5GRYA

Crystal structure of disulfide-bonded diabody
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
231
structure length
226
Chain Sequence
b'VQLVESGGGLVQPGGSLRLSCAASGFTFRNSAMHWVRQAPGKGLEWVSSIWYSGSNTYYACSVKGRFTISRDNSKNTLYLQMNSLTAEDTAVYYCARFAGGWGAYDVWGQGTLVTVSCDIVLTQSPATLSLSPGERATLSCRASQSVSSNYLAWYQQKPGQAPRLLIYDSSSRATGVPARFSGSGSGTDFTLTISSLEPEDFAVYYCHQYSDISPTFGQGTKVEIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords diabody
publication title Crystal structure of mono- and bi-specific diabodies and reduction of their structural flexibility by introduction of disulfide bridges at the Fv interface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 51
structure length 226
sequence length 231
chains with identical sequence G
ec nomenclature
pdb deposition date 2016-08-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5gryA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5gryA01
3FAWA 3IT8D 4Z7NF 1KUMA 5D2LF 1DVFA 3GEWB 3MBEB 4GRMB 3P73B 1JMXA 3OX8A 4HFUH 1GVIA 3MUGA 5KS9F 5IVZA 4HKBA 3DV6A 3DBXB 5DHYB 4J1UA 4JFEE 2H6PA 3BQUC 4PGBB 2I9LA 1E6JL 2HN7A 4XC1H 4Z95H 5FGSA 3L5IA 1VFBA 1ERNA 1FLRL 3F65A 4PLKD 4K8RH 2AJ3A 4QXGH 1X5AA 2FR4B 4JG0L 1UADC 2FX8H 1NGWA 4OLZL 4Y16B 3ME0A 4YX2H 3DGCR 3N50A 4AY0A 2GFBB 1T7ZA 1A1OA 3F5WA 4OLWL 5EUOB 4IDLA 1N5AA 4L8BB 3TH4T 1VACB 1R5WB 1UFUA 2X4PB 5T5FL 1NEZA 5D1QC 3MRCA 3W9EA 3UPAA 3MACL 4QXUH 3K8LA 4NN6C 4P59H 5IQ7H 1I1AA 4PJBA 1MJUH 3MO1B 2DI8A 1EHAA 4NM4H 2DQEH 3O6FA 4P57A 4WTWA 4HK0B 4WI6A 2X4QB 1J05A 3BOVA 4G3YL 4DAGL 3MBED 3GKZA 5D70H 4ZS7L 2I5YL 4OZFG 4AT6A 1OAZL 5C86A 5I66B 1KEMH 4TVPH 4EN3B 5TJWK 1TQBC 4LU5H 3K1DA 1KPUA 3BMVA 3UTZA 3CZJA 2AV7A 4FMFA 3SDXE 1CTNA 3QHZH 4H20L 3UJTH 2HJKA 3RA7L 3BP4B 3VFVB 4LSDA 4NCDA 2GHWB 1S7UA 4BSVA 2QSCH 4JY6A 5CGYD 5DEGA 2XI9A 4JDTL 5J3HC 2O5XL 4Z7UA 3C09C 3WXVL 4GBXD 4X5WA 3ZMRA 4APQD 2DMBA 4BQ8A 2R2EA 2KQMA 3GSNL 5CKGA 3REWB 1GZPA 3QAZC 3VGGA 3H0TB 3E3QE 5DTFB 4LK4A 4JAMA 3DTXA 3LQAH 4K23L 2R0LH 4XP1H 2AV1B 2UVFA 4L8SB 5I76B 3SGKC 4B0MM 3MRMA 1P53A 3PL6B 4RQQA 3S36H 1CBVL 3KPNB 2EKSA 3VFRB 2B5IC 1SYVB 3ULVC 1DSFH 3N1MC 4I1NB 1HYSC 4LSQH 4JFDE 1AP2B 1NFKA 3TJEL 1BQHG 3RI5F 2XPGB 1JYWA 3QPXL 2BDNH 4N5EC 3EGSB 3IJYB 4K3DL 2BJMH 2OS7A 1GHFL 3KPTA 3O2DL 5DD1L 3GK8H 1UYWH 1JGDB 3TN0B 1I3UA 2BSRB 4RAUB 3OAYH 3OKEA 1L7IL 4F3FB 4LP5A 4XPFH 1TZHA 3CPLB 3GJEA 1A7QH 4PJCF 3NABL 2NY4B 3ARDA 4F7CA 5AD0A 3MROA 5HYFA 2PO6D 3KYMB 1RZIA 2G2RB 5I19H 4O9HH 2PTUA 3I50L 1IGTA 3BAEL 5DJ2A 3ARRA 1BGXH 2ATKB 2KL6A 4ODBD 1OHQA 1W0VA 5D7SL 3AM8C 4UV4L 3PL6D 4WHTA 1T1YA 4PJ5D 5DK2A 5FKPA 2I60H 1S9YA 3GMNB 4FP8H 5JQHC 5CJQL 2EH7H 2W59A 1PJ9A 5HHOD 4NBYB 5EIIB 2ADFH 2IH1B 1FVDA 1YEFL 3QA3A 4KC3B 5FA4A 3LS4L 3UCRA 3MBEC 4NZJA 1GAFH 5KG9A 4LSVH 4MB3A 3MOQA 3IXTB 3U7YH 4G8FB 2HYMA 5EU7E 2XOTA 4JFZL 2D2OA 2B20A 2AK1H 1RU9H 3UYRL 3FB6B 2EE3A 4K07A 2L0DA 4R7NA 1I8MA 3GMRB 3GSQA 3BP7A 3KR3L 1MCSA 4AMKL 3WJLA 4IOIA 2EH8H 4Y16C 1HHJB 1T6VN 3EOTH 4UMGA 4Y7MA 3BEWB 2EDQA 4APQC 4JZOB 5BJTA 3B9DA 1R0AL 1AE6H 2EO9A 1B88A 5C92A 1FC2D 3GDBA 3MREB 1BQUA 1U92A 1F3DJ 3BJ91 4OLYH 4RIRA 5KVEL 5DF0A 4U1HB 5D6CA 1QR4A 3K4AA 4TUKL 1XGPB 3MFFB 3RNQB 2UY7A 1QLRA 3G6AA 4PRPB 1T0NB 5KW9H 4YGVB 1Q1JH 1U95B 2GJJA 4LBEA 3EO9H 4U6VL 1NCAH 4OCYH 2WAHA 4E41D 1NEZG 3FRUA 3GHBL 5E8OA 2DQDH 2VLMD 3RWJA 1QKZH 4NWTL 4XVTL 4YUEL 3O8XA 3QEGH 3ARGD 2F5BL 4CRPA 4Y5XB 4N0CD 2Y36L 3Q6GL 2AXHA 5L9DL 3WKML 2CRYA 5GRWA 3RPIB 1MCOL 1L4IA 4YHNB 3RX7A 1MCFA 2VISA 2CJUL 1I75A 4OUUB 3A67L 3C5JA 4BFGA 4FQIH 3EFFB 3HI6H 3QP3A 4RMUA 1J0HA 1Z0MA 4WO4B 4CVXB 3TBSB 3X13B 3BPOC 4XP6L 3B2VL 1IQWH 1LE9B 1JPTH 2Z93A 4Z5RB 3MRPB 3VFWB 3MUZ1 4HWEL 1KCRH 1ZT7B 1IGJA 1KN2H 3DRTB 1FO0B 2ZSWB 1SY6L 3OJVC 2DQUL 3PL6C 3GMQA 5DJYA 1RZKH 5IESL 1KG0A 2FWOB 5DRWB 3RL1A 1V7NL 4P2RA 4PJEB 5EUOE 4ALAL 4LEXH 5F89A 1DBAL 1B9ZA 5JO5A 1IKNC 5CJ8A 2ARJA 2R0KL 5GGUA 2BVPB 2DM7A 3EW3B 4KDWA 1RUML 3DURB 2X4UB 4JRYE 3RKPA 1MHHB 4F8TA 2BY3A 2X42A 3EBAA 3MC0A 5MP6L 2WM0A 3U79A 2PXYD 2X1QA 4DEPB 1PBYA 1U8IB 5C2BH 4JVPA 3UC0H 1GZQA 1CL7L 3TNMB 3NFPA 2VLLA 1DZBA 2BX5A 1PG7X 2CLVA 4JHAH 1RZ7H 4S10A 5CIPB 7CGTA 4PRIB 5DJCA 8FABA 2ZOLA 4C59B 2R1XB 2IFFL 4HWBA 4O2FB 1ZXQA 2OP4H 3VG0H 1FAIH 2BVUA 1CXHA 5I18L 2MPAH 2EIZA 5DRZA 5F7EL 3RWHB 1SEBA 4XZUB 2XTJB 1QZ1A 2JF1A 5IEHB 2PTTA 5AWNL 1FZMB 5C0BB 2KH2B 2CDEA 2DBLH 2VN7A 2IQ9L 4F9LC 4HUWA 4I4WA 1M1SA 1HCVA 4NGHH 3S9DB 2P8MB 2OR7A 3WDIA 1X6LA 1YEJH 1BFOA 3LKQB 4OFDA 4HPOH 3MLTA 3HZMB 1BJMA 4YHPA 3VGFA 1XR8A 3CDGA 3O6MH 1FZOB 2LVEA 2VITA 2YUWA 3BQUA 5F88B 5JW4N 1MWAL 3D25B 5LGJA 4ZO6A 5GRVK 3X12B 4Q6IB 1PZ5A 1BHGA 5H94A 2C1OB 4GMTH 3K8KA 4WU7B 4ODTH 4BH7B 1IJ9A 1U8MB 2IAMB 4G7VL 3D3VB 3C60B 1NGQL 1XF4B 1NGPL 1SEQL 1CWVA 3IDNA 3MRGA 3JTTB 5DJAA 4KHTH 5D1QA 3WFDL 3GMOA 1FL5B 4U6TA 3ZYIA 1Z0NA 2J8OA 5KSBF 3HZVB 2XTJD 4MSWA 1RHFA 5CZVL 1MCDA 4LFHD 1PEWA 2VZ3A 1BVZA 3PF2A 3MRKB 3BKYL 4N8VB 1DFBH 4HWUA 1RJYA 2O61A 4X9FA 1MCIA 4GG6F 3IFLH 4IMLA 1RZGA 3H6JA 5B22A 2ZOKB 3NIFF 5DT1L 3TBYB 4UV7H 3JWDL 1FGNL 5FO8B 1CDCA 4Y5XC 2B1HH 1VCAA 3PHOB 3K3QA 2EICA 1TJHL 2ZJSH 2AJUH 5H2BA 4OB5H 4NKDA 5EU5B 4W81A 3DRQA 5JIKA 3GBMH 2Q8BH 1DN0A 5IHZB 4L4VA 1NCDH 3C5ZA 1HIML 1MLBB 4HCRL 2CDGB 4UOW1 3O6KL 4P46D 1MCQA 4P2QB 3SGKA 2R1WB 3BDYH 3MBXL 3TH3T 2E7MA 2BY0A 5E2VH 2FDBP 4FQLL 1VFAB 3PABA 1T5WB 3VFPB 3WFHA 1OSPH 4UB0H 2HVKB 4NQXB 4NO3A 3EOBA 1B4JH 5DS8B 1YY8B 3QDMB 5ABDE 3IAQA 5L2KD 2BY1A 3B5HA 4F7PB 3FHAA 3WFBL 3VMPA 2WUBH 1I3RB 2M26A 3TBWA 3MLRH 4OCNC 4NJAH 3QQ3B 3EYUH 4JPVH 4DEPC 1CZ8H 4NC0B 4M1GL 2ATPB 3S5LA 4ERSL 4H1LH 4YLQT 3N1QC 1YECL 4GAYA 5MI0B 3ZDZE 3MV8E 1J1OL 4XBGB 1AI1L 5DR5L 5MEPB 4GLRH 4P9ML 3F12B 4UQ3B 2HRPL 1MQKL 1FFNB 5D8JL 1VSCA 5E24E 2JB6A 3ZKMD 5DC4B 3UJJH 2X70A 1MFEH 3G5ZA 2J5LB 1OM3L 2FBOJ 2W65B 2BNRD 2BSSA 3DSFL 1U0QA 4N9GB 3AM8A 2YD9A 1R3KB 2UV3A 4QRPD 4PGEB 1HQRA 1VPOL 2XTJC 1BFSA 1LDPH 1U36A 2V2TA 4WW1A 4ZPTA 4P99A 1DBBL 3EZJB 3L3OA 4OLVL 3T04D 1BLNB 1QBBA 1YJDH 1EVTC 3DOSA 2ITDB 5J11C 3MBEA 2VLRE 2IPTH 4GRMA 3BZEA 1PY4A 2J8UE 4KKLD 4TSAH 4JQIL 4OLUL 2GITA 4MQ7B 4M02A 5EZJB 3L1OH 1S7RA 3DBXA 4NBXB 5DHYA 1OB1B 5TDOB 1MCEA 3L3JA 4HC1L 5L6YH 3OHXB 4PJEE 3T0EE 5IMMB 4PGBA 1CE6A 5IF0B 2WP3O 3LN5B 5IM7B 2VB5A 4Y4KD 3OZ9L 4Q6IC 3SKOA 3S37H 2HP4A 1AQKH 4TQEH 4YAQB 1W72A 1IGFL 2JTDA 3OPZH 2DLGA 2NPLX 2R1YB 2GFBA 5EWIH 4ZG1A 2IAMC 4APQA 1UKQA 1JBJA 4P49A 2LV4A 4L8BA 3C60C 1JF1B 2J6EH 2RGSA 3ARVA 1UCBL 2YA1A 1AGBB 1IEBB 3N1PC 5EO0B 2X4PA 5FM8A 3PGFH 1MJ8H 1RK0B 4O51B 3BW9B 2Y6SD 4PV9B 4HJ0D 5KVGL 1ND0A 2G5BB 5E2UH 3KJ6H 2GTZB 4NYLA 4M5YH 3LH2H 3HC3H 4PRIE 4HK0A 1A22B 2OL3B 4WFEE 1OAYH 4WY7L 1QO3A 4Z7QE 3GBLA 1Q9LA 5IW6B 3BWAB 5I66A 1UM5L 3WE6A 1D6VH 3GI8L 3UYPA 7FABL 3CLEL 4QHMA 2PNDA 3EYSH 5DC0A 4G5ZH 5SWZD 3V0VB 3LPGA 1FZKA 2DQJH 2MQ0A 4K7PH 4YNYB 4C56D 2VN4A 1I9JL 2HJLB 2LFGA 5T3XL 5E08L 2IWGA 2CKNA 1ZLSL 4NZRL 2OJZH 4OIAA 3U4BL 4E0RA 4G6KL 3H0TA 5KVDH 5L88H 1G7MB 3ZKMC 5I1LB 1NGZA 1XGRB 4LP4A 5I76A 2WWKO 4DOHE 43C9B 3PL6A 4WEBL 3KPNA 3MODH 4PJ5A 4F58L 1SYVA 3QFJB 5BO1H 5HHOA 3D3VE 4Z77B 1MUJA 3R8BB 2FB4L 4QRTB 5JZ7D 1I9IH 1MRFH 1AP2A 3QHTC 4EZMA 4N1CA 3B9AA 1I7ZB 1WAAF 4YC2B 3BDXA 1SJVA 3OGOE 3U7AA 3P30H 1KBGL 4KKLC 2PYED 1D5ZB 5IBLC 4XMKL 1JGDA 4MNQD 4TRPH 4HG4K 2BSRA 1WFOA 3RU8H 4RAUA 3HB3C 4MCZA 1SVZA 4F3FA 5IBUB 5INCB 4I3RH 2VDKL 5EN2B 5FYLH 1CR9L 3CPLA 3BIKA 2YK1H 4DZBA 3PWVB 5MI0C 5JUEH 4ZAKB 3IKCB 4LAQL 4Y4KC 1E4WL 4PG9B 2W9EL 2ICCA 4G6JH 4AEEA 3KYMA 3HG1D 4U1NA 4PJGA 2WBKA 4PJIE 4HFWB 1Q0YH 3TBVB 4MAUL 1GC1H 3V8CA 2FSEB 4KI1A 2K7PA 1A6UH 2ATKA 5EU4B 2J5LC 2R2HA 4S1DD 1I3GH 3S5LG 3BDBA 5I1KL 2WQRA 2F9BT 4NC1E 3TZVD 5EBMB 1FIEA 2Y6SC 4HJ0C 5IVXA 1TITA 2AXGB 5BOPA 4XCFL 1A14L 2B4CH 5EIIA 4DFIA 1FCGA 1HNGA 2XRAH 4F9LA 2IH1A 5C0DB 1NAKH 4P2QE 4NNPL 4IDJL 5ALBL 1ZTXL 4X80H 2EC9T 4WI9A 1YMMB 4E41A 3IXTA 2IQAB 2X7LB 1CGSH 2F19H 2YPVL 2HA1A 2RCSH 3ARGA 2W9DH 2BFVL 2NMSA 1QQDB 3NFSH 4OIBA 2WIMA 4NQDE 4O2EB 3SE8L 4CMMB 5I1HH 1N5YH 5GIRA 3VWJD 3JWOC 1BQSA 3GMRA 5C0GA 3MYZA 4OF6A 5EO9B 5D5MF 1WUNT 3BEWA 1EDQA 1I9RL 1B3JA 4JZOA 2EDLA 4UZGA 4GRWF 3MREA 4LLAA 4QRUB 4JGJA 4HQQL 4M5ZH 4AIZB 3IRPX 4P3WA 3CXHJ 2YA2A 5DUPL 1J8HE 1FFOA 3H3KA 2VXTH 4XHQA 1T0NA 3BT2L 5E8DH 4I5BA 4GKZB 5I71B 4WRLA 3EHBD 4FQ2H 3R0NA 5KZCB 1FDLL 2GAZB 4DKDC 3OAYK 3QQ4B 3JVGA 3HNVH 3FO1B 1FZJA 3IDXL 2KKQA 3ALXA 1IBGH 5FA3A 3ESUF 5ITBL 3DI2B 3HHRB 2PCPA 5I75B 3C08L 4Y5XA 4F80A 2H2SC 2PXYA 3RPIA 3UZVB 2YN5A 4UAOC 1AGEA 4DKAA 4S1RL 1JFQL 2FX9H 3S35H 5BW7C 4XWGH 32C2B 3SJVB 1V7ML 1QNZH 4L8CB 2VR9A 5I8KH 4OJFL 3EFFA 2X4NA 3CVHH 2WANA 4CVXA 3X13A 1N6VA 2M8XA 5I1GL 4QRQA 3VH8B 2XV6B 1LE9A 5ICXB 5IB5B 3VFWA 2VLJE 4Y4HD 5E2JA 1ZT7A 3I3EA 1FFPB 1FO0A 4S11A 4KVNL 4S1DC 3KPRB 4OKVA 3Q6FB 3NA9L 1LE5A 1FV1A 3RQ3A 3LQZB 3T4YA 2FWOA 3EYFA 4AEIH 4U1LA 5JW3L 5JXAH 1HSAB 3NCYP 1OF2A 4PJFF 4CW1B 3U6RA 1A3LH 4YC2C 4N90E 1ACYH 2VDPH 3IDYB 1S7XB 4FRWA 1UWGL 1EMTH 2X4UA 3VXPA 4LLUA 4JPIB 2NXYD 3LKRB 1AY1L 1JGUH 3WFCL 5E9DB 1U8IA 3HC4L 3ROLA 1X5FA 4LPUA 3TNMA 3VWJC 4ZAKC 3EOAB 1IM3A 3NCEB 3UTSE 4U6XA 1HI6A 1LP9B 2GSIB 4FNLL 5I15L 4LOUD 1CT8B 4KUZH 1OGAB 3FONA 1CU4H 4U7KA 3MOBL 1DQMH 1OCWL 3RWHA 1DBKL 3IRZA 5BQ7A 1CL7I 4G9DB 5MENE 4IRZH 1NGYA 3UZQA 5C07B 4RGMB 1G7IB 2FHFA 2KUTA 3WHXB 1D5BB 4KQ4H 2JCCE 2Q3ZA 3EHBC 1MJJB 1GCFA 3U46A 2P8MA 3BWUC 3TWCH 1VADB 1WZLA 3V5KA 4TUJB 3LKQA 1MIML 4JFOB 1A3QA 2VLKE 1CLOL 4K71B 1REIA 5E9DD 1ITBB 3MRQA 1EO8H 3QFJE 1DQLL 4RGNB 2OK0L 4KH2A 3D25A 4U1IB 5A2FA 4QRRB 1J88A 4OD1L 4Q6IA 2VZUA 2BMKA 3X14B 1A7PH 2R23B 3OQ3B 3T3PE 1U8MA 1UXWB 2Y4SA 3BKJH 4YDVB 3BGAA 3WLBA 4RISL 1UVQB 4OV5B 3RWIB 1U8JA 4IRJB 1CDGA 3FFDB 4IHOB 3MJ9H 4P46A 2P49B 2NY5C 5DJDB 4ISVA 1RI8A 4EDWH 1H3PH 4LVNC 5C07D 4P9HC 1WCBB 3OG6B 3NAAL 4LVHC 2FIKA 1NBVL 5GS0D 3IETA 5HHPB 3ES6B 2DAVA 1BIIA 2ADIA 1AGCA 1BBJA 3MRKA 1SYSA 1KXQE 2ZG1A 3MLUL 4N8VA 5AAMA 4E9LA 5HYJB 3VXUB 4EEEA 3QXAB 4KTEL 5HVGB 4LPTA 4NPYB 4A6YB 5L2KA 3V9FA 1T2QH 5T5NG 1JNJA 3TBYA 5D7JB 3PUCA 2V2WB 2QQNH 5GRUH 3ZYOA 1VFMA 4RGND 3PHOA 1OSZB 4L1HA 4YBLC 5SWSE 3OB0K 4KPHH 5C0EB 5EU5A 3MR9B 4LCWE 1OARH 1N6QL 1MPAH 3HS0B 1II4E 5IKCB 1N59B 5BRZB 4GAGH 1YMME 2A9NH 1KPVB 3SGEH 1JN6B 3BVNA 1E0OB 3LEYL 1A7RH 3HC0B 4HLJA 1MLBA 4OGXH 2P5EE 2CDGA 3ARXA 2P42B 4PRBB 1BVLA 5D72L 2YXMA 2R1WA 1OD9A 1RK1A 2R4RH 5C71A 2BNRA 3T2PA 1G6VK 4D0DB 2XACC 1PZUB 4NHUB 3O3DA 1KIPB 4HFUL 4QRPA 2YKLL 3L3HB 4NUJB 1GPOH 4ELMF 2HVKA 3WSQH 4NQXA 4HXAH 3PE9A 3VXUD 3M1BB 1JL8A 2IADA 3AAZB 5C6PB 1YY8A 3LMJH 1F6FB 3QDMA 4K8RL 5D7JD 1FRGH 2J3SA 1U8LA 4NBZB 4YX2L 1M7IB 5EBWB 2W1NA 3FT2B 1NFDB 3QQ3A 4NT6B 2VRAA 2FZ3A 2ATPA 2X5PA 5C08E 1FG9C 3VWKD 4I3GA 3V79C 1H3WM 1MAKA 1W8OA 3PWPB 4XBGA 4Y4KA 4LSTH 5DA4A 5MEPA 1C5CL 2EC9U 3MLZH 3OTTA 1MJUL 4X5LA 1XAUA 3AU1B 4UQ3A 3ZT6A 1FFNA 5I30H 2WWKT 2DQEL 2ESVB 4MA3B 4WDIA 4XAWH 1VFOA 1AC6A 2W65A 3TEUA 2OI9B 4N9GA 1DEDA 2BXZA 4PJAE 5TF1H 2YPLB 4HF5L 1R3KA 1KEML 4NQEB 4PV8B 4QOKB 4LU5L 2UZIH 3D0LB 4RGMC 4MA8H 1P7HL 5FYKL 5GS0C 5KSAB 4M1DL 2ITDA 4ZPVB 5DSCB 4K7PY 1KF9B 4JDZA 4GKOA 1M7DB 3QPQC 1NAMB 5EZJA 2VMFA 3QSKB 5TDOA 5SWZA 3WUWA 2AS5M 2EYRB 1TDQA 4RGNC 5FF6B 3LQAL 4LFHG 2R0LL 2AVGA 2K9UA 3W5NA 5T1DH 4C56A 4E5XB 3C2AL 2VKXA 4KROB 4XH2B 3S36L 2R1YA 2XWBA 4GKSB 5C0ND 1EEUA 1JF1A 4AL8L 1AGBA 4IRJC 4KDVA 5E5RB 3QXVA 3MNZA 4BZ1H 1KCUH 4B53A 1P4LA 4MNHB 4AJ0A 1KCVH 2A38A 3VA6A 5D96C 2VZVA 3DUHA 5CKAA 5CHNB 4FA8A 5B38B 4NNYA 1MCKA 1LP9E 5KSAD 4PGCA 5FUZH 2OL3A 4PS4H 1KXVC 1AHWB 3S7GA 4WFHE 1IL1A 3I02A 5CEZL 1JK8B 1BM3L 4HS8H 3MRDB 5IW6A 3BWAA 1CDJA 4LVOB 2C4FT 4ZO8A 3MV7B 3MV9E 3WIHA 5D7JC 2ENSA 5I19L 3HUJE 1BIHA 4N8CH 4M61B 1T1XB 3QDHA 3I2CL 5J6HB 1NCTA 3S3PA 5F97E 2HJLA 4HS3B 4KROD 4JO4H 4N8VG 2NLJA 4NQTA 4L3CA 4K3HA 3U2SB 3DNKA 4FP8L 5C0AB 5CUSH 5D2LB 3O41B 3HG1A 3QO1A 2VWEE 1EO7A 4JY4B 4QRSA 5KS9B 3LKSB 1CF8H 1F90H 2UYLB 1A0QH 4QRRE 5T1MA 1A9BB 1JPGB 3EKCA 3MRNB 4LSVL 43C9A 3G6JA 5SX5K 2XYCA 5HVWA 4XXCC 3U7YL 2E27H 1XF3B 1MLCA 4YHIB 3WFEL 3FCTB 4RAVB 4R90H 1RU9L 3O2WH 4XHJC 5BVPL 4X4ME 4Z77A 1X5GA 4QRTA 2IBGA 4JRXD 1UWXH 3HNSH 1A9EB 2EIBA 1I7ZA 2OQJA 1SMAA 4M4RA 4ZDHB 1JF6A 3MV7D 3MLYH 3ARFB 1S7WA 4OCLC 1HNFA 3STBA 2QKIA 3WS6C 4EIGB 1J5OH 1B6DA 4X7SL 3TV3H 4ETQB 4JJ5B 5INCA 1IEAB 1AE6L 1HEZB 3HTLX 2NQCA 2DTMH 5DK3A 5EN2A 2VYRE 3QIWD 4KGJA 4OLYL 4KJWD 3VDAA 3VWJA 1J0KA 1RZJH 5K59E 2QQLL 1ZA3A 3C6LB 5KW9L 1C5BH 4HFWA 1MCHA 3TBVA 1Q1JL 2FSEA 2DICA 3W9DA 4EUPB 2XQBL 4MDJB 3EO9L 1NCAL 3VXRE 2OI9C 3X3GH 3ULUH 1I4FA 2EE9A 3VFNA 3JV0A 4OZHF 5EBMA 1G6RB 2DQDL 5GJSH 4ZUVA 3AS0A 4NUGH 5H37H 1KIRB 1QEWB 3QEGL 3OR7B 1CXLA 3QCTL 1IAKB 1G7LA 5GISL 5KSAC 5C0DA 1L7TL 3V4PH 3WNLA 1TZGH 3FMGL 4KXZI 1CQYA 1WK0A 1A7BA 2X7LA 1IAIL 4QHNB 1QSED 2BXYA 1XGTB 3N9GL 4PRHE 5FYKE 4EOWH 1T89C 2P8PB 2OXHA 2J8HA 3GNML 4CMMA 1CFTB 1KN2L 5IR1B 5HSFA 5HVHB 1MFCH 4KROC 2DQGL 5L7XH 3FFCB 2R39A 3SQOL 4UTBL 1RZKL 2ITCA 1NFDE 2GK2A 1N3NB 1K85A 3K2MC 4LEXL 4Y1AB 3WUWG 1ZHBB 4Y4HA 4AIZA 1YQ2A 4J4PD 4HUUB 4Z7OE 4X6CE 3O81A 3PWPE 5JIHA 1JPSH 5ANMB 5E6ID 3OKDB 3MRHA 4PJCB 2FJHA 2ESVE 3QQ4A 1MH5A 5C2BL 2BVOB 2WWMC 4GS7B 2G75B 1AHWC 3ULSB 4XNMA 5DI8B 4YHOL 3RJQB 5KVFH 1ZLWH 2YPLE 4LVOC 3BRDA 1ZT1B 3FN3A 3WIFB 4QOKE 3D0VB 2RJMA 1QPXA 4OCSL 2LQRA 1RZ7L 3IGAB 2DKUA 3HE6B 1WZMA 1U2CA 4MD4A 3HE7B 1FFQA 2DOCA 2R69L 3VG0L 1FAIL 3FQNB 1CFSB 3UMTA 2MPAL 3QDAA 4TOYH 5CEZE 2D0HA 4H25A 4TSCL 1ORQA 4KJWC 4XMPH 4L8CA 5CP3H 4G8IB 1FIGH 1YQVH 2J4WH 2VXVH 2W92A 4FZ8L 4XPHH 4JFQB 1KTKE 3VH8A 2DBLL 1PYWB 4H0HB 4Y1AD 3GJFB 5IB5A 4NGHL 1FFPA 1HQ4B 2VXUL 2XNAB 4QY8A 2H26A 3Q6FA 1YEJL 3LSOB 5TE6L 4OQ1A 4HPOL 4LEOA 4R4BB 1CLCA 2Q7NA 5JORB 4U7SA 3O6ML 2GJZB 1KN4H 4DCQB 1T0PB 3GHEH 5J7CC 12E8L 5F71A 2FLBT 1S78D 3W82A 3CIQA 4HLZG 1TZIA 3MTRA 3MV8D 1JNLH 4CN1A 1S7XA 2AK4B 3ARFC 1D9KD 2GTWB 1DN2A 3HE6D 4I3SH 4HEPG 3LKRA 4TULH 4MQXD 5E9DA 3A6BL 4N5UA 3REVB 3VRLF 3AROA 3C8KB 4LRNL 4G6MH 4U6YB 5TQ0H 2ZPKH 4TNVK 4XNQA 2DQCL 4F7MB 5EU3A 2YA0A 4QTIH 1N2RB 3C6LC 2A9MH 2GSIA 2XWJB 5GS3A 2ZUWA 3GFUA 2JELL 1CT8A 1OGAA 3E2HC 5IBUG 3DXAD 5GZOD 1DFBL 4PJDE 3ILQD 4J4PC 3IFLL 5IFHH 4LSRH 2F53E 4KI5F 4IJ3B 5C07A 1G1CA 3WHXA 1EGJH 1G7IA 3H7BA 1JNHA 5DD0H 5E6IC 3ZKSD 1TNNA 1FPTH 4BZYA 1IZJA 2ZJSL 4LMQE 1KTLA 1UACH 1IC4L 3OKNA 4OZ4A 1CFNB 3PQYE 1YEKH 5FIEA 5J12B 1C08B 1U93B 2EYSA 2Q8BL 1N64L 2NY3D 3GBML 4JG1H 4JFOA 4DVBB 3OXRA 4HIJB 5D1ZB 4NKIH 1G9MC 1NCDL 5EOCL 5DHVH 3EAKA 5JNYA 5I0ZA 1X7QA 5E00B 5FKAB 5FUOH 3BD3A 4I2XB 4U1IA 3BDYL 3EYQD 3S4SA 4FXKA 3X14A 5C0JB 2R23A 1MQ8A 5E2VL 1MFNA 1H3GA 5E94B 1UXWA 4OZIF 4YDVA 4RA3A 5GGTA 4QXWA 4WHYH 3FL7A 2UWEF 4UB0L 2PN5A 1S7SB 3JV4B 2DL9A 4LCCA 1KPRB 4P5TB 2V5MA 4IHOA 3PIQA 4MJ4A 1DL7H 2P24B 5DJDA 2HT4D 3GKWL 4G42B 4JZNB 5D9SA 5HYQB 2ZUXA 5HBBA 3U4EA 3WO3B 3HLAB 1NC2D 1WCBA 5LG1A 2WUBL 4MS8C 5F8RC 1ZEAL 3MFGB 4K9EC 3P11H 1RJZA 3EYUL 4I9WE 4LLYB 5HHPA 3WXWH 1UZ8B 1KTRL 1DEEA 3CFBB 4GS7C 3VXUA 1S78C 1ZKAA 4HKXB 5FOJA 4MJ2A 5SX4H 4WI7A 4NPYA 1FFRA 4R0LB 2B1AH 5D7JA 3S37X 4PBWD 1D9KC 2I26N 2ENYA 3HE6C 1KNOB 1OSZA 1X4XA 4JM2F 3HE7C 4BELD 4MQXC 1MFEL 3FQUB 3VWKA 5C0EA 3ZTNL 3HS0A 2VTFA 1EXUB 1KPVA 1MCLA 5E5MA 5KOMC 2YEZA 5ALCH 1LDPL 4MJIE 3HC0A 3HZYB 1Q9WB 3S34H 3QWQB 3JV6B 4P5TD 1YJDL 1RQ5A 5JQ6H 5B8CB 3NIDE 2IPTL 3JSSA 1M05B 3THMH 4PB0L 5GZOC 4ZODA 3ILQC 4HZLB 4XXCA 5BZDB 4ZNEA 2VR5A 3ARPA 3L1OL 5KN5B 3WIIH 3QIBD 4ZUSB 5J0BA 3VH8G 2EDYA 2YD8A 3AAZA 5DWUL 2Y1VA 2BNUA 3ZE2F 3OGCA 5E6YA 2AXFA 4K7PX 4Y4FB 3S37L 4TQEL 5FO7B 4JR9L 3TA3B 1C12B 1M7IA 3KYOA 5CSZB 3WS6A 5HGGS 4NT6A 5ANME 5KSBB 2J6EL 4ONHA 4YO0B 1J12A 4FABH 3PGFL 1MJ8L 1MFAH 2ZUUA 2BSED 2RFXB 3EYQC 1DDHA 4IRSB 3LEXB 1XCQB 3KJ6L 5E2UL 5GGSY 4DTGH 2D0FA 3AS1A 4M5YL 3G5XB 3HC3L 4W70A 2YUZA 4M43H 4Y5VB 4N0RA 1OAYL 4DK3A 3SN6N 4DJMA 1R3IL 2BHZA 3F58H 3EO0A 2IANB 5CBAB 4PV8A 4NQEA 1A47A 1D6VL 2FHCA 4IJ3C 4Y19E 4JN1H 4TNVF 4JFXA 3EYSL 3CFJB 1N4XH 5KSAA 4NQDD 1GGYA 3OJDB 1QG3A 4WCYH 2GUOB 4JDVA 4K7PL 4C83A 4OZGB 2W0PA 2V9TA 5DSCA 3PGCB 3V0WH 5J12C 2ICES 1CG9B 1E27B 2OJZL 1AJ7H 3BX7C 4MA1C 3JWDC 4Z9KB 1N26A 1BBDL 4BZ2H 4LDEB 1T89A 5FF6A 2HJFA 3O4LB 2AGJL 1T04A 3W5MA 1KLGA 4KZDH 1J8HD 1XGYH 4IRSD 4BSWB 3DV4B 4XH2A 1S7TB 1FNGB 5LXGH 1UB5A 3MODL 3LKNB 4XAKD 3RY6C 3GSNA 2CKBH 5BO1L 3MJGX 3NIGE 4P5TC 1O7SA 1I9IL 1MRFL 2I9TB 4RMQA 5MHSE 2Q8AH 4OBSA 3MPCA 1GJIA 2IAND 4GH7B 4PY8I 3P30L 5LJYH 3GGWB 4IM8A 4NQCB 3S4SG 5B38A 4TRPL 3CSBA 3FN9A 3RU8L 4QNPF 1OD7A 1U8QB 4I3RL 4X9BA 5ECJE 5FYLL 2QV2A 1AHWA 4JRXA 3V7AE 1JK8A 2YK1L 5JUEL 4HUXB 4HW6A 3MV7A 3O2DA 4R0LC 1GGTA 1YEEH 2E6QA 2HFEB 3IJHA 4OLXH 5E4EC 1I7TB 1XF1A 4G6JL 5EZOH 3Q5YA 1XGUB 3FQTB 3T1WA 1KOAA 2PR4H 3O4LD 1GC1L 2Y25A 5FYJE 3ZL4H 5B4MC 5J6HA 3DSNA 1A6UL 4WFFD 5F6HI 5T3XD 4IBLT 1C1EH 2ED9A 3U2SA 1IC7H 2DKMA 2WBJD 5A40E 5JPNA 1RD6A 5D2LA 5H8DA 3W0WB 3O41A 1U3YA 3QDJD 4KMQA 1UM6H 1X5LA 1FYTE 2B4CL 3RZCD 2MQ3A 2JIXB 1Z5LA 2PF6A 4JY4A 4U7MA 3FJTA 5KS9A 3LKSA 4I2XE 1NAKL 4ZD3H 2UYLA 1XGQB 4AH2A 5HHVH 1A9BA 1JV5A 4X80L 2AEWA 1Q9KA 2DM3A 5EUKA 4NWUH 2GK0B 1IEHA 5BMFL 4X7TB 2DLIA 4YHIA 3FCTA 4RAVA 3SDCD 4YK4B 5D4QA 1DBML 4QWWD 5C7XH 1ADQH 1A9EA 1UB6A 4F8QA 1ZGLB 3UTSD 5E03A 2NR6D 3O9WD 4XPAL 3PDGA 4Y4FC 4ZDHA 5IVXF 3S35X 1JGVH 1S7QB 3ARFA 3TA3C 1V5JA 4HG4J 1QSEA 2D7OA 3WCYA 3UPRA 4JJ5A 1QOKA 4POUB 3VFUA 3I75A 1HHKB 4M5ZL 4JO3L 1S9VB 5IW1A 3TYGL 5FO9B 1KCKA 2VXTL 3RX8A 4IRSC 1G7PB 1U8NA 3W0WD 4JG0H 1P1ZB 3OL2A 4YXKH 2E7CA 1ZANH 1S9KC 1YNKH 4Y5VC 4EUPA 3HNVL 2NY0B 1DR9A 5IMOB 3ZKQD 5JW4R 4U2ZA 4ZUWB 5TH2B 3L3IB 4KV5F 4J4PA 5J6GA 4H88H 3MACH 1QFHA 3NTCH 3QUKA 4HPYL 4FHBD 1KIRA 1JPFB 2CDFB 5E6IA 3QXDB 1IAKA 1TLKA 5T5NF 4QYOA 4U1GB 4LVEA 4X98B 2C1PB 3S35L 2FX9L 1EEZB 4G3YH 4FFZL 4CMHB 4DAGH 2X9WA 2DQTL 2I5YH 3MV11 4R96A 1QNZL 1OAZH 1KGCE 3KHOA 5I8KL 4AENB 2NX5B 4K94L 3CVHL 4PJHF 4NKOB 1JHLH 1PKQE 1QRNB 1XGTA 1RIVH 1QSFE 4URTB 1GOHA 4RDQF 4KWUA 2HVJB 1MNUL 1CFTA 2J88H 3M17A 5IR1A 1EBPA 4GOSA 3QUZD 2EYTA 2YPKA 4JDTH 2O5XH 3FFCA 3W81A 1T22A 1SJHB 2E7BA 4P23D 3WDJA 3WXVH 2XTLA 4FXGA 3FO2B 2YD5A 2GEEA 3LZFL 5D1XD 5JXAL 3GSNH 1OT2A 3KVQA 2C26A 5FAAA 4F2MA 5J13B 1Y6KR 4Y1AA 3HPJB 4X0KB 5HHMB 2KDGA 4LCYA 1AH1A 4K23H 4HUUA 2GJ6E 2IH3B 5IMKB 1UWXK 1ACYL 3T65A 2NY2B 3WL9A 3NVQA 3FOLA 3NH7L 2Z35B 1EMTL 1CBVH 2B0SH 5C9KA 4PJCA 4KRPB 5DD6B 3AY4C 1JGUL 5AYQA 2H3NB 5CSBA 1K5NA 3ULSA 4LHJB 3MV8A 2R29H 5C0IB 3SO5A 2EDNA 3TJEH 4Y88A 4YJZL 1UA6H 1ZT1A 4OD3L 2UUDK 1EEYB 2AJXL 2VE6B 3D0VA 1YEIH 1D9KA 1JE6A 1XT5A 3O2DH 5DD1H 1QRND 3L3GA 2P5ED 4MYWB 3HE6A 5B38G 5HGAB 3K7UA 5EORH 4FXLA 4W6YB 1NCBH 1RUKH 3HE7A 1CU4L 4XBPB 1CFSA 1DQML 3HAEA 1P2CB 5DMIH 2F74B 4OZGE 3IXAA 1A6ZA 2D31A 3ARBD 4DN3H 4KZEL 4IRZL 4U1JA 5I9QB 2GSGB 4JFYA 4JFQA 1XZ0B 1KIQA 4M1CD 1T80A 1Q38A 4WUKH 3GJFA 1B0GB 5HHMD 2YC1B 2A6DB 3BAEH 4CN4A 3BGMA 2FJGB 1HQ4A 4XGZB 3DXAA 5EZLA 2J8UA 4MJ6B 1D3CA 3LSOA 4OT1L 2YD7A 3Q5TA 1YEDA 4R4BA 1T0MB 5EIQA 3EJJX 2VDMH 3BI9X 4CJ0A 4KRPD 1JYNA 2X44D 5C70A 5CJQH 2WBWB 5C08D 4YK4C 4RNRB 1R3LB 4L3ED 5LAXA 3RWFB 4ODSL 4QO1A 5F96L 2BC4B 5D5MB 4JLRB 1WCQA 5L8KB 1MF2L 2G9HB 1YEFH 1JZ5A 2AI0H 4ZQKB 4GRWB 1OTUD 1A7PL 2P4AB 2GTWA 5CJ5A 4NQCE 5K9KB 5I17A 2OMNA 3ET9F 5IOPA 2H32B 4JFZH 2FO1A 4X8JB 3RVWD 3REVA 3MJ9L 4JPKH 3C8KA 3IU3B 2MCPL 5FYJU 3ARQA 4C57C 3QUZC 4EDWL 4XNZB 3I9GL 4F9PC 4P23C 5J1TC 3EUUA 3UAJD 4O5LL 1U8PB 1QVOB 5HHXL 1KJ2B 5D1XC 3VW3L 2NY0C 2QQQA 2PKDA 4WW2A 3PHQB 5GSVB 4DN4H 5KVEH 4NO5B 1T2QL 1TTUA 1VENA 1ZLWK 1NC2A 4FG6D 2P8LB 2QQNL 3FOMB 5GRUL 2W0LA 1BWMA 1SBBA 3EDDA 1TETL 4UIMB 4I77H 2R2BB 5C09B 4U1GC 1IQDB 1T03H 3RGVD 4BFBD 4EUPG 1W2KT 1CFNA 4CMHC 1IAOB 1OARL 3LVEA 1C08A 1MHCB 1U93A 4WV1B 1HINH 2A74B 3GHBH 2CK0L 4HIJA 4Z6AT 4PBVC 5JXED 1H0DB 5F1IA 1A7RL 4XVTH 4YUEH 3QUXB 1C16A 4D9QE 4D9LL 5E00A 3GSXB 5GZND 4OGXL 4UQ2A 2Y36H 3CSGA 5IEKA 1KEGL 5HHNB 1KJMB 3BPLB 3WKMH 2R4RL 5CJOH 1MCOH 1OVZA 5CZKA 4L8DA 4NDMA 1KB5L 3VFOA 5E1AB 4MXQD 3ARBC 3G5YA 4PJFB 1HDMB 4YFEA 3RY6A 3CH1A 5CWSA 1GPOL 2D7TH 2PYFA 1S7SA 5IHUL 1YYLH 4HCRA 4M1CC 5J13C 4P5TA 4YHLH 4D0BA 4OD2B 3LMJL 4PGDB 3HZKA 3OR6B 4G42A 2YN3A 1SY6H 2NY2C 4JZNA 1NBYA 3U4AA 4JO1L 3HLAA 1FRGL 1BWWA 2ZKHH 1RHHB 5EO1A 3KPPB 4ODWA 5IB4A 2KZ1B 4KRPC 1ORSA 1G7JA 5C09D 3SPVA 3O3EA 1V7NH 3CFBA 1YC8A 5DEZA 4CADB 1H3UA 3NFNA 4FTVB 3O4OB 4R0LA 1HH9B 4OSUL 1OTUC 1RUMH 4HGKC 3QUXD 4XBEL 4KTDL 2H2PD 5F7MC 1I8KB 4XAWL 1JWMB 1WJ3A 4PJ8D 3FQUA 1K4DA 2R4SL 2DM4A 3RVWC 5A16A 3ARTA 2CUHA 2UZIL 3VFGL 1UEMA 4GLRI 3HZYA 1Q9WA 9CGTA 4MA8L 1UT9A 3AB0B 3JV6A 4Z7WE 4H5SA 3UAJC 2IFFH 1J0JA 4HJGA 3WN5B 5F7EH 5IP4A 3IAGC 2F8VA 3HAEG 5IFJA 1LO5A 4GXUN 5DURB 1AO7B 4Q9RL 2DMCA 3S8WA 3ILPB 4CBPA 2B8OT 3KXFB 1L9MA 2GCYB 4FG6C 1WAAE 4MCYA 3ULUF 4EXKA 3VXSB 1CGYA 4LDOB 3KLAB 4J3OC 2IQ9H 35C8H 3Q3GA 5T1DL 4K8RD 2ZNXA 4Y4FA 4GKNB 4FTVD 3VJ6B 5FO7A 3RL2A 1WICA 1OTSC 1LEKA 5A43C 3CU7A 5CSZA 1K8DB 4D0CB 1T3FA 3CAFA 3SY0A 1WC7B 4ODVH 4F57H 5KSBA 4HC1A 4P4RB 3IDMB 2HT2D 4KKCD 3RUGE 3O11B 1BQHB 3SEPA 1MHPH 1MWAH 1R6VA 4BZ1L 1YMHB 1KCUL 3MGTA 3A6CL 1J8HA 2R0WL 1YPZF 1KCVL 4XCYB 4IRSA 3QG6B 3LEXA 1XCQA 4XNZC 4MXQC 4HKJB 4LF3B 4L9LB 4X6DE 3FT4A 4GG6A 5FUZL 3QEHB 4LKCA 3T09A 4UBDD 5A2LH 4Y5VA 4X5XB 3BKML 1NGQH 1FL3B 4LLWB 1NGPH 1NCWH 3WFDH 2HMID 4HS8L 4RMWA 1QFWH 5EC1B 2NTFB 4R9HA 2IANA 5CBAA 3U9UB 5CD5D 3EJYD 1WBZB 4W4OC 1YUHA 5IFAL 1CLZL 3C9NB 5FYKD 2VABB 1I7RA 3QDGE 5EOQL 3CFJA 5CZVH 5E1HB 3VXSD 4N8CL 3EJZD 3W11D 1WQVT 1NUNB 3BKYH 5CEXB 4WWID 2Z4QB 1F11A 4JO4L 5J4MA 1CG9A 1T83A 2OTWB 5CUSL 1FNEB 4XT1C 1S7VB 5FXCH 3QUXC 2H2PC 2P5WE 2APWA 3O4LA 2ED8A 4HGWB 4KAQH 4UU9B 1X9QA 3BPLC 1CF8L 1KJVB 1T5XB 1OGTA 1A0QL 1YEHH 2W0KA 1JF5A 4ELMB 3ZDYE 2IPUG 2BCKB 3DV4A 1S7TA 1FNGA 3V4VH 2E3VA 2E27L 1A7OL 4Z7VE 1PGRB 4JFFD 1ES0B 1P7KA 3QDJA 1HIMH 3RZCA 4JQVC 4KFZC 4XXDA 2R8SL 2I9TA 1V3LA 1TMCB 3HNSL 1ZVYA 1D7FA 3O6KH 4ONOA 4C54A 1NC4D 3MNVB 4WWKD 1DVFB 3GGWA 4HUKB 2E7LC 1KJ3H 3NPSB 2SEBB 5DC9B 5JOFA 4L4TB 5IVZB 3TV3L 2A2QT 3AY4A 3DV6B 1U8QA 4Z0XB 2DTML 1ZLUH 3TFKD 4JE4B 5CEZD 1YNLH 5GRJL 1UGNA 1UCTA 3G6JF 2A0LD 4UI2A 1DBJH 2C9AA 5IB3B 2HN7B 1VFBB 3O9WA 4JB9H 3O4OC 2HFEA 3VI3E 2AJ3B 1RZJL 1AR2A 3HR6A 3FQTA 4LQ1A 3W2DL 1F6AB 4J3WA 1TXKA 3GBNH 3GSWA 1A1OB 4ZTOH 5BV7H 1HK6A 3SOBH 4ERSH 2QSVA 1JRHL 1NCCL 3INUH 5T3ZL 3ULUL 1YECH 1R3JB 1OLLA 3DX6B 3W0WA 4NUGL 5K9OA 4G8EB 5HI3C 1I1AB 5I74B 4PJBB 2CR6A 3AB0C 3R4DA 5ETUB 3RWDB 4P57B 4UBDC 3E1F1 4MHHI 5MEQA 1J05B 1XGQA 3WN5C 1TZGL 2ZCHH 3LQMA 3QT2A 3B9VA 1VA9A 1ZMYA 4AT6B 2JK5B 5CD5C 3CC5A 1U3HB 2GK0A 3EJYC 4L4TD 2BNQD 2VERN 2DJSA 3MUY1 2HH0L 1XF5B 4EOWL 1DBBH 2FHBA 2HJKB 3W11C 2FH6A 4Z76A 4MB4A 1ZGLA 2E6JA 1S7UB 4PRAB 1MFCL 4QHLB 4MD0B 2FH8A 4ODUA 5L7XL 3CNKA 4OLUH 4HZAA 1HWGB 1GZPB 1HHKA 3LQAC 3DTXB 1KELL 1S9VA 2F53D 1IKFH 3EO1B 4Y2DD 4JCMA 3QUZA 3OAZH 3MRMB 1JPSL 4P23A 4L9LC 4DKEH 4LCIH 1AKJB 1IAMA 5D1XA 2DWEB 5BVJA 1KXTB 5IMOA 5IMLA 3PQYD 4ZUWA 3L3IA 4LARH 5KVFL 5KBNC 4P2CG 4WWKC 4YZFF 1U3HD 1BQLL 3Q5OA 1MSPA 1AD9B 1IVLA 3QXDA 1IGCL 5HGHB 1G1YA 3OKEB 3PP3H 1INEL 4BH8A 4X98A 3TFKC 4WY7H 4TOYL 1AIFB 3KYKH 4OCMC 4PJXF 2Z31D 2A0LC 1WISA 4XMPL 3OMZA 1AO7E 2APVA 3D5OF 3ARDB 5IIEB 5AD0B 3QEQE 4NKOA 1QRNA 2P5EA 3MLSH 3KG5A 3P2TA 1J9CT 1IGTB 5DJ2B 2GW5A 3LIZH 3TNNB 3DO7B 4DZ8A 2C7UA 1I9JH 1T21B 5C0CD 1N8ZB 1W0VB 4DW2L 3ARBA 1ZLSH 4GQ9H 4KRLB 1T1YB 1SJHA 4WHTB 1J10A 5FKPB 1S9YB 3FO2A 1AKJD 3VMOA 3BKCH 4AEHL 1KN4L 3HPJA 1QFUH 2X10A 4MXWL 3NGBB 3VGAB 3TF7C 2IG2H 1BAFH 2IH3A 5IMKA 1JNLL 1Q8MA 3QA3B 1NSNH 4NO0B 5I1AB 4HWZB 2KZWA 3KLDA 5LGKA 4WEBH 4KY1L 3NPSC 3SGJC 2R0ZH 4I3SL 2YUVA 4XC3L 4TULL 5CP7A 3MRLA 3GSUA 5DZLA 5GS2D 4L3EA 1Q94B 2FB4H 2ZPKL 1I8MB 3WDHA 3FTGB 3GSQB 4FFWD 1I7UB 4M62L 5HGAA 3UPCA 1V8HA 2ZUYA 5BJTB 3RIFK 2XT1B 2EEDA 3UDWC 3LB6D 4PJAA 4XI5C 4EDXB 1ZHKB 1VFUA 2NY7H 1KENH 4RIRB 5IFHL 4LSRL 5D6CB 5LGHL 2GSGA 1CE1H 1E4WH 4L1DA 1QLRB 1I1AC 1EGJL 3DX8B 3G6AB 3I6LE 3DX9A 5I74C 5DD0L 2CD0A 2NZIA 1B0GA 1JPST 5ID0B 1L0XA 1F2QA 4JFHD 4MAUH 5BS0B 1UWEH 2A6DA 2R9HD 2FJGA 4QHUA 4F33A 4FZEL 4XGZA 1UACL 4FN0A 4LBEB 4MJ6A 1YEKL 5T3ZE 3D18B 5I1KH 4JG1L 5E8OB 5C0RH 1U3HC 1NDMB 4NKIL 4G9FE 4UDTA 1IMHC 3O8XB 4RNRA 1AD0A 3K74B 1CD0A 4XCFH 3RWFA 1M71B 2BC4A 5D5MA 2CXKA 2NYYC 3GSRB 3RGVA 4NC2B 2EXYD 1INDH 3SDXF 4NNPH 4ZQKA 4IDJH 5ALBH 3IDIA 4ZNCD 3BP5B 3QUML 4XPBL 3QCVH 4RWYL 5I8CA 5JXEA 4R8WH 2H32A 2YPVH 4RFOL 1KCLA 5CILH 2N1KA 3QXUA 4LHUB 1MIEH 1DL7L 4OCWH 3WV0A 3MX0A 3IU3A 4AG4H 5AZEH 4XX1G 1QD0A 1IGJB 5I1JH 4Y19D 2ZCLH 4JEGB 3MJ8A 1RZKC 1CD1B 3GMQB 5DJYB 3DVFA 4YHZL 4KJPD 3WXWL 1KG0B 1U8PA 1W8NA 1I9RH 3RL1B 1DQDL 4HUVA 4PY7A 5F89B 2VDLH 3H42L 4R26L 5JO5B 1EAPA 5GSVA 4CN6A 1LD9B 3CU1A 5GGUB 3VXTA 4X4ZA 3FHQA 1NH6A 3JZ7A 3F7VA 3L5WB 4IS6A 2B1AL 2JKXA 5DUPH 1RJCA 5LQBL 2DYPD 2RAMA 4PJBE 5HI4C 3BT2H 4UIMA 3ZDXE 4LKXA 4ZFFB 2R2BA 5FM4A 5C09A 1IQDA 3T0XA 1L6XA 4H1LB 3RVXD 4ZXBD 4PP2A 4PUBL 1IAOA 3BJLA 3BP6B 1GZQB 4BFEA 2A74A 4F15B 5ALCL 5ADOH 3QUXA 3S34L 2CLVB 3GSXA 1D5XA 3C08H 2OJEB 8FABB 4YHYB 4LHUD 5HHNA 4M6OL 1VGEH 3OG4B 4PJ8A 2Q3AA 4S1RH 3LB6C 4ETYA 1SEBB 5E1AA 2Z8VC 2F54E 1HDMA 3SGEI 4Z7UE 1T7XA 5J56B 4LIQE 3OAUH 5I1GH 1NLDH 3WNKA 3NGBC 5HDBE 3VGAC 4Q9QL 4OD2A 4HUWB 2R9HC 2LAGB 4D9RE 4PGDA 2ERJB 4KVNH 2E7LA 1KCSH 1JTPA 3SDDD 1RHHA 2Y5EA 1BFOB 1OTTD 2P43B 3QRGH 3MLTB 4YHPB 2NNAB 1XR8B 5I73B 3CDGB 1HKLH 5JW3H 4HJJL 1NBZA 2DN7A 4FABL 4ZFOB 1MFAL 2LU4A 3TT3H 4FTVA 1PZ5B 5H94B 3WJLC 1B0RA 4DTGL 1RMFH 1X4YA 1JWMA 4M43L 1AY1H 2CLRB 3N0PB 5E2TL 3NPZB 5D93B 4HWBL 3IDNB 3MRGB 5D1QB 2QADB 4JHBA 3GMOB 4HIXL 2V17H 4NN6B 4JGMA 4JN1L 2VOTA 2MNUA 4M03A 3T3ME 1N4XL 4FNLH 4W6WB 1S9WB 5I15H 1H15A 1A6TA 3C2SA 4LPXA 4WCYL 1PG7W 3JBG7 4KMTL 3WN5A 3HMXH 3RIFF 3V0WL 4CNIA 4AIXA 1RJYB 4IMLB 5JW5A 3ILPA 4X6EA 1MCRA 6FABL 3O8XC 3VXSA 2N7BA 1CDUA 3VRJA 1U58A 4OZIB 3CUPB 5I6XB 4WI5A 1QRKA 3VI4E 4GRLB 2XZQH 2UWEB 1A64A 4NFDA 5H2BB 4NKDB 1XGYL 25C8L 2P45B 2GI7A 1G84A 2YD6A 4L4VB 3SDAB 2CKBL 5LWYH 1WC7A 2FECL 4KI5D 3C5ZB 5ACZB 3O11A 3FQRB 4O02L 3RI5K 1F4YL 2QADD 2Q8AL 4X6CA 1SM3L 4PTTB 5D7KE 4HKJA 4M7ZC 4L9LA 3OKYA 4YHKH 1A2YB 5FUCC 1E28B 3F7YA 4X5XA 4JFFA 3VCLB 1A6VH 3MRBA 4LLWA 4Q74A 1PQZA 2D4FA 4X6BA 1XEDA 3EOBB 5EC1A 2NTFA 1FVCB 1NC4A 3DO3A 3RX5A 4WWKA 1SBSH 5IK3A 1YEEL 5EUOF 5EZOL 3C9NA 4OLXL 4OUOA 2IFGA 3UBXI 1OTTC 3HI1B 3TBWB 3MXWL 1MCPH 3WJJA 3ZL4L 2ZCKH 1MEXH 5CEXA 1JNNH 3S5LB 4GRLD 4YXLH 5T1LB 2Z4QA 2XZZA 3AREB 4KTEH 1C1EL 1QBAA 4GAYB 3V4UL 1IC7L 2OTWA 5BXFB 4S2SA 1U41A 3QWOA 3SDAD 5IT2H 1A4KB 1UM6L 1B6UA 5JIIA 4YHYC 4HGWA 2JB6B 4QGYA 2X70B 3WFZA 5KTEH 1T5XA 2ICEB 2PTVA 3G5ZB 4ELMA 1IM9B 5HHVL 2ZNWA 2YSSA 1R5VA 2BSSB 2COQA 2BCKA 1A1NA 1N6QH 4X6FA 1QR1B 4NWUL 4GXUM 4M6AA 1HQRB 3OKOB 3LEYH 3T08A 2V2TB 4ZPTB 5JPMB 5C7XL 3BUYA 1YJDC 3L3OB 4KHXL 4WUUD 5DO2D 5DMKB 2ARJQ 1CDIA 4DK6A 2ERJC 3BEVB 4HS6A 3MNVA 5D72H 4JM2D 1JGVL 3P4OB 1TJIL 4J3SA 4N1EA 3BZEB 1OPGL 3F7RA 1R3HA 5F9JA 1ZK9A 2SEBA 3SGJA 2GITB 5CBEB 4L4TA 3ARSA 5I73C 2YKLH 4Z0XA 1S7RB 2BNQA 5FYLD 3TT1L 3L3JB 5T1LD 2YD1A 4P2RE 3ARED 4G80A 1CE6B 2HT3D 2HFTA 5IB3A 2NZ9C 4OF7A 4PRNA 4U1KB 1XH3B 3SKOB 4A6YH 3QFDB 2FJFA 1W72B 1CDBA 4YXKL 1F6AA 2A6KA 5E5UB 5TE7H 4GBXB 2WIIB 1ZANL 4APQB 1YNKL 4LAJH 4KI5C 3UDWA 3IFOA 5D93C 5IHLB 1IM9D 2H41A 2QADC 2F53A 4H88L 3NTCL 4Y2DA 5JW4Q 1R3JA 3DX6A 5HDQH 3VXMD 1ND0B 1Y18B 3AXLA 3L95A 3IYLW 1C5CH 4G8EA 2QSQA 5ESAB 4WTXA 5ETUA 3RWDA 1ZT4A 4NYLB 3VD7A 1N0XL 1BD2B 1QO3B 3PQYA 4G8GB 1JMZA 2C3HA 4HF5H 1Q9LB 2JK5A 4X4XA 2IPUK 1U3HA 3KLHD 3WE6B 5HI5D 4QHMB 1JHLL 1RIVL 1XF5A 5FYKH 5EC2B 4OV6F 4PB9L 4M1DH 2HRLA 1FZKB 3B9KB 2J88L 5I6XC 2Y72A 1TNMA 3V2AR 4GRLC 4PRAA 2Z31A 4QHLA 4MD0A 5E56A 5SV4A 2OX5A 5CSGA 5F1OB 1BJ8A 3CVHB 3SDAC 5FEBA 4E0RB 3C5ZC 2PO6B 3BPOB 4QF1A 4HIHA 5KJRL 4X9IA 5ESVB 3L5XL 1NGZB 3FN0L 3EO1A 3C2AH 5DUMH 3Q2CA 5C0CA 3P9LB 3WNMA 3I85A 5FFLA 2B0SL 4PJ5B 2V6HA 1A02N 1YZZA 2BVTA 4D94A 1AKJA 5DGQA 4EI5B 1BD2D 2DWEA 5HHOB 4AL8H 5DO2C 1MUJB 2EECA 1ZLUK 2R29L 4G8GD 3CZFB 2DLFH 1YA5A 1UA6L 4JANB 4JM2C 4EQ3A 5MEOB 3T4AB 4N8PA 1YEIL 4D9QD 2ICWA 1AD9A 1RZ8B 5HGHA 1DLHA 1JIBA 4TPRL 5EORL 4MCZB 4CL7A 1NCBL 1RUKL 5MERB 3B9KD 4M48H 1AIFA 4BK5A 1FSKB 3OKLB 5DMIL 3AREC 5CEZH 2HT3C 3BIKB 1BM3H 4TNWK 1J18A 4DN3L 4DZBB 4H0IA 4KDTC 3VD9A 4PLKC 1RSFA 1WFTA 4L5FH 5DVMA 5IIEA 1LEIA 1NAMH 1R5IA 5D7LE 1M7XA 1YNTA 1HHIA 1GC1C 1S8DA 4PJGB 4U1NB 4WUKL 3MMEA 1ZOXA 3ZDZF 2XN9E 3I2CH 1M4KA 2HWZH 1IGIL 3TNNA 3DO7A 4FQQA 2R2HB 1T21A 3PNWA 1CTOA 3MOAH 1N8ZA 3VA2C 1KULA 2NTSP 3C5SA 5FB8B 2VDML 3P4NA 1HE7A 2X4RB 4EI5D 4P4KB 5IVXB 5A1AA 4JKMA 2B4CC 4YDKH 1FORH 1U3ZA 2VH5H 3KPSB 5I0DA 5L8JB 3ROOA 2AI0L 2EE6A 4NO0A 2CIIA 4HWZA 5I1AA 1F58H 3UJIL 4E41B 1LEGB 3LCYA 1XF2A 2N4IA 3RY4A 4HIIA 3WFEH 4GFTB 4XNUL 3ARGB 1Q94A 2J8UF 3ULVE 5BVPH 4JPKL 5GHWL 5GIRB 3EDKA 3FTGA 1KTDA 4R3SB 5CGYC 2HTLD 5C0GB 4EXPX 1I7UA 4J6RH 3EYOA 4OZHA 4GBXC 4X7SH 1ZGLM 2BOCA 1GSMA 4OI7A 1A3RH 3WNPA 3GUTB 4EDXA 1UENA 1ZHKA 4DN4L 4HV8B 1GGCH 3QEUB 4ELKB 1FFOB 3DX8A 4P4KD 2QQLH 5DGRA 5ID0A 3V6ZB 4I77L 4I5BB 3KPSD 5DVOA 5BS0A 2OTUB 1QLEH 1T03L 2NY1B 3MRIB 2XQBH 1RVFL 4PJHB 3D18A 1U8OB 3MSPA 3ZTJH 1FZJB 3OJMB 4B7LA 5GXBB 3TESA 1HINL 3I6GB 3F7QA 1NDMA 3SDYL 5FA3B 5M7QA 2HG5A 4Z7QF 2PCPB 3ZE2E 2DYPA 2WINB 4NOFA 4WW2F 1M71A 3QCTH 1QA9A 4K55A 8CGTA 1F5WA 5GISH 2PXYB 2BERA 3GSRA 3B9KC 4ZXBA 1AGEB 1L7TH 5CJOL 3UTTB 5CINL 1UEYA 1AR1D 1KLFA 3FMGH 3BP5A 5DK0B 3VDBA 2VL5B 3E8UH 1I8LC 1IAIH 4MWFB 2D7TL 4JVWA 2X4NB 1YYLL 2PO6C 3N9GH 4PP1D 4QRQB 4YHLL 1MAMH 4LHUA 1A1MA 3STZA 1DANU 3GNMH 3G9VA 4RRPA 4G43A 3RVVD 3QDGD 3BD4A 2ZKHL 4OKVB 1Y0LA 2MQCA 2DQGH 1CD1A 1LE5B 3SQOH 4UTBH 1FV1B 3T4YB 5L0QB 4EI5C 3EYFB 4U1LB 2NY1D 4KK8D 4GAFB 1OF2B 1LD9A 2AKRA 3MLXL 3U6RB 3MJ7A 3U48A 3KWWB 3L5WA 4JHWH 3OJ2C 4RBPH 4TUOA 1G6RH 4PJ9B 3SDDA 3VD5A 2P5WD 4XCNB 2C3VA 3VXPB 4ZFFA 5H35A 4LLUB 5DJ0B 4H1LA 2BVYA 1PAMA 1H5BA 5DEFA 5GS2H 1FSKC 3FT3A 3UTTD 3ROLB 3BP6A 5EBGA 4QHKI 4YHOH 4ZYKB 5A2KH 4DVRH 5SX4I 1IM3B 2DDQL 3H9YA 4PTUB 2JJUA 2HTLC 4U6XB 2WMPA 2BRQA 1HI6B 4OCSH 2OJEA 4OFVA 2DQFB 1S5HB 3KPMA 3VFTB 2ZUQC 2R69H 3FONB 5FOBA 4O4YH 4PJIF 3PWLB 1HCFX 4TSCH 5BQ7B 4WJ5A 1S3KH 1NGYB 4FOMA 3RPKA 4FZ8H 4TNWF 4KU1A 4P4KC 2APFA 5HYEA 3DX7B 2EDRA 35C8L 3QHFL 3U46B 3B8SA 5J11B 4S1SL 3S97C 4BQBA 1YEGL 2VXUH 1EUUA 3V5KB 4PJ9D 1TCRA 5TE6H 4RX4D 3CXDH 4B7IA 2NNAA 2EDEA 3L6FB 5J9PB 4ODVL 4HSQA 4F57L 5DJZA 1K4CB 3ARGC 3MRQB 4N0CC 1GOGA 12E8H 5HHOE 4ZFOA 1MHPL 2AQ3A 4IMKC 3CCHA 3HR5B 3U0WL 1XCTB 2BMKB 2PW1A 4GW4B 2W07A 4O58L 4M8QB 3UTOA 3CMGA 2J6EA 3WLBB 5FGCB 2CLRA 4K3JH 2A1WL 3A6BH 1U8JB 4PP1C 3QRFM 1NCWL 2YUXA 3BZFA 1QFWL 4P46B 4OGZA 4LRNH 4ISVB 1JUFB 2EXWD 3RVVC 5F9OH 4LASL 1F42A 2DQCH 4JKPL 3SE3C 3Q48A 5JHLL 3D87B 4I18B 2FIKB 1S9WA 3IETB 4PJGE 4U49A 2JELH 4U6HB 5FK9B 2WZPD 3RVUD 1BIIB 2ADIB 1AGCB 3O0RH 1BBJB 2NY1C 3H9SD 3JVGC 1SYSB 2ADJA 4RZCB 4O00A 3HPLA 5CFHA 5L2KB 2EIDA 3FKUS 2AJZB 4UILH 1XR9B 3RTQB 1F4XH 2DD8L 3GRWL 4KAQL 2D7PA 2PXYC 3CUPA 4OZIA 3QXTA 4C55A 1YEHL 4GRLA 2UWEA 1IC4H 3H7LA 3DWTA 3V4VL 1N64H 1Z3GL 5K33A 3BVNB 4PBXA 3SDAA 2VLME 5EOCH 1I1FB 3WEXB 1ZLVH 4Q2ZA 5ACZA 3FQRA 5KAQF 1PLGH 1BVLB 1XIWB 2X40A 4L3AA 3D39D 1RK1B 1INQB 5LKNA 2BNRB 4PTTA 5DMJB 3RWGB 1PG7H 1KJ3L 3O3DB 5FGRA 4QRPB 4X83A 1A2YA 1E28A 5L0QC 3VCLA 1MCWM 2FECI 4WUUA 1YNLL 3IJSB 5DMGD 4UNTA 3VE0B 4NO2A 1DBJL 5FHBH 2IADB 4LHUG 1FVCA 1IZKA 3ZT7A 4JM2A 4RRPG 3GKWH 4JB9L 4QHKJ 3MNWA 2OMBA 4PJ9C 5JHDD 3U9PH 1U8LB 1S5IH 3HI1A 3RTQD 2XQYG 2W38A 3GBNL 1ZEAH 4PRPE 4D3CL 4ZTOL 5BV7L 1UJ3A 4RSVA 5FYJH 4JREB 2FZ3B 2YHGA 3SOBL 5T1LA 4MXVE 3AREA 1J1XL 3INUL 1OY3B 5EZIL 3D1MC 1HXMA 5ERWA 3VGBA 4Y4KB 4KDTA 5BXFA 2DIAA 2M1KA 1A4KA 4JO2H 1ZGLP 4D8PA 1CIDA 2Z92A 5J06A 4DGYL 3BSZH 3N85H 1UZ6E 3BO8A 1RIUH 3G08A 4PFEA 4WDIB 3HCVB 1XIWD 2ICEA 3F7PC 4H1LG 1IM9A 2ZCHL 1OQOA 1F00I 4KQ3L 4LLMB 3ZTNH 1QR1A 3GO1H 4PREB 2EXWC 3VXMA 1CICD 3OKOA 5JPMA 1RUAH 4NOBA 4S1QH 3O3UN 2O93L 5DMKA 5BOZG 1OOAA 1ETZB 3BEVA 4HIEB 3CLFL 3P4OA 2M2DA 2EZ0D 4PB0H 4OF3A 2JCCF 1JYXA 4JDZB 3O6LH 2X2YA 4YDIL 5CBEA 4Y8AA 2CMRH 1RUQH 4FFVD 4MJ5A 1YPZB 1HOCA 5SWZB 3WUWB 3QR2A 4PLOB 4CVWA 1HHGB 4CJ1A 5DWUH 4WFGD 1IKFL 4C56B 4HH9A 5IGXH 4U1KA 1XH3A 4HXBL 2I07B 3QFDA 4JR9H 2KQNA 4IOSD 1EPFA 4ZSOA 3FB5A 2XWBB 4DKEL 4NQSA 4GBXA 2WIIA 4LCIL 4H8WH 5E7FA 4DQOH 1N7MH 1CK0L 4WI2A 3O2VL 5T3ZD 3S6CA 3ULUD 3T3PF 1T7WA 4DGVH 3TPKA 4LARL 4P46C 3MNZB 3PDOB 4P2OB 1P4LB 4LPWA 3IF1A 1CGTA 4G9FD 1UKTA 1Y18A 4CVUA 1X5XA 5ESAA 4Z78B 5F7NC 4I18C 4NNYB 4PGCB 4NRXB 1BD2A 3PP4L 2AP2A 1J1PH 3ECBA 3KYKL 1R3IH 4FQHA 5DMGC 1IL1B 4G8GA 3I02B 4KKBD 1D5IH 1LK2A 4XVUD 1J8KA 1GGIL 2XTJE 2PYEB 1CS6A 4MNQB 3RTQC 4DUWA 2I27N 5J1AB 5EC2A 3MLSL 4LSPL 5C0BE 2FYYA 4RA0C 3B9KA 5CLWA 4UAOB 3F6LA 4LSUH 3LIZL 2QQKH 1BJ1H 1DLFH 2A83B 2JE8A 3C87A 4YHML 3JWOL 2NLJB 1MI5D 4GQ9L 4L3CB 5JIPA 1I8LA 3CVHA 1JZ3A 2ZZUT 1CXFA 3BKCL 2P48B 4ONGL 1BBDH 2PO6A 4D2NA 3HG1B 3GSVB 3QO1B 1QFUL 3L3DA 5ESVA 2IG2L 1K3IA 2IMMA 4JHZA 1BAFL 2AGJH 4QRSB 1FP5A 1Q0XH 4P2OD 1XIWC 5JTWA 1NSNL 5T1MB 4K7FA 3P9LA 4XNYH 5F93C 2Q87A 5FECA 1MOEA 1Q72L 3G6JB 3TZVB 5HXMA 2R0ZL 1RFDL 3O6FD 1MLCB 4EI5A 2AJYL 3GMLB 3DVGA 5FGCE 3NCJL 4CDHA 4V1DD 4OCRL 2CGRH 4GXVH 4JN2B 1WEJH 3NZ8B 3FQWA 3CZFA 4AZ8A 2V7HA 4JANA 2OQJB 5MEOA 4V2CB 1IRAY 2VDNH 3T4AA 3T2NL 1S7WB 4AQ1B 1RZ8A 2QKIB 4FFVC 1NUFA 5MERA 4AYFA 1V3MA 4JREC 2HKHH 3OKLA 4JKWA 3CX5K 2NY7L 3DYMA 2F54D 1KENL 3TLRA 2EDJA 4MAYD 2WNGA 3VWJB 1JTOA 3UTPE 4UTAH 1CE1L 1RZJC 1QFPA 4K2UH 4ORZC 5BCAA 5ISZB 1FNFA 1ZA3B 2EDHA 3RAJH 2FEDD 1UWEL 4RFNB 4JPWH 4HDIA 3W9DB 2H8PB 1EHLH 2FO4A 3ULUC 4K3EH 3LV3A 5CD3B 1I4FB 3VFNB 5D71H 4MZ2A 4M8VA 5FB8A 1BREA 1WWBX 5C0RL 2XZAL 5FDWA 4XTRD 4JM4L 3PWUA 2X4RA 4ZUVB 4P4KA 4PJAF 1YN6A 2FX7H 1G7LB 3KPSA 4MHHG 3L3KA 1CFQA 1INDL 4YFDB 5D6DC 5CEYA 5TQ2L 1URLA 2BNRE 1LEGA 4YBHA 2DI7A 3QCVL 4XVUC 2D7QA 5BMFH 1UC6A 4R8WL 2ZSVB 4QRPE 5CILL 2RR3A 4NZUH 1DBMH 4LHQB 5EU6D 5F70A 2MFNA 4UDUB 1MIEL 4OCWL 1IGYB 4AG4L 3LD8C 4IMKA 5DXWA 5AZEL 4G6FD 5I1JL 4XPAH 2ZCLL 4R3SA 3QDME 5EOTA 5ISZD 5HVFB 4PR5A 1QHOA 2ITCB 3D85B 3MJ9A 5J8OA 1V3KA 3EDEA 2VDLL 3GUTA 2WLYA 4JO3H 4Y4HB 1IAIM 4PD4K 4HV8A 4ORGB 3P9WB 1A7NH 1BECA 4P2OC 5KVMC 3TYGH 3QEUA 4ELKA 1MJ7H 3QDGA 4LVNB 3SE3A 3ELAT 5BZWA 1T1ZA 4LVHB 1FAKT 3V6ZA 3MRHB 2Y5TB 2OTUA 2FJHB 2A6JA 3MRIA 4JZJA 5IB2B 1MH5B 3EFDH 4KKNA 4PJHA 4FQXD 5JZ7C 1U8OA 4XNMB 3LS5H 3I6GA 1KIUA 5DUBB 5CAYB 3IU4H 5ADOL 4HPYH 1ZS8A 2BY2A 2WINA 2MTPA 3B5TA 5EDXA 4NQVB 2O5ZL 4X9GA 1VGEL 2NXYB 3P0VL 1MHEB 3IS0X 4MD4B 4YBLB 2OZ4H 4FFZH 3UTTA 5ITFA 3HUJF 4M93B 1I1YB 4H25B 3DI3B 2DQTH 4RMVA 1ORQB 5F7YC 5DK0A 2VL5A 3QIUD 4MWFA 1UM4H 2CRZA 2JJWA 1Q9OB 5EBLB 3BRGC 4K94H 3OAUL 4QXTB 5JA9A 1NFIA 3D85D 1NLDL 1FBIL 1G0YR 5HYSA 4EI6A 5SWZE 5DLML 3ZE0E 1MNUH 4NNXB 1KB5A 5DFWH 5B3JE 4C56E 1KCSL 4RCAA 4QY8B 1RURH 2H26B 3B3IA 3B6SB 4LEOB 3TZVC 3QRGL 5F6IC 2H9GB 4J3TA 4XTRC 2XICA 1TVBB 1HKLL 2DLEA 3LZFH 3QQNA 5DJ6B 3UYOD 1TZIB 2RBLA 3KWWA 3K81A 3TT3L 1V05A 3K2UL 3NH7H 1KB9K 4PJ9A 3RNKA 4RX4A 4XCNA 1RMFL 1I85C 2DJUA 5E8EB 5DJ0A 3LKOA 3OKMB 4OFIA 5C8JB 2VQTA 4ZYKA 1P7QD 4XNQB 2V17L 4OD3H 3HFML 4PTUA 2OR8A 5EU3B 2AJXH 2DQFA 1S5HA 2B2XL 5F3BB 3F62A 4RFNC 3ALPA 3VFTA 3D6GA 4POYA 2QL1A 4XB8A 3HMXL 3PWLA 3BXNA 3P0YH 3KPLA 1CFVH 4KZEH 2Z8RA 3FO0L 5T33H 2C5DC 4KK9D 3SDXB 4JFED 3H7BB 1EO5A 1P4IL 2X4OB 1JNHB 3TJHD 3HG1E 3DX7A 3SE9L 5I1IL 3E6HA 4N0FA 4BK4A 3H9SA 2OSLA 2XZQL 4JQXC 4FQXC 1KTLB 4OZ4B 3OKNB 3ZKXB 4XVSH 4N0UA 4OT1H 1K2DA 2EYSB 1U9KA 1QYGL 3OXRB 4RMTA 3IB4A 3L6FA 4YWGL 5J9PA 5HJ3B 5LWYL 3Q1SH 3BZDA 1K4CA 5JNYB 1X7QB 4ODSH 5F96H 4CU8A 3OF6D 3VDCA 1MF2H 2WV3A 3HR5A 3SKMA 3S4SB 1XCTA 4FXKB 4GW4A 4M8QA 3ZE1E 4YHKL 2NXZB 3QIUC 3U0TA 4KMLB 1A6VL 3L9RB 4JFDB 4LCCB 5AZ2H 3PIQB 3V6OC 2YWZA 3JUYA 4ACPA 4Y4HC 2MCPH 1NFDF 3D39A 1SBSL 1JUFA 3B83A 5GGSA 3STLB 3UBXA 5D9SB 5D96B 3U4EB 5F3HB 3LAFA 4MZ3A 3AUVA 3I9GH 3PJSA 4NIKB 4I18A 3BN9D 4Z7OF 4X6CF 1MCPL 3X11A 1RJZB 2ZCKL 4U6HA 1MEXL 5FK9A 4O5LH 2XY1A 2DM2A 5HHXH 5IQ9A 1DEEB 1JNNL 3VW3H 4GG8B 4ONFH 4RZCA 4YXLL 1CGUA 1BOGA 5D2NC 3V5DA 5FGBC 1QFWI 3MJ6A 4F7TA 4RMRA 1HWHB 3DROA 2AJZA 5IT2L 5JHDA 1XR9A 3RTQA 1TETH 1C5DA 2NXYC 4A2LA 5IB1A 5KTEL 4AM0A 3VWKB 5HPMA 5ICZB 4YIQA 4M93C 4RDQG 2CK0H 5E5MB 2FL5A 2NXZD 2YEZB 3H9HA 3HKFA 3LDBB 3MRJA 4GMSH 4LPCA 1I1FA 3ISWA 3WEXA 1O0VA 4D9LH 4JFDD 3IVKA 2J7LA 4LOUC 3SKNA 1KEGH 1F3JB 4MD5A 1XIWA 2O26U 3ZSTA 4I0PB 1INQA 2MKWA 4FMKA 3RWGA 1KB5H 3A6OA 1U8KA 1VHPA 2B7DT 1CICA 1OP9A 1FGVH 3VXNB 2D7NA 5IHUH 1AFVH 3IJSA 1P5VA 1P6FA 2WQ8A 3VE0A 5HYSG 1OW0C 2BNUB 4N0YL 3OGCB 2AXFB 4A6YL 4JO1H 5D7LD 2FD6H 3KYOB 2XN9D 4HKZA 5TE7L 3RIAF 1X5YA 3NN8A 4ONHB 1DP0A 1RIHL 1HKFA 2D9CA 3MA9L 5J3HD 1MCBA 5CJBA 2VJXA 4KUCF 3VFMA 4OGAD 3BH9B 3RWEA 1DDHB 5HDQL 4OSUH 3LN4A 3MRFA 4XBEH 3S36X 2P1YA 4KTDH 4OQTH 3KGRA 2J2ZA 2H1PL 1R24B 3HCVA 4PJ7A 4XPGH 5LBSH 4I0PD 2VKWA 3PV7A 2R4SH 4LLMA 5DYOA 2VUYA 4J3UA 3EO0B 1EV2E 4M7JL 4PREA 3SJVE 4G9FA 3VFGH 4PJDF 2XA3A 4JFXB 1CDYA 3OWEA 4GW5A 1HYSD 2ED7A 1ETZA 4HIEA 4NP4H 1LHZA 3PG2A 3CFCH 4JDVB 4C83B 5D6DA 4N5ED 3ZKXC 1LO2L 3ABZA 5HY9B 2EDKA 3KPRE 5CZXD 1TTFA 1FVEB 4Q9RH 3U30C 4POZD 4UNUA 3BH8A 4J7RA 1YPZA 1H8NA 4ZUTA 1SJEA 3E3QC 5ID1A 4MA7L 3W39B 2HJFB 1HHGA 1ZLVK 4X99B 1T04B 1KLGB 5HHQB 4N1HB 5DUML 1Z9MA 1MFDL 3G6DH 2I07A 3UTQA 1MI5A 3FB8A 1UB5B 1G9NC 5HPOA 2NXZC 3GSNB 2Q1EA 2XQYK 1CIUA 5E9DE 4LCCC 4XP9L 2DLFL 3PDOA 4OZFH 4P2OA 4Q9BA 3A6CH 2R0WH 4KVCL 5E7BA 3VD3A 4DUXA 1WV7T 3B5GA 5GGVL 4JRYB 2C3GA 4Z78A 1O7VA 4XPTL 4KK5D 5HGBB 4NRXA 1ODAA 4M48L 3BKMH 3GMPB 4V1DA 1OGAE 3WHE0 1K6QL 4JRXB 4L5FL 5IFAH 1CLZH 1NAML 3IJHB 3L7EB 3PV6B 3UBXG 2PYEA 5C07E 2QJDA 4MNQA 1NGXA 5EOQH 5J1AA 4MNGA 5TPWL 3TIEA 2HWZL 2YZ8A 1WWCA 3P9MA 4HMCA 3LHPH 3VWKC 2A83A 3MOAL 5CP3A 3T0DA 2F54A 3QIWB 2WLZA 3PWJB 4MAYA 4Y16D 3O45B 4OGAC 5JPNB 1T1WA 3LDBC 4GW1B 4YDKL 4EBQL 3GSVA 1FORL 1YY9D 5TDNB 2VH5L 3ZZ1A 1Z5LB 4RGNE 3CD4A 3GMMA 4ZOAA 4I0PC 5EA0L 1PDKA 3MCLH 4AH2B 1JV5B 1F58L 1RZFH 4JRYD 1Q9KB 3CFDA 5EUKB 3TZVA 1ZWIB 5EU7C 1A7OH 3GMLA 3NIDF 1N6UA 5IG7A 4JN2A 3CFKA 2R8SH 3NZ8A 2IPKB 4PYHA 1UB6B 4BQ9A 3RWCB 4OF8A 4EN3D 4YDJA 2VQ1A 3MRRA 4J6RL 5CZXC 1RUPL 1I85A 1FC1A 5F44A 4POZC 1A5FL 1QSEB 1OAXH 1EAJA 1T20B 3UPRB 3VFUB 5EU6A 1A3RL 3I75B 2G60L 2CSPA 5GRJH 3QWRD 3DIFA 3QYCA 1NJ9B 2VIRB 5HYJE 2F15A 3MGOB 3VXUE 4TSBH 3CFEB 5IW1B 1GGCL 1ONQA 3S3SA 5C9JB 4WEUD 1U8NB 5ISZA 5E8NA 1I3VA 3PXJA 2P7TA 4NRZA 3W2DH 1TPXC 5C0NC 1QLEL 2QHRH 4CKVX 1ZHNA 2H8PA 3U1SH 1MRDH 3E2HB 5GGRY 4GUPA 2MHAA 4DKFH 1JRHH 1NCCH 5T3ZH 5CD3A 5J6GB 2DLHA 5BRZE 3QUKB 1EGJA 4P48A 3LKPB 4NRYA 4FQ1H 1JI2A 5SWQA 5F9DC 1JWSB 1U8HA 5E6IB 5D7IA 4KK5C 3DJ9A 4LLDB 4QYOB 2X09A 4QGTA 2LAAA 3NBNA 4JQXA 4FQXA 3SCMB 1BOYA 1WSST 3QZWB 3VXQB 4PGZA 4L9DA 4R96B 2X1WL 3TN0D 4O2CA 5DHVA 3E8UL 2AERT 2ZSVA 5H37G 1DUZB 1HHHB 1KFAH 4ZNEE 1CGVA 4I13B 1NL0L 2R56L 4UDUA 1MAML 2HH0H 5JMRA 2BSTB 1IGYA 1ROWA 2YMXH 3M17B 2IJ0C 2EYTB 2NY4D 4R97B 2YPKB 1OAQH 3QUMA 1T22B 5DRNB 3ZHDA 3QIUA 1MRCH 4FXGB 3DGGA 5F7LB 3F8UB 3D85A 5JDSB 4F2MB 1YY9C 1G9EA 4F7EB 3V6OA 4LCYB 3UEZA 1KELH 3TPUA 4ORGA 3RFZC 1PX4A 3PWNA 3T65B 4JHWL 3WL9B 2VDQH 2HKFL 3NIGF 3FOLB 4PJXA 1G6RL 3KJ4B 5DQDH 5IBTH 3RGHA 2Y5TA 5F1SA 5IB2A 1VESA 3P4MB 3SCMD 1K5NB 5D2NA 5FGBA 3LOWA 3MV8B 1WTGT 4DVRL 4C4KT 1U2HA 1FG2B 5DUBA 4EN3C 3N06B 1NLBL 1BQLH 1P84K 4NQEE 2VXQH 1D9KB 1G9ML 5ICYA 2HTKD 3L3GB 1EH9A 1IGCH 1LNUB 4NQVA 2VZSA 1MHEA 3C6SB 1INEH 3DVIA 4XNXH 5FHAH 4O4YL 1JHKL 3HAEB 1OP5H 4XVJL 1I1YA 3QIWC 3IXAB 1A6ZB 1P7QA 2D31B 3MUHL 3TIDA 1S3KL 3BUTA 4U1JB 5CJXA 5EBLA 4JFYB 1Q9OA 2AQ1A 4QXTA 2YD2A 1KIQB 4LIQH 2XWTB 4YPGB 5E2WH 1JI1A 4NM8H 4OM1H 2Q76B 3U0PA 4NNXA 3BGMB 4DGIL 1DQJB 2VLRB 4L8SC 4PLNC 3DXAB 3V5HB 5EZLB 2YBRA 2J8UB 2EDDA 2FBJH 1HZHH 3B6SA 1YEDB 1PKOA 2XA8L 4DW2H 4PRPD 3CXDL 3FB7A 2H9GA 3T1FB 4K9EL 1TVBA 4JFEA 4AEHH 2EDOA 3D69B 5LAXB 3CDCA 3T0EB 3AGVA 3ZHLA 5DJ6A 4MXWH 4WNQB 3JWNC 1BZ7A 1OW0A 2VAJA 1RULH 2OR9L 1UXSA 3SKJL 2NY3B 4KY1H 3TN0C 5I17B 5J1SC 4M00A 5IOPB 3LRGA 3HA0A 5E8EA 4XC3H 4L29B 4LQFH 4K3JL 4M4PA 5KOVC 5E70A 4EVNB 1MWAB 3OKMA 5C8JA 1GIGL 3OF6A 4JRXE 3LRHA 2W9LA 2RHEA 5I1EL 2VDRH 5F9OL 2NY4C 3X3FH 3MV7E 4WO4D 1QLFA 2XY2A 4M62H 2D4DA 3OB0H 4UT7H 5KANI 5F3BA 3SBWC 2APBA 3O0RL 2VLRD 4WW2B 1CVSC 3KS0J 3DHJA 4UT9L 5LGHH 4WIQA 3TO2A 3K4DA 4Z7NE 3GSOB 1NC2B 3SDXA 4UILL 5C0AE 5D2LE 1YDPA 1BZ9A 5GSRB 2X4OA 3T0ED 5KSVA 1JHTB 4NKMB 1F4XL 2HFGL 2PW2A 2XFXB 2GIYA 5DD5H 1KC5H 5KS9E 4FFYL 1LMKA 4FZEH 3SCMC 2WK2A 4R6UA 5AEAA 3WS3B 1QBLH 4OLEA 2AQ2A 1K9TA 5E0QA 3I6KB 4MA1B 4M3KB 5HJ3A 5F1IB 4NSKA 2HTKC 1C16B 4I0KA 4NJ9H 2LVCA 4UQ2B 1J86A 5IEKB 3G5VB 1PLGL 2DIJA 1OWWA 1NANH 4DOHB 4L8DB 4NDMB 3VFOB 4R97C 1PG7L 1P69B 4JGUA 4WU5A 3G5YB 3QO0B 1X6NA 1MCNA 2CKBA 3QUMH 4RWYH 4XPBH 4PRID 4TVSa 3CH1B 4RFOH 1L0YA 4WFED 5CWSB 1QSEE 5LCVH 2PYFB 3L9RA 4RFEB 4JFDA 1B2WH 2QSTA 1EJ6A 4P3CH 4D0BB 5FHBL 3CGTA 3NA4A 3HZKB 3STLA 1NBYB 1OWRM 5F3HA 3DLQR 3U9PL 3KJ4C 4WI3A 1S5IL 3P77B 1WZKA 5C0BD 5EO1B 1X44A 2X1PA 4ODWB 5IB4B 4YHZH 5DDHA 2ZUTA 4WHYG 1ORSB 1G7JB 4HX1A 5FYJL 3KYNA 4H0GA 3SPVB 3O3EB 2FGWH 1DQDH 3QIBB 4GG8A 3BGFB 2EEAA 2CPCA 2P47B 2CH8A 3H42H 4R26H 1MCJA 4HT1H 3EYVB 3NFNB 3HN3A 3VFSA 1HILB 1VKXA 5LQBH 5D7LA 5E4EB 2Q7YB