5GRZA

Crystal structure of disulfide-bonded diabody
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
231
structure length
225
Chain Sequence
b'VQLVESGGGLVQCGGSLRLSCAASGFTFRNSAMHWVRQAPGKGLEWVSSIWYSGSNTYYADSVCGRFTISRDNSKNTLYLQMNSLTAEDTAVYYCARFAGGWGAYDVWGQGTLVTVSDIVLTQSPATLSLSPGERATLSCRASQSVSSNYLAWYQQKPGQAPRLLIYDSSSRATGVPARFSGSGSGTDFTLTISSLEPEDFAVYYCHQYSDISPTFGQGTKVEIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords diabody
publication title Crystal structure of mono- and bi-specific diabodies and reduction of their structural flexibility by introduction of disulfide bridges at the Fv interface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 47
structure length 225
sequence length 231
chains with identical sequence G
ec nomenclature
pdb deposition date 2016-08-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5grzA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5grzA01
2VR5A 4ZQKA 3T3PE 1EXUA 3OKNB 2NY5H 3S34L 3QDGA 3O6MH 4LHUG 2F15A 4NQEE 1EFXA 2ADIA 4QRRA 1RZ7L 4K8RC 3WE6B 3JV0A 5CZKA 5SX5H 2DL2A 4X6CA 2YZ1A 3HE6A 4EXKA 1HQ4B 4A6YL 4ETQA 1YEKH 4OD1H 1TJIL 1GOGA 1WZ1H 4E42B 3T8XA 1KFAL 2VTFA 5E0QA 4LCCA 5HHPB 4DKFL 2Y1VA 4H0GA 5FK9A 2NY7H 3VXNA 3QI9B 2F8XC 4OAWA 1FH5L 4PJEA 1I8IB 5JOFA 3N1QC 1DBML 5EU7E 3CZFA 3VWJB 1BFOA 1Z9OA 3T0BA 9CGTA 3IDMA 2VQTA 1JI2A 4LP4A 2PXYD 1DN2A 1K3IA 4CN1A 3HAEG 3RY5A 3OKLB 4P9MH 1FIGH 3MLXH 2ZOKB 2VZUA 5F9DC 1JRHH 3FMGL 1H3GA 3AAZB 2W38A 2VXSH 3DETC 4LIQL 2AJUL 4XAWH 2X5PA 1U8IB 1HIML 3C6LA 1IGML 3MRFA 1IEAB 5E8NB 4OFYA 1VPOL 2ADGA 4HS6A 3D3VD 2MQCA 1U3HB 4IOFC 4Y4HC 1YMMA 3DNKA 3CFKB 4XWGH 3SDDB 4AJ0A 1CWVA 5IK3B 1FVEA 3SE3A 1CE6B 5F6IC 4HDIA 3W5MA 4HF5H 4MJ4A 3GMQA 2Z4QA 2BY3A 3VRJA 2QKIB 1WTGT 4KROC 1KC5H 1I4FB 3OJMB 2OR7A 5T33H 2HH0L 1OWRM 2P5WA 1YEFH 1KTDA 4UOW0 4C54A 3GMRA 4EDXB 3IU3A 5JLZA 4P5TB 4H20L 3VWKA 3ZE2F 3DGGA 3BW9A 3HRPA 1OARL 5FGCE 3O2VH 4N8VB 4ZAKA 3UTTA 4WY7L 3SQOL 2HLAB 4MQSB 2ATPA 3T0EA 4NQED 4XCEB 5J3HD 2XA3A 3MV9D 1T22B 1NC4D 3KPQB 3GSNL 3LKQA 5EPMA 5IEKA 5K93A 1TVHA 5DXWA 4KK5C 3NCJH 2VZOA 2EXWD 3PUCA 3KWWA 4U1LA 3WD5L 4X5XA 2BZDA 5E94B 5E5MA 1XGPA 2QSCH 3VMPA 3VCLB 2BSSA 5FDWA 1S7UA 4Y5XB 2EIDA 1KENL 1MPAH 1OSZA 2V2XA 4LCIH 4PRAA 5EIQA 3MGTB 1GVIA 1ZHNB 2WIIB 2DDQL 4CVUA 3UC0L 2PTVA 4JFDA 4JY5L 3MLYH 4ZNEE 4Y16B 4HKJA 4P2RA 4JAMB 4LSQH 3MUY1 3H3PH 2FGWL 2F8OA 3VE0B 1DL7L 3WIFA 4ODXB 4XX1G 3EOAA 3L1OL 4LDEB 3S34H 3QUXA 3QDAA 2ADJB 3SBWC 4D0BB 3RFZC 4R0LB 2G75A 2BY2A 2MKLC 2IPKA 3RNKB 4LKCA 5IW6A 3O9WA 2R1XA 5C6TH 4MWFB 5ICXA 1X4YA 3JWOC 4UT7L 4KJYA 1I1AD 3DIFB 2ARJA 4G6KL 2R69L 3WHE0 3LPFA 4OZGF 1YPZF 1GGIH 3IDYC 3ZHDA 1BX2B 2NYYC 2P5EB 2VKXA 3TN0C 1IMHC 1FH5H 4YNYA 5FCUL 5I1IL 3QAZC 1DBMH 2H26A 3O4LE 3QG6B 4MA7L 4OCRH 3VFOB 5F1KC 1DLFL 2ZP0T 3G5YA 3I50L 3QUKB 2X41A 3G9VA 4JR9H 3I3DA 1HZHL 3ZDZF 1J88A 5DMGD 4NQCD 3FMGH 1ZT7A 4YHYC 5IVZB 5ID1B 2BC4B 3LN5B 4LIQH 1AP2A 4XMPH 4X9GA 1JNHA 5F97E 1IGMH 5C0JA 1D5MA 5GGQH 3B2UD 3CFCL 4LCWA 1SYVB 1NKOA 1TITA 2X4UB 3ARZA 1DP0A 4YE4L 2VDKL 5J89A 4WUKL 3FN0L 4ACPA 1R5IB 3FRUB 1OP3K 4J3OC 2DYPD 5C0IB 3ARRA 3OAUL 2JJUA 3WUWA 3QEHB 4MJ5B 5C0FA 3M17A 4M6AA 5D7JB 5HHMB 4U2YA 4ZODA 5HYQB 5I6XB 1A6PA 2DWEB 2UY6A 4Y5VA 2OLDA 2HKHH 4H20H 4XCNA 4H1LB 1PY9A 4R2GD 4Y1AA 3TVMB 1OARH 3D85A 1YNKL 4W68A 5T1DL 4WY7H 3KYAA 3SQOH 2BHUA 3QUMA 4RDQF 1JWSA 4WIQA 1AGEA 2OJEA 1BOYA 2V7NA 2X70A 3GSNH 3TBTB 2ENSA 4P5MB 4FTVE 5IJKC 1MREH 2A73B 5L0QC 3ZTJH 4NZTH 2OQJB 5JHLL 3R4DA 2EICA 3OHXB 3KYMB 1H8SA 2QSQA 4JFFB 1IBGL 3V5DA 1IE5A 5EO0B 3O41A 4ONFH 3QWOB 3HTLX 3N06B 1OQXA 3AS3A 3CLFL 3K1DA 1NFIA 3ARDA 3MO1A 4NT6A 3O4LD 5ESAB 4Q6IC 2Q7YA 3UC0H 4K8RD 1BVLA 1CLZH 4IIQC 1LE5A 5I2IB 1RZKC 4X6FB 2GCYA 1V8HA 2B2XH 4LCYA 4XC1L 5TH2A 1MIEL 2FGWH 3IXTA 4L3EB 1DL7H 5DC4B 3PWPA 3L1OH 3HR5B 4I8DA 5D2LF 3E2HB 1K9TA 3DGCR 4PRHA 3DYOA 3MSPA 4GW4A 3X13A 1TNMA 5HGHB 1NCAH 3O3BA 5SWZA 3GHBL 3NABL 4PV9B 2CDFB 4TNWK 2QADB 1GJIA 3MRPB 4K8RL 5F9OL 4O2FB 3QFJA 3GSWB 4L9DA 5BS0A 1ADQH 1DQJB 1BVZA 4G6KH 5IEHB 4PJBE 1QZ1A 1DQML 2G5BA 4HLZH 3JTSB 1AKJB 2R0LL 1HHIB 3DTXB 1YEJH 4LSTH 2ZOLB 5E4EB 5I1IH 3DI3B 5CJXC 4HWZB 3BO8A 4MA7H 4M1DH 2W9DL 2F19L 1DLFH 3DETD 1J0ZA 1QR1A 2OX5A 3TT1L 4Z78B 1F11B 1S9XB 5IP4A 5T1MA 3PL6C 3REVA 3FT2A 4IOFD 4XTRC 4X98B 4IDLA 2VZ1A 4Y4HD 2G9HB 1HZHH 3QULB 5DJDA 4EI5C 1VACB 3BKYL 4P57B 4ZUTB 3ZKMC 5IG7B 3GMNA 1BQHA 3QNXB 3RY6A 4RGNC 2DTML 1G6RL 4GW5A 4KROD 5KN5B 4JLRA 4KDVA 3CFCH 2VITA 4YE4H 1D5XB 2VDKH 4FQQB 5F72S 3FN0H 1MCCA 2KKQA 4DGIL 3MBEB 2NY6C 4KKNA 2W91A 1HCFX 3C08L 2GJZA 1QSEB 3RIFK 1I7RA 1YMHB 5IJVA 1X5KA 4MZ2A 2DQUH 3MV7A 1KIRB 1BD2E 1OGTA 3D69B 1WBXB 4NC1C 4V2CB 5GGVH 1RUQL 5FGRA 4TN9A 2CDGA 1KB5A 5IB1A 3K8LA 5D7IB 4J1UA 3QUZA 3SKOB 4KK5D 4DAGL 4NYLA 5JR1H 3U1SL 4O2EB 2IAMB 3MGOA 5T1DH 3B9EA 1O5DT 3OKDA 4UDUA 5GRVL 4PRBA 4H0HB 1IEBB 2LU7A 3MRNB 4GAYB 1JHLL 4WI8A 3IDNB 3GIVB 3PQYA 2QHLA 2RGSA 4G9FE 4XGZA 3VG9B 1ED3A 3VGFA 4GBXB 2X10A 1VFBB 4J23A 2OL3A 4JFEA 3ZE2E 5EU3B 1JL8A 3BGFC 3MJ7B 5I9QB 1IBGH 5CMAA 3CLFH 3JUYA 4WO4C 1K5NB 3GSOA 1A3QA 2ZUXA 4FQPA 1ZLWK 4XCYA 1FZOB 1CXEA 4PJ9B 4UDTA 1P69B 3SJVD 1JPTH 1U0QA 1NBYB 4JZOA 4XC1H 1MIEH 5DJ2A 2ORBL 5MHSE 4G8IB 2W0PA 4WHYH 1LEIA 1BJ1H 3STLA 4PJAB 1TFHA 4WHTB 3QEUB 1JZ4A 1AIFA 2Z8SA 4LVNC 2FL5B 3L3JA 3VG0H 3OKEA 4KQ3L 3V95A 2OM5A 4YEFA 3A67H 3P0GB 1NH6A 3TN0D 1G7HB 4Z7UA 1BP3B 4Y5YB 3P9LB 3DJ9A 5CD3B 4K8RH 3HB3C 4Z0XA 4MB5A 5C09E 1PG7L 2XOTA 1XGTA 2WINB 3KLHC 4XCFH 2C3WA 3DROB 3WFHB 3DX8B 2ZUYA 3JWOL 4NO5B 2R0LH 1NFDA 4H8WH 1QFWM 2XICA 2NTFB 4ZO8A 5EIIB 1TJGL 1DN0B 5FO8B 1PYWA 2XWBA 1XF3A 4IRZH 2W9DH 1BQLL 2F19H 4KK6C 1BD2D 2FDBP 2X4RA 4QRPB 4YBHA 4N0UB 4YZFF 4QF1A 2DQGL 3PDOA 3TZVB 3TT1H 2ZCKL 4M6ML 3U2SA 5KVGH 1W2KT 4GQ9H 3RWFA 3MLRL 3MOBH 4U1HB 4NN5B 4OZGE 4ELMA 1H0DA 1YPZE 1EMTL 3BKYH 5KOMC 3ZSTA 4F37F 4XVSL 2F5BL 4WNQA 4CNIB 3NFNA 4U1NB 5H35A 2DTMH 4GRWF 2X9WA 2OZ4A 5BO1L 4BSJA 4G9FD 5FHBL 2VL5A 3GGWB 2PNDA 1SY6H 1CLOL 4N8PA 3FJTA 3U7YL 1J8HB 1MELA 5DJYA 5C8JB 1REIA 2GSIA 2F53E 4YC2C 1EGJA 5JXAL 3C08H 4F33B 1BFSA 1RIUH 4BFIA 4OGXL 4P4KB 4YHOH 3VD3A 4HIHA 4NHCL 3ZDZE 2APXA 1B6DA 1AH1A 3QHFL 3NA9L 2GY7B 5BZDB 1UM4H 4J3TA 4RGNE 4H25A 1RUQH 4AEFA 1CL7L 2D7PA 3TV3L 1M71B 1YEHL 3MJ9A 3GMMB 1DTUA 5A16B 5ERWB 3U1SH 3FOMB 1KT2A 5T5NG 4Z7VA 5MHSD 1J1PL 1U58B 4UT6L 1GL4B 2EDDA 3BPLC 1FVCB 3D0VA 2BNQE 1JHLH 1T1WA 1CIDA 4JB9L 2P47B 2CUIA 3IFLL 1OL0A 3I3EA 1NEZG 3BPOC 5EUOA 1KPVB 3CFJA 4NDMA 2DICA 3IAQA 3WXVL 1I1YA 3HZKB 2B0SH 1KPUA 3STZB 4XZUA 4LEOB 5EBWB 4O4YH 1CBVL 3FB5A 3VXTA 3KPSB 2WK2A 4QT5A 4GAFB 3BJ91 4DKEH 5JOPE 3MRCB 2YXFA 3CH1A 4LASH 1Z6JT 3V8OA 4JRXB 5C08B 1OT1A 2AJ3B 5J12B 4YIQB 5H37G 2WNGA 1E28B 1FZJB 2ZCLL 4CRPA 5F8RC 3CPLA 2FYYB 1U8PB 3WFBL 3IJHA 3D39E 3RTQD 1HINH 4F7EB 1FL6B 5EA0H 2OK0L 3WBDA 3VFTA 3BP6A 4WWKB 2ORBH 3TP4A 5JW3L 1B88A 3RGVB 1K4DB 1RZKL 1TVBB 3L3HA 4KAQL 4MNQE 2FR4B 1A9BB 1P1ZB 1X5IA 3VFWA 2NY2C 3IFPA 3E8UL 5C0BB 2PETA 5C0EA 3FCTA 4KQ3H 5AZ2L 3B5TA 4E5XA 2EEDA 2EDJA 1FVDA 3F8UB 2DQIL 1YUHA 5B39B 4L9LC 4MAYB 4ODWA 4GRWB 1PG7H 2QSVA 1V5JA 4JPIB 2NX5B 3T0VA 2P42B 2VQUA 5IMKB 2F53D 3SDXF 5I8KL 4DEPB 3PL6D 1ZHBA 3QCVL 1QBLL 1RUAH 4LGSB 4ENEC 5D2LE 3D0LA 4XTRD 1OB1A 3BUTA 3AREB 3GSRB 32C2B 4EI5D 1JF1A 3ZKMD 1DSFH 4NO0D 3RWHA 4LLVB 3MRMB 3NCYS 4M93B 4RGND 5EORL 2DQGH 4UQ3B 1I8LC 5B3JF 1FG2B 1O7SA 1P6FA 3MLRH 1N59B 3BKJH 1AHWA 5DMKB 1EMTH 1DQLL 3IS1X 2XXMB 3QFDA 2KL6A 4M61A 4UV7L 1I3VA 1WFUA 1PSKL 2NY6D 2F5BH 1YQ2A 5ALCH 2BNQD 4NCDA 3WNOA 1MWAB 4ODHL 5FHBH 4MHHG 3BXNA 1PFCA 5INDB 1CLOH 1MVUA 5IMOB 4LPTA 1T20B 3VFGH 1YNLH 4ZSOB 1Q9OA 2DKSA 3BAEL 1RIVH 2VLRB 4OGXH 4JG1H 2OMNA 4CGTA 1HH9A 3VFVA 1QBML 4C4KT 3QHFH 5CLTA 4OKVA 3NA9H 4J3VA 1UXSA 3GM8A 3FOLB 4DW2L 2V2TB 3ARBA 5EC1B 5DURD 1V7ML 3D39D 1Y6MR 1YEHH 5T1KD 1J1PH 2F58H 2VO5A 4MNQD 4HUXB 1XGUB 5I73C 4UT6H 2WBJB 3UYRL 5IROA 2C1OA 4JB9H 4PD4J 3MMEB 3IFLH 2VJXA 3I75A 4PJCA 3Q5YA 2JIXB 2X4NB 5K9QI 4WO4D 4LLDB 5LBSL 1CDCA 1U3JA 4NZRL 3WXVH 3V6BR 3L3DA 4F9PA 1A6WL 2HJKA 5AUMA 4O58L 1LO2H 3FQRB 3HNTL 4O02L 4Y4KA 2JJVA 4FXLA 4NQDB 5L2KA 5DTFB 1J05A 4EKXA 1FYTA 4PYHA 4KZDL 4ZUUA 2QBWA 5ANME 3UDWA 5T3XE 1P2CA 3UTSB 1ZLWH 3L5WA 1E6OL 2NLJB 3WFBH 2IH1A 1KUMA 5JA8B 1UZ6F 4JY4A 3MXVL 5FB8B 3MNZB 3HB3D 4RFEA 2YA1A 4Q58C 4JO3L 3RNQA 5JW3H 2FJGA 1RZKH 2IF7A 2BCKA 3C9NA 5E8EB 2VDPH 2AJSH 3KLHD 2Q20A 3FL7A 5AZ2H 2APBA 3WNKA 5BJTB 1TPXC 1C16B 1MCWW 4WW1A 2HFTA 3TBWB 2GITA 2DLGA 2R2BA 3ROOB 4JPWH 2QQLL 4OZHA 2CRZA 1BBJA 4JQXA 1FNGA 3SHSA 4U6XB 3FQUA 3QCTL 5GRJL 2H41A 3BGMA 3DRQA 3KJ6L 4PBVC 2YD8A 3BWUC 2YOCA 2HG5B 3AXLA 1BOGB 3QWRD 5I8KH 2C1PB 3R06B 5AAMA 2FH8A 1QBLH 1NBZA 3IFOA 2X4PA 3ZYOA 3TO2B 3G08B 4R9HA 3R8BB 4U1KB 5D9SA 3TO4A 5K59F 1JCKA 4YHKL 1MCQA 2X89A 3LEXA 4IOIA 3LVEA 4OF0A 5DZNA 3QJHB 3NAAL 4OLWL 3U30B 4M9OA 3JUZA 5EG6C 4PB0L 4TUOB 2HRLA 4F3FA 3S97C 1UJ3A 4DK6A 2R2EA 1VESA 4PJ8C 4UV7H 3IAPA 1PSKH 3AUVA 4U7SA 5IB4B 3RHWK 3NH7H 3HFML 4P49A 3S36H 4E41A 3QIUB 3RJDA 1K8DA 1N26A 4PJIF 5D70L 4YZFE 4HGMA 4MXQC 4ZXBD 3OG4B 3T1WA 1W72L 3BAEH 3RZCB 5FA4A 2NY3C 4JVWA 3U4EB 4C56E 2Z0BA 1UKTA 4QGTA 5DD5H 3ESVF 5T3XD 4G3YL 4TQEL 4JDZA 4BUGA 3D18B 4P3DB 3WO4B 2O5XL 2BNRA 4TYUA 2ED8A 4DW2H 1AY1H 1V7MH 1Y0LB 1ZSDB 5JZ7C 4L1HA 43C9A 4A6YA 3P4LA 5DHVB 3PXHA 3UYRH 2YD9A 1KCSL 1H3VA 5GGRA 5CGYC 3BZFA 5T3XL 2R23A 4Z5RA 3WUWG 3OF6D 4N0YH 2DQHH 5LBSH 4P2QE 1AC6A 3H7BB 3T09A 5KG9A 1A3LL 4K23H 1ACYL 4RMTA 1K8IA 5GRUL 3QNZA 5AWNL 1A6WH 2E7LC 1JZ3A 1BM3L 5BQ7A 4HGWB 3HNTH 4EOWH 4U1IB 4ZTOH 4PJGF 1FL5B 5IV2A 1ZLSL 4H26A 4BK5A 5KSAB 1EUTA 3FQNA 1QLRB 4XXDB 5I18L 2NY2D 1OSPL 5FF6A 4QRTB 3ALWA 2M2DA 2H1PL 1RMFL 3BP4A 2FJHA 3DX6A 2FBJL 2A83B 3KPLB 4PREA 1KPRB 3WN5C 4OQTL 1I3RA 4JO3H 3HAEB 1IM3B 1F3DJ 3GJFB 3QWQB 5LKNA 2DJ4A 1CVSC 2PXYA 5DUMH 1T0NA 1Y18A 1CGXA 3CDGB 8CGTA 3MREA 4OI8A 4AMKL 1A1OA 1ES0A 4GMSH 3RX7A 3WMSA 1DUYA 1T21B 1HH6A 1TCMA 2E6PA 1R3JB 4NNYB 3RL2B 4AEEA 5GRJH 2D4FA 2YA0A 3KJ6H 1AXIB 5JIKA 2HYMA 7CGTA 3IJSA 4PJIB 4N5EC 3HA0A 4S11A 1FO0B 2X1PA 5E8OA 5CD5C 3K4ZA 4YDKL 4POZC 4YHKH 2DQFB 5HYJD 3U0PB 3MODL 2CD0A 5L2JA 3NAAH 1AO7B 3RGHA 5DK3A 3U9UB 3CFIC 1J11A 1T4KA 1OWWA 3MUGA 2NY1C 2IALA 2C3HA 3FQXA 2H9GB 3EDDA 1IAII 3SDXE 5D96C 5FEBA 1JPGB 3OTTA 4HX1B 5JMRA 4QRSB 4GXUM 4G6ML 4YXLL 3SOBL 3IDGA 1KNOB 4J3WA 3HFMH 1KJ2H 3P2TA 4G8EB 2I9LB 2FJFA 4MD0A 4P2QD 4RFOL 4LSRL 4NQEA 5GRYA 4F7MB 4XWOC 3P4MA 1FN4A 1NC4A 4LKXB 5DFWH 1J1XL 5B3JE 2I27N 3H9SE 1W72H 2X42A 1N7ML 4NRXB 2YD4A 4JRYA 1GSMA 4NO2B 5F3BB 1E4XI 4C83A 4ALAL 1KSRA 1R5WA 2EO1A 3RI5K 1IGTA 3JTTB 4G3YH 1YY8B 1KTLB 2BSRB 1BQHG 3G6JB 4G42B 3V0VA 5D6CB 2FO1A 4KDTC 1GGCL 3T77A 2G5RA 5I75C 1CDIA 3L9RB 4L8SA 5DJ0B 3D1MC 3QG7L 5DQDL 2DI8A 5BVJA 2ZSWB 2Y9RT 1D5BA 3IKCA 5DJ8A 3ILQC 1SJXA 1KCSH 1G1CA 5ESQA 1A6VL 3O3DB 1WK0A 5T3XH 5IBTL 4RMSA 1F6AB 3PGCB 2EE2A 4JKPL 4B7LA 4O00A 4L4TA 1KCRL 3FQWB 5AWNH 1QSVA 1BM3H 4ZFFB 5KVMC 2E27L 2Z92B 5K9JL 4Y4FA 4CVXA 1T0MA 3RU8H 4UB0H 2PUQT 3VDAA 5ITBH 5F7WC 5I1HH 5I18H 1UH4A 3ZKXB 4WUUD 1IARB 1OSPH 2I5YL 2H1PH 3BEVB 4KZEL 1RMFH 2J1KA 4PRDB 2JCCF 1HXYA 3QH3A 4LRIC 2EDXA 4KRPB 2FBJH 1OAQH 3NCFB 1FLTX 4OQTH 5DGRA 3VXOB 2E9IA 5D1QC 5EOCL 5IT2L 3H9ZA 1EHLH 4HKXB 2AGJL 5EOQH 5C0NC 3QUYC 5GGRY 1SJVA 4FQHB 1WCBA 3DVGA 4AMKH 3DV6B 1CIUA 2CK0L 1F4XL 5B8CA 1P7KB 3UPCA 5DZOA 5EBGA 4LLQA 4PTTB 1UZ6E 2CKBL 4NNPH 3TPUB 4F2MB 4UINH 4HUNB 3NACH 3H9SD 5CGMA 3CXDL 2CRMA 3AS1A 2KBGA 3I3BA 4B7IA 4JZJC 3D2UB 4Z7WF 4PJ8D 2DYPA 4CVZA 4J8RB 2AEWA 4NSKA 1GYAA 3MODH 3WV0A 1FFPA 3NFPA 5DJ6B 3MLTB 3T1FA 3H6JA 4XNQA 3G5XB 2Z35A 1WIUA 3KPNB 4RRPA 1IVLA 1OAKH 5F7EL 2J6EH 1MCJA 1T3FA 3UX9B 3MJ8A 4MD5B 4PJ5E 1RZGB 4JHZA 3UTQA 1I1FB 4MXQD 4JFXB 5CINH 3MLPA 1Q94B 4TRPH 4B5EA 4MYWB 2NY3D 3THML 1M7DB 1QBBA 4G6MH 4UTBL 2A77L 1G7JB 3B5GA 4YXLH 3RPIA 3SOBH 3VXSB 2OXHA 4NQSA 5IGXH 5K59E 5MENB 1MCEA 3FO2A 5E6ZA 1FNEA 2D7QA 5FM5M 4FMKA 3LV3B 1IGCL 5DD1H 3UJTL 3QI9C 1J1XH 1SHMA 3OR7A 4BKLB 1ZVYA 1N7MH 3RBSA 1QSFE 4R26L 5JZ7D 1UXWB 3MRQB 2UWEF 4TSBL 4PJHB 4ALAH 1IM9B 4Z18A 3QA3A 3ECBA 5J1TC 3O6FA 4CMHB 4JQIL 1NAML 4JZNB 1KEMH 3PDGA 1WVZA 5EU6B 1AGFA 5C0AE 5CGYD 3SGKC 2ARJQ 1RJZA 4UI2A 3QDME 5IQ9B 3BSZL 3IDXL 3KDMA 3RWGA 1GGCH 1NGPH 3O4LA 3VFUB 5E2TL 4PR5B 4UV4H 2SEBB 5DQDH 4L4VE 3Q48A 5DHXB 1JNNL 3PWNB 1U8KA 3D5OF 4X7TA 1HHKB 3V6FB 2ZKHL 4I2XB 3N1PC 1MY7A 5CBEA 3IVKA 2AEQL 2ATKB 2J8HA 1UB6A 1BF2A 4Z0BH 3TH4T 4MMZC 3EAKA 4HIIB 1Z5LA 1AI1H 1KCRH 4S1QL 5KVDH 2OP4L 1F4YH 3GJEB 3NIGE 4DGYL 2DLHA 1E4XH 5K9QG 3HMWL 2LTQB 3OR6A 5K9JH 1Q1JL 1IC4H 1CICB 3HI6L 2BDNH 3S35L 1VADB 2VMFA 4X6BB 4OI9A 1WISA 4Q9RL 1EJ6A 4DK3A 1JF6A 2IG2L 3RWJB 4XNUL 4KZEH 4G6AC 5F3HB 3H42L 3OXRB 4X4YA 3L3OA 4MB3A 5D5MB 3K4DA 4NKDB 4MNGE 2IWGA 1NMCB 2OYPA 1G6RA 3G6DH 4OV6F 2FD6L 3SKJH 4RAUB 1I7UB 1KB9J 4LPCA 4PJGE 4IRJA 1CK0L 2PCPA 2R1YA 3TJEH 4DZBA 1NDGB 3RBGA 1ZT1A 2GKIA 4N5ED 1LE9A 5AD0B 4BZ1L 5C0DA 3OKOB 3J7HA 1HHHB 3OSKA 2Y25A 3AFLA 2CK0H 4POZD 3U36B 4NN6C 1I8IA 4X4XB 2ZG3A 1QPXA 3H9HB 3CFEB 5DA4A 3VWJA 2VXUL 3SE4A 2AK4B 2CKBH 2YN5A 1XF5A 4F7PB 1KCVL 1QSFD 2NY1D 4FTVA 4NO3B 3EYSL 4IS6B 4OCNC 4NM8H 1KN2L 4WJ5A 2G2RB 1D5ZB 1JIBA 5F7DA 3MRDB 3OKLA 5FKPB 4JE4B 5IESH 3B9KC 4R4NC 2ZOKA 2UWEB 4HUMB 1QR4A 1WF5A 4FQLH 1F4WH 5C0AD 4Y7MA 1FNAA 3QDMD 1MHEB 3T4AA 1U6AL 4O51A 1U8IA 1IEAA 1MHPH 5F7EH 3KS0J 4XWOD 1IL1B 4L4VD 1ZGLM 1U3HA 1NAKL 1MSPA 4MJ6B 3V4UL 3SDDA 5FUOH 1FQ9C 2WMPA 5IK3A 4YHPB 3RDTC 1CE6A 4QCIA 2A77H 1G7IB 2FLRT 3ISWA 2DMKA 2XZCL 3BIKB 5EH1A 2DQDL 1MAML 5BW7A 2VWEC 1U8JB 4YHML 2WBKA 4HJGB 5A2KH 5IMLA 1FHGA 4M4PA 2WLZA 4XNZB 1SYSA 4I0PB 1ORSB 2NXZC 3O3AA 2D03L 3OKMB 5C0CB 5IF0B 4EDXA 1DLHA 4P5TA 1IC5H 1D5IL 4NFCA 1NFKA 3T4YA 3LPWA 4PJBA 5T5FH 2HLAA 3ILQD 4HFUL 2W9EL 2GK0B 4XCEA 4IRSC 3QXDA 1T22A 3SBWA 4IM8A 1JFQL 5C2BL 2IANE 3FFDA 3GSVA 4LLWB 4CMMA 5HVWA 2HN7B 4U1MB 5IR1B 2ZKHH 4XRCA 5BRZE 5J13B 3TH2T 4YDVB 4FA8A 5HY9B 2DM7A 5IFJA 4OF3A 3TBVA 4LGPB 4YXHL 3MACH 3EDJA 3H3BC 5L8KB 2OI9B 3KGRA 4S1QH 1ZHNA 3BJLA 2WIIA 1IAMA 3KYNB 3TN0A 3UXFA 3UCRA 3DVIA 1F13A 4DGYH 3RY4A 1GGBH 3HMWH 2VOTA 4ZO9A 1Q1JH 2X7LB 1UWXK 3BPCB 4DN4H 4APQB 1QD0A 2Q1EA 1URLA 4TNVF 2OTWB 3CVHL 1ZGLA 4GKOA 5D1QD 4Q9RH 1LD9B 4ODXA 4V1DB 4OV5B 2EKSB 3AC0A 5C0ND 3QUYD 2XKNA 2P24B 3H42H 3BKMH 3TVMC 3HI5L 4JM4L 4NUJA 2FD6H 1BD2A 4F58L 4ZD3L 3WYRA 1OVZA 4FS0A 3HMXH 4LGRB 1MI5E 1CK0H 3WFEH 1BX2A 1HWHB 4NN7C 1EEZB 1NSNH 4OCWH 2PO6B 4LNRB 2NXYC 1A9EB 3X3GL 4KKBC 4WU5B 2YSSB 1I8KB 2JCCE 3VFOA 5FGSA 2VXUH 1CN4A 5ISZE 2VUYA 2C4XA 4G9FA 1A2YB 4OT1H 5CP3H 5MEQB 4KHTL 1KCVH 5KVFL 3QUKA 5F9JA 1KN2H 1XGYL 2LAAA 2EXYC 1JWUB 2DIAA 1WBZB 1A7NL 5DQ9B 2FX8L 1QVOB 3F58H 5BMFL 3PABB 2VLKE 4ZUVA 3MYJB 1S7WA 2LVCA 4U7MA 3W9EA 5IVZA 1Q72H 2BC4A 1A1MB 3LN5A 2R39A 5BZWB 2VDRL 5IQ7H 1U6AH 1MHHB 3B3IA 2IAND 4I9WE 3QI9D 1KELL 2X4UA 1NAKH 1KG0B 3VXMB 5HYSB 4HFWB 4G8GB 4HSQA 5BRZD 2WBWB 3FRUA 4X6DB 5IJKA 5DMIH 3H0TB 4N1HB 4Z7WE 3CFBB 2XZCH 2DQDH 4JQVA 1MAMH 4R3SA 1BVKB 1JGEB 2EC9T 5ACZA 3GUTB 2DWEA 2PW1B 1N5YH 1KJ3H 1E0OB 2YPKB 1TNNA 1D5IH 4Q6IA 5C09A 2PYEB 2ZCHL 3WLBB 4EQ3A 4I3SL 2WUBL 5IM7A 4W6XB 1JI1A 3LQZB 4HFUH 2W9EH 1MCIA 3IKKA 4O2CB 5E5RB 4TVPE 3F6LA 5DD3L 2ZUWA 5LG1A 2VWEE 4FRWA 4IMLB 5C2BH 4P5MA 4ETYA 1C7TA 2BFVL 4GKNB 2OQJA 3MNWA 1MI5D 4O9HL 4G9DA 3CJJA 3KYMA 1M7IA 4CKVX 4LLUA 3HPLA 3WFCL 4OZGA 1QRNE 1YPZA 5EO0A 5SX4H 5E2WH 4JPVL 2W60A 3MBEC 4G6AD 5F70A 5F6HJ 5C86A 1N6QL 4MSWA 4S2SB 1XIWC 1OAZL 4RGOL 5J6HA 3VFPB 4DVBA 4QYOA 5CJXA 5ISZD 3MXWL 2BSTA 1YNTB 1OAYL 1SVZA 5DJCB 1K3ZA 4WHCA 5F96H 4ZQKB 1TMCB 1EXUB 1U36A 3EJJX 1RPQA 2YEZB 3OZ9L 5D1ZC 3HR5A 1PZUB 1XR9A 3NIDE 2CUMA 2V17L 5B21A 1LO3L 2VLKD 2ADIB 4QRRB 35C8L 2GIYA 3HI5H 2ESVE 3A6OA 1QPPA 1S3KH 4JM4H 3D48R 4X6CB 3HE6B 3EYVA 3I6LE 3SDCB 2AQ2A 4O2FA 4ZD3H 4ETQB 4I9WD 1DQJA 3TA3C 3T8XB 5IEHA 1OLZA 3AMKA 5FK9B 3DTXA 4G43A 4GBXC 3VXNB 3O8XC 1JHTA 5FYJD 4OAWB 4PJEB 3B83A 2JJWA 1AQDA 5JOFB 3B9KD 4R4ND 3T0AA 2BNQA 3X11A 3IDMB 2IADA 4R97B 2HA1A 3HN3A 4KHTH 5D93B 5KVFH 5E7FA 5AZEL 4Z78A 3OPZH 4DKDC 1XGYH 4JHWL 4N1EA 2ZUSA 2FX8H 3OJVC 5I1JH 1I3GH 2R8SL 5FYJL 5DMJB 4JGMA 3RDTD 3FB6A 4DN3H 4N0CC 3BZEB 3FKUS 1LQSR 4UILH 2VDRH 4TVPD 2Z8WC 5TE6L 4I0CC 1P84K 3W0WE 3U79A 1CL7I 2CR6A 1GHFL 4WV1C 4H88L 2ADGB 4HS6B 2P5ED 3HC0A 1KELH 1YMMB 1NGQL 2R56L 4ZUSA 1OQOA 2NXZD 1FVEB 4YBLC 5T1KA 2CGRH 2YD3A 2RR3A 3SE9H 1YMHA 3RVVC 2V5TA 1QRND 4PG9A 3LN4A 4CUCA 4TVPL 1WBXA 3OWEA 4IRSD 1KTDB 4YJZL 2MQ0A 4R4BA 5JLZB 4CAGA 3VWKB 3DGGB 4PIRF 4JN2A 2ZCHH 4FXGA 4ZAKB 4I3SH 2WUBH 2DMBA 1L6ZA 1EAPA 1HSAA 2JKXA 2KPNA 3UTTB 2N56A 2RFXB 2ATPB 3TZVC 3S6CA 3MA7A 2EO9A 4XHQA 1IEBA 4BELD 3LN9A 3EYOA 2VLLB 4NN5C 1JTPA 5D2LA 3GIVA 4S1SL 3LKQB 5EPMB 5IEKB 5CIPB 1HHGA 3I6LD 3KWWB 4U1LB 2BFVH 4KUZL 2VUOA 4X5XB 4HPOL 5E5MB 1XGPB 1VFBA 1MJUL 4O9HH 3HI1A 1H3PH 3PV6A 5EU3A 1OGAB 2F54B 1OSZB 5HDQL 2V2XB 4PRAB 4JPVH 1RUKL 2YKLH 1K6QL 5BOZG 3FFCB 2EYRA 1FZOA 1RK1A 3G5VA 2XKUA 3TVMD 4DFHA 2Z93A 4IBLT 4JFDB 1UWXH 4PJ9A 1N8ZA 3MXWH 4ZOCA 4HKJB 4P2RB 5TQ2H 1OPGL 3TWCL 2VE6B 3MQIA 4KDWA 1IGJA 1KBGL 3WIFB 3OZ9H 1G7LA 1ZHLA 3EOAB 4EIZC 4WHTA 3QUXB 5IMMB 4OQ1A 3QWRA 2Q3AA 2V17H 1LO3H 2FH6A 4J4PC 2G75B 4MA1B 1YQVL 1MFCL 4LKCB 5IW6B 3O9WB 2NXYD 2R1XB 3DARA 2Y36L 4HC1A 4XPTL 2E3VA 5ICXB 3W0WD 4KKBD 4KTYA 1EUUA 3ZDXE 2JJSC 4OIBA 2ARJB 2GTWA 5MEOA 4M9PA 4PJ7F 5JHDE 4FQCL 3EFFA 4NO5A 3B43A 4XT1C 2EXYD 2NTFA 4BQ8A 5EIIA 3IAGC 3QP3A 2H26B 2GW5A 3BWAA 3S36X 4UNVA 1K85A 4MJIE 3EYFA 1JVKA 1YA5A 3EGSA 1W8NA 3DMMC 1A22B 3SO3C 4TPRL 1NL0L 3G5YB 1S7RA 3VRLF 5AZEH 5IB2A 4M48L 1P4BL 4FOMA 4PGCA 2I07A 2R8SH 5FYJH 4F57L 2N7BA 1I7ZB 1ZT7B 4PG2A 4WWKC 5IHUH 1AP2B 4Z7NF 2VRAA 4D2NA 5ANMA 5TE6H 3VRIA 1X6NA 1CDBA 1JNHB 4QY8A 5C0JB 1D5MB 5J56B 4I77H 1GHFH 1AKJD 5F9WB 1DVFC 3G5ZA 4H88H 2XPGB 3LQMA 2HT2C 2R56H 4OFDA 2FATL 3CVIH 1A7RL 1XGQA 3UTPD 2L4OA 5TDPB 1S7SA 2R29L 3VGAC 1LP9F 5C0FB 4X7SL 1LO0L 2X4QB 5A2LH 3ZKNC 1C5DA 2WM0A 3K3QA 3QRGL 1I85C 4G5ZH 3WO3B 5AAWA 1X5YA 5GGTH 4XCNB 4RRPG 2VN7A 2I9TA 4Y1AB 3VMOA 2X09A 5C6WH 2HVJB 1JYWA 3VGGA 3KXFA 2CIIA 3QUMB 2PR4L 1RZIB 4PD4K 3O45A 5MERA 2RIKA 1U41A 1AGEB 1A21A 1FVCA 2OJEB 2V7NB 1PKQE 1FRGL 2A9ML 5HHVH 4S1SH 2X70B 1KLUA 3WNNA 4CU6A 4OGAC 3K74B 3MBED 4NKIL 1NPUA 1XIWD 1RK0A 4KUZH 3KPOA 2UY7A 4HPOH 2W9LA 4K71C 3JSSA 5JHDD 5JOEA 25C8L 2FBOJ 4XMKH 5HDQH 3MRCA 5C9JB 1CGTA 5C08A 5E9DE 1RUKH 3ARDB 3MO1B 4JFPB 1K6QH 4YIQA 2IH3A 2FZ3B 1BVLB 2EDBA 4MJID 1LE5B 2UUDK 5E8PA 1FL6A 5F1IA 2NW3A 2GCYB 3TWCH 4LCYB 5TH2B 4OSUH 3IXTB 2WZPD 4ZNCD 5BV7B 1KBGH 3PWPB 3TA3D 4AG4L 4PRHB 4GW4B 3X13B 4S10A 4C56A 2EIZA 3O3BB 1QLFA 4GBXD 3O8XD 3DV4A 5SWZB 5I74C 1MFCH 3PP3K 4MA3B 3RQ3A 4H1LH 5EUKA 1QBAA 3KPRE 4XPTH 4FQXA 3B6SA 4G6JL 5FGBA 1NGYA 2GTZA 3VFSA 5BS0B 1MRFL 5C92A 2RCSL 4JPIA 2G5BB 1HNGA 4PJDF 1S9KC 1BECA 4QHLA 4FN0A 4DKAA 3CX2A 5JW4M 1H5BB 3BO8B 1DBJL 1L7TL 1QOKA 4N0CD 4LLVA 1HXMA 4JG0H 4I3GA 1SM3L 1ROWA 1NL0H 1FCGA 3VW3L 5ACMA 5L7XH 5GRZA 3REVB 3WCYA 1FDLH 3FT2B 4HWBL 1DBBL 1B2WL 4U1SA 3S98A 5DMKA 2FX9L 4U31A 4CJ0A 5DJDB 1DBKL 3GMNB 4F57H 1BQHB 2MMXA 3SDYL 3DVFA 4MLSA 4EUPB 4M8QB 3OAZH 5DF0A 2XQBL 1T6VN 5DSCA 3F12A 4GW5B 3RVVD 2P46B 4OF7A 1V3KA 2GSGA 4AEIH 3LB6C 3BN3B 2XV6B 3TYGH 5INDA 3GHEH 3P40A 3O2DL 1J10A 1S8DA 4ZSOA 2GJZB 2VLRA 2R29H 1DANT 4QRPD 3CAFA 4X7SH 4WCYH 5A40E 3MV7B 2GJJA 3TZVD 4N90D 5E9DD 1OGTB 3KYOA 3QBTB 4FQ1H 4NPYA 2HJFB 1SBSL 2R2CA 1P5UA 5JA9A 5IB1B 5ID0B 4J1UB 3QUZB 4Z95H 4NYLB 4EZMA 3V52L 1VGKA 5D2NC 2EDQA 4N9GA 1GAFH 4PB9H 4UDUB 1KIPA 2PR4H 1T89C 2YXMA 4P3CH 1XGUA 3MLZH 2WBJA 4ZTPH 2XXCB 1FRGH 4LU5H 2RHEA 4P59H 3PQYB 1GOHA 2HTLC 3PGDB 4I13B 4PGDA 4XGZB 5DWUH 3BP5B 1YN7A 2WAHA 4NKIH 4HWUA 3DXAE 4OZFB 2CLRA 5A1AA 1EAJA 2OL3B 4JFEB 25C8H 1BJ8A 3UPAA 1T1XB 5DTFA 3KLSA 3ULVF 1C08B 5CMAB 2B4CH 1T2JA 1ZHKB 3SDXA 3GSOB 5F71A 1WWAX 4G80B 4OLYL 3O11A 4J4PD 3U46A 2VDQL 1JGUH 2RAMA 5DJ2B 1INDL 3WO4C 4RFNB 1AE6L 2YD2A 3STLB 3MRRB 1AIFB 1Q9KB 3H9SA 5TQ0L 3IDIA 3OKEB 1ITBB 1C16A 1KF9B 4JJHA 2QV2A 1UA6L 2WW8A 4PJ8A 3TFKC 1ZEAL 4KGJA 4PP1C 4K3JL 4Z0XB 3VGDA 1MRFH 2RCSH 4NJ9L 4RISL 4NRZB 4AENA 5FOBA 3EBAA 3DMMD 3JVGC 4JRXD 1YEEH 2HG5A 4PGZA 4Z7QF 4Q9QL 5EIVA 1MCHA 4XHJC 1GC1H 3Q2CA 2HP4A 3TO2A 1PYWB 2XA8L 2XWBB 5DZLA 3QIWC 4X5WA 1L7TH 1IC7L 1NAMA 4WWKD 2X4RB 4OTXL 5CEZD 1TZGL 1SM3H 2V5MA 3QJHA 4PUBL 3PDOB 3VW3H 1JYNA 3U2SB 1DVFD 1RFDL 1R3IL 1LMKA 3RWFB 3UJIH 4TUOA 4HWBH 1DBBH 4PJ7E 4ELMB 1HEZA 2C26A 2HT2D 3SDYH 4MAYD 5AYUH 4WNQB 3M8OL 1HE7A 5H35B 1Z9LA 3WKML 1D7FA 4F7TA 2VL5B 3IETA 2ID5A 5CEZL 3HUJF 4L3AA 3ZKND 2YPLE 4D9LL 1B9ZA 1RV6X 4OUUB 5EZIL 5DJYB 4ZFGL 3DXAD 2GSIB 3L6FB 2APTA 3VRLE 3RZCA 3B9DA 3OX8B 2E7LA 1N64H 1MCNA 4BFIB 5MEPA 4HIHB 2AAVA 3KLAA 2JTDA 1CTNA 4P3DA 4OZIF 2R0WH 1BAFL 1NLDL 4Z7NE 4H25B 3BHBA 8FABA 2IQ9H 2DQCL 3UAJC 4ONGL 4OGAD 1HHJB 5L8LB 1KT2B 1U3YA 2FEEL 3P11L 2HMIC 1GGUA 1KLGA 3D0VB 5DA0B 4XNYL 1T1WB 1LP9E 5K9OB 3AB0B 2BVOA 2COQA 5T1LD 2Y5TA 4U3CA 4XP1L 4G6FB 2D7TH 4OIIL 3G04A 3TPKA 1JMZA 1KPUB 4XZUB 3J8F7 1MJJA 3IU4L 3JZ7A 3FB5B 1OTUC 4YXKL 4GS7B 5C6PB 1FL5A 5CEXA 5D2NE 1MWAL 3ULVC 1FGVH 4PJ5A 3CH1B 2V9QA 4PS4L 3TC9A 3PIQA 4UOW1 2D7NA 1AXSA 5E1HB 2ZPKL 4QRTA 1FE8H 2EH8L 2UUDH 4BFEA 5I17A 3IJHB 5FUCC 4FMFA 2XZAL 3BP6B 5FYKE 3L3HB 3N0PB 1F45A 5EU4A 3IFPB 1L4IA 5TQ0H 5C0EB 3FCTB 5GIRA 1VEMA 4LP5A 2A6DB 3WFDL 3PP3H 1ZEAH 2H3NA 3GI8L 4G7YH 5LCVH 3MBXH 1KV3A 1Z9SA 5C0AA 2YPLD 4KV5F 3VXQA 4NJ9H 4RISH 4QLRA 1CD0A 1MCPH 1A5FL 3C60C 3AU1B 3H9YA 1MQKL 2JB5L 2QHRL 1KCLA 4GXVL 4YFDB 4PJIA 4EN3C 4OD2B 2FHCA 4U6HA 1OB1B 5DMYA 3NTCL 1JF1B 3ZYJA 1FFOB 1IC7H 4OTXH 2AK1L 4RNRA 1TZGH 1VEPA 3LB6D 1RFDH 4RX4A 3OG6B 2VABA 3LS4L 3U9PL 4PP2A 3VD4A 5C0GA 2EC8A 2MPAL 4KDTA 2MTPA 2H9GA 3WNMA 3MJ6A 4M61B 4OM1H 4PJDE 5D8JL 1R3LB 1WC7B 4UOJA 1JPGA 4HX1A 1VFAA 3M8OH 1S9WB 1KNOA 1S5IL 5DJZA 4OCLC 3WKMH 4K7PY 2X4OA 1RSFA 5CEZH 3WHE1 2I9LA 2MCPL 1MVUB 1EBAA 5BCAA 5TF1L 3GJFK 4ZFGH 1AR1C 1Q9OB 4XNXL 2ZG2A 4YX2L 1A3RL 1ZTXH 1HYSC 4YWGL 3CVHA 1HH9B 1WSST 3VFVB 4PJGA 2W0FA 4MLIA 4OKVB 3JTTA 4K3EL 1YY8A 5TF0A 1UFUA 4G42A 1WT5C 3WEXA 4D9RE 1UXSB 1NLDH 4S1DC 3T04D 3ARBB 2HTLD 4RDQG 2DQCH 1KTKE 1AR2A 1F97A 1W8OA 3KG5A 3L9RA 3CXHJ 5FYKD 4X99B 2Y23A 2XTJB 3TESA 2YK1H 4PRPB 1INEL 5D1QA 4JHAL 3I75B 3RL1A 4PJCB 4I4WA 1B0RB 1JYVA 4P2OC 1AD0A 3PXJA 3L3DB 4OIIH 1MCBA 1IFHL 2HJKB 3MRGA 3IU4H 4XC3L 1JPSH 4YXKH 2BRQA 4Y4KB 5FYKL 5L2KB 3BYYA 1J05B 2NY5C 1G0DA 1MWAH 2Z31C 4BZYA 1FYTB 5DJAA 1UWGL 1P2CB 3SKUD 1A6TA 2K9UA 3L5WB 5KOVC 3EOTL 2EH8H 4JZJA 4MGXA 4TUKH 4PRDA 2IH1B 1WICA 4DVRL 3TFKD 5JXEA 4HWNA 1F3DH 2XZAH 4JY4B 4PP1D 2B5IC 2XZZA 3PHSA 4NQXA 5SV4A 4GKSA 4LHUD 3S37X 2GYSA 5I15H 3RNQB 1Z0NA 2FJGB 3C9NB 3QO1A 1WLHA 3X3FH 1MVFA 3ULVE 4K2UH 3WFDH 2GITB 2R2BB 4FQHA 1INQA 1CLCA 2R4RL 2VLJE 4XHJD 5L9DL 5FM4A 4OZHB 1BBJB 4RAHA 1FNGB 3QIWD 4KHXH 2ICWA 1QKZL 5D1XC 2LAGB 3BGMB 4KI5C 1H9VA 5E95B 5FUCE 1MQKH 1G1YA 3ARUA 3AXLB 4GXVH 1B4JL 2X1QA 2X4PB 3D2UA 3UO1L 4M6NH 5D9SB 3TO4B 4AK1A 2BVPB 1XCTB 4D9RD 2AK1H 3LEXB 4IOIB 3BPNB 3MRBA 4YAQB 1KEGL 5DJ6A 2CDEA 1WZLA 5I1CL 3G5XA 2BOBA 3KPNA 1H15A 4UMGA 5GPRA 2GAZA 3LS4H 3U9PH 4JDTL 4F3FB 2BSED 1UJ3B 5CWSB 2X1OA 4NCC2 1YYML 2R2EB 5J8OA 4MD5A 2BHYA 1EHXA 1NMCC 4WTZA 5D8JH 2OJZL 2G60H 1S5IH 3VXSA 4E41B 1EJOH 3MPCA 4PRNA 5DUPL 4EQ2A 5MENA 4KUCD 2MCPH 1K8DB 1E27A 3UTOA 3NFSH 5TF1H 1WCQA 3GSUA 3LV3A 3HRZA 5CJOL 4BKLA 2WANA 4XNXH 3UAJD 1EO5A 1A3RH 3ZZ1A 2GJ6E 1AFVL 1UXWA 1FZMA 4JANB 1IM9A 4ZFOL 2HMID 3MROA 4XPGH 4K3EH 3WXWH 2CMRL 4JDZB 4M3JA 5GSRA 4JZNA 2OR8A 3NCBB 1Z2KA 3LDBB 5TE7L 5IHLB 5KBNC 5DO2C 4XP5H 1U42A 2BNRB 4GH7B 5IQ9A 2ICES 3HUJE 3VFUA 2JCCA 2H8PA 4JREC 43C9B 4A6YB 5HTSA 1ONQA 3PWNA 3T3PF 1OTUD 2P7TA 1INEH 5GGRB 2A38A 3BZFB 5I66A 3ULVD 4QOKE 4JHAH 1DBAL 4Z5RB 2J2ZA 2YPVL 3OB0K 1WITA 2VLJD 4L8DA 5KG9B 2XWTA 4OZIE 3P0YH 2MCG1 1NANI 1K8IB 5F9AC 3QNZB 4JN1L 2R1WA 3GSXA 4YBQC 2C7UA 4Q9CA 1G7MA 4LMQE 5EDXA 4QXTB 5FYKH 2DLEA 4GAJL 4H26B 1M7XA 3FQNB 1R0AH 1UWGH 1ZA6B 5CHNA 4GFTB 1CD9B 4Q7DA 3ULVL 4X9FA 3VJ6A 4X4MA 4Y2OA 3BP4B 3BH8B 2C3GA 3ET9F 4DVRH 4Z7WA 1T03L 3B9KA 2DLTA 3DX6B 3MLUH 5CJBA 4FXKA 3WIIL 1HCVA 1I3RB 4OGYL 1I7UA 4RAUA 4WW2F 5E2UL 2APVA 3C60D 3JV4A 1JGVL 1P4LA 4KKCC 2PXYB 1T0NB 4EN3D 2EYSA 2N4IA 4M02A 2R4RH 3MREB 3OKOA 4YDIL 5DEFB 1FAIH 4XCCL 1A1OB 1ES0B 5H8DA 3P9MA 1I9IL 1HH6B 4B41A 3RDTA 5KVEH 1QKZH 5JPMA 3CFEA 5L6YL 3QEQE 1UVQB 5DHVH 2AK4A 1FPTL 3CLEH 1C5BL 2PYFA 2OI9C 3FHAA 3IJSB 2A0LC 1B4JH 3D3VB 2GJ6D 4U7KA 4HZAA 1NGXA 2G2RA 3GNMH 4WFEE 2VQ1A 5GISL 3UO1H 4G7VH 2UZYB 2UWEA 4RA0C 1I9RL 1LK2B 1JTTA 3QR2A 5L2JB 1X5ZA 3TJHC 1LO4H 2IBGA 5I1CH 1T4KB 1H3TA 3MUGB 4KV5E 4KI5E 4U49A 4JDTH 1IL1A 4RBPK 2IALB 3FQXB 1AR1D 1A6UL 2AXFA 2CIKB 1CQYA 2OJZH 1HI6A 4F8QA 1HYSD 3IDGB 1KXQE 3ARPA 5DHYB 2FJFB 3BUYA 5DVLA 3HAEH 4YR6A 3VFNA 4NQEB 3GJFH 4HJGA 4YFLF 4S1DD 1FN4B 5HYFA 4FP8L 1NC4B 1N2RB 2ESVA 1A0QL 3LKSB 4JDVA 1AFVH 5IF0A 3VD9A 3NGBC 1R5WB 4N1CA 5F8QC 4HUWB 2CMRH 3FAWA 2J8UF 1R3HB 4OCXL 1WEJL 2VZSA 4H5SA 4KTDL 1X9QA 4M03A 4P2OD 1FO0H 3T77B 3PV7A 5CSZB 5J1AA 5BVJB 4U1MA 3IKCB 1D5BB 5JIPA 1DQTA 5DJ8B 3C8HA 3MOAL 4WW2B 5E2JA 5ESQB 5HY9A 4POUB 2Z31D 1DBAH 1F58L 5KAQF 1SJHA 3UZQA 4M7JL 4QXUH 4JN1H 5FHAH 3KYNA 5E2VL 2XRAH 2NTSP 3QEQD 4Y4FB 4M43H 2HT4C 4DQOL 3W0WA 1UM6L 2DQTH 4GAJH 4APQA 1RVFL 1I1AB 4QRQB 5EU6D 5HVHB 2NY5L 3QHTC 3L7EB 4WFED 3LMJH 1G84A 1D9KC 1TTGA 3PWJA 1HXYB 1T03H 3QH3B 4WENB 3WIIH 4JFQB 5D7LE 4OGYH 4RMQA 5D1XD 4GW1B 4GRLC 4UT9L 4KI5D 3SGDI 3MGAA 5E2UH 4EI6A 3ARVA 1P4IL 4OD1L 1JGVH 1WZ1L 4JM2C 3DX9A 3FO9A 2AKRA 3DVGB 1PZ5A 1XF4A 5FGCB 4AQ1B 4XCCH 2NY7L 4MXVF 3ARGC 2CKNA 5MI0B 5B8CB 1A9EA 4GKZA 3CH8A 4BSWB 4W4OA 2YSSA 5L6YH 5EB9A 3WJLC 1T7YA 2ICCA 2J4WH 1C5BH 3EOBB 2AXGA 3HKFA 2OR9H 4EDWH 4U0QB 5EC2B 4I18A 5JTWA 1JWUA 5DQ9A 1QVOA 4OJFH 1T66C 1ZA3A 2DYPB 3DUHA 4CVZB 3QQ4A 1JYXA 4NSKB 1MUJA 2ZUTA 1YC8A 3NFPB 2VXSL 1A1MA 4U33A 1OD7A 2Z35B 2J8OA 3K2UH 2O93L 3EOYG 2XIDA 1CE1L 1MHHA 3UMTA 2R4SH 3FB7A 2IFFL 3O4OC 3MJ8B 3UTQB 2Z91A 5DK2B 4MXWH 5HYSA 2ZWLT 4XWGL 4Y19E 1U9KA 3OGOE 1NC2A 3RA7L 2HTKD 4NQSB 4UUJA 1RHHB 4LIQE 1KC5L 3FO2B 4LCCC 2O61A 1FNEB 5T33L 2V9RA 5F6HI 5DO2D 3VD5A 3T0XA 3OR7B 2ERJC 5GZNC 5JW4N 4KK9C 4L3CA 3OXSA 2R0ZH 4GOSA 2EC9U 3QA3B 3ECBB 1S7VB 4HWEL 3WLBA 2E5EA 3O6FB 4RSVA 4R97C 1CFVH 5JHDA 3BIBX 5D93C 2Z9TA 1JK8B 1UYWL 1AGFB 4KI1A 1RJZB 1WEJH 5JNYA 5D1ZA 3ARFA 4IMLA 3O4LB 2BXZA 1CR9H 1OAXL 3U82B 1IKFH 2AV7A 3LKOB 4MJIA 1NJ9A 4YBQD 4PJFE 1U8KB 4X7TB 4IHOA 3C6LC 1CGSH 4PBXA 4R7NA 2QSCL 4JFOB 4R8WH 5CBEB 2VC2L 4PYGA 1BMGA 1UB6B 3OB0H 4WI6A 1L7IH 1MPAL 1EEYA 4LCIL 4E0RA 2EDNA 4ODVH 1U8NA 2VAAA 3O8XA 1H8NA 5E2VH 2R9HD 4M7ZB 3LKPB 3QXUA 3OR6B 2CLZB 2MOVA 4DQOH 4ODSH 4MJ2A 4LHJB 3V6ZA 3HZVA 3H3PL 3QXAA 1QEWB 5A3ID 2DI7A 2C9AA 2YEZA 4ZYKA 2AABH 4TNWF 4KKCD 2P8MA 3S3SA 3Q3GA 5D7SL 4X4YB 3L3OB 3QJFB 3MV9E 4XP6L 4OCSL 1G6RB 2Y4SA 2AP2A 2GHWB 3RUGF 3T0EC 5CUSL 5C6TL 4P46C 5ETUB 4UT9H 3SDCA 3K7UA 2P45B 1ODAA 1P4IH 4H8WC 4IRJB 3JBG7 3O2DA 2PCPB 2R1YB 2A0LD 4DZBB 1GGIL 1ZT1B 4Y19D 3F7PC 1LE9B 2BXYA 5C0DB 3ILPA 2DS4A 3HE7C 1IGIH 4Y4HB 5KZCD 2KDGA 3IXAA 4HD9A 4OCRL 4JRWA 3I2CH 4KROB 4X6EA 4LVHC 3TJHD 2W59A 1XF5B 3AY4A 4YDJA 4FTVB 4WJ5B 3HZMA 5F7DB 1GRWA 4JR9L 3WIHL 4WI4A 3BKCH 4D94A 3PG2A 2H32H 2PW2A 3BZEA 3SGDH 1QHPA 4XMPL 3AROA 4O51B 1QYGH 2UZXB 4Z9KB 1CE1H 5GGQL 4RBPH 2IFFH 3S3PA 3WHXA 1U91B 4MVBC 4XNMA 4CBPA 5DD6A 2PO6D 4F7CB 2IPUG 1V3LA 4U0RC 2MQ3A 5IBLC 3VXUE 4QCIB 1P9MC 2ICEA 2V5SA 3RA7H 1PW3A 1D6VL 5ICYB 2BP3A 5IMLB 4MD4A 4X7FC 3HC4L 1T83C 1SYSB 3QDGE 2QQQA 2ZUQB 3KPRA 2YD1A 3O3AB 4LPUA 1DLHB 2HKHL 3L5XH 2DD8L 3VDCA 2ADFH 3T4YB 4HWEH 4PJBB 4XP4H 2Z8VC 4NQCE 2RFXA 1OTTC 3E6HA 1UYWH 1MFDL 4ONHA 2VLLA 3QXDB 4HUVA 3WUZA 3IGAA 4U6YA 3OGCA 4G8GD 1OAXH 3SGEH 3GSVB 3FFDB 4J4PA 5CIPA 4CMMB 5KSUA 1MREL 4XRCB 4WI9A 3PWVA 4NZTL 5IVOA 2HT4D 4RAVB 4QEGA 2VC2H 2JJSA 2Y07L 2B20A 5IFJB 1Q8MA 3V6OE 1OGAA 2F54A 3TBVB 4NGHL 1EH9A 1X5FA 2J8UE 4HMCA 4ONFL 3IDYB 2DAVA 3TN0B 1D9KD 3FFCA 2PYED 3ALPA 4R4FH 3M1BA 3QAZB 1CLZL 1FL3A 4LQFH 3VXRE 2B2XL 1OW0A 2VE6A 3DRTB 4GRLD 1ZGLB 3K2MC 4Y5VC 3DMMA 4U1JA 3LOWA 5IMMA 4F9LC 4JM2D 2XKNB 2FHFA 5D7SH 1CFQB 1NCAL 4XP6H 2CXGA 3ARGD 4OCSH 3CDFA 4NUJB 4HPYL 1HILA 5CUSH 4YHYB 4RWHA 1BD2B 4OFKA 4GG8B 3BYTA 4AY0A 2MSPA 1ADQL 2VDLL 2DB8A 1DVFA 1QFUL 2P5WE 1XH3A 3VXUD 1KJMB 5DVNA 1YEJL 5I1GL 2FECI 3CUPA 4LSTL 4IJ3C 4QHKJ 5ESVB 1T66D 4HUKB 3X14A 4M1DL 3CCHA 2P8LA 4CN4A 2VB5A 2FB4L 4K3DH 1NGWB 4G9FB 3QDGD 3WSQH 1U8MA 5HHOE 3T0EE 5F9JB 1Q9LA 1EFXD 2Q3ZA 5CFHA 5JW4Q 4LLMB 1G7PA 1ZLUK 3WIHH 4K9EC 5IB3B 4ZUVB 1S7WB 1I7ZA 4MHHI 1JV5A 4YGAB 3W9EB 3ZT6A 3OKKA 4MXVE 1XF2A 4PPTA 3HNSH 3N1GC 5FV2A 4M62L 1ZVSB 3B3IB 3K81A 2DIBA 5C3TA 2XPGA 5HDBF 5HVGB 3EZ8A 2MHAA 5GZND 4KK9D 5DC0A 2X1WL 4X9IA 3O0RL 5L0QB 5TDPA 1D6VH 4R3SB 3N1FC 3NN8A 3NCEB 1EZVX 1MCSA 2DQUL 2X4QA 5GZOD 3U7AA 5ACZB 3HC4H 4HW6A 2DN7A 3PWLA 1A7BA 2OTUA 3X17A 1Z0MA 5GGVL 4QTHB 3TLRA 1A4JA 1C5CH 3VXRD 1F3JA 1PEZA 2DD8H 4K94C 4Q6IB 5C09B 1OOAA 5JR1L 4IIQB 1MCWM 2HVJA 2WIMA 5J9PB 3VGBA 1X5XA 4BQBA 5IM7B 3C6LD 4WTZG 1RZIA 4OFYD 1R6VA 1MFDH 4UIMA 5JIHA 1TQCC 1JUFA 1WFOA 1KACB 2E8YA 3O2WL 3GMOA 2DM4A 1A7OL 3EO9H 1A14H 3RY6C 4P23C 4YEEA 1NUNB 3PE9A 4GUPA 3D25B 3MNWB 5F7MC 4YQXL 4G9DB 3FT4A 5E8DL 1M7IB 2P5WD 2Y07H 4LLUB 3HPLB 4OZGB 4PJ7A 1YPZB 4NGHH 1WGOA 2KQMA 5ALBL 1MHCA 4K3HA 3HG1E 5C9JA 2X2YA 2W60B 3EHBC 4JFPA 3MFFB 1LEKA 4MSWB 5J6HB 5ABDE 1J0HA 2FZ3A 4DVBB 4QYOB 1JPTL 1W0WA 2BSTB 4BH7B 3O3EA 5HHOD 3T0ED 4UTAL 3KAAA 4P46D 3FO1A 4UQ2A 2R0KH 4I48A 5BVPH 1XR9B 1QRKA 3VFMA 2YRLA 3VG0L 4LCWE 5F93C 3A67L 3HE7D 1UH2A 4HV8A 4MA3A 3RTQC 4HPYH 3EYVB 4P2YA 3RIAF 4RGNB 5H37H 2VDLH 4XCFL 1QFUH 4KWUA 2QQNL 3LEVL 4ZUWB 4G43B 4H8WL 4Q97A 1JHTB 5I1GH 1NKRA 2DRUA 4JFDD 1AQDB 2NY6B 2HVKA 1H5BA 4JHBA 4P9HH 4IRZL 2BNQB 3X11B 5D6DC 1LP9A 2FB4H 4XVTL 3SJVE 2J12B 2D3VA 2IADB 3RUGE 2EDEA 4OLUL 1P6AB 4TUJA 3B5HA 5KVGL 4GQ9L 3MOBL 4MVBD 1NGZA 1R24A 4L1DA 5IBLD 3SKMA 1J87A 3FB6B 5D2NA 5KTEL 4WTWA 4DUXA 4X83A 4EUPA 4M8QA 4M62H 1BF8A 1WAAF 1BFVH 1SY6L 1EO7A 3HC0B 2NZ9C 4KJPC 3D39B 3L3IB 2EEAA 2Y7QA 2GFBA 5SWQB 4ZUSB 2KQNA 2FEEI 2E7HA 4LF3A 5T1KB 3HLAA 5DC9B 4B53A 3O0RH 3ZMRA 1RIUL 4MNQB 4O5LL 5LJYH 4YHOL 3EFDH 4PG9B 3LN4B 3HG1D 1OTTD 3BGFB 5I19H 2KUTA 3SY0A 2HJFA 3C2AL 3SE8L 1UM4L 4WO4B 1UENA 1UWEH 1DANU 5TGBA 4R4BB 1EX0A 5ID0A 1EDQA 1CYGA 4JN2B 3BEWA 4FXGB 4NCC1 1HSAB 1EAPB 3Q6FA 3RWDA 4U05A 1RULL 2YS4A 3MA7B 3QFJE 2IFGA 1ETZB 3EYOB 4LCWD 5D2LB 3O2WH 1CDJA 4LVNB 2BNUA 3PGDA 4U1GC 4C57C 3BP5A 4X8JA 3GBLA 1A7OH 1HHGB 4HXAL 2AI0L 1DFBH 2B0SL 1EBPA 4OZFA 2AW2A 4O4YL 4YQXH 3HI1B 5E8DH 5I71C 3PV6B 1T1XA 5LXGH 1C08A 4DKEL 5ALBH 4LASL 1ZHKA 1PQZA 4PJDA 1SJEB 3V9FA 4G80A 2EYRB 1RK1B 3G5VB 3D85D 1T1ZA 3GEWB 1E4KC 2Z93B 1N8ZB 1X7QA 1FJ1B 5D71L 4R90H 3QIWA 2NY4C 1HINL 5EA0L 4UTAH 4AEHL 1IGJB 3LHPH 1G7LB 1ZHLB 3P3YA 2OXGA 4TTGA 3MRRA 1Q9KA 2DLIA 5MP6L 5E03A 1JPST 5I8EA 1I8MA 2RB8A 1GGYA 3V8CA 4YK4C 3OBAA 2VDMH 4F80A 1MLCB 1M6OA 1UGNA 1JGDB 2E6QA 1FLRH 2GTWB 2HJLA 5MEOB 3AB0C 3ULUC 4NRZA 1AD9B 4HZLB 3TNMA 4HKBB 3EFFB 2XFXB 1NCBH 3VI3F 2QQNH 3L7FA 3LEVH 4HIJA 2FX7H 1RUAL 2Y06H 4YC2B 4ZFOA 3BWAB 4LQ1A 4QXGL 1J1OH 1DSFL 3EYFB 5T3ZH 3T2OA 3EGSB 4LPYA 1NMAL 4XVTH 5B38B 3AVEA 4OLUH 1S7RB 4PRHD 4WEBL 3U6RA 5IB2B 4HHAB 1ZLUH 4JJ5A 3BKJL 3RHWF 4NHUA 5E00B 4PGCB 2I07B 3STBA 1GPOH 2QR0A 3QFJD 3S4SA 5KTEH 5ALCL 5BS0D 4K9EL 5ANMB 3VRIB 3ZT7A 5TDOA 4QY8B 3CX5J 3QQ9D 5HHXL 3BPLB 2V2WA 4HCRA 3CSGA 3G5ZB 5I1AA 4OUUA 3BPOB 3VFGL 3L6FA 2CO6B 1XGQB 1YNLL 1OP3H 4X9BA 1RIVL 1TZIA 3OX8A 4QGYA 1S7SB 4O5LH 1V3MA 1HQRB 4JG1L 5EN2B 1PKOA 4A2LA 5HYIA 2QL1A 1C5DB 4WI7A 3C2AH 3SE8H 3ALXA 1Q9WA 4ZXBC 3CXHK 3H7LA 2I9TB 1U92A 1HHJA 1V05A 5HDBE 5ILTL 3GK8H 1CFTA 4P23D 4Z7UE 3HC3H 2F58L 3KXFB 3UBXB 3CNKA 2CIIB 4LSPL 5HYSG 4K94L 1RULH 3O45B 5TJWK 5M94B 1UT9A 1K4CB 5MERB 2CR3A 4HMDA 1WV7T 1AHWC 2NY2B 5K9OA 2QQKH 2H2SC 3P4OB 1KLUB 4OD3H 3NPZB 5F7FA 2Q6WA 3QZWA 5HVFB 1NFDE 3EHBD 3UEZA 1F90H 4HXAH 2L7JA 2AI0H 4NC1E 1RK0B 4GG6F 3KPOB 1CXFA 4DOHE 1LO2L 3MV7D 5LGHL 5FYLE 1CF8H 3QUZD 2IH3B 5E08H 3NVQA 1CG9A 4OIAA 5KSBF 2FO4A 5D71H 3IDJB 3E6FB 5E8PB 2NW3B 5F1IB 4OLXH 1LWRA 2XI9A 4AEHH 1T7WA 3N9GH 2AJVL 2P48B 3BDBA 3PQYD 2VDPL 4ODTH 1GIGH 2AJSL 4NKOA 5MP6H 2GJ6A 5H94A 2A6DA 2FIKA 4YPGA 4C56B 2EIZB 1KB5L 1QLFB 3IRZA 3DV4B 5F7UA 4JPWL 4YGVA 4LSUL 1MOEA 5EUKB 3Q0HA 1BBDL 4BYHA 1R3KA 3QPQC 3OAYK 1ZWIA 4FQXB 3B6SB 5IROC 1NGYB 2GTZB 3VFSB 2EIBA 3QUMH 3AU1A 2UYLA 3HUJA 4OD2A 1M05A 3LD8C 4W6WB 4F9PC 4ERSH 4QHLB 2EDOA 4XPFH 1FFOA 1OTSC 4QXGH 2XZQL 3GRWA 3JWNC 1IAKA 1A64A 2YBRA 4QOKA 4Z7VE 1NMAH 4JGJA 4PJXF 4KXZI 1HXMB 1FFNB 4P2QB 4RMUA 3PNWA 4WEBH 4OZIA 2CJUH 4W6YB 5EFIA 3ULUE 5CILH 4U1SB 2NZ9D 4KJPD 3L5IA 5EUOE 5FO9A 5E1AB 1R3LA 1WC7A 4K9EH 4YO0A 5DSCB 1BGXH 3F12B 1S9WA 3NH7L 5I73B 3S36L 2GSGB 5HHXH 4HXBL 4BFGA 4YDLC 2HRPL 2WWKO 4BH8A 3DURA 1EPFA 2ED7A 4P2OA 4JQXC 1S8DB 3RI5F 1N6VA 3KHOA 2XY1A 1CU4H 2AJZA 5FYLD 4TOYL 2XYCA 5DD5L 1EHNA 4MNHB 3KYOB 4NPYB 2Z31A 4XAKD 2DBJA 1ZK9A 5AEAA 3SCMA 1AY1L 3N50A 1WAAE 3PHQA 5ILTH 1VGKB 4P3WA 4LSSL 1SEQL 4N9GB 4X99A 4LSPH 1KIPB 4K94H 3MRJA 5IOPA 4MCZA 5FYLL 4PRPA 1AJ7H 4OM0H 2D7MA 1UJ3C 1XF1A 3IS0X 4PGDB 1B0RA 4HBCH 4N0YL 2DQHL 1TPXB 3LY6A 1YN7B 2I25N 4K23L 5DUBB 3HS0A 4FFYH 2VXVH 1TETL 2CLRB 2H2PC 2NY4D 4AIZB 4EOWL 4ZTOL 3MNVA 2UZIL 5D1XA 5LGHH 1ACZA 4KTEL 3ESUF 2OZ4L 1MFEH 1QFWI 4NFDA 2VR4A 5HD8C 3SDXB 1MJ8H 1ORQB 1JNJA 2ZZUT 1BREA 3O11B 3BX7C 3C5SA 3U46B 1EGJL 1CFNA 1IILE 1F3RB 3WKNA 2FRGP 3LDBC 3NPSC 2AJVH 2BVUA 2A9NL 3ULUD 4X7DC 4YHLH 3H9SB 3IDIB 3SDAC 5DUML 3WFZA 1KB5H 2ITDA 4KMTH 2VERN 4YHIA 4PJ8B 3MJ9L 3MLWL 4LSUH 1BBDH 1UM5L 4GMSL 1G7QA 2JJTA 2XN9E 1MCOH 4AENB 2EIEA 5CSBA 5EBMB 5FOBB 2VXQL 3EYUL 1LDSA 1MFBH 3ULUL 2GEEA 1CDYA 4N8CH 3DO7A 3FONB 4QHUA 4D9QE 4X5WB 1NAMB 2BVPA 2XZQH 1XCTA 1UZ8A 2OL3H 4YAQA 4K7FB 2ITCA 2DI9A 2DKUA 4HS8L 4PRIE 4D0CB 5EWIL 5J1SC 4J3UA 1GCFA 5CBAA 1G6VK 2D0FA 3HZYA 1HEZB 1KCKA 5CWSA 4ORGA 2UVEA 3MCLL 3VI3E 4MQ7A 4P2CG 3X12A 1CGUA 1V7NH 3DX7B 2LFGA 5F89A 4YLQT 1KJ2L 3AGVA 4F7TB 3DWTA 5TE4L 1IQDB 3IETB 1CVRA 1I7TB 4R96A 4HXBH 2HRPH 3C8KA 2FSEA 3DSFH 3MRLA 6CGTA 5C70A 3V5KB 4LMQI 5D7LA 1S78C 3LQAC 1MEXL 1OT2A 5MEPB 4JANA 3MV8E 4NQVA 1S5HA 4TOYH 3QDHA 1UEYA 4IMKA 3KLAB 1NCCL 4EEEA 5HYJE 4JO2H 5E6IC 2X05A 4X7EC 2BHZA 4OCMC 3BHBB 3NIGF 3I85A 2H2SD 8FABB 5CZVL 5F1OB 1MJ7H 4S0TD 2HWZL 4P99A 1QQDB 3B2VL 5KS9F 1CXKA 4KU1A 4LSSH 1PX3A 1SEQH 5GS1C 1NEUA 3T3ME 1ZLVK 4G8FA 3WN5B 1KLGB 3INUL 5FYLH 3QEGL 2FLBT 4GQPH 7FABH 3BVNB 4NC2B 4NWTH 2BVOB 2Y5TB 2EDRA 3B8SA 2NW2B 2YMXL 1QG3A 2GT9B 3ARTA 4KVNL 1TETH 2PKDA 2XN9D 3G04B 3IT8D 4P0DA 1MJJB 4Y88A 2BVEA 4F15C 2JB6A 5CEYB 4QXTA 2UZIH 4TSAH 3RU8L 2D9CA 4KTEH 5CEXB 4UB0L 2OZ4H 1YDPA 5ITBL 4PJ5B 5FA3B 4NKQB 4RGMB 1TENA 5I1HL 5KJRL 1LGVA 1A6ZA 1ZA6A 3PIQB 4CN6A 1AXSB 4D9QD 3LAFA 1LK3L 3BH8A 2Q8AH 5I17B 1EGJH 3F5WA 1OAQL 3QPQD 5JQHC 4PRID 2IQAA 2NQCA 5F88B 1P7QD 4K55A 4GG6E 2MFNA 2P43B 2A9NH 1BWMA 5EU4B 1JNLH 1EHLL 1QSFB 5IVXF 2NY1B 5GIRB 5EU7C 5EOQL 4L8SC 5IWLC 4MA8H 4QRUA 3MJ9H 1JRHI 3MLWH 5DEFA 1UM5H 3OAYH 2H3NB 2CK2A 5H2BA 3DBXA 1ZT4A 2BVYA 1OTSD 4NZDA 5C0AB 3VXQB 5KSBE 3QDMB 3ARYA 4HIXL 1UVQA 4JKKA 2D2OA 2VXQH 5C3LD 5GS2H 3BE1L 4L29A 3EYUH 4NNPL 4UINL 5EOCJ 3NACL 3ULUH 3AM8C 3D3VA 1FGNL 4L4VB 2VSDA 1MH5B 1E6JL 4U6HB 2YD6A 4KJWC 4WUUE 3MV8D 1PEWA 3KR3L 4Y4FC 4ZS6C 2LU4A 1DEEB 1A47A 3WS6C 4RNRB 1LK2A 1S9VA 4HS8H 4XBGB 5EWIH 3NIFF 3GSNA 2VABB 1OAKL 4PP2B 4FFZH 2J6EL 4Y2DC 4LCUB 5C0GB 3QNYA 3MCLH 2WQRA 5I75B 3TBSA 2CIKA 5CINL 4TRPL 4M6OL 5IBUG 3NA4A 1VFAB 2K7PA 1YC7A 1JF5A 5DJZB 3OQ3B 5IGXL 2X4OB 4L5FL 5TE4H 4LBEB 1JHKL 5DHYA 4I5BA 4PJXE 1BEYL 3MV9A 5DD1L 4JKLA 4MNGB 1N2RA 1VA9A 3K8MA 3TO4D 5GS3A 1KIUA 3I9GH 3LKSA 3KJ4B 3S88H 2X89D 1MEXH 4B50A 2D31B 3CVHB 4PJGB 2W0FB 1J18A 2LABA 3MRIB 4HUWA 1NCCH 5E5UB 1X44A 1KEML 3WEXB 1R3HA 3ELAT 1U2CA 4EUPG 2Q87A 1IQWL 5CZVH 4KVCH 2HWZH 1NGPL 1D9KA 1YJDC 3B2VH 5CSZA 1IAIL 1UQSA 4UV4L 2MWCA 1XR8B 3F7VA 3QIBC 1ADQA 2H2PD 2IGFL 3BN9C 3VA2C 3S7GA 3INUH 4WW2A 4GRLA 3QEGH 4OB5H 5D1QB 1ZOXA 3RL1B 4HK0A 4I4WB 5HD8D 3NZHL 4MDJA 4LL9A 5I16A 4Z0BL 1AD0B 1TDQA 2YMXH 4JGUA 3GDBA 1AI1L 4KVNH 4X5LA 5KVDL 3SN6N 1F4YL 1JBJA 3MRGB 3ARGA 1E4XL 1IC4L 4NP4L 5IB5A 5JQ6H 5IUSA 2H6PA 2BDNL 3IYLW 1DR9A 2AEPH 1I1AA 4QRQA 5F44A 3WJLA 2VN4A 1DDHA 1LEGB 3O6LL 3P4NA 4OZ4A 5DJAB 5KJRH 4ISVB 3L7EA 1A6TB 5E6YA 3SDAD 4NC0B 5I8OH 1LK3H 1I1CA 1BWWA 4JZJB 5C7XL 1UB5A 3O6FC 5E7BA 3T4AB 5CCKH 4NQXB 3C5ZC 3G6DL 4JFQA 4GKSB 2R2HA 4HJ0C 3SKJL 5SWSE 1NLBH 1MRDL 4GW1A 2BRRL 4OZFG 2D0GA 3PP4L 3K4AA 3I02A 3QO1B 1IT9H 3MLVL 3QXWA 3TJEL 3HNVL 3R1GH 3L95A 1EO8L 1INQB 1IAOB 1WIPA 4JRYE 4NQCA 1WUNT 4HUUA 2ICWB 5EO1B 4BSWA 3BQUC 4HIXH 2VL4A 3BE1H 1T7XA 2NY0B 3EOBA 1FNFA 3T2PA 4X9HA 3QDJE 5ENWA 2IANB 1FGNH 4M00A 4LVOB 1WBYA 5EC2A 4NM8L 1E6JH 4M7ZC 3LH2H 2EDFA 3EJZC 3FZUC 3KR3H 5BRZB 5CJ8A 5IESL 1U8HB 4MCYB 4RMWA 1LNUA 3MRBB 1AGCA 4FQLL 5DR5H 3V6OA 1F4WL 3ZSSA 2CDEB 2J8UA 1KLFA 4XPHL 2BOBB 4NBXB 3WLWC 4JVPA 1H15B 1MHPL 2GAZB 1SQ2N 4AIOA 3T08A 3FO0L 5DK2A 1VFOA 4L4TE 4MX7A 3VXRA 3K0WA 4ZNEA 3VGHA 4M6OH 5FUOL 1S78D 3DYMA 5FECA 3MRHA 5GGUA 2MKWA 3BRGC 1J86A 2B1HH 3F7YB 4RIRB 5DRZA 1V3JA 4IRJC 4L5FH 1RHHA 4PRNB 5GS0C 1JHKH 3LS5H 1E27B 3TBYA 5E6ID 4Q0XL 3GIZL 3GSUB 1QSZA 1BEYH 1BIHA 2XKSA 3HRZB 3O3UN 5FAAA 3B9VA 1ZS8A 5HDOA 1Q0XH 1VGEH 1FZMB 1IC5L 3CMOH 3VWJC 2XTLA 4PY7A 3SE4C 4DCQA 3DPBA 1S7VA 3MROB 1MI5B 1Y6KR 5FYJU 5GSRB 1GZPA 3LQAL 3V4PL 5C0RH 4FQIH 5T5FL 3S4SG 1JK8A 5A43C 3SEPA 3GO1H 1IQWH 4FNLH 2VIRA 5I30H 2AV1A 3S3JA 2YUVA 4U3XA 1IAIH 1K2DB 1JZ2A 2JCCB 3LKOA 2H8PB 2WUCH 1ZLVH 5SWSD 2DLFH 5ISZB 1ONQB 2IGFH 4CDGC 5HHOA 2P7TB 4P46A 5C07E 4JFOA 3NIDF 1FBIH 3BH9B 5I66B 4ZO7A 1U3HC 3NZHH 1RJLA 4L8DB 3TM6A 3MACL 4JRYD 2XWTB 2VLKB 3SDDC 1QTYT 5EZLA 3HE7A 2R1WB 3GSXB 2C7UB 3V7AE 1FNHA 1T04A 1G7MB 3LKPA 1GGBL 4NN6B 5BW7C 3BGAA 3P9WB 2CLZA 2KZWA 4NP4H 1CXHA 5KS9E 2A6IB 4HK3N 4DN4L 3QDJD 5GJSH 3O6LH 1QEWA 3FB8B 5CHNB 3EDFA 2ZUQC 3VJ6B 1IKNC 4P5TC 1UADC 5DGQA 5CGTA 2HFEB 4HEPG 5L88H 4POYA 3ETBF 3BKML 5C7XH 4Z7WB 1AGBB 3QJFA 3B9KB 4FXKB 2YC1B 3QZWG 4QNPF 3ZLQC 1D6EB 5ETUA 2E9WA 1MRDH 2BRRH 1B0GB 1SY6A 3PP4H 3JV4B 5ADOL 3MLVH 1P4LB 3HMXL 4NRYA 4L4TD 4PBWD 3WFEL 2EYSB 3HNVH 1RZ8B 1RZ7H 1EO8H 4WGVB 4Y4HA 3MRKA 3NCYP 4OCWL 1NSNL 2NR6C 4KJWD 4Y4FD 3P9MB 4ZS6D 3CU7A 3RDTB 4A6YH 5JPMB 1P9MA 3JV6A 1TJIH 4Y5XC 3W9DA 1KFAH 1L0QA 1QFHA 1TTUA 3S37L 2PYFB 4DKFH 4OT1L 4KKAC 1X5GA 4C58B 1T83A 2DJSA 5GJTL 1GXEA 1NGXB 4PV8B 4Y2DD 5DQJB 2NXZB 2VQ1B 5IVXE 3F58L 4Y16C 1F42A 3QSKB 3U0TB 1QRNB 1Q72L 5IQ7L 3HG1A 4XPHH 5CP7A 1CGYA 4LOUC 1ULVA 4YFLI 3CU1A 2C4FT 43CAA 4IRSB 4R0LC 3NZ8B 1U91A 3FO0H 3EIFA 4F7CA 2AXFB 3V5HA 4OFIA 1HI6B 2WV3A 4C59B 5C07D 3I6KA 1WZMA 2AJUH 4OGZA 5DMIL 1HIMH 5K33A 1PX4A 3KPTA 5ICYA 3BUYB 4YR6B 1VPOH 3VFNB 3EYQD 4Q0XH 3GIZH 2V5RA 4QHMA 2AXHA 3V7MA 2ESVB 5GGVY 1CD1B 3NIFE 2DL9A 4JDVB 5HGAA 1KJ3L 1N5YL 3KPMA 1RZFL 3EW3B 3DUSA 3HHRB 3LRSA 3JV5A 3QIBD 4XPAL 1X4XA 3LQAH 2HH0H 3BN9D 3DI2B 3V4PH 3TNNB 4U3HA 2ICWJ 4UZGA 2VISA 1IJ9A 4H5SB 4AH2A 4F9LA 5J1AB 3ZE1E 4D8PA 5JO5A 3SJVA 1L0XA 1YJDL 3RUGA 5GRVK 2C5DC 4RAVA 4WDIA 4JKMA 4FZ8L 1LHZA 1SJHB 5DRWA 3TEUA 4QHKI 1CZ8L 1H3UA 5E2WL 4GSDL 1PY4A 1NMBL 1KYOJ 4NN7B 1N4XL 3V0AC 3WD5H 3ZDXF 2UV3A 2NXYB 4JQVC 1LILA 3O6FD 1HWGB 3W0WB 3W82A 2XT1B 5D7JC 3C5ZD 5GQBA 4JFYA 1KENH 1FNSL 4HJ0D 4JKWA 3DRTA 3SGJC 5F96L 4YFEA 5I6XC 3ARSA 5HHQA 5D7IF 2DDQH 5DFVC 3BFOA 1ZV5A 2K1MA 3PWJB 1CFQA 4JY5H 3MTRA 5HI5C 1XMWA 3ZYZA 1S3KL 4ESKA 3MR9A 1NCWL 4ZDHA 1T5XA 4N0FA 1OM3L 1KTRL 3BQUD 3GBML 4EI6B 4GG8A 5ADOH 3DX9B 3L3GA 4BK4A 3FO9B 1HK6A 3RX8A 5DS8A 2AKRB 1PZ5B 1XF4B 1KJMA 1C7SA 1QO3A 1F2QA 3EJZD 3FZUD 4WTXA 1TCRA 2DMCA 1YEIL 4GKZB 2PTTA 1OP9A 1U3ZA 3GSQA 4WFFE 5ESVA 4UT7H 1MIML 4KJQC 2R69H 1N3NB 4GT7A 3S37H 2AXGB 1NGWA 2CH8A 3G6AB 3WLWD 5I8CA 4W81A 5GJTH 3OPZL 1KJVB 4I18B 1XGRA 5FCUH 4LLMA 4ELKA 5F1NB 3ZDYF 1BHGA 5I1JL 1ZA3B 1I3GL 2APWA 5IB3A 3A0OA 3QQ4B 1MUJB 4DN3L 4UILL 4PJAF 5IW3A 5K9KA 2VR9A 3I50H 4IRJD 3E2HC 5GS0D 1ZVSA 1M4KA 3FB7B 3SPVA 3BT2L 5DFTA 4UAOB 2Z91B 1MCDA 1GH7A 4MAUL 2QJDA 3F62A 2QADC 1RI8A 2H45A 4NOFA 4P23A 5GGSA 5FYJE 1NC2B 3BD4A 3VWJD 2CGRL 5GHWL 4NBYB 4UUJB 3SE9L 4WWID 1A6AA 2O61B 1QA9A 4FTVD 3HPJA 4MS8C 5HJ3A 4LK4A 5GS0L 4WUKH 4D0DA 5E4EC 2GK2A 1PLGL 4QTHA 4L3CB 3OXSB 1RZFH 1QNZL 1XIWB 3OAUH 1JPFA 1GZQA 2YRPA 2EE3A 4IIQA 4XPAH 5J9PA 1WJ3A 5JHDB 1G9MC 1IZJA 5JNYB 5D1ZB 3ARFB 1U3HD 2DWDA 1O0VA 5DRNB 3SDDD 3GMLA 2AV7B 1YNKH 4NM4L 2P5EE 1NJ9B 2AQ3A 4MJIB 3K1KC 2WP3O 3RTQA 1YJDH 4PGBA 1T6WA 4IHOB 4NZUL 3ARWA 4R7NB 3D25A 2B4CC 5IHZB 4HQQL 2DOCA 4OUOA 1H3PL 1PAMA 3TA3B 1EEYB 4FZ8H 2BVTA 5J7CC 1CZ8H 2EZ0C 3RWEA 4GSDH 4E0RB 1U8NB 2VAAB 3PJSA 1NMBH 4PTUA 4P5TD 3RWIA 2YKLL 3O8XB 1N4XH 3MFFA 4WFFD 2V9TA 1BZQK 5JHLH 5LGJA 3C5JA 2C3VA 3K46A 4BH7A 3V6ZB 1JN6B 1FNSH 5TQ2L 5D6DA 3HZVB 4ZOAA 1TZHA 3QXAB 4ZYKB 2F53A 1ZGLP 4HJJL 2P8MB 3PL6A 3Q3GB 2IAMC 5AG9A 2NR6D 4EI5A 4XVUC 1MNUL 3FN3A 1NCWH 1OM3H 4NO0A 3GBMH 5DK0A 4A2MA 3DLQR 1CGWA 5EU5B 5HHME 4RWYL 4KKAD 5EULV 4WV1B 2WWKT 3VG9C 1GC1C 2NYYD 4TTDC 2IBZY 3ILPB 3GHBH 3NABH <