5GRYA

Crystal structure of disulfide-bonded diabody
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
231
structure length
226
Chain Sequence
VQLVESGGGLVQPGGSLRLSCAASGFTFRNSAMHWVRQAPGKGLEWVSSIWYSGSNTYYACSVKGRFTISRDNSKNTLYLQMNSLTAEDTAVYYCARFAGGWGAYDVWGQGTLVTVSCDIVLTQSPATLSLSPGERATLSCRASQSVSSNYLAWYQQKPGQAPRLLIYDSSSRATGVPARFSGSGSGTDFTLTISSLEPEDFAVYYCHQYSDISPTFGQGTKVEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of mono- and bi-specific diabodies and reduction of their structural flexibility by introduction of disulfide bridges at the Fv interface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords diabody
total genus 51
structure length 226
sequence length 231
chains with identical sequence G
ec nomenclature
pdb deposition date 2016-08-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5gryA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5gryA01
2DLFL 1U8LA 1XCTB 2Q7YA 4YBHA 3LRGA 3KPPB 3PP4H 1NSNL 3TVMC 3DJ9A 2H9GA 2DWEB 1L0XA 3KYNB 5CKGA 2R0WH 5AG9A 4EQ2A 2IQAA 2BOBA 4PG2A 1IC7L 5IHBA 5EU6A 5HHOA 4HPOH 2BX5A 3O45A 2A9MH 4G8IA 1A1OB 1OM3H 5BZDA 3T65B 3KPOB 4UB0H 4PGEA 1NBZA 2IALA 5EBWA 4JKPL 4LSSL 4PP2B 4Y5YA 1LO4H 4ZNEA 3QIUD 3GKWL 3UPAA 3ARDD 3SPVA 4U1GB 5C08B 2MNUA 1ZT7A 2P44B 2A73B 1QSEB 1QO3B 3QG7L 2G5RA 1XMWA 2DJUA 5HGAB 3TNMA 5CP7B 3EZ8A 4UMGA 4F15C 5DVLA 1RVFH 1Q9KB 3BYYA 5BRZD 3BZFB 1IVLA 3VD4A 5I0DA 2AXFA 2R9HD 2YUWA 1P5VA 1DUZA 3LN4A 4LSQH 1YEFL 4M61B 4LFHD 4LLVB 3PWPD 1BM3L 5F3BA 1P7QB 2Y5TA 2CXKA 5F7DB 4OCYH 5DJCA 3JTSB 1WISA 3GHEL 2QBWA 3U9PL 3RUGF 1A9BA 1FH5L 3IETA 3PHQB 1WBZB 5DJ6A 4DWHA 1OAKL 5F89A 2MCPL 2LE9A 5D6DA 3BKJL 3P11L 3UO1H 4FOMA 3D9AL 1JHLL 2XQYK 1NCWH 4LLDB 2WWMD 2W0LA 3ZHDA 4BZ1L 1BQLL 3UYOD 1GCFA 1J12A 4RGMC 4O2FB 2H2PC 4JPKL 4PRDA 4Z5RA 5GGQH 3S9DB 2NXYC 1NFIA 3X3GH 2B2XH 1JGVL 3QCUL 4XXCA 3V2AR 1S9YA 1S9VB 2ZUWA 4FQHA 4OSUL 1A6PA 1N6UA 5HI4C 3REVA 1TVBA 1GJIA 3MCKA 3VFNA 4M7KH 3FN9A 4TSBH 5DZOA 3FO9B 1J5OH 5F9OH 4JM2F 3D3VA 4Q9RL 12E8L 5E2JA 4M5YL 3TO2B 2J5LB 1IKNA 1T22A 1FV1B 1HHIA 2ZOKA 1PFCA 3LN9A 3UJIH 4HBCL 4KROC 3OXRB 1QR4A 2QKIA 3WIHA 3HNSH 1RJCA 5FDWA 2Z91B 5AWNL 1QBBA 5IOPB 3NTCH 1KGCD 3OSKA 1O0VA 3NCYS 1CXLA 2BRRL 5EUOB 5IK3A 3T0DA 1UKQA 4TSCL 6CGTA 4J12A 1OL0A 1XGUB 4PBXA 4KQ3L 1CFSB 5INCA 4R3SB 1RUAH 1JV5A 5B8CB 3T1FA 4MD5B 4X6DA 2PYEE 4YE4H 1HKFA 4M8QA 5KTEL 5KVDH 3MNVB 2EH8L 4BFIB 4NCDA 4PJCB 4NHCL 3SE3A 1G84A 2HJKA 3JV5A 2ITCA 5CGYC 1OD7A 1LO0L 3NFPB 5FK9A 5LQBH 3ET9F 1AR2A 1FSKC 4HWZA 4AIZA 5L6YL 5I17B 1MIMH 2YD9A 3KHOA 3MNWB 4OUUB 2DQJL 3RY6A 5SWZA 4XPAL 3UTSE 2NY0B 1AE6H 2PTVA 5TFSL 5DI8B 5SWQB 3BIKB 4GFTB 3TEUA 1BEYH 1XGRA 4BSVA 2P8PB 3IRPX 4OCRL 1IZKA 4XPFL 4OM0H 1OLZA 3UAJD 5DMKB 1NC2D 4K8RL 1RZIA 4ZUVA 2G5BA 1MJ7H 5BJTB 3BVNA 4LHUD 2BY0A 3HNSL 1UZ8B 1WT5C 3DVGA 4E9LA 1MFBH 1VFUA 2UUDK 3WNOA 4R97C 3T09A 5IB2B 4NQSA 1PQZB 1MI5D 5J8OA 1TVBB 2NY1B 1WAAF 3G5ZB 5BJTA 3DXAB 4P57B 5CZVL 2VN7A 4UNVA 4JO2L 4EOWH 5B39B 2DLTA 1X6NA 2FBJH 1GZQA 3QHFH 4MXQD 5JHDD 4GRMA 1WC7A 1NSNH 2BXYA 4DQOH 5HVFB 5IWLC 1XZ0A 4I5BB 1A21A 2PTTB 3U4BH 2QR0B 3JV0A 3S37L 3MUGA 3OAUH 4PRAB 3F7QA 1BZ7B 5IB5A 4K9EC 3CMOL 5TQ0H 2CLVB 3AAZB 1LK2A 1RU9H 5E8NB 4G42A 4XCNB 3O2DA 2FZ3B 4XP1H 1FO0B 1J8HB 4F7EA 4K3EL 4RGNB 5GGVL 4PGCB 1FIGL 4JFEB 1PYWA 4YFLF 2FO1A 2R4SL 3FB5B 5FGBA 1LO5B 1ZT4A 5DRWB 3A67L 3PGCB 1D5ZB 3I02A 4OFIA 2B1HL 1YQVL 3BSZH 3DX6B 1OTUD 1JGUH 4JN2B 5JXEA 2KZ1B 2GAZB 4A6YH 4FXLA 4CMHC 1XGYL 1PX4A 4RGMB 4Y8DC 1C5BH 4U49A 3WLWD 3LY6A 4G3YL 1BREA 3DX6A 3UDWA 4OFYD 5CEZL 1HQRB 3RVXC 1Y6KR 1T2JA 4NNPH 5JR1L 4U6TA 2DS4A 1ZANH 1GGBL 3U9PH 2B4CL 5D7LE 2ZZUT 1IGTB 1E6OL 5D8JH 3S6CA 3OAZH 3VGBA 5JW5A 4POZD 3LKQA 5D1QD 1OAKH 4FQ2L 2VAAA 5T3XE 3ESUF 3SE9L 3RBGA 3U46A 3P11H 3QDME 1NGYA 4Y4FB 2LFGA 4EUPA 4WEMB 1L0QA 4XTRD 1FN4B 4JAMB 2VZ1A 1HKLL 1JHTB 5DR5H 1YY8A 3AFLA 4XNYL 2QQLH 2BVPB 1QQDA 5E00A 4TNVK 1J8KA 5DJ6B 5L2KB 4GRMB 1R3HA 1UXWA 5GHWH 2Y6SD 5T1LA 4J8RA 3LH2H 4KJWD 4OGXL 3W81A 5DD3H 4MNGB 4WCYH 3BDYL 3BHBA 2VQTA 4QXWA 3LQZA 1ADQL 4XB7A 2YUVA 2W9EL 5HHOD 3IDGB 1NC4B 2IANA 2F8XC 4G3YH 1E28A 2CKBA 4LLQB 2Q7YB 4OZFH 3MFGB 3W0WA 5JORB 5MEND 4I2XA 4NRYA 3TVMD 5HVHB 4QRRB 1OP5H 3CAFA 4ZUWA 4JKWA 5HYQA 4P23C 3STLB 5E8EA 2PW2B 3WKMH 2JB6B 1BZ9B 1MCWW 4G6AC 1CXHA 4MD4B 3LEXA 4PJAE 4FQJH 3TBYB 1FL6B 1NJ9B 3QNXA 5C0AA 3D25B 3HC0A 4LSPH 3UTTD 5HGAA 4F9LC 1INQB 3QO0B 3S35H 2PTUA 5KVEL 1UADC 1H0DB 3EYVB 5FECA 4YO0A 4I4WB 1T03L 1L7TL 1QLRA 2YPLD 3HC3H 3O3BA 2CRYA 5C09B 1AXTH 5T1LD 5B38A 3SJVE 3BO8B 1B6UA 2NY7H 4Y16D 5DMJB 1P4BL 3CPLA 3T2QA 4FP8L 3LS4H 3OXSB 1YNKH 3CJJA 2GW5A 4K55A 4RGOH 5A43C 1ZLWH 3QHZL 5ADOH 5CHNA 1MCFA 2IPUK 3B5GA 4L8DA 4YX2H 5DXWA 2B4CC 4XP4L 4LCIL 32C2A 3ULSB 2W9EH 3DO7B 4H8WL 4JANB 1KT2A 3OG4B 5FOJA 4RAHA 5E5MB 4LCWA 3BO8A 5GS0H 4L1DA 1CBVH 1VEPA 3CZJA 4R4NC 4MJ6A 1M6OA 4XNMB 5FYLE 3OKDB 3RZWA 4H0GA 4U1LB 3O4OC 4M00A 3F12A 3QDMD 5T1MB 4OUOA 3GGWA 3QJHA 1FRGL 4U2ZA 2D2OA 4FZEH 3SE3C 3STBA 1JHKL 2C3HA 3P3YA 4JY6B 3RKPA 1DVFB 3MMEA 4LKCA 4QHMB 4HWEL 5D5MA 1FFNB 4LPTA 4EN3B 3PNWB 3UMTA 4HUVA 4ZOEA 1DBBL 4R4BB 3JWOH 4XC3H 3ZE0F 1FDLL 4OCSL 3QIWC 1MHEB 4FTVE 4NN7C 4PJ9B 4RIRA 3OAUL 1T2XA 4NN5B 3P4OA 1B4JL 3MJ6A 5K9QI 4YHKH 3EAKA 5GZNC 4UOW0 4J3OC 1T1YB 1LILA 3RU8L 3P73A 1T5WA 1U91A 1W0WB 4IOFD 2H2PD 4I0PD 4MXWH 2NY6C 2RAMA 3L7FA 3HMXL 1CLOH 1FL3B 3C08H 3LEVH 1U8IA 3OMZA 1CGSH 3TBWA 3K81A 4YEEA 1OWWA 3WKNA 4MJIB 5FCSH 2AEPL 3SGJC 3FMGL 5DMIL 5T5FL 3GMOB 5BV7H 1WAAE 4ZSOA 5C6TL 1JGUL 2N56A 5TPWL 2FYYB 4CU6A 5HGBA 4UV4H 5HDBE 4YHOH 3INUL 4HS6A 5D7JC 2IPTL 4GRLB 3BP5B 1OT1A 3QIWB 2P5WD 5BVJB 3WHE1 4DZ8A 1KJ2A 2CD0A 5E2TH 3H42H 3ARGA 2XTJB 4HJJL 3VD3A 4AYFA 4R0LA 3FZUC 1V05A 5IMMB 5IJKA 4X7CC 3W39A 1ZANL 3BPOC 3BWAB 1NUGA 1DFBH 2MCG1 4KWUA 4XX1G 1YZZA 4GOSA 5HI4D 2R15A 4MSWB 2AJUH 5GS1A 1KBGH 1ZT1A 3O9WB 4UIKL 2IPKA 3DHMA 1S3KH 4IMKA 1FL6A 1AGEA 2X4NA 3QFJD 3HZKA 3UC0L 5T1LB 1KULA 1BD2B 3EYSH 1CDJA 4M9PA 3MREB 2OL3B 4ELMF 4ODUB 1IAKA 1TJHL 2IH3B 4WO4A 3SOBH 3QULB 2HTKD 2EC8A 2VRAA 2FRGP 5HDOA 3BZ4A 2MQ3A 4HK3J 1QLEL 3C6SB 1CGSL 3GSWB 4JZJA 3DMMC 3F5WB 3D39D 4M03A 4M4RA 2WSKA 3PQYB 4AZ8A 1UB6A 4HAFA 3BKYL 4HT1L 2D03L 4GAGH 1MFDH 2ICEA 2Z8WC 4LGRB 3HR6A 4NT6B 3WNMA 4UV4L 1CVSC 4YDKL 3S36X 1AJ7L 1N26A 1Q94A 1RZJC 3B9KA 4E41D 1RFDH 4PJ7B 3HE6B 4YDJB 3RVXD 1UXWB 5F1KC 1ETZB 1Z5LB 5F21B 3WNPA 2Z8RA 5FO7B 4PJGF 3HS0B 1A7QL 4P57A 4B41A 4HUWB 3VFRB 2PTTA 1J11A 5KN5A 1F4XH 4YHNA 4OLEA 4FQ1L 2F74A 5T3ZL 5F7EL 3O6MH 1I4FA 4MVBC 1WZ1H 3UO1L 3GIZH 4ESKA 1UH4A 2CRIA 2V7NA 3CDGB 4LCUB 3LKSA 2FJHB 5D1QB 4XP6H 2HVKB 3QUYA 3VFSA 3TPUB 3MCLH 1N6VA 3E6HB 1FLTX 1CDGA 2I27N 4X4XB 3RWDB 1FHGA 2CGRL 1CE1L 3CZFA 4JY5L 1RJLA 4ZO6A 4PJ8D 4U31A 3QXTA 5DK0B 3S8WA 3QUKA 5IMOA 12E8H 1KJ3L 3QEQD 1AY1L 1ZGLB 1LO5A 4HLZG 2R1XA 2DQUL 4PJXB 1NBQA 2DQHH 3VFMA 2IAMB 4N0UA 2RR3A 1OF2A 1PD6A 3U46B 3ZT5A 3B9KD 2F54A 1JRHH 1UJ3B 5IMLB 1J10A 3EOTL 3VXMB 5CEXA 3FOMB 3QUZD 4Y4FC 4M7LL 2Z35B 1HHGA 3CMGA 4F58L 4NO3B 1I9IH 3VDAA 3T0EE 1OSPH 4M6OL 4MVBD 3OL2A 5IEKB 3R0MA 5EC2A 4O02H 4YNYA 5ENWB 4YAQA 1MCIA 2H1PL 2XFXB 2VZUA 5KVMC 2QV2A 25C8H 3MJ7A 2J12B 4WENB 3IXAA 5FYKE 1ED3A 3BQUB 1ZHLA 2G2RB 5F8RC 4QWWD 2QEJA 4NHCH 4XWGH 1JHTA 3TO4B 1U58B 3T4AB 1A7BA 4HD9A 1C08B 5C0IB 4W4OC 3BDBA 5EO0A 1HQ4A 1U8MA 1TJIH 1NCNA 1FE8L 1NFDE 4HKZB 1MIML 3ZDYF 3PABA 1KEMH 2NYYD 4FQLH 4RMQA 4LKXA 4HK3N 4HZLA 2EDTA 4Q74A 1EJOL 4KROB 5A16B 2ZOLB 5J3HD 3QA3B 2R0KH 4LF3A 2M1KA 2X9YA 3ZKMC 4KKAD 5E9DB 2ENYA 1MJ7L 3RJDA 3FFCE 3VG9B 3MUGB 3U1SH 5EBLB 1I3GL 4M5ZH 3RJQB 4AMKL 2Q8BH 4OKVA 3AU1B 5JQHC 4K71B 5F89B 5FYKH 3MBXH 3QEQE 5IROA 1MHHA 3GSNB 5C6TH 2W0PA 5D2NB 5ESAB 4JFXA 4L3ED 1SYVA 4KHTH 3L3OB 4ONHA 3GKZA 4UT6H 4N9GA 4HF5H 2IPTH 3FCTA 4Y5XC 3RNKA 5C71A 3NPSB 4G6JL 4NDMB 2JIXD 4Y1AD 5JPNB 4R4FH 2EIBA 1D5BA 4PJIE 5SX5K 4I18B 5SWSB 1PG7L 4ZUSB 1OAZL 5IW6B 3MRJA 1YEIH 2RCSL 5A2IH 5BW7C 1JZ5A 2VDLH 5AYUL 1LQSR 3KLAA 4L4VB 3FTGA 3MRIA 5FIEA 4ZG1A 2VB5A 2EE6A 4NCC2 3RWGB 1UEMA 4MS8D 3JVGA 5J57B 1FNEB 3E8UL 4MQTB 5DTFB 1A6WH 2ZKHL 1HILA 1WIOA 4AEHH 1BLNA 5FA4B 3LSOA 3QDGE 2CR3A 3EYSL 1KOAA 1AQKH 5C0CA 4U1IA 3SKMB 4JO4H 5I75C 4Q6IA 4H25B 3SE4C 1QKZL 1RUPL 4ZTOL 1Y6NR 2GUOA 3H9SA 1EK3A 4GXVL 1IQWL 3B9KB 1N5YH 2E6PA 2FEDC 1P7QA 2Y5TB 4FQHB 1WFOA 4XCYA 2FWOA 1YEHL 5E2WL 5A1AA 3DBXA 4MD5A 4A6YL 3SDYH 2Y23A 4QF1A 1J1OL 2FD6H 2VIRB 2WBJC 4TUOA 3SDAD 1F3JB 2E27L 2HFEA 1HK6A 1AJ7H 5TDNA 1DL7H 3VFVA 5K59E 3QXAA 9CGTA 2H41A 1U8LB 1S78C 5TE7L 1T6VN 2DB8A 5E9DE 2ZUQC 4JFDD 3QIBC 3V9FA 2RGSA 5FO7A 2R2EB 4EUPH 1Z9SA 3VCLA 3D0LA 5IVXE 5C8JA 4U6HA 1X5FA 1A9BB 1DLHB 4LQFL 3IJHA 4PG9A 2GITA 4XBEL 1DUYB 5IVXA 1K6QH 2X05A 1G9MH 3QFDB 4RZCA 4K7FA 3UTSB 3GIZL 3BWUC 3HA0A 5SWSE 2PF6A 1FYTA 3E8UH 3ESVF 3KNBA 5DJYA 3LQMA 5E4EB 5JLZA 2NY6D 3IXAB 2A1WH 3HE6D 2WLZA 1XR9B 1YY9C 1I8MB 1BFVL 3M1BB 5HHMB 3C6LD 3V6BR 5EU6E 1NMBH 1HWGB 2BVOA 1S9VA 2ADFL 4L4TB 2C9AA 1A6UH 3P73B 1D6EA 4O9HL 2IMNA 1DQQB 4F8QA 1IQWH 3LV3B 4OF6A 2BNUB 3EBAA 5E8DL 2EIEA 3IF1B 1V3JA 4GAJL 4F80A 3ZYJA 1T7YA 1N3NA 2D0HA 2DQTH 2H8PB 4L8CA 4IRJA 4XH2A 2J1KA 4JKMA 1BM3H 2D7QA 4NQXB 2QSCH 1J0YA 3MODL 5DJ8A 5EU6B 4P2OA 1WWCA 4F58H 1I1FB 2GJZA 3TT3H 1VSCA 3FT3B 1KJ2B 1EEYA 4G43B 5KSVA 5D1ZA 4WWKD 3V4VH 5JPMA 3L3JA 4NQCA 2X42A 4YXKL 4RISL 4PRPD 4Y2DA 4DVBA 3JTTB 3U48A 5DJ8B 3V7AE 3WFEH 4D9RD 3T4YA 3V8OA 4LCWD 1LNUA 3R4DA 4IRJC 2HN7A 3G5VA 3K4AA 5H37G 4ZFZA 3PIQB 4P46A 4PJ8A 1M6OB 4XNMA 4G43A 4PLKC 5GGQL 4OBSA 4IM8A 3QIBD 4WO4B 4TVPD 5D7JB 5E0QA 3MLSH 8FABB 4P0DA 3G6JF 2GFBB 2OMNA 3UTOA 3QPQD 3QUYD 2Q20A 1QNZH 2JK5A 4GKSA 1MFEL 1DEDA 4FQXA 3RGVA 3MACH 5EO1B 5EC1B 1S8DA 1J1PL 4HG4K 3HLAB 1BWMA 1LEKA 4KUCF 5CP3A 3CXDL 3SHSA 1TJGL 3N9GH 3TA3B 2HAZA 5DD1L 3QYCA 1S7QB 1ZMYA 1JNLL 3TIDA 4HFWA 1A47A 3T8XA 3G04B 4ODWB 1OB1A 2APXA 1WAAA 4M6NL 1HEZA 2X4PA 3KPRD 2RBLA 3F7PC 3KWWA 4X7FC 3BUYB 4OBRA 1A1NA 3AREB 5EZOL 2A6DA 1F97A 1DLFH 1T4KA 3EYOA 5GGVY 3RIFF 3T8XB 1S9XA 1QSEA 5JTWA 5H94B 3TT1L 2OZ4H 4JREC 3S88H 1B88A 1NLBL 4M1DL 1NDGA 2AV7B 4WW2F 5DSCA 1R5IB 4TNVF 2VDPL 5HHOE 1KB5A 2NR6D 4KJQC 3PP3H 4KTEL 3HR5B 4BH7A 2NZ9C 4U6XB 1JYNA 2N4IA 4R2GC 3DYPA 4OB5L 2BJML 1IKFL 1KPRB 4KGJA 4H88L 4KK9D 2N1KA 3H0TB 2F8OA 3U0PB 2AS5M 2CO7B 1LO3L 1RZKH 2GUOB 1FLRL 4KV5E 1BBJB 2ID5A 3QDJA 4JN2A 4GW4A 4NUGL 3HMXH 3KJ4B 5J6GA 4JO4L 1DANT 4LVOB 4TVPH 1UCTA 2J88H 3EJJX 4ZFZB 2GTWB 5I75B 4O2EB 3QXVA 2UZXB 2Y25A 3PL6A 4QKXB 4OZIE 2C1PB 4JLRA 1HQRA 4KGLA 4P48A 1EPFA 3TV3H 3TZVD 4RMVA 3ARFD 1JZ7A 3HC0B 3LSOB 3IFOA 1PW3A 5FO9A 1A1MB 1CGYA 2ICWA 1YPZF 5EWIH 4P59L 2R8SL 2ESVB 2CQVA 2VDKH 4ZPTA 3I2CL 1QBML 3QHFL 1FNFA 5M7QA 1HHKA 3HRZA 5CGYD 2AJVH 4QXGL 1QFUL 3G9VA 4RAVA 3BXNA 5DFVC 4HUMB 3CXHK 2OJEB 1YYMH 3FOLB 2UVEA 3Q1SH 2CKBB 4LLQA 2GTZA 3IDIA 1CGTA 4XGZB 1AGCA 4OLVL 5CHNB 4QHUA 3FT2A 1GOGA 3T04D 4GKNB 4PJHB 3IDXL 1NAKL 3GJFH 4OD2A 5EU4A 1CFVH 4XBGA 3OJ2C 2FZ3A 5GGVH 4OIIL 1JTPA 2DQCL 3FFDA 2IJ0C 1NAMB 5AZ2L 1KUMA 1Q9WA 3G5YA 1UYWL 4GG6F 4PTTB 5BQ7B 3FB5A 3C5JA 3PWNA 1R0AL 1S7XA 4MHHI 3QO0A 1FGNL 2VDRL 3G5XA 3RY4A 2XZAL 3BAEL 3GHBL 3PDGA 2Z0BA 2EDBA 5M94B 4G42B 1MREH 1JZ3A 3OR6B 4HGKC 4ZAKB 1NQBA 2NCMA 5B4MD 2Q6WA 3W9EB 1CTNA 5T3XD 4JHWH 1LE5A 3T0EB 4OLXH 5J1SC 4P59H 5JHDA 1EVTC 1SMAA 3ZKXB 2VDKL 2A38A 1H15B 4APQD 1FVCA 2J8UB 3MJGX 3PP3K 4ZAKA 5JHDE 3PWJA 3K8LA 5EZIL 3BRGC 3LCYA 3PP4L 4HXBH 4WFEE 1HDMB 3VFUA 3O6KH 2CLRA 2VLJB 1G7JA 2VZ3A 4DK3A 1C16B 1B0GA 2Y36H 1RMFH 1MCPH 1IRAY 2NW3A 1YPZE 1QLRB 4LVEA 5IBUG 4BFBD 3M07A 2YD2A 5IB2A 1NC2A 1KCRL 2PUQT 2EC9T 2W9DL 5C0RH 3L3HA 5CEXB 1EEUA 5JW3L 1ZLVK 4U1IB 3B9KC 3CVHL 3S4SB 1LEIB 1FN4A 3BEWB 4NJ9L 4QRSB 5IMKB 4N8CL 5FYLL 5F96L 1TCRA 3IKCA 1IARB 3TZVC 4J7RA 1QNZL 2P7TA 5J1TC 5I66B 4PJ7E 1NGYB 1T1ZB 4YHPB 3QI9B 3S37X 3D0LB 5I1HH 1WEJL 1QA9B 4GLRI 2EH7L 4V1DE 2CH8A 2A0LC 1S7TA 1ULVA 4HFUL 1RUMH 3ZZ1A 3KAAA 2OCFD 5FKAA 2RIKA 3BP4A 5SV4A 4LSQL 3OKOB 4FFYL 4XVTL 3WS6C 1X9QA 4WW2C 4FABH 3WBDA 1TFHA 3BQUA 5KW9H 4YK4C 5TH2B 1VKXB 4XX1E 5FHAL 1RJYB 4HHAB 5DFWH 2A6IB 2FATH 4RCAA 3CSYB 5EULV 5LBSL 4JM4L 4LQ1A 2XICA 5KSBB 3NGBC 5KZCB 4L29A 1D5IL 3VXSD 2CDFA 4MA7H 5B8CC 3R0NA 3IFLH 5BO1L 1JF6A 4O00A 4NBZB 4HGMA 4FRWA 5DJYB 4EI6A 2D9QB 4DKDC 2O5XL 1BWWA 2WINB 5HD8D 4LPYA 1I1AD 3GMLB 2Y6SC 1M1SA 2ZOLA 3FZUD 5ICZA 4QEGA 4TOYH 4NJ9H 1HSBA 5F7LB 3FB8A 3HE6C 4JHZA 3ULVD 1W72H 2B5IB 3A6CL 4IDJL 1UACH 4XNXL 3CLFL 1NH6A 3LQAH 5F7WC 4GMSH 43C9A 1H9VA 2AJSL 5ICXB 5IT2H 1PBYA 4JCLA 1LVEA 2C1PA 3BE1H 2CRZA 2DMBA 2BNRA 5D7KD 1K5NB 1Y18B 4B0MM 4W68A 1WJ3A 5C7XL 1MHCB 3QR2A 3SKOB 5D2LB 2QSVA 3TFKC 5C0BE 2AABH 2HMIC 2I07A 3O9WC 5F9OL 1AO7B 5EIVA 5EU7E 3OKMB 4C56A 2HKFH 4HAGA 5IKCB 3IVKB 4HS3B 3MV8D 5EO1A 4C56E 4P4KD 3GSQB 4PJGA 3ARGB 3CGTA 4NWTL 4F7CB 4Y2DC 2VQ1B 1U8QA 2YR3A 1OAUL 4YIQB 3CSGA 1YNLL 3JTSA 2GIYA 1YEDA 3VXNB 2R1XB 4R6UA 3IDXH 4FTVD 1ZWIB 2BRRH 3CFJB 4QCIB 4WEBL 4IJ3B 4PPTA 1PEWA 5EO9B 5C9JB 2Z4QB 1VDGA 3PWNB 1AE6L 1S7XB 2GY7B 3QRFM 2DQCH 4L29B 1ZS8A 4OGYH 1AQKL 4R96B 4QLRA 4JO1H 3DRQB 1PKQE 5DJCB 1FAIL 2XWTA 3B9AA 3L3GB 1DQDH 5D1QA 3VFTA 4CW1B 4L3EB 2AV1B 5E7FA 4KRNA 1WSST 4HWBA 2BOCB 2JB5L 4V2CB 5DQJB 4B7IA 4A2MA 2KPNA 4XP5L 4ZUUB 5JXAH 5LG1A 1WZLA 2DQEL 3KYMB 2IANE 3SDYL 3WYRA 4RNRB 4Y16C 5CBEA 2NXYB 5TF0A 3LMJL 1ZLWK 4H5SA 3A6BL 5DJ0A 4M43L 1Y6MR 3IAGC 2BNRD 5E2UH 4DCQA 4POUB 4PB9L 4NWTH 4ZOCA 5IMMA 4KTDH 3WFBH 1K3ZA 1YQ2A 5FYKD 4YFDB 2MMXA 4IMLA 2H9GB 5FGCE 1MFBL 4Y8AA 2V2WA 1MCPL 5HYJA 2IGFH 4BFGA 3BP5A 1NCDH 4WFFE 3ZHLA 2FX8H 1H0DA 1CZ8L 2VLLA 2FX9L 3IAQA 2VE6B 1S3KL 3TWCL 4KI5D 1WTGT 5DQDL 1BHGA 1N64H 4N0YH 1NLDL 5D1XD 2FJHA 3D2UA 1HOCB 3ARZA 2D9CA 2ZWLT 4D9LH 2CLRB 4YXLH 4ZO7A 3MNZB 1A4JA 1KF9B 4N8CH 3MC0A 3L3KB 4PJ5D 4Z7VF 2DDQH 5T3XL 1LP9F 2HFFA 3GJFK 4QOKA 3FOMA 3MTRA 1A3LL 1FFRA 2YMXL 3LHPH 2E3VA 4GAGL 4XAWL 4WVRA 1U8JA 2AEWA 5H8DA 2QQKH 1JNNH 4H20L 3IETB 1A6TA 5CFHA 2JTDA 3V5DB 3SDCC 5GJTH 3V4UL 4EIZC 3F12B 3ARGD 3IDYB 3VW3H 5FUOH 3DURA 2AVGA 4PJXE 1I3UA 1T7VA 5D7JA 3DPBA 1HYSD 1FCGA 1I8KB 2P43B 4FNLH 3MV7A 3IB4A 4K7PX 5T33L 1C8PA 4YGVB 1UQSA 5JW4N 1Q9KA 3BYTA 2W0KA 5IJKC 3BGMB 5ESVA 1LE9A 1J0HA 5IBTL 5H35B 3TGXA 4ISVA 5D5ME 3WJLC 1DJSA 1RY7B 3ARFC 5IQ9B 5DLMH 3SY0B 1KB5L 4CL7A 4XBGB 4OLZL 4DN3L 4R7DB 4L4TE 1GZPA 2PO6B 3DUUB 1W0VA 4FXKB 4HIEB 4HIIA 3IJYB 3MJ8B 1WWAX 3EYUL 2KL6A 3A0OA 4OD1L 5CP3H 4WU7A 3ULUE 2HT2C 3KNBB 2XNAA 2IF7A 4KTYA 3MOBH 1CICA 3W5NA 5FF6B 3E6FA 3SO3B 3CFKB 4BSWB 1P1ZB 4HIIB 2IADB 3NACL 2R0WL 3IU3A 1I1RA 1QFOA 2WIIB 1AXSB 2ZP0T 1BECA 4FQ2H 4UINH 4Y1AB 1Q94B 1PKQB 4E41B 2PW2A 1Z3GL 5FGSA 4M6ML 2BVOB 3ALWA 5DVNA 3MR9A 4G8FB 3DV6A 3CVIL 3WIIL 4Z7WB 2IADA 5E8OB 3MV11 1OQOA 1PZ5B 3CCHB 2NYYC 4Z0XA 1LK3L 5I9QB 1NCBL 3L6FA 1UM6L 5JIKA 3ARFA 5EB9A 4JRXD 1LDPL 4GT7A 4BH8B 3QDMA 4HUUB 2Q8AL 2XWJB 2MCPH 3KXFD 3AS3A 5EU6D 4P2QE 4BM7A 1Z9OA 1DLFL 4G6ML 3BUTA 1DBKL 5D1XB 4D8PB 2FEDD 1U8JB 1IQDA 5E2VL 5FUZH 4Q2ZB 2VXVH 5ACZB 1XGTA 2G75A 3RWJB 2A74B 4OCXH 5E08H 3GRWL 1KTDA 3WLBA 5CZXC 3N06B 3RI5F 1R3KB 5CIPA 3C5ZB 2H32A 3KJ6H 2MKWA 1G6RB 4KK6C 5DUPL 2XWTB 4BKLA 4QRQA 3L3GA 4PR5A 2P24A 3HG1E 4U1HB 4WI3A 1KELL 4FQJL 3JXAA 4LCIH 2PN5A 3N1QC 2I9LB 5CJOL 5B3NA 4L8SC 2FR4A 4R7DA 1BF8A 1BQLH 2P48B 4EI6B 4G7YL 4JAMA 2P49B 4TPRL 3H7BB 4OCWL 4NKOA 4CVUA 5JXED 3K80A 5DJDB 1NMCB 4TVSa 1VEMA 3MRMB 5ITFB 1CF8L 5AUMB 1H5BA 1CD1B 4XMLL 1SVCP 3MLYH 4PJ8B 2F5AL 1S7WA 3MRGB 1BFTA 1MQKL 1T1XB 2G2RA 5BRZA 3WFHB 4I9WE 3ZHKA 4Y0GA 2BY1A 5D7SL 1CI5A 3T1WA 1YEEL 1GC1C 3BH8A 1N2RB 3GBNH 4F37K 2VXVL 5C0IA 3C09B 4KVCH 4LCCA 1FJ1A 4GW5B 1CDYA 4MMXC 3EDFA 5EPMA 4X9HA 5MI0B 1SJXA 3ZSTA 5DURD 3O41A 5F3HA 1K8IA 3LB6D 3BHBB 4HS8H 3V5KA 5FHBH 1KIPA 4UAOC 2XZQH 4ELME 4GAFB 1BVZA 2ITDA 1CR9L 2HLAB 2WUCL 2F5BL 4LIQL 5FEBA 3VH8B 2WZPD 3PWUB 4NOFA 3VGGA 4QGYA 4OCRH 1INQA 2FJGA 3SKNA 2PR4H 1K4CB 3IFPA 2HVJA 1EHLL 1ZHNA 3MRQB 3OX8A 4NGHH 43C9B 1OAQL 2XTLA 4PY7A 4KY1H 1FGNH 2VDRH 3JWOL 1FNGA 4XC3L 5EUOA 2X1OA 5IK3B 4AEFA 3MCG1 4RMTA 1LD9B 3TJEL 3CU1A 5GGRY 5FAAA 3DMMA 2YMXH 1EZVY 3CK0L 35C8L 1X5YA 1A64A 5GS2H 4MNQE 5I30L 1EUTA 2DI8A 4QXUH 4XMKH 1KCVL 1FG2B 5DYOA 2ORBL 5C9JA 1I1AB 5HDBF 5SV3A 1QFWH 4Z18A 4XPFH 3MSPA 4M7ZC 5I2IA 1BVLB 1GSMA 2PNDA 2YPLA 5EZIH 1C12A 2X4OB 5HHNA 3P4LA 1DFBL 3B5HA 3UYRH 2X10A 3T0BA 2AEPH 4MDIA 5KANI 1B6DA 2APVA 1MF2H 4PJGB 3HUJA 4WGWB 3HPJB 4PBVC 4XCFH 5D7LD 5IV2B 3EIFA 5DQ9B 5EA0H 3JWDL 3HE6A 5IBLD 2VKWA 3VXNA 4OF5A 4R26H 5I73B 1N0XH 1WZMA 4HUWA 4X5LA 2AEQH 5J06A 1AXIB 4WWKC 5KS9E 2JJSA 1B0WA 1MPAL 2ILLA 4S1RH 4DQOL 3UTZB 1VFBA 1MI5B 1JGEA 1KJMB 1U0QA 2W65A 5A2LH 4FQQA 5K9KB 2NY2D 2ESVE 2ZJSH 4PJEF 4GRLD 4V2BA 4X6CF 4ZXBC 2AJXH 2UWEB 1JRHI 4M62H 4LLMA 4UINL 1AHWA 2EH7H 4WWKA 1L7IH 3C60B 2EIDA 3OHXA 4K94L 5FYJL 3GM8A 2AEIT 1ZEAH 1S9YB 5IROC 1IGIH 5K93A 5I1AA 3SGEH 4Z78B 4Z7WA 2QHRH 4QHKI 4YQXH 5BOZG 2HKHH 3WE6A 3ARDB 1AGFB 4PJHE 5HJ3A 1JPFB 1GGBH 3UROR 2VDML 3MLWL 3BMVA 3SQOH 5ICZB 1F6FB 5ANMA 1C5DB 3UYRL 5C1MB 1H5BC 4K9EH 1UZ6F 4ZUSA 3PWJB 1TZHB 3NCFB 4Q9CA 1R3JA 2VLKA 1GGCH 2AK1H 1S7WB 5F7MC 2A6KA 4WW2A 4U6YA 4YDKH 5IOPA 3MOQA 3ARUA 1MCOL 4W4OA 3VDBA 1XGPB 3H7LA 4Y4HD 4CVXB 2IAMA 2V17L 3SCMC 5DC9B 5D6CA 5ESQA 3ULUD 3M8OH 5FO8B 4AM0A 1MLCB 3KLDA 4HUUA 5DI8A 4MB5A 1CE1H 4C59B 4OZHE 3A6CH 4AIXA 4JPWH 3UTQA 4QXTB 3UBXI 4LASL 3QZWB 4NKMA 3DLQR 1GL4B 4MCYB 4NQDD 3RX7A 1MCJA 3O3DA 3H9YA 1N7ML 4NOBA 3OJDA 3SDXF 4G9DA 1SBSL 4NSKB 4UUJA 1ZEAL 3CXDH 5GJTL 4X8XA 4PGJA 3W39B 4JHAL 5IFAH 2F53D 3CH8A 3FQXA 4ODVL 4YBLC 3ZKSD 1S7QA 1C16A 1IGJA 1BAFH 3G5ZA 3FFCB 5E99H 4QTHA 2BSTB 5EFIB 4NQVB 4RFNB 3QAZB 5EOQH 3L3DA 3P40A 2G9HB 1HEZB 4OZGA 5BZWA 2J4WL 1PLGH 1MI5A 2UWEE 3NIGE 3VGFA 4PJAF 4C83A 1D5MA 4NM4L 4PV9B 2H1PH 1RZIB 1CTOA 2AJZB 2Y06L 2IBZY 3IU4L 1CQYA 1MQKH 5JW4R 3HI1B 1V3MA 4LLYB 3MUZ1 2DMCA 2XN9E 3IRZA 3VMOA 3CFCL 2DBLL 3WEXB 5IF0B 4LLAA 2UY7A 5C0AE 3W82A 4HXAL 1T5WB 2VWEE 5MEPB 4F9PC 3BD5A 2HG5A 3KPOA 1QRND 3NMEA 1FFNA 2OYPA 1TVHA 4J3XA 1I9IL 1BQUA 1KEML 2DF3A 4UAOB 1CICC 1F02I 1S9WB 3VA2C 5JW4M 1H3VA 3CDGA 3QXWA 3I75B 5CBAB 5D2LF 2Q6WB 3CX5K 3D85B 4XHJC 1FAIH 3B83A 5EBGA 5KSAC 5IMOB 3V8CA 1ZGLA 1MIEH 5LCVL 5BS0B 3G6AA 3MROA 1H15A 1MLBA 4JRYE 1CK0H 1T1YA 1GAFL 3O2WL 4WV1A 2FJFB 3CZFB 4XNZC 1WFTA 3DSNA 1MOEA 3UTSD 2VXUL 3TCXA 4HUNB 2OXGA 5F3BB 1XR8A 3WN5B 1ADQA 2DTSA 3IFNL 1TTGA 4JB9L 2VDOL 5E2UL 5HHMD 1K8DB 2YBRB 3MV7E 2NY4C 4WUUE 2EXWC 3QIUB 1JWUB 4P2CG 1NFDF 3S5LG 3KS0J 1U2CA 3RBSA 2FR4B 4HS6B 3WLBB 2FO4B 1CBVL 5ICYA 4MDJA 1UZ6E 3TA3C 4ZMAT 2XTJC 5BMFH 1NDMB 2IWGA 1H8NA 3MRCB 3OKKA 4MCZB 4X4YA 3TNMB 4KPHH 4PIRF 1CLYH 3GNML 1GC1L 5L6YH 3KPRB 5IG7B 1B4JH 1BJ1H 1P84J 3G6DL 2VTFA 3OKNB 4L5FH 5EU4B 3CDFA 4GW4B 4K23L 4HLZH 5I8OH 3PL6C 1EXUB 2OXHA 3I6GB 3B3IB 4JG1H 4HWUA 1OPGH 4XCEA 5C0FB 1B4RA 2X4TA 1U91B 2AJZA 5JDSA 1W0WA 2R2EA 1UM4L 4RWYL 3G9AB 4Z7UA 4F7TB 2HLFC 4JFQA 3CDCA 1ZHKB 3IDJA 3NIFE 2VC2L 1X4XA 3RPKA 4QOKD 4NNYA 3DGCR 4WDIB 1CK0L 3MUHL 4Z7WE 1LMKA 2VDLL 1NDGB 2AV7A 4RMWA 5BV7C 3H9SD 1NC4A 5CMAB 3IS0X 2EICA 2H3NA 4WV1C 1JNHB 5LAXA 3MPCA 1GZPB 2IH3A 2QQKL 4U05A 4EN3D 2BSRB 2ATKA 3MO1B 1BD2E 2QSQA 3IT8D 4MA1B 4NT6A 5F1NA 4TQEL 5T3ZE 4DEPC 1IEAB 1DL7L 3PNWA 5BVJA 1XR9A 1I8MA 2AJ3A 1VFAA 2MHAA 4ZOBA 4P4RA 5T1KA 3KYKH 5DEZA 5DK2B 4JRYD 4Y4HC 1SM3H 4OZFB 5LXGH 3NCJH 4X8JA 1ORQB 4KJYA 2VUYA 1ZT4B 2OBGA 4LNVA 4KKLD 1CLYL 2GTWA 3GNMH 1GC1H 4ZD3L 1GGCL 3E6FB 5T3ZD 3DVNA 3INUH 1F8TL 1WCQA 1J1OH 2W60A 2A6KB 2VERN 1V7MH 1F11A 4QTIH 4Y1AA 3NIFF 4PGEB 3TJHD 5IHUH 1PZ5A 4O2CB 3SDCA 5D7LB 1TJHH 1BFVH 4OF3A 2Z8VC 4GSDH 4W6XB 1G1CA 1G9MC 4LSRH 1FNEA 1KB9K 4GS7C 1YMMB 5HDQH 4JRXE 4Q9QH 2AI0L 2BY2A 4X4MA 4Y4HA 3S37H 3OB0K 3MRHA 3KPNB 4X4ZA 1ZXQA 3VA6A 4Y19D 2D03H 3QQ3A 1U3HC 1N59A 1F3DJ 1RIVL 4KJQD 3GSVB 1LP9B 1FGVL 1RIHH 4MS8C 4O2EA 4F8TA 2I9TB 4OZGE 4O4YH 1MQ8A 3QO1B 4N8VB 4CMMA 4I77H 5C0CB 4G5ZH 3D3VE 1X5XA 2D31A 4X98A 1SM3L 2YEZB 3LIZL 1JMXA 1A7QH 4UQ3B 5C0BD 3ZSSA 1R24B 5TQ2L 4NFBA 5KOVC 3O4LA 4PFEA 4LHUG 1I3RB 2XTJD 2VQ1A 1QBAA 4LNRA 4PJAA 3CLEH 3HI5L 4HCRH 3LVEA 1DBKH 3N0PB 1ZAGA 5FYKU 1G7LA 2JK5B 4GKSB 5CJ8A 1ND0B 1EO7A 1XGYH 4MJ2A 2XA8H 1C5BL 3LQAC 3HMWH 4OI9A 4KKBD 4P5TB 1TQCB 4XZUA 5DR5L 4EI5A 4LEOA 1WC7B 2BVUA 1S7RB 3MFFA 3DIFA 5GZND 4L8BA 4JY5H 4MCZA 4X4YB 1AP2A 1S5HA 2UZIH 1UENA 4OLYH 4XNXH 5HDLA 3L7EA 5C2BL 1S7VB 5F70A 3V52H 4JRYA 1MRCL 3EUUA 1QP1A 3VWJC 4RA3A 4G8GE 1UKTA 4P2RB 1MSPA 3KYMA 2HYMA 2VLLB 3V79C 1XGUA 2DL2A 4XP6L 1F6AB 4OGAC 5DHVH 2HG5B 1IBGL 4ODHH 4WTZG 1IC4L 3IDNB 5DUBB 2X70A 4L3EA 1E0OB 4NCC1 4DKAA 5J56B 4ZQKA 1XGQB 3X11A 1GGIL 2CGRH 3P0VH 1IGFH 3GSNL 1NEUA 4Y5XB 4AENB 1X5AA 3CLEL 3SKNB 1NCTA 4PY8I 2XY2A 3WHXA 4KRPC 3L5WB 3VXME 5FV2A 3CIQA 4R9HA 1YEEH 3RUGE 3VH8A 1EO5A 4KI5E 4B53A 5C2UB 3K8MA 4QHNB 5JNYB 4EEEA 4M4PA 4HH8A 4N9OB 3MBEC 2WBJA 1I7TA 5D7IB 5HYQB 4CDGC 1OGAA 2V2WB 5AYQA 3WDHA 4ONFH 4LEXH 2NX5A 4QCIA 1DQJA 2F5BH 2E7MA 2DTML 2SEBB 5EU3A 4ACPA 1I7RA 4CUCA 2EE2A 3P4NA 2Z31D 2HFTA 4MB3A 1HINH 1NCWL 3EOAB 1OAQH 4JFFD 3TO4C 4LRIA 1OAXL 5I16B 1XCQA 4HUXA 2IG2H 5SWQA 4KXZI 4L1HA 4OSUH 1YMHA 3MBEB 4J6RH 1L7TH 2IEPA 2O26U 3D1MC 1A2YB 2E8ZA 2IANB 1MRFL 3KR3H 3SKMA 5B38G 5IM7A 1IGFL 3OAYK 1LEGB 2NY7L 3TZVA 4KMQA 4HS3A 4JVUA 1U3ZA 4NBXB 3R8QA 2C7UA 2YD3A 3VWKC 3DWTA 4M43H 2A6IA 3L3IB 4IOFC 4WHTA 1E6JH 4WTWA 5GZOD 3V6OC 1G7QA 5LXGL 5C07B 5HHXH 2Z92A 4HIJB 4YLQT 1CFTA 4KTDL 4EXPX 1IGYB 4OV5A 4FXGB 3CFJA 5GISL 3BIAX 1IGCL 1OARH 4XRCB 5I76A 4MLIA 3CNKA 4U1NB 3HAEB 5I1LA 1K5NA 5DRWA 4X0KB 3QNYB 5LGHH 2CXGA 3DV4A 5D96C 3DYOA 2DQJH 5HI5D 4UT6L 4X6DE 5HHQB 4PGDA 2C1OB 3EFFA 1KB5B 3QRGL 1NLDH 1JL8A 5MERB 2VXTL 5FA4A 1JGLH 4XTRC 4EDWL 4P4KB 1UYWH 4YXLL 1ACZA 4TSAH 5IKCA 4KJYB 4WI2A 3LKRA 2GQHA 4IRZH 5C0CE 5LGJA 4OAWA 4G8EA 3FMGH 3V6OA 2J6EA 2V9RA 5D1QC 5AYUH 3GMMA 1IEBB 2VLKB 7FABL 3SGKC 5IIEB 2VNCA 2DOCA 3HI6L 4Z7OF 4JFEE 3NGBB 5JOPE 5D2NE 4UDTA 1HCFX 1SYSB 5IJVB 1EJ6A 3FRUA 5T1DL 5ADPL 1T21B 4NZDA 4UTAL 4E42A 1NEZG 3IKCB 4H8WC 2X4NB 1VHPA 2ZCKH 2C4FU 5GRXG 2R1WB 2VDMH 2JJSC 1UCBH 3ZTNL 2DQFB 4JVWA 3BKCH 4H1LA 4YHLH 3RY6C 4NC1C 2DQDL 3ARPA 4HW6A 5EBMB 4QY8B 4DN3H 2XN9A 3C87A 4P3WA 5C08E 5EIIB 1QOKA 5EOTB 2FD6L 3DIFB 5EORL 1G7IA 2EDOA 4L8SB 3CD4A 4LP4A 4PJ9A 4RIRB 4X7TB 3DX8A 4QRUB 2XQYG 3KPRA 4WHDA 2WK2A 3LAFA 5LVEA 2YD8A 1H3UA 4MX7B 3UAJC 4PV8B 1RHFA 1LE9B 1TPXC 1MH5A 3O6FA 1XCTA 1AD0A 2X5PA 3K1KC 3O6KL 3BEVB 1CFQA 3D85D 3BVNB 4KK5D 1KN4L 1ORSA 1OSZB 1PY9A 2X4SA 1K8IB 1S7VA 4LMQI 4R8WH 3U82B 3CMOH 3IDNA 1ZK9A 1PKQA 5DUBA 2DICA 3O81A 1NFIB 1RU9L 1FC2D 3TPKA 5LWYL 5DEFB 4HUVB 1PQZA 2OJZL 3RAJL 2PXYD 1MAJA 3G6JB 3UBXB 4JZOA 3IGAA 2UWEF 4LPWA 1QTYT 5D9SB 4V1DD 3L1OH 5GGSY 3C6LC 5BRZB 3TCLA 3T77B 3SOBL 1JPTL 3MV9E 2P42B 4BELD 3WHXB 1YN7A 1UM6H 4ZQKB 3T0EA 3L5XL 4JFZH 4X7SH 2FATL 4V1DB 3BN9D 3GDBA 3E6HA 4YDIH 3GSUA 3PV6A 4ZYKB 4XVSH 3OXRA 4K07A 3BPLB 2COQA 1JGDB 1S9XB 4OFPA 3IJSA 1HSAA 3QQNA 1M7DA 2HP4A 5AAMA 1KCUH 5D7LA 1Z0MA 3U4EB 3CU7A 2W0FB 2NTFA 4OF0A 1K4CA 3GMOA 2BNQD 5KG9A 4JFPB 5AZEL 4PS4H 5KW9L 5CSZA 2HRLA 2YWYA 3ALXA 5EU7C 2H2SD 3AB0B 4M7LT 4D8PA 4U1KA 1JFQH 4F15B 4H26B 4U0RC 1RZGA 3VH8G 4U1HA 1LGVA 4RISH 3QUZA 4PRIE 1FO0L 5DRXA 1P69B 4ODSL 3MLRL 1KNOB 4JVPA 4JFOA 4RFOL 4BZ2H 5BS0E 5GRVK 4RAUB 1KYOK 2Z91A 4KI5C 1QR1A 1HZHH 1U8KB 3D5OF 4JY4A 2DLIA 1F6LL 1S7SA 2YXFA 3KPLA 1PX3A 5I18L 1HKLH 1OAYL 4R90L 5KVFL 2WWMC 3ARBA 1Z9LA 1Q8MA 2E7LC 4QRQB 2C26A 5IEHB 4M1CC 1BJ8A 3RWEA 4LLVA 3B8YA 2NY5H 3PHOA 4NO5A 4XMLH 2BMKA 2ZUTA 5ISZA 5F72S 3BEVA 3HKFA 1E4XL 4LMQE 3GMNB 1NGXB 3HZVB 3VMPA 1MY5A 3MMEB 1NKOA 1FAKT 3PHSA 3W0WE 4KVNL 3VFWA 4OZHB 5DC4B 1KTLA 1YY8B 5HPMB 3MV01 3WN5C 4PJAB 2AXHA 3MR9B 2X4TB 2V9QA 5T5NG 3X14B 4LVHB 4EUPB 4WU5A 5F93C 5GISH 4NPYA 1HH9B 4PS4L 1G0DA 3T0WA 4YC2C 3UYPA 1FH5H 2F74B 3FHQA 5D7JD 1R5VB 3HLAA 1WIUA 1WFNA 3OKEB 5FB8A 4WFFD 1XF1A 2UUDH 3B4NA 4JPVL 1TZHA 5SWSD 5HGBB 4BQCA 3Q3GB 4WI9A 5IHZB 1A7OL 1ZE3C 4XCCL 5INDA 1OP3H 1RUQL 3TJHC 3U1SL 4JPKH 5JPNA 2IQAB 4UT9L 4GQ9H 1S9WA 3MJ9L 4PJ5A 4R90H 3AY4A 3WE6B 1QHOA 4W4NA 4JFFB 1D7FA 5IHZA 1MFAL 3EZJB 3ZLQC 4FP8H 4RGOL 2RQ8A 4MCYA 1EO8H 3LMJH 1Q38A 2YD1A 1LO3H 1UB5B 1NBVH 3TBYA 1PG7H 4H8WH 1HILB 4O58L 5I1EL 1KXVC 4N0UE 3UCRA 5C08A 3O8XB 1WBYA 3HZKB 4UTBH 3DROA 4YDLC 1HOCA 2BOBB 2H26A 4GKOA 1D6VL 3BZEB 5GRYA 1MF2L 2H8PA 1NCDL 1KJ2H 1QSZA 2VITA 1U3HA 3ROOA 2DQDH 3D3VD 2MJWA 5ISZD 2J8UF 2AK4E 5IBUB 3ARXA 2Q76B 4X6EB 1A6ZB 3QDGD 3TWCH 1MH5B 3O6FB 1GHFH 1KCSL 2LAAA 4KQ3H 3GEWB 1OWRM 1JZ4A 3GJEB 3QUXB 4JPVH 3ETBF 3DBXB 2HTLC 5ELIA 3G6AB 3O2VH 5E5UB 1QFUH 3O3AA 2EZ0C 1KCKA 1FNAA 4MA3A 1DQMH 1YEIL 4UI2A 3R06B 3X13A 2DM7A 5DEFA 4DGVL 5DMIH 5CINH 2ZPKL 3QZWG 1CFNA 3RWCB 4UDUA 1MREL 4G7VH 3O0RL 3MRFB 5F7YC 3GZKA 2UZYB 2EXYC 1FG2A 3P0YL 1IM9A 3MOAH 1A8JH 3ARBC 4NQDB 2FX9H 5B4MC 2Z31C 5CLTA 1IMHC 2XPGB 3VW3L 1UC6A 3V0VA 1J8HE 5A2JH 3BPLC 4I0PA 3RU8H 3MLZH 1J8HA 2DJ4A 1JMZA 3FQTB 4HUKB 3BT2L 1KLGB 1QKZH 3LKQB 2DDQL 5T3XH 4HKZA 4QHLB 1A14H 5CCKL 1R0AH 2KKQA 1MCQA 2VR9A 2AJYL 5CKAA 3RPIB 2VLKD 4NQCE 5T5FH 3MV8A 4CMHB 2X89A 5D2NC 4GG8B 4UBDC 3RQ3A 3VGHA 2AERT 1QLFA 3E2HB 1KCSH 4LSUL 1DQTA 1MJ8L 1Q72L 1EEQA 3ARDA 4KV5F 5GSRA 2XA8L 3CSYA 3DVIA 3DXAE 4KK8C 3VG9C 3F7VA 4YHZH 1MWAH 2JB6A 1QEWB 3BGAA 2KH2B 3I75A 3SE8L 1MHHB 3T2NL 5MEQB 4HKJB 2OTUA 3WO4C 1GGUA 3ELAT 2ARJB 1U8OA 1I7UB 3DI3B 4WWKB 4DGVH 1A6VH 4X9IA 5EU5B 1D5XA 1FYHB 5DC0A 5JUEL 4EDXA 4PRHE 1WEJH 4P2OB 1MFDL 1TVDA 1M7DB 3MYJA 3RIAF 1U8HA 1XGPA 4CVXA 3GB7A 3O2DH 3VXPA 3P30H 4CVZB 4OF8A 1T0MA 3AS2A 1U95A 4E0RA 2NNAA 3SBWC 2IH1B 4QRRA 4AH2A 2ZUQB 1E27B 3T3PE 2HFGL 1JUFB 1C1EL 1QLEH 5FGCB 2OP4H 3P9WB 4YBQD 2VR4A 5T3ZH 3E0GA 3SKUD 3T08A 4PJCE 3C2AH 2EEBA 1X5HA 2XN9B 4HV8B 4DUVA 2HFEB 1CG9A 1W2KT 5C8JB 4BKLB 3MNVA 1I1AC 4KRPB 4AG4L 1CU4L 1OCWL 2WW8A 1DBJH 3JWNC 3PGDA 1T80A 2YA1A 4S1DC 1P4IL 1NGZA 3BX7C 5FOBB 1VADA 3HHRB 1N6QL 1ND0A 4TNWF 4LF3B 3TFKD 3FQNB 2CKBH 4NC2B 2FDBP 2FL5A 4PREA 4ZNEE 1DLHA 2FB4L 3S35X 4GBXD 1FVDB 3PGDB 3IAPA 1J0KA 1IM3B 2QQQA 3GJFB 3FQWB 1G0YR 2XKSA 4GXUN 3DMMD 1WZ1L 3IFLL 3RX5A 4IHOA 4FQQB 4NYLB 1MJUL 2YEZA 4RMUA 2OL3L 4ZFFB 3EOTH 4KFZC 4U6YB 1OQXA 3ZKNC 1K4DB 3NCBB 5C7XH 3TO2A 3HE7D 1D5ZA 3I02B 3J8F7 5KVGH 4XNYH 5C07A 3EDKA 4C55A 1GGTA 3JSSA 1R3LA 4PJFB 1EEZB 4FXGA 2EYSA 3RVTC 5I1CH 2ARJA 5MERA 3QFJA 2ZUYA 2WBJD 3LKSB 3B2VL 5DS8B 2FHCA 2AJSH 3BPCB 4BK4A 5J13B 4KXZH 2VLJA 3V0VB 5IT2L 4YR6A 4K71C 2ATPA 4UQ2A 3VWKB 2DM2A 4Y5XA 4AENA 1P4IH 3RGHA 2LABA 4TNWK 3V6ZA 1TZIA 1JNLH 4PRPA 5DHXB 5EBWB 2ZUUA 4JDVB 5I8EB 4YBQC 1XH3B 3FTGB 3PXHA 5IVOA 1IJ9A 2F53E 2ZG2A 4LIQH 2XYCA 1WT5A 4P5MA 3WXWH 1KEGL 2LVEA 1G7JB 2OR8A 5GS0D 3CCHA 4NQDE 4LKCB 4NUJB 4QHMA 5ALCL 3U7AA 4NQDA 3R06A 3ROOB 2YC1A 2B2XL 3BQUC 3TH3T 3TJEH 4LGPB 1I8KA 2V7HA 1U92B 5HPOA 1YECH 3RWEB 3TV3L 4QNPE 1NBYB 2PYFA 2GJ6A 3QEGH 2OL3A 3TA3A 3M17A 4JR9H 4KKCD 3LS4L 3KPLB 4HC1A 5HXMA 4Z7VB 5C0DA 4XMKL 5DRZB 1BP3B 4XHJD 5D1XC 2R23A 4CVZA 3CX2A 5EC2B 1L0YA 1AFVH 2FH8A 4YDLB 4Z8FH 4NUGH 4WGVB 1EHLH 1OGTB 5CS7A 3BT2H 1G9NH 4J4PD 3S5LB 4FXKA 1A3RL 1W0VB 1AI1L 3VD5A 3P4MA 5DRNA 3O4LB 3R8BB 5IGXL 4NKQB 3T0EC 2AJYH 4ELMA 4JDTL 5GSRB 5GRJL 4OLVH 1YPZA 4I13B 2GI7A 5DJ2B 3QPXL 2Q87A 3VRJA 4ZAKC 3KG5A 4NKIL 1AQDA 4N68A 3U36A 4ZSOE 1TETL 4I5BA 5E6ID 5J9PA 4AQ1B 4QTIL 1NMAH 1P5UA 2V5MA 2R8SH 4R4ND 4XPTL 4PLJD 1N0XL 4O2CA 1MWAL 3CFIC 3BH9B 4QHLA 1QBMH 5EZJB 3GSWA 4LSDA 1OB1B 3SDDB 3ZDXE 5JHDB 2DYPB 5ACLA 3H3KA 1P4LA 5B21A 2OTUB 3MGTA 3PWUA 3GHBH 5ALBH 2OMBA 1XF3B 1SY6A 1W72B 2JJUA 2R69L 2VSCA 3KLHD 4ZUTA 2PKDA 3ZMRA 3V5KB 1P1ZA 4MMZC 3MRQA 3ARED 3H0TA 2P5WB 3SDAC 4K94H 2PO6C 2WANA 4YHKL 2VITB 1CICD 3QO1A 5DQDH 4G6FD 4F7MB 1JJUA 4G5ZL 4BQBA 3TVMA 2V5YA 4EI5D 1YY9D 1D3CA 3V5HA 1CLOL 3O8XA 4NNXA 4URTB 5EOCH 3UJJL 3RGVC 1JWSB 5JOFA 4PJXA 2HFGH 3W11C 2ICWB 1N5AB 3RZCA 5D70H 5HY9B 3FN3A 4X7SL 3EO0B 4S1RL 2D4FA 2R2HB 4ZFGH 5TDOB 5ISZE 4QYOA 3EYFA 3UPRB 1Z0NA 2NLJB 2OQJB 1CD8A 1JPSH 1IFHH 1KCRH 2J8UE 2JLLA 1YNTA 4DTGL 1HI6A 4JM2D 5C0RL 1OVZA 2ICEB 4XPTH 2ED8A 3FT3A 2BSRA 4OCNC 3WXVL 2NY3D 1NL0H 4JFDA 3PHQA 4LPVA 4P99A 4HJJH 1BPVA 3MQIA 2YKLL 1EIBA 4L8BB 5D1ZC 4TYUA 3PHOB 2GTZB 3DOSA 3IDIB 4NO5B 2ZUXA 3U7WL 3QULA 4Z7WF 4HIXL 3RWJA 4F7TA 3EHBC 3V52L 5A2FA 1G6RL 2P47B 1Q0YL 2G9HA 3DO7A 3VGAB 1IL1B 5BS0D 4K8RD 1GPOL 2GFBA 4QF1B 2OJEA 3BGFB 1AIFA 1J05B 1SJVA 4WU5B 2WWKT 4ODHL 1NANH 5CWSA 2W60B 4E5XA 4HGWA 3O4LD 3QDJE 1CT8B 5KVGL 4FFWC 2CUMA 4ZXBD 3V4PH 4UILL 3MOBL 4WY7L 1DSFH 3EYVA 4P4RB 5T1KB 2VZTA 5K9OA 5I9QC 5MENE 2X4PB 4BH8A 3QUYC 3AREC 2FYYA 4G8EB 5SX4H 1DEEB 1RHHB 3HR5A 3TCLB 2HT3D 1Q1JL 1EFXB 2A6DB 1KG0B 3HNVL 3GSOA 4X7DC 4AL8H 3MJ8A 5B22A 2UYLA 4DTGH 3BW9B 3DX9A 4HMEA 4M48H 4OTXH 5J11B 1AH1A 2EYRB 5C09D 1T04A 3I3EA 4JJ5A 4M7JH 1MHEA 3CVIH 3UX9B 3WIIH 4Y16B 3RY5A 1MCWM 5DMGD 5F1SA 1EHXA 4FFZH 4JN1L 3EYOB 2QL1A 2NY6B 3SDDC 3DUHA 2ZG1A 5FM4A 4PRID 3WUWA 2V5TA 5FHAH 1GH7A 4M93B 5B39G 4ZFOA 3ORJA 5LBSH 1OTUC 1MNUH 3LDBB 1X7QA 4JM4H 1O7VA 4LL9A 5IW1B 3V7AG 3C2SA 3WXWL 1KEGH 2R56L 1J1PH 5EN2B 3PWPA 3QH3B 3HG1D 2WP3T 3G6JE 4U3HA 3NIDE 1AGFA 5C09A 3I85A 4NO0D 4XCCH 3GMPB 2J8OA 1YEJH 3HNTH 1ZVSA 1NDMA 3LRHA 3MRCA 4X4ME 3CX5J 4OCWH 5D6DC 1OAXH 1XH3A 2NX5D 5D5MB 1YN6B 3CC5A 1H8SA 2J8HA 1DCLA 4ZS6C 1T2QL 4MX7A 3K1DA 2AABL 1JF5A 4MYWB 4WHYG 4WTZA 3QWOA 3T4YB 5C0FA 1WBXA 2VLRA 3QDAA 4D9RE 4P46D 2QTEA 3DETC 5CD5C 4Z0BL 2M2DA 1CWVA 3OKNA 1NBVL 1AFVL 1ROWA 2R29H 2CPCA 3FQXB 5CJOH 1INDL 2F53B 5DJ2A 5HHXL 3NVQA 3O6LL 3T0XA 3U7YH 2HN7B 3G5VB 4NNXB 3GBLA 3WHE0 1MIEL 1VPOL 5E5RB 3HI1A 1MUJA 5TDNB 3WMSA 4OUUA 4IIQC 4NHUB 1K4DA 2R2HA 5SWZD 4H1LB 3HE7A 3QNZA 5EZJA 2CDFB 1UWEL 2QLVB 5F6HJ 3SDAB 2YSSB 4S1QL 1GHFL 2ZUSA 3QRGH 1RZKL 1QSFD 1NMAL 2F5AH 3L3OA 4ONHB 3SJVA 4Y4FD 1KLFA 4I3RH 5JA9A 1UM4H 1KIUA 4TVPL 3IFNH 4NP4L 3BPCA 1IGML 1IM3A 1DQDL 1KTRL 3GSRA 4OQTA 1JE6A 4LSVL 5MEPA 3TM6A 3WSQH 3U0WL 4WUKL 4TUJA 5IB4B 4MD4A 4TUOB 2DQEH 3RNQA 1DE4B 1PYWB 3P0YH 1M71A 3MUY1 1P7HL 1UFUA 1IAMA 4Z95H 4EBQL 3RZCB 3WEXA 3GFUA 4YX2L 5ADPH 4L3EE 4P23B 4YXHL 4EVNB 4CKVX 2L4OA 4KJPD 4PRBA 5ACMA 3I3BA 1A4KA 5L2KE 5DHYA 5GGUA 3SDDD 5EOCJ 1AO7A 5DUML 5IP4A 1DBML 1HXYB 3DV4B 4HDIB 4RZCB 3ZTNH 4TRPH 1P7KB 5CGMA 3V6FB 4AM0B 4HUXB 3ZDZF 5JZ7C 4POYA 5JXAL 4PB0H 4NFDA 3VI4E 4R97B 3FONB 2JELL 1JHKH 4NZTL 4ZS7L 4MNHB 2A83A 3JWDH 3L5HA 4LAJH 2V2TB 3MRDB 1R5WB 4X7TA 1U8NA 5FM8A 2V6HA 4P9ML 4BJLA 1HHHA 2GKIA 4UUJB 1PDKA 4UT7L 3BP6A 2Y1VA 3T2NH 3G08B 1YEGH 2WBKA 1E4XI 2EDQA 2DIAA 1R5WA 4HIJA 4GAYB 1T6WA 1U92A 3WCYA 3MRIB 3OGCB 1G6RH 2APWA 2ARJQ 4NRXA 3VXRB 4GW1B 4HHAA 1RJYA 4YDVB 3IJHB 4PG9B 1CZ8H 5I16A 4HKXA 4X0KA 4HBQA 3V4UH 1SJHA 4AEHL 4PV8A 3OAZK 4M61A 1YJDH 2YZ8A 1U58A 4YXHH 2VIRA 4PLNC 2Y5EA 4GKZB 4HWNA 3GKWH 3DX7B 4MXVE 1IGTA 1RUKL 1D9KC 3VDCA 4K8RH 4MJ5A 5A2KH 1A02N 4ZTOH 1QBLH 4HMDA 1S7TB 1FC1A 4QTHB 3QQ4B 1DBMH 4CAGA 1RI8A 5BW7A 3MLVL 1C5DA 5HBBA 4J8RB 5ESAA 3DRTB 4RGNE 1VGKA 4PJEE 4PUBL 3ZT7A 1RZKC 3QI9D 4PJ7F 4BK5A 3OTTA 4QHUB 4MQXD 2JELH 1JV5B 2E6QA 3B6SA 3RVUD 2APFA 3QCVH 2WINA 4X9GA 3T4AA 2WP3O 4MQ7A 2FX7H 2P8MA 4OKVB 3SDXB 2YD7A 4UDUB 1DDHA 4MNQB 5C3LD 5BZDB 4HXBL 3TF7C 1NGQL 5DHYB 1F2QA 2DQIH 2EYSB 3B6SB 4WO4D 2VABB 2C3XA 1EVUA 3DVFA 4DVRL 3IDUA 3EO1B 3KPSA 4XBEH 2A0LD 1N7MH 1UWXH 1YEKL 5IB5B 4HDIA 5HYJE 3THML 1HHIB 2ZOKB 1D5BB 4M6MH 5LGJB 4XCNA 2DM4A 3QEQB 3WNNA 4XXCC 4DFIA 2CK0L 4JG0L 1NAML 1H3TA 4N0CD 3V6OE 1BZ7A 3FO1B 3QWOB 1HZHL 1KIPB 2VLRD 4KKNA 1Z2KA 7CGTA 4Q6YA 2CDEA 5I8CB 2Y7QB 1U8PB 2GJ6E 3CSBA 3NAAH 4E41E 4GG8A 1A6UL 2VKXA 2EDLA 1DN0B 4OLYL 4O9HH 4NQSB 2PXYA 1HQ4B 3B2VH 4M5YH 5HHNB 5TF1L 5HHPA 4TULH 2E7BA 1S7UB 3D18A 5DJAB 1NPUA 4DOHE 3VJ6B 2OS7A 5MEQA 4NHUA 3O8XC 5CUSH 3F8UB 4LKXB 1BVKA 1SJHB 3RHWK 2HJKB 2PXYB 3GRWH 3LN5B 5EZLA 1IBGH 3IDMA 5DDHA 2EYTB 1UACL 3TZVB 4ONFL 1OP3K 3QUZC 1MCNA 1HXMB 1XGRB 2FO4A 1MVFA 5GJSL 4HK0A 2O5ZL 4ZNCD 3VXOA 3RTQA 4NP4H 3MCKB 3VFNB 1EFXA 2ADIB 2WQRA 4Q2ZA 5L9DL 1NCCH 1YYLH 1MUJB 5SWZE 3ARSA 2QADB 4XZUB 1I3RA 5LCVH 3EFDH 3GGWB 2VYRE 2EYRA 4NZRH 3X13B 4TTDD 3OZ9L 2MSPA 4HWBH 4LCCB 3WFCH 1JZ6A 4L4TD 3ZO0A 3KR3L 4WHCA 2UVFA 4MNQA 3QEGL 3PGFH 2V7NB 5DD3L 1TTFA 3EOYG 4WCYL 5FYJE 4FQXB 4JRYB 3S97C 1NFKA 4XPAH 3VFWB 4JPIA 3EW3B 1HHKB 3HRZB 4DUXA 4XVUC 3LKOA 4K94C 1FZJA 3GBNL 3O11A 4L3CA 3OR6A 1TJGH 5GRZA 5JQ6L 4LCUA 3ZKMD 5IR1A 4E0RB 2J3SA 4EKXA 1HN1A 4X8JB 3N1FC 1M71B 5B8CA 4BA8A 4M7LH 4KAQL 1RZ8A 5D72L 4J6RL 3OBAA 5HYEA 3WFZA 1CR9H 2J8UA 3P9LA 2A74A 3L3JB 1KLUB 4NQCB 1I7UA 4JG1L 4MA8L 3AMKA 5IFJB 2HT4D 1U6AH 2CSPA 1YJDC 1QD0A 4W81A 4JO1L 2ICES 2EXYD 2H32B 1U8IB 4LOUC 4UT7H 5L9DH 4Y5VA 2NY3B 3C5ZC 2QQNH 2C3VA 4OM1H 4PR5B 4JQXC 3W2DL 1HIMH 1T83A 3E3QE 4NJAL 2YN5A 3FT4B 5E5MA 2YD6A 1REIA 4PJ9C 1AR1C 3HC3L 3BRFA 1R24A 4OZGF 3GMRA 3PL6B 4TSBL 3DSFH 1UM5L 3B2UC 2VOTA 1U8KA 4C57C 4HC1L 1UB5A 3O45B 5CSBA 1L9NA 3A6BH 1A7NL 1F58L 4YHIB 5HTSA 4MNGE 2P5EB 4MLSA 1QFWL 4UTAH 5CLWA 1BD2A 2B39A 1P9MA 2R4SH 2HT2D 3HRPA 4TSAL 5GS0L 1BQHB 1YA5A 1I9EA 4G9DB 4EN3A 2BVQA 5ANME 2IBBA 2FNBA 4IRZL 3MLVH 3OG6B 2JB5H 4YHIA 1IM9B 2LTQB 3K74B 2Z4QA 3O4OB 4CDHA 4Y5VC 5E6IB 4Y2DD 3WO3B 2IAND 5H35A 2A73A 4Y19B 3UBXA 3HI6H 3SGKA 3ULUF 4NM8L 3BFOA 1Q72H 4LLWB 4HQQH 1Z6JT 3O3AB 4K3HA 4HWEH 2W1NA 1JP5A 1FZOB 5FYLD 5DD6A 4G9FD 5GGSA 3UPCA 3GRWA 2Y07H 2H3NB 3NCCB 5HDQL 3TLRA 1JWMB 3GSUB 4ZYKA 1XIWD 4NQUA 3VI3E 2XKNB 3GO1L 3I84A 4PRHB 1T7ZA 2AI0H 2ZJSL 2BSSA 1PG7W 5AD0A 4Y4KC 2AP2A 5FF6A 4X99A 3BJ91 4FQPA 4DVRH 3QIUC 1YN7B 3QBTB 3PWPE 4J1UB 3CPLB 3H9SE 3GSRB 4P3CL 4XVUD 4Z7VE 2GHWB 4E41A 1N4XL 2V9TA 5J3HC 1QZ1A 5D4QA 1ZTXH 4JCMA 4DCQB 3KXFA 2YRLA 3CFKA 1KFAH 4NWUH 4B5EA 5JHLL 3QEUB 5E03A 4H5SB 2JJTA 3TN0B 1HSAB 1FNHA 1JF1A 2LU7A 4ORGB 3L5XH 4JFZL 5HHPB 2BY3A 4UILH 4X6FB 1GIGL 2NTFB 3ILQC 1A5FL 3QJHB 2XV6B 5DTFA 2DI9A 3HZMA 5CJ5A 1OW0A 1KCLA 2CMRH 2QSTA 3HFML 4IMKC 1EMTL 4UBDD 5ITBH 4TUKL 2NY4D 4TULL 1NBYA 5JIHA 3TBSB 2O61A 5KSBF 2GJZB 3LOWA 4RFEB 2Q3ZA 3RGVB 1KCUL 1I9JH 1FG9C 3MV7D 1XF3A 3K2MC 2HFFB 4GO6B 1LEKB 3BKMH 4PD4K 3BI9X 5DT1H 5EBMA 4N0RA 5GRVL 2DJSA 1WGOA 4DKEH 2E9BA 4FFVD 3RTQB 5K33A 4HFWB 3DX8B 4QRUA 1RIUH 1NC4D 1QFWI 1U41A 3FB6B 2V2XA 2BRQA 3BESR 4Y5YC 2LTQC 3WD5L 2DAVA 3HI5H 5KJRH 2ZSWA 4D0DA 1U8QB 2O5ZH 2DD8L 2P5ED 1BVKB 4ODSH 5CD3A 3SN6N 1K2DA 1RZFH 3ULVE 2WMPA 1D5MB 4PV9A 3RIFK 5I15H 3CH1A 4ODVH 2PXYC 1ZLUK 1CXEA 4K3EH 1JYWA 2X1PA 4XXDB 1IC4H 2G60L 5TE4H 5IQ7H 1HHGB 3D69A 2J7LA 3BGMA 2YPVH 3Q2CA 4IRJD 4DZBB 1MLCA 4HWBL 3I6GA 3MRRA 1OGTA 5AZEH 1E4WL 1T5XA 2HRPL 2VXSL 3MGTB 3ARWA 4LASH 4IBLT 3VCLB 1MELA 3QI9A 3KYOB 1YNKL 3N85H 5DD5L 1MCLA 4ZUTB 1NGWB 2IFGA 4NSKA 1B0RB 3JV4A 4J3UA 4WI6A 5L2KA 1ES0A 5C0AD 3JV6A 4UQ2B 3O6LH 3EFFB 4GRWH 3SDXA 3T77A 3ZTJG 4LSTL 4RNRA 4I0PC 3MRLA 3WJLA 5CEZH 1DBAH 2OTWA 4Z7UF 4JFYA 1JCKA 5C0BB 4LEXL 5MP6H 4ODBD 3P0VL 5D8JL 2NW3B 2DIBA 4TSCH 5F7HA 1N8ZB 1LWRA 1CFTB 5L0QC 2Z9TA 1EUUA 2PW1A 3KDMA 3NABH 1H3GA 1KELH 3O6ML 4G6MH 1MEXL 1Q9OA 4JFPA 3P4NB 2DD8H 2VABA 3UTQB 1HINL 2OR7A 3OKMA 1KIQA 4C56B 5FUZL 1CYGA 3CFCH 4M6AA 5D6CB 4PD4J 3RWGA 1SEBA 4GQ9L 1T21A 3C8KB 4JZNB 3MUJA 2Y7QA 2J6EL 1NFDA 2AQ3A 2ESVD 4KZEL 2D7NA 4CJ1A 1UM5H 1CXFA 1MFNA 5IIEA 3FQNA 4PTUB 5D5MF 1P7KA 4QRRE 5DJ0B 1FBIL 2ZCLL 4JKKA 4Z95L 4RRPG 4EBQH 4QRRD 1A0QL 1UJTA 2O93L 5DJAA 4RQQA 4APQA 3BP4B 2NXYD 5BZWB 3TO4D 4ODTL 1G9NL 2EDRA 2EO1A 5C0NC 3X12B 1IGCH 1OARL 3RRQA 4JDTH 2IG2L 5KSBE 5HD8C 5HVWA 3FRUB 4GBXC 1ZGLM 5HHVH 2DQFA 4MDIB 3J7HA 4AY0A 3RWHB 4HKXB 1OP9A 1UA6L 1FVEB 5KSBA 5A40E 1BQSA 1SY6L 2X9XA 3OGCA 3ABZA 1KN2H 2IAMC 2YA2A 5DQ9A 2VL5A 4PJIA 1W0YT 3HZYA 2DL9A 1VGEH 2I25N 3S4SA 1LEIA 1IGJB 4EDWH 2DLHA 3ECBA 4LHJB 5I1IL 5DS8A 5JOPD 1MCEA 4C54A 4FS0A 3FB7B 4PJHF 4X6CE 4Q6IC 3NH7H 1O5DT 3QB7C 1KJVA 3B2UD 5EOTA 3BDXA 2ZPKH 2EE3A 1INEH 1JGEB 1U8MB 1FPTH 7FABH 3CK0H 3MRLB 4PJDA 1SBBA 4M7ZB 5DK0A 4IOIA 4G6AD 5I8EA 3T0VA 3MGOB 4L5FL 1EGJL 2W07A 3RVVD 5FKAB 1N2RA 3AGVA 4U7KA 3T3MF 3LEYL 5A3IC 1EJOH 2WBWB 4N9GB 4X7EC 3KLSA 2CO6B 4JFEA 1UJ3A 2R1YB 4XMPH 5DHVB 4HIHA 5GGTA 1AHWB 5DEGB 3L5WA 3SKOA 1QEWA 3MRRB 1F42A 3I6LE 5FGBC 2HJLA 4PUBH 5HHVL 4EXKA 3MA7A 1N0LA 4HT1H 3GIVA 4L3AA 4YK4B 1NFDB 3SKJL 4KHTL 4P5TD 2X1XR 5IEKA 4TUKH 2BHUA 4U6XA 5IB3A 4S1SH 3JZ7A 3GSVA 3PGCA 5T1DH 3QUMA 4KKBC 5C0DB 2NX5B 4WRLA 3NFNA 1EAJA 2AEQL 4LSRL 4AK1A 3AM8C 1FNSH 2VJXA 4WUUA 2F53A 3DMMB 2HVJB 4K3DL 1QUNA 5L7XH 2EC9U 1QHPA 2C4FT 3VXRD 5MI0C 3JVGC 1JTTA 3O3EA 1FNGB 5CEZE 4N1CA 1IC5H 2V2XB 1UGNA 4D2NA 4YGVA 2X1WL 4YHLL 3BP6B 1P9MC 4AEEA 4WNQB 4ZTPL 2F54B 1QO3A 4PJ8C 3BXNB 4KROD 3DNKA 2WM0A 1N64L 1BD2D 2JCCB 1KXQE 1CFNB 3RWCA 4Z7NE 2FEEL 2QHRL 5K9QG 3N1PC 3U6RB 2OR9H 4RGND 5IQ7L 2P8LB 3TBTB 1BGXL 5AZ2H 2F54D 5KZCD 3GMQB 4MAUL 2QQLL 4XGZA 2C7UB 5L88L 3OJMB 4PRHD 2YPLB 5C0EA 4GXVH 5CILL 3MRFA 1UXSB 1GVIA 4OD3H 1T66D 3OKOA 5DZLA 5BV7L 3M45A 3C2AL 1Q1JH 3K46A 5DMKA 3LHPL 1ETZA 1J7VR 1Z5LA 4U1SA 4N5ED 1EFQA 1RVFL 1JNNL 1IEAA 3NA9L 1FGVH 1RIHL 4M48L 5TDPB 3AUVA 4R7NB 4AJ0A 5K9JL 2C3GA 5CJQL 5FFLA 3GUTB 5E4IA 3V0WH 1ZHBA 4LCYA 1BFSA 1F13A 2F8VA 3H3PH 5AUMA 3M8OL 3L1OL 3QUXC 1RZ7H 3K7UA 2XZZA 5CMAA 2NW2B 4F2MA 1R3LB 1F6AA 1NMCC 3X3FH 2Z31B 1QLFB 1VENA 3FFCD 1C1EH 4JE4B 3HAEH 2VLKE 5J1AB 1MRDL 4PYHA 4PJIF 4YWGH 1ITBB 4LNRB 1K6QL 2R56H 5DVOA 3UEZA 3VD7A 5CJXC 3TESA 1KB5H 5MEOA 1YMMA 4OT1L 4ZTPH 1SJEA 5F88A 3P2TA 4Q97A 4J3WA 1XF4A 2OZ4A 1AGBB 4YFLI 2BHYA 3VXQA 2O61B 2YS4A 2VLJD 4KI1A 4ZXBA 1JGVH 4FTVA 3MJ9A 3QUMH 4FFWD 1E4JA 1T2QH 1N6QH 2DN7A 5ECJE 2NY5C 2B0SL 2VZOA 4GRWF 4GMTL 4WI5A 3VGEA 2VR5A 2D7OA 2UZIL 1I1YB 1JPST 2NY5L 4H0HB 3QUYB 3RWIB 3WFHA 2BMKB 4OD3L 5HI3D 4P5KA 4O5LH 4KUZL 5B3JF 5L8LB 1JYVA 1G6RA 1DVFC 3RWFB 3VWJB 4HFUH 5DSCB 4RMSA 2ZSWB 5J4MA 4JLRB 2DQTL 2WAHA 1JZ8A 3HZMB 5DFVD 1AGEB 3L7FB 5DMGC 3BGFC 1MFCL 3SCMD 3IFOB 1J05A 1XGTB 3O6FD 5AWNH 2VXQL 3VG0L 2VZVA 1X6LA 4KHXH 1A1OA 4ORZC 4X6CA 4U3XA 1BBJA 3QDJB 4YC2B 5I1CL 2JCCF 4QRPB 2ICCA 2IH1A 3B5TA 4P49A 2XN9D 3KYOA 3WFEL 3FRPA 1A7OH 5EC1A 4KVNH 5C0GB 3CVHB 5KTEH 4NC0B 4GS7B 1ITCA 4OZIB 2DBLH 4FG6C 5INDB 4GKNA 3QUXD 3I50H 4LSVH 4OCSH 5C92A 3OPZL 2I9LA 4Q58C 3I6KB 1VFAB 3MCLL 5AEAA 4ENEC 4TOYL 4FQXD 3VXSB 8FABA 1CICB 3S34L 4M1CD 2F19H 5GGTL 2HJFB 1NGXA 1U3YA 2VXUH 2GYSA 4JO3H 4PRIB 4Z6AT 5GS1C 1KJ3H 1P6FA 2PYEA 3DUUA 5C0BA 3TN0C 2NZ9D 1CGUA 1X3DA 1E6JL 5D7IF 4XH2B 3KPQA 5E1AA 3FL7A 1ORSB 1OSZA 3N9GL 1IAII 3LKPA 4YHYB 4OZFA 1KC5H 5GSVA 1AI1H 5ALCH 3P4OB 2GSIB 1B0RA 2VXQH 3VG0H 2PCPB 3MGAA 5IB1A 3BQUD 4ZSOB 4UOJA 4WFGD 3FQTA 4Y4KB 5IR1B 3R1GL 1F4AA 5KG9B 3K2UH 1OPGL 3NZHH 2VXTH 4JO2H 1LNUB 4EOWL 2CLVA 3AAZA 4X6BB 2VLRB 3SDCD 4JM2A 1MJJA 5HYSB 4UU9B 3W0WD 5TE7H 2VDOH 1OTTD 4M1DH 3VJ6A 4KVCL 3FAWA 3GI8H 1NBZB 2IALB 4WNQA 3GO1H 4NN5C 4NDMA 2Z31A 5D71H 4PJXF 5HGHA 3S34H 4P3CH 1NANI 1OGAE 1BFOA 1I7ZA 3MOAL 1QR1B 4H88H 4WI8A 3VWJD 1M05A 1G7HB 5FCUH 4IRJB 1QSFB 4XC1L 4Z7UE 4BUGA 1ZTXL 4FQIL 3PL6D 5C0EB 4CADA 2UY6A 2LU3A 3ULSA 3SEPA 2OR9L 4GBXA 3RFZC 3NZ8B 3SCMB 3P9MA 4FZ8H 2J88L 1RUKH 1YEDB 3CUPA 2E7CA 1K8DA 1EBAA 1HHJA 2VLRE 4J3VA 3HC4L 1JNJA 2V7HB 3UTPE 5I66A 1ZSDA 4A2LA 2APTA 1M4KA 5IVXF 1HNGA 2IPUG 3M17B 1JPSL 1TIUA 1ZS8B 5DURB 4ZAKD 3QQ9D 4LBEB 1S7SB 3ZDXF 3PG2A 4WUUD 3OKDA 3S36H 5HHME 3VMNA 5ABDE 3FFCA 3BISA 3NA4A 4TQEH 1ZLVH 5EO9A 4JFQB 3AB0C 3ARDC 3ULUL 2LAGB 5E6IA 3SDXE 2YC1B 4OFYA 4K2UL 4XCYB 2LVCA 2ITCB 3MLZL 2YKLH 2ZNWA 5KSAB 3IGAB 1OAZH 5KSUA 5KAQF 2R39A 5F7KC 3P4MB 1F3JA 2V5RA 2VWEC 3HUJF 1S78D 3H3BC 4XBPA 3TC9A 4HIXH 4PJDB 5JUEH 1YEKH 1QQDB 5F7EH 1FVDA 1WTLA 4Y89A 2VDQH 43CAA 1WLHA 4LHUA 5E8PA 4WHTB 4DAGL 4RGNC 5LWYH 3RVUC 3MA7B 4AEIH 1NUNB 1NUDA 3TN0D 2EDYA 1F8TH 2XKNA 1KXTB 4PRHA 1R3IH 4I0CC 4OIIH 4JFED 4AQOA 3GMMB 4P4KA 1DQQA 3LPFA 1MY7A 2EDHA 3PDOB 4JRXA 4FQXC 5J7CC 3KPSE 3C6LB 3U9UA 1E4WH 2QADD 2OP4L 3NFNB 4QNPF 5JDJA 1ZVYA 2IBGA 4L4VE 3MXVL 1MFEH 3BDYH 3MZTA 3VFOA 3QFJB 3AY4C 3PQYD 4HJ0D 1TLKA 4L4VA 4KK6D 1RIVH 4UIMB 3NFPA 4M3KB 4Q0XH 5FK9B 3D18B 4IRSC 3FO1A 4MQ7B 4OLUL 3P9LB 4ZDHB 2CLZA 3P30L 5CUSL 5E6ZA 4DGIL 1ZOXA 3VWKA 4LP5A 1CDBA 4OAWB 1YEFH 1MFCH 5DA4A 2I07B 2XT1B 2BNRB 3MLUH 3VFOB 4GQPH 1AC0A 1C7SA 1F5WA 3LIZH 4JGJA 2V2TA 3KPSB 4Q6IB 1G7IB 4L8SA 1RSFA 5CEYA 2KBGA 3V4PL 4WY7H 2Y36L 1LO2L 4NQVA 4U3CA 4MQXC 3VXUB 4F7CA 2P1YA 4F7MA 2QHLA 2FJGB 3HB3C 2K7QA 3QI9C 1EDQA 5GGRA 5F1OB 1UXSA 3NCMA 2AK1L 5IM7B 1CFBA 4I2XE 3HPLB 3S88L 4BZ2L 2VDNH 1MHCA 3HE7C 2GCYA 3ARQA 2AW2A 3OPZH 3FN0L 4G6KH 1TNNA 3QDHA 3VXRA 4OD1H 4D9QD 4MNQD 2W92A 4JN1H 4HG4J 1J9CT 4XI5C 4KZEH 3ES6B 1H3PL 2CKBL 3HPJA 2E6JA 1A2YA 4PJFA 5D96B 4WEUD 3VXOB 3VGDA 4POZC 3IVKA 2X4RA 1L6ZA 3S96A 3VXUE 3C6SA 3HN3A 3SO5A 2R29L 1VADB 5F7UA 3K4ZA 4NO0A 3GSNA 2C1OA 4YHPA 3MRMA 2A9NL 1G7QB 4B7LA 3PXJA 3RA7H 4FFYH 4XVTH 3TA3D 3UDWC 5EBLA 1CLZL 3I9GL 4DK6A 1J0IA 5E99L 4XRCA 1BMGA 1PG7X 1S7RA 5IVNA 1UA6H 1WK0A 3ISWA 1LDPH 3L95A 4WFED 1X4ZA 1K3IA 1NCUA 2Z92B 4PP1D 4B50A 3BJLA 5LGKA 4TUJB 5IB4A 1LD9A 5I1KL 4MA8H 2C4XA 4YXKH 1NAMA 5I76B 1U8OB 4J4PC 1CVRA 4X5XB 4P2QD 1MWAB 3EO9H 4S2SB 1N8ZA 3BD4A 3BEWA 2X7LB 3RX8A 5HSFA 4F7EB 5I0ZA 1YDPB 4MWFB 5E24E 3FN0H 4G6KL 1HSBB 1XZ0B 1OGAD 4LLMB 2EDEA 3D3VB 1H3PH 4KKCC 4GRWE 1NGWA 4GBXB 3BP7B 1DR9A 1HXYA 1WCBB 4G8GB 4P2RE 3NBNA 1UWEH 5TFSH 1QSFA 4HKJA 3TYFA 1HHJB 5DO2C