9SB 4PLKC 4QRRA 5C09B 1V8HA 1KIPB 3TBVA 3MRIB 3RZCD 4NCC1 1GGYA 3UTOA 3V0WL 1KC5H 1MAKA 5C9JB 5D7SH 2GSGB 25C8H 2G2RA 1T2XA 4HS3B 1A02N 2H32B 1GAFL 5DRNA 2AJ3B 3FQXB 2FO4A 3MLWL 3DXAB 1B88A 1KCVH 4M6NH 5FK9A 4HKZA 5FGCE 3ELAT 1Y6NR 3RX5A 2R8SH 3P11H 4C54A 4OCSH 2ZG3A 2PKDA 2VLRD 4WFGD 2VABB 4ELKB 1XGQA 3AS0A 1HKFA 1AO7B 2QJDA 4FQJL 3Q6FA 1LHZA 2VXUH 5FYJH 2AEPH 3WFEH 2VDMH 2D7NA 3MRFA 1AY1H 2FSEB 3MCLL 2Z4QA 1QTYT 5FYJE 1IMHC 3QDMB 2VXQH 1CXLA 4MJ6B 4Y5XB 4AJ0A 1EEYB 4UTBH 3X3GH 8CGTA 4S1RH 1KJMB 4NUGH 3LIZL 4JVUA 1VFAB 3WLBA 3KGRA 1YEDA 3V8OA 4I0CC 1ZVSA 1WBYA 2NXYB 3DTXB 3LEXB 2DQGL 4PB0H 4RBPH 3R06A 5C08D 1GHFL 5TGBA 5DO2D 1X6NA 1Z5LB 4KKBC 3VFNB 3OR7A 2YK1L 4M4RA 2DLFH 3QIUC 4LCWE 1ZLVK 2VLLA 1TCMA 1MI5D 1S7VA 4IOFD 3MO1B 1U3ZA 5BW7C 5L9DH 1G7LB 2DN7A 3ZKSD 1HNFA 5D5MA 5ALCL 5A3ID 1QFUL 4G7YH 4L8BB 7FABH 2A6JB 5EU4B 3LB6C 2OL3A 4PRNA 1MVUB 3G08A 5TE4L 5GS0H 2QQQA 2OJZL 3QUYA 1G7QA 3UTSE 5I1GL 3REWB 4PG2C 3CFCL 4ZMAT 2CPCA 1DQMH 3TH2T 3QEQB 4KK9C 5GSRB 1GPOL 4JFPA 1SEQH 5J13C 4XBGB 1MFBH 3GM0A 4DOHE 1MCOH 3GMLA 4NKIL 3GMOA 3IGAA 1R5VB 2HJLA 4HUMB 4MD5A 5J12C 4MZ2A 2ITDB 1KELL 4NN7C 3VWKB 2H8PA 1IAOB 4JY5L 1T66D 3HUJE 5DFWH 5KZCB 2C1PA 3KPPA 5D71L 1TZIB 3MUGA 1TZHB 1Q0YH 5CILL 4BFGA 3V5KA 5E1AA 4M43H 5MERA 4YC2B 2DQFB 1B3JA 3RHWF 3ZTJH 4HWEH 3CIQA 5I1EH 4KJYB 3VWJD 3E3QC 2OR9L 5CZXC 1S7SB 1H3UA 4LKCA 4U1NA 2E8YA 1B2WL 1RSFA 4TPRH 2N7AA 2FEDD 4YHLL 4KI5F 1ZSDA 3ZT6A 1CU4H 5FOBA 3UTTA 3P9WB 2Z8RA 4L3AA 2HTLD 3VH8A 1BFVL 1LO0H 3OHXB 4LSTH 4QXWA 3K8MA 2Y7QA 5H37H 4UIKH 4XCNB 4XPTL 4CMMB 3TZVD 3ZO0A 4D94A 1LILA 3NZHH 1VACA 1JPSL 5EUOF 3GGWA 3TV3H 5HDBF 3RL2B 1KLFA 1J10A 5IMMA 5GGUA 3PWPB 2NY4C 3LKQB 3DO3A 1JYWA 1J0KA 1UCBH 3QWRD 5GGTL 3P40A 2P7TB 4X7SL 5D96C 2X4TA 5IB1B 3OZ9H 2AVGA 1F2QA 5EOTB 4KRMB 4Y5YC 3MODL 4XVUD 3GBLA 3BEWA 5BMFL 3ARDC 3FB7A 3IDMB 5FHAH 5EZJA 2HN7A 3V4UH 3P73A 1WT5C 5BV7B 4CN4A 4KY1H 3O3AB 5EBGA 5C0JB 2OQJA 4HIEA 4YBLB 2ZUTA 1RU9L 2AGJH 4QRTA 3QCTL 3MTRA 2FB4L 1U8NA 5SV3A 4KKNA 1FGVL 4H5SA 4M02A 4BSVA 3UBXI 2I07A 2XV6B 1MCKA 5D6DA 5AZEH 2CLRA 3EYQC 4F57L 2XZAL 4Y5VB 1WUNT 1S8DB 3GNML 5D1ZD 4NFDA 4JJ5A 5CZVL 2BXYA 4NNYB 3U0TA 43C9A 3VE0A 3UDWC 3AFLA 2QL1A 5H8DA 1TDQA 2YRLA 4LEXL 3ISWA 1IL1A 4CGTA 1FO0B 4TTGA 2MPAL 1V3KA 2RFXA 4WUKL 2Z31B 3GSNB 5CEXB 4E42A 1UB6A 1S7WB 3T0EE 4XP6L 2V5YA 3MV7E 1AE6H 3SKJH 1NPUA 2VQ1B 1DQJB 1Z9OA 4LSQL 3BYYA 3V5DA 4PGDA 2HT4C 2QHRH 1WVZA 3QEHA 4MX7A 2H45A 4FXGB 4AT6A 3QZWA 3HC3L 1VKXB 3DPBA 4YZFF 1QO3B 2J8HA 2AV7B 3A67H 4EN3C 4Z0XA 3ARBD 4NRXA 4FFVD 5E70A 4ZFZA 1DQTA 2VZ1A 1J1XL 3CFEB 2VDRL 1H5BA 5DJCB 1F45A 4OD3L 1NAMB 1VADA 3H9ZA 2XZQH 3WD5L 1J05A 3DSFL 4JFDD 4QOKA 1I8IB 3DYOA 3BXNA 3KLDA 2VDPH 1F4HA 3TWCH 2PN5A 5EOCH 5E24E 1P5VA 4WU7A 3Q6GL 4QRQB 3ZTJG 1FIGH 1WJ3A 1MHCB 3GMQB 3EO1A 1CLYH 4LOUC 1NMCC 3AREB 1XFPA 4JRWA 2EYTA 1FORH 1U93B 3V4VL 3WIHL 2KZWA 3O4OC 4R97B 1PLGH 4U6XA 4H8WH 5EU5A 3BI9X 4RFEA 4Z76A 4RZCB 3WJLC 3O2DL 4HWBA 4Q6IC 5IVOA 2MCG1 2R0KL 2GI7A 3L9RA 4X9FA 5D2NA 1JN6A 4Z7OE 1UJ3A 5BCAA 3KPNB 4KJQD 5FXCH 4F9LC 3K8KA 3OKMB 1YNKL 3RVTC 4EIGB 2KL6A 1JNHB 4LVOB 3CH1A 3CX2A 3NA9L 1HCVA 1FNSL 4YHIA 2HWZL 2W0FA 1LP9E 4I0PA 4UNUA 5F7DA 3V6FA 2DQTH 1VESA 4PD4K 2FLBT 1IKNA 4N5UA 4ETYA 5ESVB 1IC4H 3WNNA 1ZHNA 5B38B 2W9EH 4MAYA 2PCPB 5E00B 3OF6A 5D72H 3RY5A 2NXZC 1CBVL 1FFOA 3AB0B 4ORGB 3MJ7B 1RQ5A 4JFHE 3ZE0F 3W9EA 1JF1B 4R4FL 4PJHE 2ZOKB 4NRYB 1K8IB 4N8VG 1I8KA 5TJWK 3W81A 1TJGL 2D0FA 1RZ7L 4NQED 3RTQB 1KIUA 5ID1A 1NMAH 3T0EC 1QFPA 2QV2A 4IRJC 4HULB 4POZD 3RPKA 1HQ4A 3C8KA 3ZE2F 1R3HB 2R0ZL 5ICXB 1MRDL 2XTJB 5E7BA 1S78D 3AAZA 5DUPH 1IM9D 3RPIB 5C0BB 3OKYA 1JRHL 5DMGD 1DANT 1ERNA 1RURH 2HFGH 2HVJA 2VAAB 2FJGB 5CBAB 1S9KC 4ZDHB 4FMKA 4HLZG 3EFDL 2DICA 3CZJA 2W9DL 4LBEA 2OBGA 4FFYL 3CMOL 3EOBB 3EYSL 4YHMH 5GZND 3ZSTA 5B8CC 4WW1A 4HGWB 4XNMA 2GTWA 1DLFL 5HHNA 3NN8A 5KOMC 4M1CC 2XN9A 1K85A 4FZEL 5D7IE 3LS5L 3H7BB 2DQJH 1QEWA 1DUZA 3PQYE 2W92A 1RUML 4PP2B 3UMTA 4AL8L 3LN9A 3FRUA 2GFBB 2NY2D 4L4JA 1N5YH 3CVHL 2Z92A 3F7PC 5E8OA 5TFSH 4HEME 5C09D 5D7JB 3NPSC 1MFDL 1G9NH 2ED9A 5EZLA 3SDXA 5KANG 1D5ZB 4U7MA 4G43B 3FFDB 3F6LA 4TNWF 4ZG1A 3NCYP 4KK8C 3WO4C 5IFJB 1JHLL 1BQHG 1XAUA 3MCKA 2FGWH 3RWHA 4XPAL 2EDLA 3C5ZC 4H8WC 2GAZB 4XVSH 3QIBC 1NCBH 2YBRB 3FQTB 3DXAD 4X7TA 2HRPH 1JNLH 3HE6B 1CXEA 4RAHA 2NTFA 4XP4L 4HIHA 2A0LD 3KPOB 1SYSB 5DI8B 3IJSA 3D5OF 4NM8L 3L5HA 4FHBD 2X5PA 2DQHL 4L4TE 4ZFGH 3FFCE 4K3DL 4XVTL 5F6HI 2A38A 1DBBH 2DQDH 1AO7D 1PQZB 5IR1B 3WIIH 1HSAA 1H3XA 1QYGL 2X1WL 2E9JA 4BA8A 3DV6B 5A40E 1H8NA 3QDMD 2WUCH 3FB8A 2R15A 3VXRA 3MRRA 2D9QB 2UZXB 3OXSB 4AIZB 3V6BR 1TVBB 3IRZA 2UZIL 5TE6H 3EO9H 1NUGA 3OXRA 4BQ8A 5KSAA 2G5BA 1SBSL 3ALPA 1DQDH 4JZJA 5KW9L 5MENA 3K46A 2NXYD 5IEKB 3IKCA 3S35X 1QSEA 3VRJB 4H25A 5SWSA 3I3BA 1EO7A 4WO4A 4UQ3B 5GGTA 1A3LH 2PETA 3QQ4A 1D9KA 1N64L 2QSVA 3SE9L 2CK0L 1FAIH 4MS8C 1CT8A 4HC1L 5DDHA 4XBPB 1FCCA 2FD6H 4LGSB 2X1OA 4PREB 3KJ6L 4KTYA 4OTXL 1CTOA 4ZOCA 4L8SA 5IB3A 4L1DA 5D5MF 5JTWA 4CVWA 4I9WD 2AQ1A 5FYKH 1XGYL 4IRSA 4DW2L 5HGBA 5F6IB 1F6AA 5FYKE 1OLZA 4BK4A 1PKOA 1F4AA 4J6RH 4GKSB 1I9JH 5IMLA 2OMNA 1BWMA 1WFUA 4TRPL 4ZO9A 5IGXL 2JCCA 5JW5B 2WUBL 3QEQD 2VLJE 1OM3H 3DUSA 3O6LL 2CRZA 3V8CA 3AM8C 4OZFH 3MGOA 1QHOA 3HA0A 3QUZC 2GTZA 1MEXL 1YECH 4PJFA 3BFOA 5JPNB 4C59B 5DK0B 2NYYC 2AERT 1U8PB 3G5VA 1FZJB 4P99A 3V0AC 5BO1H 4N90E 4RDQG 5EN2B 2CRIA 5I1DA 3MA7B 5JXED 2HLAA 2DLIA 4JRXB 3CFKB 2EIEA 1G9NC 4KAQL 1T21A 5I0ZA 1CE1L 3O6FC 4XCCH 3MOAH 5C2BL 3LOWA 4J8RB 2BSTA 2W9LA 1ZS8A 1MJ8H 4MNGE 4K9EH 4QXUH 1MCIA 4LRIA 4JJHA 4UTAL 3D3VA 3HC0A 1T2QL 2X4RB 1JJUA 3NCCB 4IRZL 1AHWA 2MFNA 3HNSL 3RNQB 3JWDH 5DT1L 3D9AH 3FQWB 3ZTNL 3EYUL 5C0CA 3UO1L 4MLSA 1IFHH 2VLKE 1BQLH 4RMWA 4LP5A 5KVFH 2HG5B 1U2CA 3SE4C 4GG6B 2ZCLH 3GSOB 5F9OL 3ZL4L 5DEGA 4ONHB 3BH9A 3KYOB 3PWPD 3ZDXF 3HCVA 1VERA 1NUNB 2NY0C 2EXYC 4PBXA 3R0MA 3O41A 2A1WH 5IOPA 4HT1H 5DJYB 4ODWA 3I9GH 4G8GE 1ES0A 1T83C 1J8HE 3O4LB 4NKDA 4PJ8A 4XHJC 3FT4B 4LCYB 4N8CL 1A21A 3QG6B 2Q7YA 4AZ8A 4MXQD 5I74C 3WIHA 2B2XH 4LLYA 2Y6SC 4MJ5A 4ZO6A 4IDJL 4ODUA 3EOYG 1T0NB 3HC4H 3F12A 5CFHA 3EW3B 1Q9WA 4JFEA 3LKOA 3RIFF 5C6WH 2YN5A 3O2DA 4GO6B 3B2UD 1O5DT 1LD9B 2FWOA 4ZNEA 4UU9A 1XF5B 3D18B 2PYEB 3FT2B 1YMMB 3C5SB 2J2ZA 4TULL 1XR8A 4A6YH 4NOFA 4GBXA 1A6TB 3FQUA 3V79C 1BPVA 5IK3A 3HRZB 5I8EB 1DZBA 2IAMB 3IXTB 1JUFB 3BYTA 2DWEB 3VXQA 2Z31D 3FMGL 3HE7C 1XH3B 2NY7H 3CK0H 4K2UH 3ROOB 4G6ML 1Q72H 4ODBD 5J6GB 1F3JA 1E28B 4JVPA 3VFMA 2ZCHH 1T7ZA 4HKJB 3QO1A 4U6YA 5DD0L 2AS5M 3GKWL 4RFOL 1EHXA 1S7XB 4OLUH 4YHOL 1WLHA 3DSNA 4P59L 4ZYKB 1G7IB 3WNMA 4FQIH 1RUKH 1F11B 2ICWJ 2BHZA 1LEIB 4HCRL 1CFNB 1MCPH 3QH3A 3C8DA 1NC4B 4OKVA 3RA7H 4MLIA 3QHFL 4IEFB 1ZLSH 1JIBA 2EKSA 3BKCH 4NQCD 5I8KH 5KG9B 4HIIA 2Q1EA 1RVFH 5HD8C 5I9QB 4PJGA 4LLQA 3I75B 4K9EC 5J11C 2IQAB 3QIWA 5J1TC 2Y9RT 2RHEA 1LE9B 3GMMB 1N0XH 3PL6C 3QPXH 5IEHA 2LAAA 2H26A 3MV8B 1KPUB 2EYRB 2LU4A 4WW2C 5D1QC 4CN6A 3VXME 1BFOB 3NFNB 5D2LE 3JWDC 4KMLB 4AQ1B 4NQXA 5ADOH 3JXAA 3TH3T 4GAJL 4MB4A 4RAUA 1E4WH 2DF3A 3V6OE 1G0XA 5HDQH 5IVXB 4OM0H 4G9FA 4P46B 1IAII 3LEVL 2R2CA 2VNCA 3OJDB 3HZYA 4N0YH 3G5ZA 4ENEC 4PUBH 3ROLB 1KG0A 3GRWA 5J6HB 4UT9L 1OAQL 4ZD3L 3DIFA 1W72B 3A0OA 1DVFA 3GJFA 1TZGL 1ZLWH 4JFFB 4JN2A 2FX7H 3BWAA 1PX4A 3BRGC 3ULVF 1J12A 1T1XB 2JJTA 4J4PA 4PGJA 2ARJQ 4HIJB 5GSVB 2EDHA 1I1FB 2V7HA 4WTXA 5DRXB 4DVRH 5CD5C 3SKMB 2Y36L 1M71B 2DIJA 2F19L 3ZMRA 1JPGA 5JQ6L 3TBWB 3PWUA 1I75A 5L7XL 3QDJD 4KK5D 1OTUC 5IHUL 4KFZC 5B4MD 3NIFE 1NFDE 4XCFH 1QP1A 1JZ8A 3NACH 3S35H 5JA8B 1MCJA 2LU7A 2Z35B 2CKBB 3E6FA 3O3EA 1RZ8A 1ZXQA 3VXUA 1KENH 4YIQA 1BZ7B 2YA1A 1WISA 5F1IA 4HXBL 3IXAA 4Z5RB 2D03L 5DMJB 5IHZB 3WUZA 4FQLH 5I1CL 3V2AR 2VLRE 4WFGE 4OIBA 3MFFB 3VFTB 2UVFA 3LQZA 4HDIA 3X14B 3H3PH 3MLRH 1SMOA 3WL9B 1CQYA 3I6KB 1BVKA 1NSNL 1P4IL 3EIFA 4P3CL 5JIHA 1AI1L 3UJJH 4O2CB 4Z7UB 3LN4B 4WCYH 1PSKL 2XTJD 4NO3B 3WV0A 3QQ3A 4DUVA 5LXGH 1L7IL 4NJAL 4QXTB 4OV5B 2WBJC 4XMKL 1KSRA 4K07A 3BDYL 4WWKC 4BZYA 4O58H 2E8ZA 1LQSR 2NMSA 3W0WB 5CINL 1I7TB 4MA3B 4U0RC 4WTWA 2GHWB 4YHNA 5KOVC 5EO9B 1HXYB 5EULV 5KS9E 3BKMH 1NL0H 5EIQA 1UH4A 2C9AA 5EFIA 5GIRB 1A6AB 3D87B 4OLVH 1NGQH 5C0EB 5JIIA 1AJ7L 3I2CL 4LHUB 4H1LB 4NO0A 1XF3B 4X4YB 3CUPB 1VA9A 3A6CL 2ATKB 1M7IB 2DYPB 4XX1E 4GOSA 1NGXB 5ALBH 1VGKA 4UV7H 3WIFA 1UM6L 3RL1A 2AJSH 3ARGB 1JGEB 1MRCH 5D7JD 3UC0H 3TJEH 4LGPB 3E6HB 4JM2B 3UYRH 3I02B 1U3HC 2X4SA 4MA7L 3V6OC 4GAGL 5I1KL 3GUTB 1BBDH 4UT6L 3P0VH 4NFCA 3SDXF 4L3EB 3RNKA 3TA3A 5I76A 1A2YA 1YPZB 3SGDH 1MJJB 1TTFA 3WEXA 4CVUA 1KGCD 4PRHB 4PTUA 3VA2C 3DX9A 1FVEA 5I17A 4Z7QE 1CLCA 2J88L 3HE6D 4TSAL 3S97C 3QJHB 3KDMA 4RMRA 5LWYH 1V3LA 2WWMD 3KHQA 5INCA 3ARVA 4F9PA 2G75A 3EJZD 3PGCB 2FJFA 2X4OA 3ULVD 3HAEB 5IB4B 3RZCC 5A2LH 1LVEA 1JGUL 4WDIB 3DV4B 4RMQA 3H42H 3TCLA 3VFRB 3FL7A 4UB0H 1A1MB 4LFHG 3VGAB 4QHNB 4LRNL 3KXFA 5FYJU 1T0MA 3U2SA 4D3CL 1WCBA 2ADJA 4X9HA 1Q9KA 1IAIM 1NC2B 3BZ4A 3O9WA 3T8XB 4YE4L 12E8H 1BM3L 1ODAA 3MYZA 4BUHA 1ZGLB 1OGTA 4M7ZC 2R56L 5DZLA 3BPCB 4Y2OA 4LCCA 1A14L 1BHGA 5HYQA 1OTSD 1CL7L 4PJEE 3V5HB 3TFKD 2M26A 3U36B 3AMLA 2APWA 3CLEH 2P8LA 1FFPA 3QUMH 1RUPL 5C0AB 4ISVA 3FAXA 1CGYA 4QHKJ 4YDIL 3U1SL 1CF8H 2GJZB 1T5XA 1CFVH 4RNRB 1A7PL 5CKAA 1MLBB 5FO9B 1WBXA 4O2EA 3VDAA 3KPRD 3GKZA 1HIML 2J5LC 2EE9A 2R2EB 2VZOA 3MLYL 1C12A 3PIQB 5EZIH 5DO2C 2EC9U 4M7KH 2CLZA 4BKLA 4LLVB 1NCDH 1D5BB 3CMGA 1D6VH 5I16B 4YQXL 3U7AA 4IOFC 1X5KA 4KV5F 3SKNB 4KTDL 2IH1B 5DMKB 1KYOK 5BVJB 3BP7B 3DGCR 4ZQKA 4GAFB 4LVEA 4OCNC 4XPFL 3OWEA 5HVHC 2VIRB 5TDNB 4KMTH 2HRLA 1N6QH 1ZGLM 5F7EH 3MMEB 4PJFF 4F37F 2ENYA 5FUZL 3STBA 1QBLH 4FQHA 1V7NL 5DJXA 3CLFH 4M6NL 5EWIL 1ONQA 2F54A 4V2BA 5E7FA 1SM3L 2J8OA 1FFQA 3MNWB 4JRXD 5A16B 2HKFL 3ET9F 4PJBE 1RZFH 2F58H 1CD1B 4OD1L 4RWHA 5BS0E 1EK3A 3QG7L 1IJ9A 4EI5B 5DJDB 5FKPA 4MWFA 3VXSB 2VDML 2ZG1A 1EHLH 4CAGA 1UB5B 4U1KB 1ZHKB 5F9JA 3VXNA 4WHYG 5BRZD 4NZRH 5T5NG 1PKQE 4ODHL 3V6ZB 1MCDA 2A9ML 1G7HA 1HHJB 1T66C 4XGZA 3T04D 5E2TH 3WJJA 3V7AE 1I7ZA 3Q3GA 4CUCA 3QDAA 4NUGL 4EI6B 4HCRA 4HPOH 5F72S 1V3MA 3JV6A 4L9LC 1ZEAL 1KEGL 1P4BH 3SGJC 1A4KB 3QNXA 3VWJC 2NQCA 2PNDA 4HFWB 3DRTB 4OM1H 4AYFA 5JOFA 2DLFL 4ZXBB 1MCWM 4TTDC 4FFZH 2FEDC 1HYSD 4PJXE 1CFSB 1GVIA 1S7RB 3D39A 5L9DL 4OZIE 3O4LD 3QI9C 1R3IL 3KYNB 3P0YH 2BVPB 3N06B 4MXVE 5LCVH 5E2UH 2BNQA 4KDTC 1J0YA 3TCXA 2N7BA 1JI2A 4MCZB 3MBEA 3RIAF 5DUML 3JVGC 4QNPF 4Y89A 5IJKA 4PJIA 5GS0L 5BJTA 3PABB 4C56A 3LEYL 1ZANH 1GC1H 2QLVB 2W60A 4ZO8A 1FGNL 4KHTL 5TQ2H 4DZBA 4NIKB 1MF2H 3SDDB 1VEOA 4QHUB 4Y1AB 1BFTA 1NGZB 5E4IA 3L3IA 4Q9QL 2VITB 2V2WA 2Q3ZA 1A7QH 1C5DB 4OI8A 2JK5A 1DQQB 1WZLA 4HZLB 3GSXA 4OLXL 4JM4L 2YUWA 1MFBL 3DVNB 2C7UB 3GEWB 1Q1JL 1U8LB 3T0VA 1H3PH 2PYED 2RIKA 1D5MA 1YMMD 4XVUC 4GW5A 3OV6A 4LPWA 1F00I 2AEQH 3BAEH 1G9MH 4CVZA 3BESR 4BZ2L 3O3DA 2IBZY 3ARFD 1Q0YL 4YFEA 2PW2A 3L7FA 4F7PB 4M43L 2IAMD 3MRNA 4NN6C 4ZSOA 5ISZA 4R3SB 3MRCA 3RHWK 4KKLD 2QEJA 1K2DA 5I1EL 4PJDB 4JDTH 1PX3A 3RWJA 2ZSWB 5I18H 2ICEA 4TPRL 2B4CH 4EVNB 1C1EH 4XCYB 3TC9A 3KNBA 4HQQH 3OKDB 4OZGE 1CU4L 5CHNB 5D1ZC 5I1IH 3EOAB 4FQXB 4UIKL 3UJIH 4YX2H 2L4OA 5IWLA 4AK1A 1LEKA 1X9QA 1B0RB 2A9NH 5FO7B 4Y4FB 2GITA 5HVGB 1JNJA 1HHIA 5E5MA 1MLCA 3V0VB 3BZEA 2DD8L 4JG1L 3UZQA 1S7UB 4XAWL 4ZAKA 3NZ8A 5DJZA 1QVOB 4NQEE 1YMHA 1KJ2H 2JELL 3QQNA 2Y06H 2J6EA 4I0KA 1RK1A 1MJ7H 4HH9B 3NFPB 2VXVH 3QEGH 3O6MH 4WFED 1UCBL 4PJGF 4C83B 2C3VB 4GRLB 1M7DA 2XPGA 2MKLC 3MV8D 4L29B 2PO6C 4PJCB 4AEIH 4LVHC 2VZVA 4LCIL 3OZ9L 3C60B 1L0QA 1MHEB 4MAUH 3L5IA 5JPMB 4NQDB 5D1XA 2Q8BL 1ZTXH 1RZKC 3M1BA 2PW1B 2W0PA 1REIA 2FIKA 4PY8I 3QCVH 4P46D 4LNRB 2XWTA 5ENWB 1OF2A 4HUWB 1N2RB 1MH5B 4F58L 5ESAB 4QY8A 3MRMB 1NMBL 2UY6A 4TUKH 4KI1A 4LQFH 1MJUL 3I84A 3ARQA 4JFFD 3DMMA 1WEJL 3IU3B 4LMQE 1CXKA 2AK1L 4P3WA 5AZEL 2D31A 3RDTC 5CCKH 1R5WB 3QHTC 2KQNA 1PAMA 1HCFX 5ID0A 3LMJH 4QHLB 1GC1C 5C0IA 4ZOEA 3ZHLA 1EZVX 5DRNB 4M1DL 1CLZL 3CSPA 4Q2ZB 5L2KA 1XIWC 2ZJSH 4HIXH 1MCCA 4J23A 4ODVH 1J7VR 3LKSA 2CIKB 1B0GB 4HUXA 4ORZC 3S37L 2OCFD 3L3HA 3S36X 1FL6B 2UWEA 1AFVL 2VISB 4EUPG 5KVEH 3DXAE 3GIVA 4L3CA 4GUPB 1F8TH 2VLMD 3TP4A 2MHAA 5CP3A 4CU7A 3BKYH 4JDVB 2QHRL 1D5IH 4HLJA 1BJ8A 4J3UA 3LRHA 1MWAB 2V2XA 2F74A 3QIUA 3TNNB 3ARXA 1G9MC 4P4KC 4YWGH 1JPTL 2X1PA 1YJDH 2GJJA 5BW7A 5E6IB 2A77H 5JR1L 4NNXA 1T1WB 3FO9B 3LKRA 4M7LT 4PRBA 3T4AA 1RMFH 2R4RH 4QWWD 3U6RA 2VDOH 1GGBH 1NBQA 1G9EA 3OGOE 1VGEH 4DQOH 3TM6A 3PWNA 2B4CC 4IS6B 2IADB 4MVBD 1U8MA 4PJ7E 2Q6WB 3KPSB 4PG2A 2VDPL 2GSIA 2FIRT 3HR5B 1XF4A 2CLVA 1KLUB 4DUXA 1BECA 1N59A 5ICYB 3B9KA 1WC7A 1IT9L 1NUFA 2XKNA 5J3HD 1IQWH 3OG6B 2YPLB 3MLTA 3P9MA 1B6UA 3W82A 4POUB 32C2A 1T22B 3O8XB 4U1SA 1S78C 4ODXA 2YZ1A 4BQ6A 2DYPD 1U8HA 4MB3A 3SGKA 1FBIL 4HUNB 5CBEA 3UPRB 4JM2D 3PJSA 3E2HC 4R7DB 2HVKA 3S4SA 5GZNC 1JWUA 1MCSA 3BN3B 3QEQE 3TYFB 4UNVA 4L3ED 3O0RL 1YDPA 4RIRB 1H3GA 3ULUF 3PWVA 4X6CA 1OP3K 1CD8A 3OKKB 4OLZH 5HYEA 4X6BA 4EDWH 3BHBA 3RWGB 3KLHC 2Z93A 3G6JA 4PRHD 5DSCB 5I6XC 3U7WH 5J9PB 4YHZL 1KJ3L 2DQTL 5C07E 5K59F 4KQ3L 3QBTB 5ACLA 4P2QA 5DQDH 3BP4B 1IC4L 1JK8B 5F9DC 4YBQD 1CGUA 3BDBA 3VI3F 4Z7WB 3TLRA 2AJUL 4WGVB 3R8BB 4EOWL 1SBBA 3MRGA 3LRSA 1CDBA 4EEEA 1CD9B 3TVMD 4YXHH 4P3DB 2XA8H 3QUXA 2O5XL 3VA6A 2BNRA 2ESVA 2H3NB 1L7TH 2HP4A 3TESA 1IGJA 1NC2D 1HOCA 3PWJB 3QFDB 2ZWLT 1S7TA 4HWZB 1KTLB 3PHQA 1NQBA 4KPHL 2A0LC 5DUPL 1JF6A 4NM4L 1ZA3B 3OGCA 4NOBA 2IFFH 2VKWA 4PGEB 2YD1A 2HFGL 1ORQA 5IBLD 5A2JH 2YUVA 3KWWB 1YJDC 2E6PA 2XQBH 4HBCL 4HK3N 2BJMH 5SV4A 1HWGB 3T2QA 3PWPE 2CUIA 1KPRA 4PRIB 5C0AD 5J57B 4Y5XC 4KKAC 2GUOB 3LHPL 5HY9B 5D6CA 5CSZB 2QTEA 3IFOB 4X8JB 3VGDA 4Y4KA 4C4KO 4F33A 5HYJB 5I8OH 5GPRA 1FNLA 4P9ML 4B5EA 4HK0B 4AMKH 5FECA 4HFUL 3UTSA 3IDIB 3E8UL 3H8NA 1AGFB 4ZFFB 5DURB 2V2TA 1G6RL 4KH2A 1Y0LA 4PJDF 3MNVA 5FYKU 3F7QA 2CXKA 2P49B 4GSDL 2C1OA 4Y19B 5E08H 5LJYH 3UEZA 4M1GL 3F5WB 4P2RA 3RKDD 4TNWK 2P5EB 3VRLF 1C7SA 1R24A 2EDFA 2BOCA 3IDGB 4P5KA 1U8KA 3KYKL 3QULB 1WICA 4N9OB 3KS0J 1AGEA 3FHQA 4DFHA 5K9OB 3MRHA 3FJTA 5J12B 2IPUK 2ZUVA 4XH2A 5EUKA 1QPPA 4JZOA 4LSUH 3NFSL 1UQSB 2HRPL 5KSBE 5HVFB 4KJPD 2B1HL 1HH6A 1Q9LA 5EU3B 4QF1A 3MRLA 1FO0H 2VQTA 4FG6D 5HHXH 3PV6B 3C2SA 1DP0A 3GSNH 2DQDL 3CFBA 4JO1L 5DK3A 4EI5D 1JL8A 4KMQA 2YD3A 3VXSD 3WIIL 2HFEB 4PJCF 4PV9B 1A7RL 1RD6A 4JB9L 1BEYH 4M48H 1IC5H 2EDJA 2WUCL 4RGOH 1A9EB 1QQDB 4MQTB 1MFNA 4NKOB 1W8OA 4X9BA 4D0CB 4NRZA 5FGBC 5I8CB 3VXTB 5E8EA 2VDLL 3C5JB 5GGQH 3L3DA 3F7YB 2PXYC 3VMOA 3CDYA 2A83B 3U0WH 3CFDA 4OLYL 2AEWA 1FE8H 1FYTE 1NLDH 4EXKA 2NW2B 1JZ4A 4YC2C 4NPYB 1WIOA 2EZ0D 2VDKH 1FQ9C 2K7QA 3SKOA 1UH2A 3WJLA 1TTGA 1NAMH 3CZFA 3BMWA 3H9SA 4NQCE 4ZXBD 4FQCH 3HZVB 2AABL 1MNUH 1W0WA 1AGBA 4FTVE 4D0DA 4P2OC 5HI3D 3ZDYE 3EYFB 1NBYB 5FO8A 5D96B 4F9LA 4GKOA 4K3HA 2DIBA 5JHLL 3S98A 4OI7A 4AY0A 4OQ1A 4Y5YB 3THMH 4FS0A 4PJIF 3TO4B 2MSPA 3DURB 3S36H 4OUUA 4Y1AD 4G5ZH 4N8VA 3MXWL 3N85L 2XY1A 5CGYD 1FDLH 3RWIA 3IFLH 1HILA 3QPQD 4S2SA 4LARH 4LCWB 4MDJB 3IETA 4PTTB 4LNVA 5D2NB 5JIKA 1YN6A 2IPUG 5IF0A 3PGDB 3EDKA 9CGTA 5DK2B 4UIMA 2MQ3A 1YUHB 5C86A 5MEQA 2QQNL 3QEUB 4MXQC 3RVUD 1KFAH 1PY4A 3DYPA 4DGVL 3WCYA 4U1GC 3I6LE 4UAOC 2AJVL 5I15L 4WEBL 3T65B 2EDDA 5LBSL 2X4PA 4JPIB 3QXAB 1W0VB 2IGFL 1GJIA 4OSUH 3QDJE 3L6FB 1IM3A 2ZUWA 5EG6C 2HMIC 3OPZH 4DOHB 1RUAL 4NZUL 3OG4B 1OAYL 1EFXB 3OJMB 3T1FA 1CK0H 4K7PY 1I4FA 3B5GA 3BW9B 3S5LA 1OGAA 1OARH 5GGRB 3CVIL 4FQXD 3HUJB 1EAPB 4R96A 5B8CA 1LE5A 4Y4FD 4KK6D 2WW8A 4LEOA 4QTHB 3U4EB 1X5JA 1BQLL 1OB1A 4KGLA 2Z31C 1BQHA 3BPNC 3VFUB 4YO0B 5CZKA 1IGCH 1QLEH 4TSCL 4EN3B 1MSPA 4WHTB 3VFVB 4MD0B 5I66A 3X12B 5I1HL 5GS1C 1Q8MA 4GRLD 2KPNA 5AAMA 5E94B 1MRFH 5L2JB 2XTJE 5IKCA 3I9GL 1LO4L 2K7PA 2BVOA 5EZOL 5J1AB 4Z0BH 5BZWB 35C8H 2O61B 3EYOA 3WNPA 4YHYC 2XKUA 4L1HA 2JIXD 2RQ8A 2B8OT 2YZ8A 4YXKH 3BIKB 1PJ9A 2P4AB 1E4KA 2FR4A 1BMGA 4S11A 4X80L 1BAFH 4I3SH 3T77A 3HG1D 3QIBA 1NMCB 1RHHB 1AGCA 4Q6YA 3HC4L 4JFQA 1AQDB 1EFQA 2V9QA 3O4OB 2M1KA 1JWSA 1U92A 1EXUA 1KPVA 5T1KB 4S1QH 2ED8A 2CRMA 4ZNCD 1GGTA 3TN0B 3KPLB 4Q6IB 1UZ8B 1C5BL 4A6YL 1KBGL 1TJHH 2G9HB 4MNQA 3MRBA 5E5RB 2XYCA 4ZUVA 4MMXC 1PG7X 1HH9B 4HKBB 4LIQE 2LTQB 4KRPC 3UP1A 1K5NB 4G3YH 1HNGA 2NY7L 5F3BB 3QJFA 4KQ4H 4FABL 4EBQH 2UWEF 5I75C 4ONGH 4K71C 2HT3D 3WDIA 1N5AA 4NNPH 4WTZG 4PJHA 1E27B 1ROWA 2WV3A 2LAGB 1S5IL 5IROA 4I3RL 3IU4H 2HJFA 2NXZB 1MPAL 1YYMH 3BJLA 3GHBL 3NIGF 4M03A 4QCIA 1NGYA 2VUYA 1OD9A 5E6ID 1KCLA 1O7VA 2P24B 4NYLA 3BT2H 1LO5A 2P8PA 4KK5C 4I4WA 1R0AH 5B4MC 3BO8B 3NOIA 3RUGA 4NKQB 1ZLSL 6CGTA 5DYOA 3BKCL 3KPMA 1HK6A 3T0EB 4IRJB 3K2UL 3G6DH 1A7NH 3MV7B 5T3ZD 2OK0H 5HHPB 2PR4H 4OZ4A 2BY2A 3KPSD 3MV11 1CGSH 2JJVA 2Y07H 5ADOL 1BZQK 5D7IA 3AM8A 5SX4I 3VRIB 3BDXA 4NO2A 5E99L 1IGML 2ATPA 1XR9A 5EC2B 4X5XB 4YDKH 1UA6H 5AG9A 1HXMB 2FHCA 3GSUA 2YPLD 1KV3A 4XP9H 2BERA 1P69B 2Z9TA 5C7XH 3RQ3A 5B38G 5LGJA 3I3DA 3O8XD 2R2HA 2XTJC 5IMKA 4TUJB 5MHSD 5KSUA 3KPRE 5F8RC 3NAAL 4I5BB 1YZZA 4UUJA 3RVXD 3JTTB 4F8QA 1EGJH 1LNUA 5FA3A 5AYQA 1YEFH 3EDFA 3MGAA 4DVRL 3HPLA 3GI8L 5ANMA 1FL3A 2FECL 1YEIH 1AP2A 2FZ3B 4NHUA 4CKVX 3WO4B 4X6CF 4R90H 4F2MA 2X42A 1T4KA 5C6TH 4RSVA 5JUEH 3WXWL 4G6FB 5F97E 5C3LD 3HS0A 3QCUL 4KVNL 3C5ZB 4L4TA 5F1NB 4UILH 1AIFA 3B9VA 1OY3B 4PRDB 4FZ8L 3U48A 2E27L 3R1GH 5D7JC 3X3FH 1GZPB 1A6WL 3GM8A 1YA5A 3QNYB 2ARJA 4KWUA 1FPTH 1BD2B 3MLRL 43CAA 3MV01 4Y16B 3TPUA 1S5HB 4CJ1A 3AUVA 1LP9B 2UY7A 3A6BL 3D85A 5BRZE 1ZAGA 2K3TA 3P77A 5KAQF 3WFBH 2BDNL 2IQ9L 4OAWA 5MEPB 3RX8A 4WCYL 5E2VL 2G60H 3VFSA 1F3DJ 3NABL 3D6GA 3MREA 5M7QA 3SDCB 3EJZC 5AUMA 4O2FB 4O58L 1EO8L 4AQOA 5J8OA 2GYSA 2YC1B 3EYVB 2NY5L 2OJEA 4MNHB 3AY4C 3FOLA 5IUSA 3M17A 3DGGB 4ZO7A 5KJRH 2I5YH 5ESQA 5HSFA 2HAZA 2XACC 5CUSH 5DUBB 1T03H 1NCCH 5HYJD 3U46B 2NW3A 4WY7H 4PB9H 4WRLA 4LSVL 4KUZL 4MCYB 5SWZA 3DO7B 1T89A 1E4XH 1EJOH 2XFXA 5HGDA 4YGVA 2W07A 4L4VB 4HKXA 5DURD 3Q1SL 5ALBL 2VLJA 4RCAA 5TF1H 1P7QA 2CUHA 5DRWA 1IARB 1OTSC 3K74B 3HE7A 1MRCL 2P5WA 3TFKC 3UC0L 4LLWB 4NP4L 4Y19D 4WGWB 1HHHB 1CG9A 3X13B 5DMIL 5DJ8B 2BRQA 4HPYH 1BBDL 1NDGB 3LZFH 3P0VL 1I8MA 2H2PD 2UUDH 3DYMA 3OJVC 4KK9D 4OFVA 1GZQB 3HUJF 3MQIA 4IJ3B 2F5BL 3SJVE 2NLJB 3QUZB 1U6AH 4NWUH 2GK2A 3FN0H 3IFNH 3NTCL 3V52H 1UWXK 3PQYB 2JB6B 4MMZC 2PYEE 1J86A 2W65A 2EDWA 4QYOA 5F6IC 1BOGA 3LKPB 2ITCB 4LHQB 2IPTL 2QADB 5GJSL 1U8JB 3U9UB 8FABB 2EIDA 4YNYA 4J7RA 4IM8A 3SO3B 1GGCH 2IALB 4K23L 4P23B 1UCTA 3O6FB 4EDXB 4CNIB 3K80A 3DVFA 3MRQA 1JNNH 5CZXD 1AKJA 2P48B 2VYRE 4WW2A 4YR6B 5D1QA 3ME0A 4PP1D 5FAAA 1ZK9A 3ARWA 3BP6A 3QFJA 4PGBB 5JW3L 1NBZA 2KKQA 5EIIB 2NCMA 4NO5A 1XF2B 1YQ2A 5ERWA 1IQDB 1F4WH 3PXJA 1OW0C 4OZHA 3GB7B 1NANI 3PP4H 2A73A 2IANA 1S3KL 1EEZA 1D6EA 1OAZL 4NQVA 3S96B 2IH3A 4E41B 4LCUA 2NR6C 3OKOB 3FFCB 2FYYA 1P4LB 3MLSL 1QKZL 5L0QB 1T1YB 3CPLA 2O93L 3C08H 1A6VH 5ITFA 2I9TB 5C0FB 3DETC 4PRPE 3L7EB 2NY0B 1LK2B 4JPWH 3GSWA 4PJ9A 4M00A 3ZHDA 3TBTA 3SY0A 1F58L 2X7LB 5HPMB 1PG7H 1QOKA 1G0DA 1QR1B 4WI6A 4P49A 1BBJB 1UWEH 3CDGA 1MHHB 1OAXH 4FOMA 4XZUB 5FDWA 1IZKA 3TO4D 2P46B 2R29L 5GGSA 5I74B 3CVHB 3WS3B 3MYJB 4KZDL 3GJFB 5IVXE 4XTRC 1D3CA 4P5TC 4M7KL 1YNTB 3BUYB 1WZ1H 1W72H 5EOQH 1XGPB 2Y5TA 1U91B 5F21B 4C4KT 4UOW0 4NT6B 1CS6A 4WHCA 5FCUL 4JFFE 5ACZA 2YMXH 3RU8H 2XZCH 2X1XR 4FQ2L 4WJ5B 4CU8A 1RZIA 2CDGA 4ELMA 4A6YA 1N6QL 4OGXH 5F7EL 4M7JH 4BSWB 3F58L 3MV9B 2X44D 4PV8A 4F37K 5EIVA 2WQRA 3CLFL 2Y25A 3TNMB 1KT2B 1L4IA 4I0PD 4RISL 2AKRA 4HS8L 1UM5H 4LVNB 1DBML 1ADQH 4G9DA 2EH7L 1RZFL 2F58L 1IEAB 5DEFB 1D5XA 2I9LB 3D69A 3K4ZA 3H0TB 2CKBH 4V1DB 1CDIA 2XNAA 4JQIL 4JCMA 3DVGB 2EC8A 4K94H 3TT3H 4BSJA 2H6PA 1EFXD 1ZHLA 1CYGA 4OZFB 2AJYL 1SY6H 2VLME 3CNKA 3MXVH 3D2UA 1OTTD 4PJAB 3M45A 3WKNA 4ETQA 1FYHB 4HX1A 1NLBH 4QTIL 4TYUA 4APQB 3F7VB 4RQQA 4O51B 4F3FB 3KR3H 1CICA 3ARFC 2WBWB 4HPOL 3GJEB 2IAMC 4O02H 4P48A 4I2XE 1BIIB 1U58A 2R69H 4N0UA 4J1UA 4EN3D 2X4QA 1CIUA 2ENSA 3VXMA 4HHAA 3VW3H 4MNGB 4Z7UE 2XWJB 1P2CA 3K2MC 4O9HL 1YEHL 5IBUG 3PHOB 1QLFA 4C55A 1KLGB 3L5XL 1U0QA 3B3IB 4P9HH 2E3VA 4Q7DA 4X4XB 3PL6B 5LCVL 2ZUYA 3SQOL 5BOPA 1KB5L 3MJGX 4P4RA 3RIAK 1FZMA 2VDQL 2EDEA 1QNZL 2VLKB 4CDHA 1ZANL 2QQLL 5TQ2L 1DFBL 4MD4B 2FX9H 1MFAL 5LAXA 4LOUD 2VTFA 3STLA 1QBAA 4H1LH 5T1LA 5FUOH 4DN3H 1NKOA 5DLML 3C09C 3STZA 4KJWC 3RGHA 1HKLL 4DCQA 5TH2A 2DBJA 1Z6JT 4I18C 3TT1L 1IAIH 4D9LL 1R3KA 4G8GB 4Z7OF 1J8HB 3K7UA 1NGPH 3P4OB 3AS1A 3RZCA 3TN0D 1NDMA 5ETUB 5I1JL 2XRAH 1ORSA 2WNGA 2YWYA 5H35B 1U95B 5E8NB 3VFGH 3ES6B 2AEQL 3BAEL 4QEGA 3ORJA 2CIIB 3FONB 1B90A 3GMRB 4Z77B 3BX7C 4KTEH 4H0GA 4OFIA 4L3EE 2A6DB 3KYMB 4EKXA 4YPGA 3RVTD 3TIDB 4R8WH 4JZNA 5T1DL 2YWZA 1G1YA 5EU6B 5FV2A 3T4YA 4X9IA 3BKJL 4PRHE 4QRPE 3WKMH 4JDTL 2R4SL 2VJXA 4U3HA 3JWOH 3LPFA 5T3XL 2VLRA 2X4OB 5HJ3A 3U30C 5C0ND 2CDFA 4OD2A 4ZUTB 1OP9A 4HQQL 5A2IH 3HAEH 4PJHF 4U1LB 1FZOB 2NXZD 4WI7A 2VR4A 1KUMA 2DJUA 3HMXL 1N3NA 4G42B 4CVXA 1IEBA 2R23A 3RUGF 3HLAB 1ZGLP 1KJ2L 2B0SH 5EUOE 1QLRA 2JJSC 4CN1A 3M8OH 3EJYD 1MJ7L 4DKEL 3QEGL 3GSVB 5BVPH 4WO4D 3MV7D 2BSSB 5C08A 1KNOA 4UDUA 2YD2A 5DTFA 4KZEL 1I9EA 3LQAL 4FQQA 2ZKHL 1R3JA 2BC4A 1GGIL 2WBJB 4XMLH 4U1IA 5KS9A 2HTKC 4WWKB 2ZOLB 1R5IB 1MI5A 3GBNL 5MEOB 2DM3A 1TQCB 2A6KA 1JFQH 4MDIA 5D7IF 1NBVL 4UOJA 1U8QB 5AEAA 3S9DB 3HNVH 4U0RB 3ILPA 2JLLA 4QWWC 3B2VL 2ZCKH 2WIIA 3MRPA 2WINB 1A7BA 1OT2A 2YSSA 3LRGA 4DGYL 2ZG2A 3QQ9D 2SEBA 4QRUB 5DJ6B 2VC2H 3O2WH 1R3LB 4X6EA 4R4ND 4PLJD 5CJQL 3MRDB 3LV3A 2YOCA 2WMPA 4KUCD 5DWUH 1YNLH 3BVNB 4LASL 5CCKL 2ZNWA 3IFPB 4P9HC 1BF8A 5D2LB 4UV4L 1E6OH 2UYLA 3ZYIA 4ZTOL 2HFFA 1A9BB 2GY5A 3CGTA 1DDHA 4GAYB 4DKFL 1U3HB 3GI9L 1NJ9B 4LLDB 3VMNA 4KK8D 4OFPA 4TUOB 5D8JH 3WNLA 2ZPKH 4XXCC 4HIXL 4ODVL 3D0LB 1S7QA 1I9IL 4G6FD 4R26H 3RWDA 2C3WA 2D2OA 1T0PB 2DBLL 3AU1A 2X70A 5DZNA 3JUZA 1X4YA 3VWJA 2DTSA 3BEVB 3ZKND 3H9HA 2R2BA 1D5IL 4XNXH 3SGDI 4QT5B 3U0PB 3RKPA 3P4NA 5IW1A 1JHKH 1AQKL 4NKMB 2FX8L 4LHUG 2CMRH 5HGAB 5IHLB 1FZKA 4AG4H 1BD2D 3IJYA 1G7PA 3TBYA 3VXSE 1KULA 1N4XH 2VZTA 4Y16D 3QRFM 3MRKA 3HI1A 5C0CD 4KDTA 4R6UA 2QR0A 3RBSA 1NFDB 3EOTL 2NX5E 3GSQA 4JG0H 5FHBH 3TZVA 5GGSY 2E7LC 3AS2A 5TDOB 1GGBL 4GS7B 4DTGH 1BGXL 4JN1H 1ND0B 3QNXB 1RK0A 4PJEA 2AXHA 1NCWL 2P1YA 5BXFB 1INDL 1WWWX 1S9WA 2RCSL 3EGSB 4QHMB 3GMPB 4YBQC 3SOBH 1OPGH 3O6KH 3SDCD 4HS6B 4M7ZB 1XGUB 2D0GA 2R1YB 3PDDA 3QWRA 3QUMA 3DHMA 3QXDA 1LK3H 3TVMC 1INQB 4WV1A 3UJTH 5C0DB 3L3OB 2AXGB 2KQMA 1KTDB 3INUH 2DI9A 1FL5A 3FO0H 4Y2DA 4BK5A 1KJVB 3VMPA 1B6DA 5KTEH 1IAKB 2J8UE 3WN5B 5B39B 2EC9T 3PWLA 4JQXC 4W4OA 4M61B 4LAJH 1A0QH 1CLOH 3HAEG 4NGHH 4X0KA 4L4VD 1K4CA 3K8LA 4BFIA 3TBSA 4HV8A 1TETL 5B22A 2O5YL 2J5LB 4MSWB 1A3QA 4Y1AE 3QDGE 4L8CA 4PRAA 4HUVA 1JGLL 1TVHB 3L95A 3W2DL 4ODTL 5DJAB 5KVMC 3T2NH 4DZ8B 1I85C 4RRPG 3OMZA 2OP4H 3GO1L 5D1ZA 1XGTB 4JFYA 4EDWL 4XXDA 3QUZD 2C3GA 2AI0H 3WS6A 5CIPB 4P5MB 3OQ3B 5EPMB 2EYSB 5IFHH 1BVLB 5F7WC 1MCHA 4TOYL 4JPKH 4RWYL 3RAJL 2BY1A 4PGZA 1RUQL 2ZNXA 2I60L 5HHVH 3QO0B 2NYYD 3PNWA 2QADD 5IMOA 1NFKA 4GW4B 4OCWL 3SDAA 5E4EB 1KIQA 1CCZA 2XWBB 2Y5EA 5JHDA 5F96L 2IPKA 4P23D 1JHTA 3RKDC 5K9KA 3O6FD 4IIQB 1JWMA 1VFBB 2KUTA 4OQTL 1UXWA 1C08A 3EHBD 5DVKA 5E8PA 1S9XA 4HUUB 5C8JB 3BPOC 1OP5H 4WW2F 5C0RH 3ESVF 3I6GB 3NCJL 2OTPA 5GS2D 1CL7I 3P4MB 5IG7B 3ARBA 4CU6A 1IGYA 3IDNA 4E41D 4OV6F 3EO0A 3SCMC 4L9DA 3FFCD 3ULSA 5IESH 4L9LB 1RJLA 5JMOC 4M5YH 4PJXA 4EI5C 1E6JL 4OZIA 5AZ2H 1G7MB 5EBLA 4JFDA 2XQBL 1MIMH 4PR5A 4NUJA 4F7EA 1FH5H 2NY0D 2EXYD 3KLAB 1ZHBB 5M95B 1KB5A 2X4NB 4B7LA 4R7NA 1CWVA 4X99A 3L3JA 2OZ4H 2COQA 3QI9B 4ZUUA 5BZDB 4U1MA 3VDBA 4JKPH 2VH5H 4WU5B 3FQNB 5BV7L 3B5HA 1LDPH 4HWUA 1VFMA 2Y6SD 3W9DB 5CGMA 4LSPL 1SYVB 3X11B 4W4NA 3BH8A 3UTPE 3HG1E 4LLUB 1F4XL 1HN1A 2OSLB 1EMTL 15C8L 3T0XA 5E2WH 3CSYA 5FM5O 5JO5A 1MFEH 4W68A 4ZTPH 4QRRE 3P9LB 3NH7H 5HI3C 5FA4B 3Q0HA 1INEH 2X89D 4U7SA 1Z2KA 1PFCA 1I7RB 3L5WA 3OAUH 3VD5A 1WWCA 2OM5A 3MV9D 1FFNA 5SX5K 3S6CA 1IC7L 3BIBX 5IVNA 4JANB 1ETZA 4YHPB 3VI4E 3ZKQD 2E6JA 3UTQA 1EO5A 5ICZB 1EA9C 1K4DB 3ECBB 4Z78A 4X6FA 2BOBB 2UZYB 2VAJA 4N68A 4NWTL 4V1DD 4DVBB 1UWGH 1IGFL 4IOSD 3QUKB 4NN6B 4R2GB 3IB4A 3IF1A 4NDMA 4HZAA 1I1AB 3EJJX 3B6SA 1ACZA 1XGRB 4BQ9A 2Z91A 5TDPB 1N8ZB 3HI6H 1EEQA 4G6JH 4OF3A 2YR3A 1MWAH 1QA9B 4M8QB 5IIEA 2YD6A 4APQD 3K4AA 3VGEA 2EDTA 3U0WL 3NCEB 3GFUA 3O2VH 4OCYH 1IBGL 3WHXB 5CLWA 5GRYA 4BQBA 1QBMH 5EO0B 1CDYA 1KJ2A 1TCRA 4X98B 5CEZL 3FCTB 4PJBB 1IVLA 5BS0B 5IV2A 5KN5A 1VB9A 1M6OA 2FATH 4K3EH 4JKKA 5LQBL 1NAML 1F6LL 4G8EA 4QXGL 1J1OH 2JB5H 1OSPL 2EEAA 2Q76A 4XPGH 5T3ZH 5HD8D 5DGQA 3MLPA 1BVZA 1PKQB 5EORL 5T3ZE 3WHE0 3KPSE 1NUDA 3PL6D 5BOZG 1DEEA 4U6HA 2PO6B 5T1MA 4LVHB 4U6VH 4Y4FC 3D25A 2OYPA 2VLKD 2FHBA 4AM0B 1BJ1H 1HHGA 5D5ME 5H94A 1K9TA 1DLHA 3MJ9L 3PDOA 3OB8A 2XIDA 2DLEA 5KSVB 4GQ9L 3DI2B 2DQIH 1OHQA 3DUHA 5D9SA 5DXWA 1IGTB 4XVJL 5CJXC 5I1LB 4HEPG 4GRLC 2BFVL 2C4XA 5C09A 1P7KB 3ALWA 1KIPA 4G8GD 4IMKA 1HYRC 2VXSL 5KBNC 3HN3A 4JO4L 1J1PH 3MRIA 2QBWA 4QLRA 3IDJB 3H6JA 3RDTB 1E4JA 5C9JA 2FCBA 2VQUA 4YK4C 2GSGA 4HWNA 4IOIB 2Z93B 4DAGH 4ERSH 1G7JB 4HS3A 1XCTB 3NIFF 1NFDF 2H32A 1YY8B 4RA0C 5CD5D 2MQ0A 2AJ3A 3FQXA 4D8PB 4CADB 4LMQI 3DXAA 5EU6D 5INDB 1OCWL 4OSUL 3WE6B 2B20A 1UC6A 1XIWB 3KVQA 1KB9K 1OTUD 4JY4B 1Q9OB 5EA0H 2ADFH 4Y4HB 2VABA 4ELKA 5I1AB 4RFNC 4UOW1 1AO7A 4MB5A 2DIAA 5IB2B 5JXAL 1H3TA 1ZT4B 2WM0A 4D2NA 3T0DA 1U36A 4F15C 2FBJH 3QDMA 3KXFD 3GK8L 4MJ6A 4XPHL 4Y5XA 3HZMB 1KCKA 1UADC 4JE4B 4P4KB 1EEYA 2VDNL 4GMSH 3H3KA 1KJMA 2GW5A 2ICWI 4CJ0A 3BE1L 1VFAA 4XNYH 1LDSA 1DUYB 1KXTB 3MLXL 3EFFB 1HEZB 3DTXA 2LU3A 3LEXA 4QGYA 3G5YB 2BRRL 3C6LB 4S1DC 5GRJH 2IG2H 2XQYK 3N9GH 3FO2B 2AJXH 4YDJB 1Z5LA 4OZGB 2EE2A 3RVVC 5GGVH 4XB8A 2EIZB 3LKNB 3VFNA 5DQ9B 1I9RH 2E9BA 4WWKD 1KTKE 2YUXA 3U7YL 4Z0BL 3MO1A 2JJUA 5KS9F 5E6IC 2BNUB 1G7LA 1RZGB 4F33B 1P9MA 5E8DL 1CTNA 4PBWD 4L8BA 2A6JA 2QSCH 5EU4A 2ORBH 1JZ3A 1MVUA 1PZUB 4NQEB 4PS4L 5I73B 1T7VA 3TPKA 1KN4H 4N0CC 4ZOBA 4RMUA 1T7XA 2YXMA 1DBKH 2ZUXA 2E7MA 3REWA 3VFOB 5I19H 1IM9B 3QEQA 4ALAL 1KOAA 3BGMB 2V7NB 4N5EC 5GSRA 4XBGA 1RPQA 4M6MH 3GIZL 3IDUA 1R5VA 4Y19E 5L88H 1CGTA 4IMLB 2ITDA 1U3HD 2JKXA 3E2HB 1SJEB 3VWKA 2VXTH 4K8RL 1IAOA 4RX4D 4Z7QF 3SE8L 4JO2H 5DC0A 1TZIA 1TZHA 1UYWH 2MCPH 3QUYC 5JXEA 3B5TA 3V4PH 3ZT7A 1WTLA 2YPVL 2DQFA 5I6XB 3CFBB 4KJYA 4AEHL 3B9AA 3RVXC 1S7SA 1JE6A 1NAKH 4NNPL 3MPCA 4FXKB 4OQTA 4BELD 3ULVL 3QISA 5KANI 2YPKB 4HWBL 5DJ0B 5B3NA 3SPVB 2BSRB 3OHXA 3BT2L 3E3QE 5K93A 4X5WB 4XCNA 4CMMA 1N7MH 5FGSA 3REVB 2XQYG 5AD0B 2CJUL 4X4ME 5K33A 5DD3H 3KHOA 4UINH 4DFIA 2XZZA 1U8IB 1LWRA 3RL2A 4PJEF 5MP6H 2ICWB 1E0OB 2PR4L 1XT5A 2E7HA 3PWPA 3LKQA 1TPXC 5F89B 2Y07L 4NSKB 2P7TA 2XXMB 1FAKT 1HDMB 4QOKE 5E95B 2Y72A 4I77L 4YDKL 5IB1A 3AS3A 5EOTA 1AD9B 4YHKH 4C56D 2X6MA 3IDMA 3U4BL 1UACH 3FN9A 4M7LL 3O3AA 5TQ0H 3K81A 5C0JA 5GISL 4PJ7B 3IS1X 5D4QA 3MROB 4FFWD 1EIBA 1EGJL 1YEFL 4Y5VA 1S8DA 1FVCB 5A1AA 4H88L 3NA4A 5D2NE 5IBTL 1TENA 3HNTL 4NNYA 4PGCB 1GAFH 3KLSA 1CE6B 3CFJB 3MLWH 4CW1B 1TXKA 1AH1A 4XMPL 4N0FB 1FO0A 1DBJL 4PJBF 1DE4B 1PGRB 2Z31A 3GSNA 4E0RB 2ARWA 5CEXA 2VO5A 3MOBL 4WNQB 2OTUB 3O3UN 1S7WA 5D6DC 3C9NB 5CD3B 1T20B 5JIPA 1UFUA 2H2PC 2VQ1A 4FQJH 1DQJA 3L5JA 3O11B 3MCLH 4FXGA 4WI5A 1YQVL 4Y7MA 1JZ6A 4OT1H 4U7KA 1MCBA 1HSBB 1VKXA 1H3WM 5K9JL 3LIZH 5C07B 1ZA6B 2AV7A 3WYRA 4ZAKD 1LGVA 3VGBA 1I3VA 2PXYB 1I8LA 2DQGH 3CFEA 4RBPK 1HWHB 5EC1A 5C0GB 5DJCA 1NAMA 2A6IB 1GHFH 1GIGL 3MACH 2L0DA 1GOGA 4PJXF 4ZPTB 1GXEA 1I8IA 2YK1H 3S88L 1TLKA 4OZIF 5KJRL 4XP1H 4PP1C 4MXVF 1TVDA 5CUSL 1PD6A 4TTDD 3HKFA 4QRQA 1H8SA 1MHCA 5ALCH 3GMQA 1QFUH 4PB9L 2BMKB 3IDYC 4P2OB 4HG4K 2X4UB 4QHKI 4WTZA 3AREA 3DHJA 3QI9D 5JORB 1EJOL 3MJ9A 3KPQB 1U93A 2XN9E 1H5BC 1I3GL 1YEGL 3CXDL 4OJFH 2OJZH 4RZCA 3MLVL 1HHKB 3EBAA 5I1GH 3CFCH 3S4SG 3HI5H 2EH8H 1LO2L 1F4YH 1GPOH 5L8KB 3KG5A 1BOYA 3S7GA 1HQRB 2ICES 3CU7A 4LDLB 4NKIH 3SDXE 1KELH 1OT1A 5DFVD 3KPNA 3OKMA 4LLMB 2HA1A 4JY5H 2CQVA 1UM4L 1JNHA 3LS4H 4BH8B 1NCAH 5D71H 1WZKA 3TO4C 3DRQB 4GRMB 5DRZB 5HGGS 5CILH 2HFTA 3C6SB 2FL5B 1QFWL 4U1GB 4UAOB 4M62L 5ESVA 1GGCL 3DX7B 1AXTH 2OR9H 4D9RD 5B38A 1EBAA 3P4LA 5D2NC 4OZGF 4R2GD 2PCPA 5E00A 1NGWB 2P8MB 1I1AD 1UJ3C 4YHLH 4ORGA 3MJ7A 5KAQG 2NNAB 3QXTA 1JF1A 4JREC 2R39A 2ZOKA 4NRYA 1K8IA 4KHXH 4XPTH 1JV5B 5KSBB 4JFXB 4I0PC 3RTQA 3HFML 1FVDB 4LSSL 2E9IA 1R3HA 5ICXA 3BJ91 3I50L 4MJ2A 5BS0D 4JHBA 4MAYC 5DQJB 3RPIA 5C0BA 1Y6KR 3BPNB 2J12B 1AXSB 3G04B 2VAAA 2FJGA 4LL9A 3I3EA 4NN5C 5CBAA 4ZDHA 1FV1B 4Y0GA 4JAMB 3MLUL 3BZFB 4X7SH 1OTTC 5GS1B 4D0BB 3EOBA 3OKLB 1FNFA 2PO6D 4HGWA 4UT7L 4JGJA 2OTWB 1CFQB 3MODH 5BMFH 4X4ZA 1P1ZB 1FYTB 1OAXL 3H7BA 1J18A 3RRQA 5IQ7H 4YHYB 3SDYL 1G6RB 3MUY1 4PP2A 2MKWA 2PTTB 1OQOA 1RU9H 4K3JL 2GFBA 3DUUB 4OIAA 3AGVA 3ZDZE 3QCTH 5DD6B 5FF6B 2FB4H 1W72L 5EOQL 4NQCB 2D7QA 1CVRA 1FGVH 5D7JA 1Y18B 4FTVB 2FDBP 4QRSB 2JCCE 2CDEB 1D5ZA 5GRUL 4PFEA 4G43A 3FFDA 4F57H 5DJ2B 5IFJA 3RDTD 1ZT7B 4OGXL 3GNMH 4JPVH 5JOPE 2VB5A 1UKSA 1XCQB 5CZVH 1RJZB 5C71A 5IJVB 2R9HC 5KVGL 3FB6B 4PJFE 3CU1A 5ADPH 2GAZA 2GK0B 1EHNA 4LEXH 5E1HB 2YBRA 3FQTA 1MUJB 4P2QD 3HE6A 2MPAH 4WUKH 1XIWD 3ILQC 3KPOA 1SYSA 4XWOC 2D9CA 5DI8A 4K94L 4Y4HD 4KRPB 5CEYB 3IDXL 5H37G 3WUWB 1PQZA 3QYCA 5IR1A 4LSQH 5D7LB 4Z8FH 1IKFL 2YEZB 3TN0C 1RFDL 5I75B 4K71B 4S0TD 3DV6A 5IQ9B 1A3RL 3HC3H 1M05B 1RIHL 3QUXD 5E9DB 1T04B 3OXSA 2Q20A 1KB9J 4P4KD 3RVWD 3UBXB 4AIZA 4BZ1L 1BD2E 1TVBA 3HMWL 3MA9L 3G6AB 2J1KA 1AC6A 1BZ9B 1VPOL 2LTQC 4O02L 1U3JA 3LN5B 4Z7VB 3QDJB 3BQUB 4UQ2B 1WCQA 5C0CE 1RAMA 1J1XH 5IEKA 4PJ7F 4OB5H 3VRJA 5M94B 3C6LD 4OD3H 4PG9B 5GJTL 5C0NC 3WD5H 3DSFH 1A47A 4UQ3A 2EECA 2WBKA 4MHHI 4JO3L 5HHOB 2H2SC 3TJHD 3Q6GH 3OR6B 4XBPA 5DD5L 4H26B 4PLNC 2WWKO 4PREA 2OXHA 4ZPVB 5CJOL 1OAKL 3WSQL 1FN4B 4W6YB 4JZJC 3AXLA 4QNPE 3V4VH 3WIHH 1UXSB 2E6QA 5SX4H 2FEEI 5FUOL 3G5XB 3EJYC 5DD1L 3MX0A 4WO4C 1FLRL 3PE9A 4GKSA 1I1YB 2NY1D 1D9KC 2ZSVB 5JW5A 3O2DH 4L4VE 3PF2A 4P2RD 1EGJA 1BX2A 2R0KH 5JMRA 3WHE1 4KVCH 3WFDL 4ZNEE 4GKNB 2H9GB 5HDLA 2GQHA 3GBMH 4GRWH 1YNKH 5JPNA 3GHEL 5DK0A 3NA9H 4B7IA 4GRWE 1FNSH 1U8PA 1FZJA 3QQ9C 2HWZH 5FKAB 4R4NC 5EN2A 4PLJC 3KLHD 3WKML 3MA7A 4LU5L 4JRXA 3JWOL 3CFKA 2RR3A 3G9AB 5ILTL 1NFIB 5CGTA 3GRWL 1W8NA 1I7UB 2LVEA 3S5LG 2DKSA 4J8RA 1KCSH 1CBVH 4K3GA 3IVKB 1T1ZB 1G6VK 4JCLA 1L0XA 1Q94B 4R4FH 2X4RA 1CZ8L 1IGIH 1JP5A 5I2IB 3RNQA 4H20L 1TJGH 2Q8AH 3FQWA 5F1KC 3VCLB 4PY7B 1FLTX 1ACYL 2B0SL 2HG5A 1MIEL 5GS2H 2R0ZH 4GG6A 1MRDH 3GSOA 5BVPL 2X1QA 1T5WB 4ONHA 1XZ0B 4XP5L 3ZKNC 3H9YA 4OGYH 5GHWL 3KYOA 4OIIL 1FNGB 1JRHH 4E41E 1MCFA 4DKDC 2MOVA 5DJYA 3CCHB 3EFDH 4TSBL 2W9DH 5DVOA 2HH0L 3N1PC 1JFQL 4FFYH 2CO6B 4XC1L 3EYSH 3O4LA 3SY0B 4Y16C 4U31A 1DLFH 3FT4A 4MQXD 4LCYA 2CUMA 5CAYB 3QG6A 1GSMA 4FZEH 2ZCKL 3LS5H 4G8FB 2GY7B 5CMAB 1YN7B 4KKAD 5HYSB 2CKNA 4RAVB 2JF1A 4HGKC 1RUMH 4AL8H 1T0NA 1SEBB 5EBWB 2BVTA 1MREL 4FQ1L 3SDCC 3CVHH 3FT3B 5DWUL 4UI2A 1A7OL 2B1AH 3GJFH 4Q9CA 2GJ6B 2FECI 5IW6B 3FQRB 5D7KD 1MFDH 5E6ZA 1LD9A 1E6OL 4U4BA 3ARUA 4F7TB 4KRLB 3T2PA 5CLTA 2NY6C 4J2XA 4JVWA 5F9WC 1XF5A 3D18A 4XRCB 2PYEA 2QKIB 3FT2A 1E4XI 1YMMA 4HJJL 3L3GB 3C5SA 4CMHC 4XPAH 1A6TA 4NC0B 1RULL 2CD0A 2IMMA 3VG0H 1QSFB 4U3CA 3MV9E 3HRZA 5I8EA 5ITBH 1A6UL 2PUQT 2IAMA 3IXTA 1JUFA 4XP4H 3KPRB 1UT9A 1K6QH 2DWEA 4AH2B 1XH3A 3EZJB 4NM8H 3BD4A 3ROOA 5F7UA 2DOCA 2DQHH 2R1XB 5J6GA 1HI6B 4K3DH 4XVTH 1E28A 3S3SA 4JHAL 3VXUE 1KIRB 2W1NA 4HKJA 4V1DE 2HKHH 1QYGH 3TO2B 1OGAD 3OL2A 5TPWH 1S7XA 4IJ3C 4FXLA 3BRFA 3M07A 1N4XL 4ZYKA 1G7IA 3ULUL 1F11A 2ADIB 2UZIH 4PJAE 1LEIA 5C07D 1CFNA 1SBSH 1NC4A 2QADC 3CC5B 5KW9H 2PXYD 3MNZB 4G7VL 5KG9A 4JGUA 3SO3C 4G6KH 4BH7B 3I75A 1ZWIB 3NMEA 4P23C 3E0GA 2IQAA 1VFUA 4K7FB 2G5RA 3BN9C 2NTSP 3Q5TA 1LE9A 3GMMA 1NANH 1N64H 3EHBC 3MV8A 4HMDA 3ZDYF 3SE9H 1KPUA 2EYRA 3UJTL 2CK0H 1BFOA 3NFNA 5IW3A 5SWQB 3VXOB 4HC1H 4GKZB 6FABL 4MQ7B 1T3FB 3IAQA 5IM7B 5BRZB 3KJ6H 4OTXH 4P2OD 3R4DA 2FJHB 1H9VA 3RWCB 5IVXA 4P46A 1CLOL 3ARSA 3N1QC 4DW2H 4F7CB 3OJDA 5I71C 3ROLA 5J6HA 3QIWC 4LSRL 1W72A 5L0QC 5IGXH 4TRPH 2YD7A 2DTMH 4JFFA 2WUBH 1T1XA 4P5TB 3O6LH 4M5ZL 4HIJA 5GSVA 4HG4J 3EUUA 1M4KA 1I1FA 4NCDA 3VGFA 5GXBB 5IVZB 2OP4L 3SBWA 4TVPL 1MEXH 3PP3H 1MQKL 4ONFL 2H1PL 3HRPA 5DRXA 1WBZB 3SKMA 5DF0A 1M71A