5GRZA

Crystal structure of disulfide-bonded diabody
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
231
structure length
225
Chain Sequence
VQLVESGGGLVQCGGSLRLSCAASGFTFRNSAMHWVRQAPGKGLEWVSSIWYSGSNTYYADSVCGRFTISRDNSKNTLYLQMNSLTAEDTAVYYCARFAGGWGAYDVWGQGTLVTVSDIVLTQSPATLSLSPGERATLSCRASQSVSSNYLAWYQQKPGQAPRLLIYDSSSRATGVPARFSGSGSGTDFTLTISSLEPEDFAVYYCHQYSDISPTFGQGTKVEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of mono- and bi-specific diabodies and reduction of their structural flexibility by introduction of disulfide bridges at the Fv interface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords diabody
total genus 47
structure length 225
sequence length 231
chains with identical sequence G
ec nomenclature
pdb deposition date 2016-08-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5grzA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5grzA01
1DSFL 2J88L 3DMMA 3L5HA 2XYCA 2HRPH 1TQBC 2L0DA 2A1WH 4K07A 4LKCB 4WU5A 3MUGB 4EBQL 2D31A 4TNVF 5EO1A 5KAQF 4H88L 3RWGB 1VADA 3DHMA 1LO5A 1P4LB 1MQ8A 5GZND 2DQHH 3V4PH 1VFOA 1K4DB 3MOAH 5D7KD 5D2LB 3OHXA 4NKMB 2P8MA 1AC6A 4YJZL 1J18A 5L2JB 5JIKA 3WKML 1CGYA 5I19L 3CFIC 4AK1A 3QUZB 1EJ6A 4B7LA 4GLRI 4RZCB 3GI9L 4S1SL 5CBAA 1CXHA 1ZVSA 5EU6E 2EYRA 2DI7A 2PXYB 5SWQA 3SQBA 4L9LA 1MF2H 2O61A 4N90D 5D2LA 1IC4H 2YEZA 3GMRB 1HHGB 1KFAL 4YPGB 1MCEA 4YO0B 3CX5J 4QRUB 4M93C 4NBZB 2QADB 3HFML 3OXRB 4P9ML 5HI4C 3BH9B 5E6ZA 4Z0XA 1JN6B 1FLTX 4HKJB 4F57H 4JFYA 1MFDL 4WFEE 4O4YL 4IRJB 1QBML 1MHEB 1AC0A 3HPLA 4MSWA 3MRJB 1S3KH 3K8MA 2EDHA 4HD9A 4PJFB 4LRNL 3T2NL 3SKNA 3U83A 4D8PB 2E27H 4L29B 3QIUB 5JOFA 3MZGB 1SMAA 1V3LA 3MRQB 3UXFA 3HUJA 1HDMB 3IDNA 1UKQA 1MJUL 3IFNL 4R4FH 5ANMA 3OL2A 3QDGB 5CGYD 3C6LB 1UB5B 4PJBF 2X2YA 4G5ZL 1KB9J 4GH7B 3UTTA 3H7BA 3P9LA 1AR2A 1MAMH 2X7LB 3ZTJH 5HHOA 4OZIB 4R4BB 2WP3O 3BP5A 2FATL 5FYJD 3D85D 3CFDB 1Q72L 1OGTB 2XTJD 4ZPVA 5E8EA 4PREB 4KTDH 2YOCA 4NYLA 3MCLL 1EHLL 4JN2B 4KK5D 4BQ9A 1S5HB 1DTUA 3BKML 1KELH 4IIQC 3E0GA 5DD5H 4YDVA 3ULVE 2P1YA 1U8IB 2VLJA 3ARDC 2H32A 2X4NA 4P99A 5TH2A 5T1LD 4MQXC 1FZOA 3L9RA 1CL7L 3SDAD 1S9WB 2Q86A 4R8WL 1FZKB 2M26A 3PWLB 2F54E 3K2UL 3OZ9L 5CZVL 1UQSA 4ODTH 3UBXB 5IM7B 5DHVA 5GRWA 3TT3H 5C2BH 4YHNB 5DK0A 1F4HA 4C57C 5J6GA 4P48A 3SDXB 2YD8A 4CW1A 1KJMB 3VFWA 3VMPA 3FQXB 5C6WH 4HKJA 1P2CB 4HXAL 3DROA 4LSVH 5SWSE 2UYLA 1DFBH 3OXRA 4TUJA 5MERB 2P46B 3V5KA 2DMCA 2RJMA 1AY1H 4HSQA 1AQDB 4YO0A 4K3JH 4YHIB 1VEOA 5FYLD 3ULUH 1G9NC 1NBZA 4W68A 1R3HA 1X9QA 1KJVB 4HUUA 2E27L 1U42A 3GK8L 2XKUA 3HE7B 4G6MH 5BMFH 2CR3A 3BPNC 3TBWA 3QNYB 2ESVE 2FIKB 5F7UA 3CCHA 3DJ9A 5GRYA 2JJSC 4OGYL 4ZTOH 3RIAK 4BSVB 1DUZA 4Y5YC 4MA7L 1IC7H 1DL7L 5B39A 2E5EA 3KPSE 2CQVA 2PETA 6CGTA 4UNTA 3NTCH 1DQML 4X5XB 3VI3E 5IGXH 4LKCA 1RJLA 2C3VA 3STLB 5EOTA 3HG1E 4X9IA 4LPVA 2R23A 3QI9A 2BVOA 2IQAB 4ZUWA 3ZT6A 4B53A 4RISH 2CLVB 4LCWE 2ADGA 4UIMB 5GS2H 1U41A 3ARFA 4L8BA 4Z7UE 5DUPH 3RX8A 2IPKA 4YXLH 1N4XL 2M1KA 3O0RL 1EMTH 3CFDA 1C5DA 4LLDA 4WENB 3ARDB 2F54D 3FOLA 3S96B 3KYNA 5E2VL 4MVBD 1YN6A 4ZFOB 3G5YA 3HNSL 3WDJA 5I2IA 2X1WL 5ALBL 4ISVA 2EKSB 3JV6B 1AGEA 1I7ZB 2X4UB 1NJ9B 5GRUH 1ITCA 1A7RL 2LE9A 5TF1L 4ZXBA 3LEYH 4RAHA 3ORJA 3LD8B 4PJFA 5I8KH 1Q9WA 2DM3A 3UDWA 2R1YA 2UZXB 1TCRA 4RAUB 4J4PC 3AM8A 2GY5A 4WW2C 5HHQB 4HS3A 1S8DA 4IRJA 3FCTB 5H35A 5JDSB 5I8OL 1EVTC 1EEZB 4XVTH 5D6DA 4HWEH 3LSOB 3TFKC 3MRPA 5EO0A 4LSRH 1ZT4B 1NJ9A 1J1XL 4ZODA 2X4QB 1TPXC 2HA1A 3PWPA 5DVOA 5MENE 3KNBB 1S9XA 1BBDL 2KZWA 3C5ZD 3LEYL 3GNML 4GMSH 5HY9B 5LCVH 3GRWA 1IGTA 4E41B 3F7PC 4AM0A 1G9ML 2PO6C 3IS1X 4OCSL 3QDJD 4HH9A 2KUTA 3WFEH 2FR4B 3LQZB 3AU1B 1ZK9A 4JFPB 4M7ZC 5HHNB 4NSKA 4DZBB 4PBXA 3BXNA 3KYAA 4O00A 1X44A 2HKFH 4X6DA 2DWEA 4BKLB 1FN4B 4UT6L 3RFZC 5J1TC 4WHDA 1VFUA 3PDGA 4BSWA 3HC4H 1KN2H 3AVEA 1JF1A 3BIKA 5DWUH 4EI6B 2P42B 5F70A 4JKPH 2OLDA 4HK3J 4I0PB 2X4PA 4I9WE 2VXVH 1DZBA 5F6IC 5HYJA 1MNUH 2FBJL 4KTEH 4QF1B 3DMMB 2WLZA 3N1PC 5JLZA 2WIMA 5KANG 2EDLA 4LLMB 1QSEB 3VFNA 3T1FA 2WBJA 5C0CD 4U0RB 4AYFA 3F7RA 1Y6MR 3FO0H 1JCKA 5IVXA 3OKKA 1MH5B 5IHZB 3Q2CA 1I3GH 5C86A 2NXYD 4A2LA 1KBGL 1R3HB 3AS0A 1C08B 3KPSA 3D25B 4PD4K 2XN9D 4F7TB 5L7XL 4GG8B 4I3RH 5FYKH 3O3DA 3TNNB 2FYYB 5FFLA 4YLQT 4LBEA 5H94B 5J9PA 4IHOA 1QRNB 1RUQH 1NFIB 3K80A 4YHPA 2CO6B 4AQOA 4ELKB 1K4CB 4XCEA 5A40E 5CEZH 1FN4A 3C08H 1OW0C 3PF2A 1HNGA 1W8NA 3I3DA 4LQ1A 2LABA 1M4KA 3OAZK 4ONFL 4CJ1A 5D7LD 2AV7A 2VXSH 4X7SH 3GIVA 2FJGA 1GHFH 5DQ9A 4PJCE 5TFSH 5ACMA 2OTUA 3FAXA 2VQ1A 1ACYL 3LS5H 4PGEA 3QEQB 1J05B 3O6FD 5D1XD 4YAQA 1NFDA 1S9WA 4OCMC 2EYSB 5E4EC 5LXGH 2A73B 2IBBA 5D2NE 4BZ2L 4HHAB 5IB2B 1I8LC 5D1QC 5GZOD 1J0YA 1U8KB 5TH2B 5C0GA 1FJ1B 4QNPF 1BOGA 1YY8B 4ZQKA 5LG1A 4C56B 1KUMA 3W11D 1U92A 5IBTH 3S3SA 4IOSD 2F54A 1K3IA 2MKLC 5ETUB 3FO1A 1EEYB 3NGBB 4NZTL 1ZVYA 3P3YA 2EE9A 5IJVA 1IC7L 1KT2A 4JDVB 2DIAA 2VLKB 5KOMC 2DBJA 4NN7B 3NA9L 1P7KB 4X5LA 4AG4H 3GHEL 2HJLB 2VAAB 4E9LA 3L3IA 3D6GA 3L6FA 1BQHA 1WBZA 2C1OB 3L3OA 3CVHH 4L4JA 4LEXL 4LMQI 4X4MA 1A6TB 4HG4K 1KB5B 2PW1B 1YEDB 1S9YB 3HC0B 4JHZA 4DN4H 1X5JA 1FCGA 1IGJA 4NQCA 5DUPL 2XZCH 3C9NA 4K3HA 5HHXL 2NPLX 3T09A 3BSZL 2YPKB 3KPQB 3MMEA 5DFWH 1XF3B 3K1DA 2UWEE 4FFVC 5T1DH 1HWHB 3HZVB 4MWFB 5MI0C 2AGJL 4PJ8D 3RX5A 1LHZA 1ZGLA 4WO4C 4DOHB 1SJEA 1NC2D 3VE0B 5KSAC 1JHTA 3T4AB 4JFZL 2OM5A 4XXDA 3IDXH 2CXGA 4OF0A 4Y2DB 5C6TL 3H9SD 4W81A 4R0LC 1B0GA 4LAJH 5A16A 3QZWG 2XTLA 4EVNB 4PJAB 2BP3A 1NGXA 3G5VB 1GGBH 3BJLA 1ZV5A 3V6ZA 1F6AB 5JR1L 4DQOL 3QCTH 2VRAA 4P46C 4U1JA 3WFEL 2A9NH 4WFGE 4WY7L 2APTA 3SDAB 1D6EB 3ABZA 2DJ4A 1AD9B 2F74B 3QA3A 1H9VA 5I71B 3IF1B 1A3RL 3A6OA 5CIPA 3C87A 4PJAA 5ENWA 3KVQA 4V2BA 1A1MA 4P5MB 4UBDD 5IVXE 2AJ3A 4PYGA 1KJ2A 4N5EC 2OL3A 3F7YB 1OD9A 1KJ3H 1J0JA 1XGUA 4QNPE 1I1CA 1MREH 4HF5H 5GS0H 1AIFB 3RWIA 4PJXA 3S7GA 4CVXB 4HUNB 3W39A 4G9FA 3G6AB 1YPZF 5GISH 4Q0XH 1NBQA 5HPOA 1U0QA 1IGFL 2K1MA 2JK5B 4NO0B 3MGOB 2ZCKL 5ILTL 3MOQA 4LPTA 4LVNB 3GKWH 4OFYD 2WK2A 4BZ1H 1NC2B 4GG6A 4HIJA 3WL9B 5IBLC 3KPLA 3ZDYE 1S7TB 3MBEA 1HH9A 3MCKA 3SO3C 4KDVA 3X13A 3HN3A 2AAVA 4G7YH 1QBBA 4U0QB 2MSPA 4OFDA 5HHXH 4U1NB 3QCVL 4JM2D 1N7MH 5E9DE 5C0IB 1FVEB 1HSBB 2AVGA 4LASL 2BJML 5F21B 1FZOB 1INQA 4IOIB 4P4KA 2JLLA 2F5BL 2R2EB 3EHBD 1Q9KB 2QKIB 4JREC 1T0MB 1UYWH 4ZS6C 2A6JB 4FQPA 1T89A 4HJJH 4F7PA 4Y16A 2C3WA 5D4QA 1Q94A 1S7UA 1NCWL 4U33A 4X6BA 5KVFH 4KTYA 1KENL 1WC7A 1Q1JH 2G60H 3L3JB 5DC9B 1U8HA 1CGTA 3MRFB 3QDJA 1A14L 3DUHA 4H25B 5F1KC 5EIIB 4UUJA 2YPLB 4YEFA 1TVBA 3QXTA 2FHFA 5KSBE 3L95B 4LLYA 5D6DC 5IBTL 1VFBA 3EOYG 1BVZA 4U49A 5CWSA 3TLRA 5IW6A 2HN7B 3QI9C 1G7LB 3MRCA 3PDDA 1F6LL 1FFNA 2VL5B 2R0KH 7FABL 1K5NA 3TH2T 3M1BA 3MV8D 4NQEE 4YAQB 2RGSA 1YMMA 1QSED 3K7UA 3UTZA 2ZSWA 3HMWL 1S7TA 3VDAA 1IZJA 3ARVA 4P2YA 3O8XA 1BZQK 2R15A 4PJ9B 3D3VB 3HC3H 1MHEA 1LK2B 1Y6KR 5E9DA 1P53A 3VH8B 1RUPL 1NFDE 5ABDE 3HUJE 1S7SA 4L8CA 2HFGL 4ZSOA 2AXJA 5E6ID 2EO9A 1RZIA 1AGDB 4G8IB 4P0DA 1RURH 2V9RA 3IDJB 5J12B 4JFXB 1DLHB 3VG0L 2OZ4L 5E99L 3A6BH 4WUUD 1LNUB 1OAXL 3R06B 5FYKD 2FNBA 2IMNA 1KTKE 4LIQL 2FGWH 4LCWA 4MJ4A 4N5UA 5M95B 1LD9A 4LU5L 3QIUD 2JELL 1OP3K 3O2WH 5HSFA 1QSZA 5DJYA 5DI8B 2V2TB 2F19L 3LMJH 2DKUA 2WINA 4QCIA 4PRNA 4F7CB 4X7FC 1ZA3A 4Y88A 5HHVH 3O45A 3MBED 4F15B 3S3PA 1JTOA 4P3WA 3CC5B 1WZLA 1XMWA 5HD8D 2XACC 1MI5A 4X7SL 4JO1H 1ZGLB 3CDCA 4ZOCA 1MFAL 3HB3C 1EUUA 4AY0A 3ARGB 1G1CA 3LEVL 2R1XB 2J8OA 1UC6A 3GHBH 4KRLB 5TGBA 1KCSH 4YR6A 1V7NH 5F7EL 4HCRL 3V5DA 4ZAKC 1XF4B 5ICYB 4P46A 5T1KA 1ZLWK 3ZE0F 4I8DA 3LKNB 4HFUH 5ERWB 5CSZB 4NQVB 3G9AB 4QHNB 1CGSH 1EA9C 2ITCA 2O5YH 1S7WA 1MJUH 3IFNH 1MSPA 3QQ3A 4R4FL 1OAYL 5E2WL 4PLJD 4XWOC 5SX4I 4JFDB 4JO4L 4RWYH 1NFKA 1SBSL 1A9BB 5KSAD 4LPYA 1EAJA 5EA0L 3DMMD 2VAAA 5BO1L 1OAYH 3AM8C 5E2WH 3CDGA 3VW3H 2DQFB 2QQQA 3PGCA 4J4PD 2EYTA 1P4BL 4YZFF 3KPRB 1B9ZA 1X5LA 1NGWB 2I9TA 2CDFA 5GRZA 1JGLL 3T77B 4H0GA 4JREB 3VD4A 1A6WL 2BFVH 4UQ3A 3RL1B 4BSJA 1I1AC 3T0AA 5L6YL 1MIMH 5EC1A 1IAIH 1YC8A 4JE4B 1QSFB 3F7VA 1I4FA 4ZNEA 2BNQE 4GO6B 2DQFA 4XPHL 2GAZB 4A6YL 1KSRA 1I7ZA 1T0NA 1Z9LA 4HBQA 4PJEB 1A5FH 1HXMA 5LQBH 5HGGS 1BVKB 4PJBE 5HHVL 1DE4B 5EORL 3OKMA 1RHFA 4WUUA 4OI8A 1A6UH 4WGWB 1WICA 2B2XL 3QHZH 2VZ1A 4U6TA 3MNVB 4TSAL 3WNMA 5HVGB 5DD1L 2VLRE 4UT9H 3GBNL 4GXUM 4OUUB 3IDXL 4OD2B 3UTTD 4HDIA 5IK3B 5TDNB 2O5XH 3T0VA 3DYOA 3QEUB 4GUPA 3L3KB 5DRWA 3UAJC 4IRSA 4K8RC 4MXWH 1UZ8B 4X5XA 4OCRH 5IF0A 1OAKH 3V8CA 4PJ5A 3SE4C 1MAKA 4XMKH 3QDMD 3RZCD 4LPCA 3TGXA 5HGDB 3ES6B 4PP1D 2XG4A 1NCNA 2D7MA 4R0LA 1QVOA 5JHLH 3QFJE 4Z95H 3CCHB 2FIKA 4OZFG 5HVWA 4J6RH 4P9HC 5EWIL 5DS8B 3H8NA 5HYJB 4PJ5B 4M6AA 2FB4H 3RGVC 5IF0B 4KFZC 4M43L 4M4PA 4Y4FB 3QRGL 4E5XA 3B6SB 3GMQB 5GGSY 5EBGA 3KS0J 4ODXB 5E6IA 5FA4A 1DLHA 5DO2C 1PG7H 4WRLA 3VFTB 2R4SL 5C1MB 1SEQL 1N4XH 1U8LA 2AXGB 2VMFA 4QRPD 2FJFA 4OF3A 4HLZG 1DFBL 2ZP0T 1XCTA 3AS3A 5INDB 5F96L 3LKPA 4OCLC 1PLGL 5DJ8A 4ZSOE 3U2SB 3VFTA 2WWKO 4HUXB 5AUMB 4J6RL 5IM7A 4LVHB 4ODXA 3LKRB 4AM0B 1RJYA 5I71C 4Z8FH 4Y2DD 2GJ6D 4XBGA 3TO4A 1NGQH 5FB8B 3F58H 1G0XA 1GHFL 3MLVL 1MCLA 2GAZA 4C4KO 2IANE 4YDIL 4OGYH 4FXLA 1FPTL 5CJQL 1KPUA 3B5TA 3RJQB 5EC1B 4I18B 5IB3B 5IVZA 3X11B 4JB9H 5E1AA 5KSBA 5MENA 3RHWF 5FYLH 4G6FB 5SX5K 4OBSA 4GRLC 1DVFA 3EJZD 1RFDH 3IU4H 3ROOA 1OPGL 2XTJE 5FHBH 5B38G 3O6FC 4XPGL 1QFPA 2X4SA 4L4VA 3DVIA 1N5AB 4GRWH 4PG9B 1ZHNB 2ADJA 4KRPB 1JPSL 1JPGB 1NGPH 3MUZ1 3QDHA 4MAYB 3BW9A 5HHOE 4EDXB 4ZFOA 3SKMB 5DJCB 2I07A 4KWUA 4R7NA 4ETYA 1KC5H 5GSRA 4Z5RA 3TT3L 4HIEB 5I1LB 2A74B 1R5WB 4NP4L 1I1AD 1U3HD 3MRJA 4MSWB 4RFOH 1NLBL 5FDWB 5C9KA 1T03H 2YSSB 5EO9B 2CDGA 3OR6B 3C5SB 3MV9B 2VXTL 2R1XA 4JQIH 2DTMH 2BFVL 3KLAA 5H2BA 3IJHA 1OAUH 3F7VB 2VXQL 1JN6A 5FUOH 3LY6A 3DIFA 4PY8I 4LPUA 4TTDD 5T3ZL 3TJEH 3AROA 1NSNH 3P4NB 1CD9B 2Z31A 4ODBD 4I2XA 1YMMD 2UV3A 5GGRB 4X0KB 1CDIA 1W72A 4P2OA 4XP5H 1IGML 4NWTH 3D48R 3H9HB 3D39B 2DYPD 1J87A 3CZFB 1NCCL 2DJUA 3T1WA 2EDTA 3B2UD 4N9GB 5HGAA 4LCWD 3QUZA 1ORSB 3HE7A 3RX7A 5ACLA 1MFEL 2XZZA 5JXEC 5C8JB 1PG7X 3NZHH 4G42B 1JNHA 1ZE3C 2P5EA 3IXAB 4AMKH 3MREA 4YHIA 2MHAA 4Y2DA 2R0WL 3RWGA 5CFHA 1U8JA 2CUIA 3UTOA 5FECB 1KCLA 2E6JA 3QXAB 1FL3B 1YNTB 4QXGH 3C5ZA 1CDUA 1DR9A 3OR7B 3CAFA 4EEEA 2XY1A 2EE3A 2NY2C 5LGJA 5DJ2B 3SGDI 1A3LH 3QUXB 4POZD 2HMIC 3PWLA 1P9MC 1F00I 1UG9A 2PNDA 2BOCA 4LOUD 5SWZE 4WTZG 2UUDH 1HCVA 1UM6H 3DX6A 2ZUUA 4FRWA 3GFUA 3C8DA 3TT1L 3VI3F 3U4BH 1QLFA 2DM4A 3KPOA 4WV1C 4H20L 4H25A 3BN3B 5DJ0A 4CN4A 1RUAL 3K8KA 3KJ6L 4JR9L 3U4EB 4PJDB 4OZIA 4OZHB 4NIKB 4ZXBD 1RZKL 2HFEB 3QUKB 2YD5A 1ODAA 2Q7YB 3VH8G 4J23A 4O2CA 3CSGA 1OCWL 3MUJA 1IL1A 1A5FL 5BVJA 1ED3B 1DSFH 5C08A 2AK4B 3V7AG 4FXGA 2IPUK 5HHMD 3B3IB 4LLWB 4NUJA 4P4KB 3WIIL 5MEND 3PL6D 4NC1C 3W0WA 1JGUL 3DSFH 4X98B 3QBTB 3LPFA 3VFOA 3TV3H 5F89B 3DXAD 4Z9KB 1MRFH 1AD0B 4JRWA 1YNKH 3G5ZB 3RQ3A 4U1MA 2V5MA 1RK1A 5EU3B 1RJCA 3KYKH 3WIHL 3R4DA 3L5JA 1LGVA 4JPKL 3DARA 5C09B 4HGKC 3G5XA 5B21A 4XNXH 4OCRL 2BNRD 3CVHA 2EH8L 4PRBA 4TQEH 5C0EB 5C0NC 2V5TA 1T5WB 3REVB 4G9FB 2FBOJ 3MLYH 3L95A 4PJXE 3MV7B 2W0FA 4P4RB 2AEIT 4WCYL 1FNSH 4GBXA 1V3KA 4P9HH 5DVNA 4N0RA 3EJYD 4G43A 5I8CB 1MCWM 4JKMA 3VFGL 1G7HB 4OSUH 1UM6L 3HNVL 3SGKA 3MLRH 5CP7B 3BT2L 3C6SB 4MD5B 2HT4D 4R96B 4QYOB 1IC5L 3BQUB 4R8WH 4ONHA 5C08E 1LEKA 1QLFB 2VOTA 1TZIA 4PJGA 1T04A 1CQYA 3EO1B 3BKCL 2VR5A 2W9EH 5GS1B 1YEFL 1T89C 3T0XA 3MRIA 3EYFA 1FVEA 1HSBA 1Q9LB 1JJUA 5E95B 1N59A 2I25N 3WFHB 4ODUB 4JO2L 1N2RA 4F7EB 4MJ5B 3SCMA 5DSCB 1YYLL 2FZ3A 3PNWA 5LGJB 4EJ1C 1IAKA 3BH8A 2PYED 1X5ZA 1A7PL 1MVUB 3STZA 4X6DF 3VGAB 1B88A 1FZJB 4B41A 4JVWA 2XQYK 4XP6H 1XGQA 1ZHBB 3ILPA 1R3JB 1HI6A 1B2WL 1ZANL 3G6AA 3BXNB 3SDAC 1OL0A 3QPXL 5F7DA 1EHNA 3S35X 3PQYA 1KG0B 1SY6H 3TO2B 1XR8A 3SGJC 5GS0L 4YHOL 4I0PD 3VXTB 1R5IB 1I8KB 4M6ML 5I6XC 2C9AA 3QDMB 3BD3A 4IMLA 2X09A 5C07A 4APQA 5L2KD 5D7LA 1D5MA 4LLVB 2OYPA 1R3JA 4G42A 5IG7A 3MTRA 2E7HA 5E8DL 4X6FB 5GGVY 5SX4H 5C70A 4YGAB 4G8FA 3VXPA 2EDQA 4PS4L 4Y4FD 4BH8B 3HZMA 1CE6B 1QACA 3DVNB 1NGXB 2VIRB 4P2CG 5CCKL 4K7PX 3RAJH 3NCEB 4R4NC 3CPLB 2YD9A 1F4YH 2E9BA 3AAZA 4QT5B 2NX5D 3T0ED 4QRPB 3ARBB 3BZ4B 1DVFD 3O6FA 2JELH 4XP4H 1CFNA 5I73B 1JZ6A 3CUPA 3IJHB 2BXYA 4DEPC 2ZOLA 5AWNL 3C6SA 4WNQA 1OY3B 4UILL 2NY5C 2OZ4A 4I48B 1U58B 3ZHLA 1KIPB 2DBLH 4QRRE 4M61B 4NPYA 1UEYA 1IAII 1T1ZA 1MHCA 4YNYA 1IBGL 4K55A 1IFHH 4LVNC 2EDYA 2B4CL 5E8PB 4F9LC 2GJ6B 3P0YH 2BSSA 4BQ6A 1TQCC 2FL5B 4XCCL 2R2HB 4XCEB 1TMCB 3L3IB 2IAMC 4NKDB 3MV11 2X4RB 2ZCLL 2WWMD 1J5OL 1QRNA 3D9AH 3DX7B 4UQ2B 5D2LF 1NDGA 4LCIH 4MMXC 4JG0L 1G7JA 2FYYA 4JKWA 4CBPA 2X5PA 1MEXH 1CGVA 4NZUH 3CGTA 1KGCD 3LB6D 5IB5A 5ETUA 3H9ZA 4KMTH 3I9GL 1JV5A 4X5WA 1CF8H 5H8DA 4GG6F 3G04B 3PWUA 2H41A 3QEHA 2MJWA 4QGYA 4YBLC 2BVUA 1BJMA 3KXFD 1VB9A 4AEHH 1CLCA 3MRMB 1H5BB 3WNKA 4J8RA 3DOSA 1F4YL 1SEBA 2NY1D 4Q9QL 5JPMB 4UTAH 1QG3A 1RZJH 5EU4A 3GBLA 3ARUA 3NIDF 2IFFH 4DWHA 4RMRA 2AEQH 5MERA 2ESVD 5BXFB 4PRIB 3X12A 3PG2A 5KG9A 3C60D 2AXFA 4DK6A 1HYSC 4F37K 2BY1A 5DRNA 4KI5D 1HILB 4HKBA 4LRIC 5DHVB 4CVZB 5LGKA 1Z5LB 1F58L 3LDBB 4AQ1B 2X4TA 4WEBH 3DRQB 3D25A 1A02N 3NAAL 1MWAH 4QHMB 4AH2B 3ZT7A 2GQHA 2P7TB 4F7MA 3KYKL 1S9XB 3CXHJ 5I1JH 1CXFA 4KVCL 1ZHKA 3HG1B 3VXOB 1I3GL 2CD0A 3EAKA 4OJFL 4M6OL 5DJ6B 2QSCH 3GMPA 3TV3L 2YN5A 4DZ8B 4IRJC 5JA9A 1AGBB 3CZJA 5IW3A 1N0XH 5FKPA 3S36X 1IEBB 2BNRA 2DMKA 5GQBA 25C8H 1MJJA 5C07D 4JRYE 3WIIH 2R1YB 3SDDA 3F6IA 1RZ8B 1OGTA 3BYTA 3HC4L 4U1LB 2F5AH 1ORQB 1KIUA 3U0TB 5DFVD 2A9ML 2IAMD 5FO7B 4FFYL 1P6FA 2J6EL 3DXAA 4HW6A 2CRMA 1G7JB 2VR9A 4XX1G 4PJ7E 2JB6B 4HWZB 4I5BB 4NM4H 3NIFF 4Q6IA 1NLBH 1T03L 2P8LA 4MXQC 1L9MA 5E4EB 1KULA 1B6UA 3O2DH 1LEGA 1LVEA 4X80L 5IVXF 4JFFB 2R2BB 3C2SA 3SJVA 2K9UA 3QWQB 4L3EE 3MROB 4NZTH 5DJDB 2XPGA 3D85B 1H0DB 3GSXB 3LQZA 4OZ4B 2DD8H 1FLRL 3TCLB 4JPIB 2Q6WB 8CGTA 1WWWX 4XP6L 4CDHA 1DE4A 4JRXE 3RVTD 4GKZA 1F8TH 1IGTB 3PHQB 5DK2A 4L8BB 4N90E 2HVKB 3MLTB 1ZLSL 4I48A 4JFQA 1I3RB 2RFXB 4OLUL 1EEUA 1AXTH 2OL3L 1HH6A 1LDSA 2BOBA 4YQXL 4Z0XB 4JPIA 2Q6WA 2QQKL 5JW4R 5GS0D 1ADQH 3ETBF 4TSCH 3ARBA 1NFDF 5KVMC 4HIEA 3QIWA 4WUUE 1JYXA 5HHOD 5LGHH 1CGUA 5FKAB 4DGIH 2HAZA 5JW5A 3X17A 2BDNL 3PQYD 5I8KL 4N8VG 1JPGA 2EYTB 4BH8A 2HT2D 1G0DA 4Q6IB 1WSST 4RZCA 2JJTA 4CDGC 3JTTA 1NLDL 3O6KL 1A0QH 2FGZA 3RWEB 3NH7L 4Y5XB 3P0YL 3PABB 3EOBB 2X70B 1OW0A 4U1LA 2W60A 3QDMA 5C07B 3VXMA 1MUJB 1T6WA 4X9FA 4PRPD 3MUGA 5JORB 2GTWB 3IU3A 5IFJB 5ALCH 4JFHE 1BFOA 5C0CA 5HYFA 4FOMA 1K9TA 4JY4B 5ITBL 1WEJH 2FEDD 3SCMC 4BQ8A 5T5FH 1ZWIB 3SDXA 2ARJQ 1KCRL 5FUZL 3STZB 4U1IA 5JXED 5JHDB 5IFHL 4U1HB 2ATPB 2R8SH 3V0VA 3QXUA 1F2QA 3VXRA 4HUXA 4TRPL 1JYWA 1FVCA 3JV0A 3KAAA 5DMIH 5F7KC 1W0WB 4K7PH 5I0ZA 3C2AH 2IMMA 5JOEA 2G5RA 3EO0A 5IMMA 1VCAA 3VXME 5E5MB 1HOCA 3NH7H 4NFDA 4NP4H 5FF6B 2CIIB 2WMPA 2XNAA 3RL2B 5HGHB 2P5WB 3V6BR 3ZKXB 5C0JA 1QFWH 5F7FA 1II4E 3DV4B 4KUZL 4Y0GA 2DM2A 3ARBC 3EJYC 3CLEL 3TBWB 1FFOA 2NY2D 5BRZE 5FGCE 2VDQH 4GJTB 3ARPA 2Z9TA 3MJ6A 5HXMA 3DNKA 5CILL 1TJIH 5DQDL 4ESKA 1NC4A 2I24N 2Y7QB 3D69A 4JGJA 5B8CA 1IM9D 4YUEL 4QOKE 5DRZA 3S4SG 3ULUL 3W9DB 5D7SH 4PB0L 4F15C 3O3EB 4JY6B 2O5ZL 3UTTE 5I1KH 2DQUH 2UYLB 3HS0A 5FGRA 1QUNA 5F7YC 4X6CB 1A6UL 5IQ9A 3WS6A 1G9EA 3G5XB 3O4OB 3ISWA 4PY8J 4YHNA 3Q1SL 1PGRB 3D0VA 3RIFK 4F2MA 4MXQD 3D3VA 1UQSB 3O8XB 5KSVA 5F89A 1FL5A 2V7HB 2X1XR 4GRLB 1YUHB 5TE6L 2Q76B 3MNZB 5TFSL 3HR5B 1F58H 4HKXB 2Y4SA 1CIDA 1H3XA 3BVNB 2FD6H 3CVIH 5TDNA 4BM7A 1H3GA 4P9MH 4ZXBC 2DQCH 3PWPD 4Z7QE 2X40A 3C6LC 1Q9OA 1E6OH 2B5IB 3BWAB 1KACB 1MCCA 1PLGH 1RSFA 1UWXK 4P23B 1I1AA 4J2XA 4PREA 2D0FA 4M7KL 1S7QA 4CJ0A 4HS6B 1RZ7H 3VWJA 2K7QA 1HN1A 4EKXA 4PJBA 5JZ7D 1TZGL 2XFXA 3GNMH 4UU9A 2I27N 4L9LB 1Z3GH 2O61B 1HQ4B 4DGYL 5CP3H 1BJ8A 4KJYB 1PY9A 5GRJL 4WNQB 4OIIH 4LSRL 2LAAA 5IB4B 1Q94B 2EDFA 3QFJD 1ZA6A 4DKEH 4OJFH 4XPGH 3VGEA 1JK8B 5BS0E 3BUYB 4RIRB 3DYMA 3HG1D 1RI8A 3PWNA 1IT9L 2V2WB 4RFNB 5KZCB 3L1OH 2AKRB 4FQJL 2NXZC 3VFRA 1EZVY 3WIHH 1H3TA 1FVCB 5BVPH 4YFLI 5JW3H 5D7SL 3TPUB 1RK0B 2VISB 3BKCH 5ADOH 1YEHH 3PWJB 4JGUA 4LSQH 4MJ2A 1J1OL 5DYOA 3SEPA 3K4ZA 3PGCB 4Y2OA 2HLFC 3KHOA 1RULH 2A6DA 3D2UB 3OKOB 3QG6B 3VXNA 1LILA 4RFOL 4GRLD 4YHML 1I1YA 1WTLA 5C9JB 5DMKA 4JZNB 3SKOB 4LLVA 3T2QA 1KOAA 3FO2B 1AIFA 1T1XA 3VXMD 4WTZA 2D4FA 3T4YA 1P69B 1AR1C 1JBJA 4XWGL 4QRUA 3HRZB 2HG5A 4FTVD 3BP7A 1DQLH 4M5YL 2VDKL 3IJYA 5DRXB 3TA3D 3SJVD 2YPVH 4K3EL 4R90H 3D1MC 4Z7VA 4OLXH 3HI1B 3UJTH 2C7UB 1VA9A 4TUOB 5CIPB 1B0RA 3WN5B 3B9KA 1WFNA 3MO1A 1IM3B 5T3ZD 1FZJA 3MA9H 5GGSA 1A2YA 4GAGH 4XTRD 3QIBB 1J10A 4MCZA 3DGCR 4XWGH 1N6QL 4JFEB 4X9HA 5A2KH 2OZ4H 5I9QC 2WV3A 2FSEA 4P2OB 4TNWK 3GSQA 1U95B 4HXBL 1CFVH 3VGHA 2VKWA 4PRNB 5E03A 4YBHA 2D31B 5EZIL 1H3WM 1GVIA 4YXHL 1HHKB 2HFGH 2XWTB 3GBML 3MRBB 1GXEA 1RUML 4PLKC 4WU7B 4N0YH 3SGKC 5TDOB 3Q6FA 1FVDB 2DN7A 4Y16D 3LRGA 5GJSL 1N8ZA 2ZUXA 3ZDXE 4N8CH 4JFQB 4YE4L 1BREA 1M71B 2R69L 4UDUB 4OQTL 3CK0L 4K9EL 4FQJH 1P84K 1JGVL 1G7HA 5I9QB 3A6CL 1JGDA 2NY7L 1A7NH 1F90H 1V05A 2X44D 5E00A 1A6ZA 4LLQB 1T1WB 1AGFB 2ZZUT 3RNKB 4NM8L 2HFFB 5DZNA 5GSVB 5LAXA 5BW7C 2VLRA 4BFGA 1NUDA 3I50H 4UILH 4MAYD 4NHCL 3DO3A 4RRPA 2CKBA 3IB4A 3MJ8B 4GRWB 3SGEI 2OS7A 4PJAF 4Y1AB 1U2CA 4WI4A 3OJMB 2GHWB 3ARRA 4XP5L 1YMME 5E7FA 5ADPH 2FJHA 2NX5B 3TWCH 4X4YB 3M1BB 5ESQB 4PR5A 2F54B 3DYPA 4KRPD 3W0WB 1ERNA 1U8PA 5GJTL 3TA3B 5MENB 3NFSL 3OAUL 2QQNL 5KVDH 2WIIB 1ND0B 2H6PB 4MD0B 2H8PA 1JUFA 3JVGA 4LGSB 3IKKA 1OLLA 3VXOA 1WQVT 3QUKA 4WI6A 5HJ3A 3W2DL 3PHOA 3VFVB 2UZIL 2R0WH 4H5SA 4QHMA 4P2QD 2MQ0A 4GKOA 4U31A 1NC4B 3E3QC 3F5WA 3HE7D 1N64L 2VZ3A 5CINH 2ICEB 4BFEA 1TNNA 3H3PH 1XGRA 2R0LH 3TO4C 4X6BB 1E4WH 1AXIB 1UJ3B 3OKNB 2X4OA 1A1NA 1XCQB 2EC8A 1A9EB 1AFVL 1E28A 2DYPA 5T1MA 4UT9L 5HGHA 1MJ7H 5INDA 5JW4Q 1T5XB 5JQ6L 1FFQA 2JJWA 1EUTA 5DC0A 5F44A 2WBJC 5GHWH 1Y0LA 4JEGB 1KLFA 2QSCL 5ACZA 3L5WB 4RBPK 5EORH 4TQEL 4U1GC 2NXYC 1SYVA 1MCPL 3OGCA 4JANA 1RZKC 2OI9B 4Y5VA 3RGVA 5J6HB 5LQBL 3B9KC 4H0IA 5EUOB 1C08A 3KPSB 4U1HA 4WHYG 1YNKL 5E56A 4XPHH 4F57L 1CICC 3ILQC 4DQOH 4LRNH 5D70H 2CLZA 5D6CA 2AI0H 5IVXB 3W2DH 2NY0B 1CT8B 3FTGA 4LLUA 3RWDB 3PGDB 4RGMB 2W65B 1VGEL 2EICA 3C5JA 3O9WD 1Y6NR 4LGRB 5IW1A 2OJEB 4PJCF 1YNLH 5J57B 1P7QA 4NDMA 1BMGA 1SYSB 4NKOB 4S2SA 1UT9A 3V4VH 4FFWC 2NY4D 2AEQL 5J13B 4RNRA 2X4PB 3HZKA 4U4BA 5ENWB 4YDJB 1LMKA 2YMXH 3KDMA 4HIHB 2NYYC 4JO3L 3VWJD 3RVXD 1CR9L 3RTQD 5CS7A 4AEHL 2YPVL 4FTVB 4TVPL 1J8HB 3VCLA 1KN4H 1QLEL 1W72B 4HUWA 3RWHA 3GJEA 4L9DA 3V7MA 2GIYA 2YUWA 3T2NH 4L4TE 4R26L 3MPCA 3M07A 1UA6H 4XZUB 4Q9RH 4TSBL 2IJ0C 4KJQD 2Y06H 1GOHA 3KLAB 5H2BB 2H2SC 1QYGL 1MHHA 1FAIH 2EEDA 1DBBH 5C08D 4P4KD 1FG9C 1E0OB 3V9FA 2DLFH 3NN8A 4WWKB 1UA6L 3EYOA 3KLDA 4JFEE 1B4JH 5FCUL 2VZVA 3MLWL 32C2A 2YD4A 3K74B 4E0RB 2FWOA 1OTTD 5GSRB 3QO1A 4NN6B 5K93A 3BDXA 1WCBB 3VG9B 1HHJB 1YDPB 3MX0A 3P73A 4YDKH 1R24B 2VSDA 3FQUB 3TPKA 1VERA 1CVRA 1T6VN 5J4MA 3L6FB 1UVQB 4ODSL 2HJLA 2NZ9C 2QHRH 4BH7B 3QHTC 5B3JF 1NBVH 3UPRA 3OKDB 4P57B 3KPRE 1UCBH 3O2VL 4DEPB 3ZE1F 5C09E 1JNLH 3QULB 1A9BA 5IKCB 1R24A 3IDGA 1EEYA 4V1DE 5KBNC 1CE1L 3ARYA 1JTTA 5E70A 3VRIB 1Q1JL 1J8HD 2BNRB 4NWTL 1D5BA 2ZPKH 3QEGH 4XGZB 3A6CH 1RULL 2XICA 1KPVB 5FGBC 2ATKA 4OF5A 4OD3L 1MRCH 1FGNH 1FHGA 2IPKB 3PDOA 2NYYD 3RU8H 4DOHE 1Z0NA 4LP5A 4MDIB 5T3ZH 1T7WA 3VXQB 4PJIF 5TF0A 1NFDB 4GS7C 4YIQA 1K6QH 3IFPB 4TULL 1MVUA 1MLCA 3AS2A 3NACH 4MB4A 2P4AB 1IAIL 2GCYB 1CICA 2KDGA 5DEFB 4W6XB 5M7QA 2BXZA 3AREC 4Q58C 5AUMA 4Y8DC 3WFHA 4Y2DC 4NN5B 3GK8H 4PRDA 3MBXH 4U2YA 3NVQA 2OR9H 4R3SB 1GGUA 2FJFB 1DLFH 4OIAA 1MFEH 1RY7B 3QQ9D 2VN4A 3LN5B 1A14H 3U6RB 1K8IA 2YA1A 5DJYB 1DBAH 1A6AB 3FO9B 4R96A 35C8H 4M6NH 5TDPA 1NKOA 5CBEA 1OAQL 4GW5A 4PJAE 2IPTL 4N9OB 3ELAT 4JO4H 2V2XB 3WXVH 1MWAB 4NOBA 5J1SC 4JZJC 2B39A 4PV9A 4UT7H 3NCYP 4XMPL 3UC0H 1KCUL 1R3KA 2QEJA 2YXFA 3CLEH 4J3OC 4LEOA 4MJIE 4OCXL 3TBYB 2E6QA 1DDHA 4M5ZL 2EE2A 3FO9A 4HFUL 5ECJE 1CBVH 5TE6H 2DQEH 1XGTA 3PGDA 1ZOXA 5KAQG 2Z93A 3WJJC 3FQXA 5EZLA 5A3ID 4EN3A 3G6DH 5TPWL 1MJ8L 4NWUH 1EXUB 3BRGC 3JUYA 5C2UB 4N68A 1IKFL 1N3NA 1HWGB 4ZUTB 5DTFA 1EAPB 1V7ML 3OSKA 3KPNA 2O5ZH 4FQ1H 4XMPH 3UC0L 1EGJA 3BYYA 3U0PA 5DRWB 1P4IH 4OZGA 2N4IA 4XMLH 3EJZC 3LEXA 3PV6B 3B2VH 1OAQH 3FT4A 3ULSA 2HJFA 3HNTH 1KPVA 4YH6A 2IGFH 4JN2A 1XF2B 4HUVA 4KQ4H 3WFBH 3D9AL 4NN7C 5E8EB 1MHCB 4YNYB 2ICEA 5GGTL 5JA8B 5D1QD 5GZOC 5D96C 3MUHL 4X7DC 4RDQG 4ZYKA 1YA5A 1YEKL 5HY9A 4BZYA 5LKNA 1BFTA 5DJ0B 1R3IH 1JF5A 4M1GL 3RA7L 2CIKB 4M3KB 4IS6A 2X05A 5HI5D 1A7QH 3CVIL 3D18B 2AJUL 4F7PB 2R9HD 3OJ2C 4LHQB 1PG7W 3MLPA 1JPTL 3O6FB 4PJDE 4G7VL 1EEQA 2FX7L 5DUBB 5E5UB 4PGZA 2B1HH 2OK0H 2NY6B 4W6YB 1C12B 1FO0B 2D0HA 3CNKA 3BP6B 1WZ1H 4I18C 4OLWH 5IBUB 3QUMH 2WQ8A 4ZFFA 4HIJB 4NRXA 5D2NA 2B7DT 2YHGA 1YN7A 4WWKA 4EQ3A 3V5HB 2XWJA 3WNLA 4NQEB 2CKBB 1I8MB 5ISZA 4D0DA 4OLXL 4NFBA 2KQNA 2YA0A 3UTPE 1KB5L 2C1PB 3HI5L 4XP9L 1MCHA 3OB0K 1CU4H 2G75A 4IDJH 1U3HA 2BY0A 3OKLA 4KAQH 2V6HA 1JHKH 1S7WB 1I8KA 4KK9D 3WHE0 3IS0X 3F7YA 1KXQE 3FB6A 3ZE0E 1CFQB 1IGCL 5GS1C 1I1RA 1U6AH 3QQ4A 3V0WL 4NRZA 4FHBD 4HPYL 4WHTA 3MUY1 2YWYA 3SKOA 4HV8B 4OTXH 4PJ8A 4LFHD 1NAML 4K9EH 5ICXB 4PTUB 4KJWC 1A0QL 3F6LA 1EGJH 3BH8B 1FVDA 4XNYH 2NY5L 3NCJH 2VR4A 1KEML 4K2UL 4Z0BL 4YQXH 6FABH 3QUYB 1BM3H 1I7RB 4JJHA 4OLVH 4LVHC 2VZTA 2RHEA 1FC2D 2PO6A 3MLVH 1KJ2H 1UH3A 2DQGH 3TN0C 3ZSTA 1JHTB 1XF1A 4HWEL 3EO1A 1Q8MA 1MOEA 1BJ1H 2JB5L 4PJGB 1S9VB 5IEKB 3QNYA 1GC1C 1X4ZA 3FB8B 3T04D 3BN9D 3T3PF 3LS5L 4PRAA 4ORGA 4KGJA 1MNUL 3PHSA 1XF3A 4HGMA 5FDWA 5EG6C 3PXHA 4PRPA 4HS6A 3LQAH 4YWGL 3IJYB 3G6DL 4GXVL 1CFQA 2CK2A 2NY6D 3M8OH 5L88H 4I0CC 3TFKD 2EXWD 2VLMD 2GK0B 5ELIA 3EO9L 3INUH 1Y18A 1RIVH 2CSPA 5CHNB 4L4VD 4NUGL 1WBZB 2H9GA 2Y6SC 5D1XA 1YYML 3QFDB 3BD5A 4PGBB 4PTTB 3VXUB 5FYKL 4NQEA 4LF3A 1PBYA 2AJYH 3E6FB 3S88H 1NCBL 4OCWH 2BCKA 5AZ2L 1WF5A 3V4UL 3PWJA 3VFMA 3ROLB 4U1SB 3SGDH 5I1AB 3WFDH 1FZKA 4QXWA 1TNMA 4PJEE 5E1AB 5KSBB 3Q3GA 4JKKA 4RGOL 4OT1H 2OR9L 2FH8A 4Y5XC 3MOBH 4YDVB 1UCTA 2LAGB 1IJ9A 1OTUD 1X7QB 4L8SA 3V7AE 3BPCB 3IFLL 2BVEA 2NNAB 4KQ3H 2X10A 4PR5B 2VB5A 8FABB 3SY0B 4PBVC 3D69B 2Y7QA 1S7VA 5B8CB 3RY4A 5ESAA 1K6QL 1WC7B 4LCCA 1CXKA 5A3IC 4XCYB 5E2JA 4P23A 3UTTB 4LHUG 1Q9OB 1T20A 3BFOA 3N1QC 4D9QE 4Y5YB 4D0CA 2XNAB 3HFMH 2NY4C 2PR4H 4G3YH 1OTTC 2X9WA 2J6EA 4IRZL 3KYMB 1PEZA 2N56A 4ELKA 5GSVA 4MS8C 3I2CL 4U1NA 3HE6D 1FDLH 1IBGH 1QFWL 3IGAB 1I9JH 4YXKH 2CDEB 4I1NB 3D3VE 5D71L 3UEZA 4Z7UA 1ITBB 4CVWA 2ATPA 1X6LA 1JGDB 1NC2A 25C8L 3NPSC 4Q9QH 1CICD 1I85C 3KYOA 4F33A 5DJXA 4EOWH 3A67L 4GAYA 5BV7C 3QUZC 4OQTA 2VC2L 4PJDF 4YPJA 2WBJB 3FMGH 4KHXL 1NBYA 1XGTB 4N8VA 3HS0B 5BS0B 2YXMA 3FQTB 2DAVA 1KLUA 5E24E 2VUOA 1HQRA 2A1WL 4LCYB 3JV5A 4WEBL 1J5OH 1G7IB 2FSEB 4BA8A 2OX5A 1UZ8A 4JLRB 3WO3B 5CBEB 1I8IA 2GJZA 2Y36L 1D6EA 1NC4D 4O9HH 3BP4B 2Z8SA 4RDQF 4PTUA 5JHDD 4TSBH 4NNYA 3HA0A 1GGYA 4IIQA 2VDLL 4LL9A 5E94B 1A1OA 5C0JB 1U6AL 3QUXD 5CEZL 4U05A 5BZWA 2DQDH 4XPFL 4HJJL 5IK3A 1RUQL 2PO6D 2YD3A 2F5BH 4PRDB 1MI5D 4ZPTB 1IE5A 1RZJL 1JZ7A 5D8JH 4P2QB 2VDLH 3VJ6B 5EU5A 4XP9H 1AHWB 1PSKH 5SWSA 3L7FA 5C0DB 2YRZA 2IG2H 5K9OA 3LDBC 4OFVA 3WS3B 5I75B 2XRAH 4OI9A 4JO3H 1LO0L 4IMKC 5DMKB 1JFQL 4ZO9A 2RFXA 4YIQB 1HXMB 1H3VA 3VXNB 4YHYC 3KNBA 4L3AA 4NN5C 3MLTA 4U6XB 5C0CE 5I76A 1XGYH 2MFNA 4Y19D 4KMTL 3C8KA 5GGQL 4ODTL 3O6ML 4P3DA 1X5XA 5T33L 1EIBA 5EBLB 2APXA 3BP6A 3L5IA 3O2WL 3BOVA 2FX7H 1OP3H 3U7YL 1UADC 3D3VD 4XAWL 3TIDB 3T3ME 1EK3A 2XG5A 3RKPA 3A67H 1P84J 2FH6A 4ZXBB 3RWFA 5DWUL 3O41A 3O4LB 1G7PA 1BQHB 2PYFA 1VFAB 5B4MC 2H3NA 3B9DA 3LOWA 4OAWA 4ERSL 3CMOH 3P4MB 4U1KA 5IB4A 3BO8A 1R5VA 1JWSB 4HK3N 3DXAB 4PJ9C 1BX2A 3N1FC 4K23L 5IQ7L 1T7VA 3P9MA 3QI9D 4FZEL 3TIDA 3L7EB 3QO1B 4LQFH 2IH3A 1INDH 1JPSH 3QIWC 2BSED 3MACH 4LLDB 5CMAA 3MLYL 1X5GA 2D0GA 4R6UA 5T3XD 5HI4D 1J8KA 5MP6L 4M6OH 2D9QB 1BPVA 3GMMB 1PYWA 3FT4B 4RQQB 4TTGA 3L5XL 5CEYB 1ZANH 3M45A 3O6MH 3GSRB 2A73A 3RNQA 3RTQB 4HKXA 4XAKE 4Q74A 3TO4B 5CGTA 4GKZB 1OT2A 5AG9A 1F8TL 4G9FE 1MI5E 3GDBA 4HKBB 5GS3A 4OCWL 4XPAL 5KSUA 4ZPTA 3TIEA 2YD2A 3SJVE 5D5MB 3VD9A 2WNGA 4FTVA 3OAYK 4LVOC 3BGMA 5ISZD 2VZOA 4OV5B 2D4DA 5KSAA 4X4XB 5ALBH 1KCSL 1OGAA 4PJ8C 2ZPKL 2P24B 4O58H 5K9QG 5D2LE 4LCWB 5KN5A 4Y4FA 3QT2A 1T0PB 1MWAA 3FFCE 3L3HB 4X4ZA 4Q2ZB 3TEUA 4C59B 2FO4B 5GGUA 3TM6A 4XVUC 4IRSC 4KKCD 2BVPB 5C0FA 3GSUB 2F58H 3FN0H 3DUSB 3HAEA 4KDTC 5C6PB 3LIZH 3MFFB 5L8JB 3NMEA 1NAKL 3LN5A 3TYGL 5FF6A 4NM8H 2MKWA 3PXJA 5HGDA 4ZSOB 2L4OA 5FYJL 5KS9F 1CIUA 3ARFD 3H2WA 3MRNA 4UINL 4AH2A 2YA2A 2VC2H 3KHQA 3QH3A 3ZE2E 4Q0XL 4LMQE 4RGMC 4X6DE 4OD1H 5BOZG 1CG9A 4HS8L 5MP6H 1MLCB 5CJXC 4POYA 3S36H 3ZDXF 4KKAD 5HHPA 5IVNA 1L9NA 5D71H 3WJLC 5IHBA 3B5GA 2DQDL 3KYMA 4XPFH 3PP3H 5GIRB 1H3PL 5D7JA 3MNWA 1MCFA 2H32B 2X4NB 3GMMA 1BD2B 3MXWL 5T3XH 2EIDA 1MFCL 5T5NG 2LQRA 3GUTA 1A9EA 2VLRD 1IFHL 2JJSA 1PZ5A 4O9HL 1BGXH 5J3HD 5AYUH 2PTVA 4QHLB 3MRFA 3QDJB 4HC1L 4ZPVB 2Z92A 4LCCB 4M03A 1ZLUK 3OKMB 5EZJB 2JIXB 3U9UB 3EFFA 4EI5B 3TH3T 4OGAC 2N7AA 1AKJB 2W0PA 1BX2B 4E41E 1CDHA 5MI0B 2X7LA 3BO8B 5E6YA 5CJ5A 1OTSC 2HRLA 1UB6B 2DOCA 1I4FB 3QO0B 1T0MA 4XC3H 5T1LB 3BZ4A 3MLUL 3O41B 1SQ2N 3DURB 4CRPA 5JO5B 3JZ7A 4LVEA 2A0LD 1QR1A 5JW5B 1F13A 5T3XE 4EOWL 2ZG2A 3HI5H 5ESQA 1JE6A 5CCKH 4L4TB 2CUMA 5I1DA 3DHJA 5FXCH 5EZOH 2R56L 1WZKA 5J56B 4K3DH 4DAGL 2KQMA 1AE6L 4HZLA 3JV6A 1DVFC 3EDDA 4IRZH 2YBRA 4X7TA 3N9GL 2ZCLH 4M1GH 3RA7H 4JN1L 3OKEA 3HMXL 2B5IC 2BSSB 1CXIA 3TYFB 3UYRH 5TQ0L 4XZUA 2GJ6A 3JWNC 1FGVH 1MLBB 3IFOB 4LSPH 4ODVH 1KV3A 1G6RA 3FB5B 2DLGA 1JZ3A 4RFNC 4UV4H 5SV3A 4G80B 5CSBA 1WLHA 4PJGF 3D39E 5I74C 3CX2A 4GKNA 3IKCA 3CH8A 4WHYH 3RZCA 4IIQB 1G9MH 1ZLVH 5TQ2H 4HKZA 4M1DH 4J3XA 3ZE2F 1E4WL 4M8QA 4H8WL 2P8MB 4OLYH 3LVEA 1U3JA 3HE6A 5E8OA 3BGFC 4QT5A 1AQKH 3MRHB 2C3XA 5K9KB 1XFPA 2VDNH 3WEXB 3FQRA 5F1IA 2OJEA 5DEGA 4NKIL 2EDJA 1BF8A 5CJQH 4BFBD 3EIFA 3N0PB 4HGWA 4HWUA 1IC5H 3RWDA 2IF7A 4MA8H 1F4AA 1HZHH 4HKZB 3JV4A 1YMHA 3U46B 2XIDA 4PRID 3NCYS 1R6VA 5JPNB 3GSWB 4NUGH 1B0RB 1DEEB 4KDWA 3BKJH 3IDUA 3QIUC 1IM9A 1D5MB 1P7QD 2FO4A 5GGUB 1SM3L 2EDXA 2NZ9D 4PY7B 1IGJB 3QQ9C 3T4YB 2YKLH 4YHYB 3R8BB 3UBXI 2G75B 3WN5C 1V3MA 4PYHA 3V0AC 1T7ZA 3EKCA 4LHJB 4ZDHB 1YC7A 4S1QL 5JXEA 3VFWB 1MRDH 3OX8B 1ZS8A 4NT6B 5D96B 3LZFH 3KPRD 4RA3A 2X4OB 3H3BC 3IRPX 1RK1B 2PF6A 1XGRB 3HI6H 3RKDC 3TIEB 4ZFFB 5KSUB 4NBXB 5DSCA 3SCMB 3T65A 3RY6A 1KTDB 5D1ZA 4MNHB 2Q86B 3WFCH 4XBPA 2XWBB 4KJQC 3MRIB 2XZCL 4JM4L 3TZVB 2Z31C 5DLML 4ZQKB 1JUFB 3BZFB 3JWOC 4LLYB 1ED3A 2OR7A 1FJ1A 4LEXH 4OD3H 1U8NB 4I3SH 5AZ2H 2IADB 3UROR 1WK0A 3K46A 5F6HI 1DN0B 2CPCA 1JWMA 4UU9B 3QQNA 3VXSB 1NAMB 1R3IL 3PWVA 3GI8H 4ZUSB 3KPPB 1NAKH 4UAOC 3P9MB 4EZMA 4WWID 3X14B 4MB3A 2OXHA 5ITBH 4GG6E 4PV8A 3GI9H 5J11B 3NIDE 4A2MA 4Z18A 4KZDH 1J1PH 5IJKC 4JRYD 3T3MF 1T5WA 4M02A 1I8LA 5D1QA 2X1PA 4YDKL 3RVWD 2HVJB 2DQIL 4LSVL 5E8PA 5B8CC 2BNUB 1CXEA 1AGFA 2GKIA 2E8YA 3U4BL 3AB0B 4ZUTA 1UYWL 1ZGLP 3BJ91 2FEEI 1NGZA 4XVTL 1X6NA 4JJ5A 2FDBP 3S3JA 1L0YA 5DZOA 4GRWE 3WUZA 2P45B 4X8XA 3MC0A 2FO1A 3O4LD 3NFNA 2Q8AH 4ZUUB 4PJXB 4CVXA 4WDIB 3QXAA 4O2CB 3PUCA 3S36L 5I6XB 1CFTA 1QHPA 2GUOA 4JRXD 1IEAA 5D7JC 3GMOA 5LBSH 4NZJA 4PLKD 4YFDB 4JHBA 4IOFC 4OLYL 1I7RA 3T65B 1MCBA 4N5ED 1S78D 1AY1L 3ARQA 3SDAA 1QKZH 1A2YB 4U1JB 4NT6A 4P5TB 3SDDC 3UO1L 1K8IB 4Y4KA 4HIIA 5CUSH 1QEWB 1QO3A 4XTRC 5IROC 5EC2B 3P11L 3QAZB 4WHTB 1AP2B 5DZLA 43CAA 1YY9C 5FHAL 1IAMA 1A3RH 3EYVA 2BSTA 3VXTA 3HRZA 3SN6N 1G7IA 3VE0A 5IIEA 3QG7L 5EIQA 1DBML 4X80H 5DEFA 3ZKXC 5D7IA 4EUPG 1A4KA 3QZWB 4JN1H 2NMSA 2ORBH 2DTML 2C1PA 3OKEB 3VFPB 1CL7H 1DQMH 4R2GB 4X7TB 4D0DB 5ISZB 2K3TA 5C92A 2ERJB 4GBXD 3RUGA 2BSRB 3VMNA 3VA6A 1FBIL 4LLAA 3MRPB 5DYOB 4DAGH 2E7CA 3QEQE 2OTPA 5H35B 4AIZB 2RIKA 1E4KA 1D9KD 3DUUB 2I60H 2GITB 4OM1L 2VERN 4PJIB 2PTTA 3MREB 1FP5A 3IXAA 3EGSB 2F19H 3LMJL 3MRGB 2R1WB 5HVHC 3G6JA 4PJGE 1F3DJ 1T04B 4XC3L 1DBMH 1EJOL 4HWNA 4MAYA 3RWEA 3OBAA 2HJKA 2IPUG 4G5ZH 1RIHH 3W9EB 3GEWB 3SBWC 5JNYA 1WBXA 1OPGH 2CUHA 4RGNC 4XI5D 5F9WC 2R0LL 4PV8B 1BFVL 4CADB 5I73C 1P7HL 3H9HA 2FRGP 4FQIL 5DA0B 3G5YB 4Z7WB 2WSKA 3FO1B 3B2VL 3HMXH 2O93L 4QXUL 1BECA 3VMOA 2DQCL 1BAFL 1DN0A 5F1OB 8FABA 2GJ6E 4B7IA 4DVBA 2VH5H 1M7DA 3KPMB 1BD2A 5I0DA 1CDGA 1R0AH 4ZD3L 5CZVH 5TQ0H 4C54A 3CVHB 5TE7L 3AY4A 3U0PB 2ADGB 3Q3GB 3TJHC 2IQAA 1XF5A 4R2GD 3PJSB 4FS0A 4PUBH 3QNXA 2VQ1B 3WS3A 3STLA 2X9YA 1Z9OA 2ED9A 5DQ9B 1RZFL 1U91A 2VDRH 5ID0B 1YQVH 1SBBA 1RZGA 4Q9RL 2WANA 4ZO7A 4X6CA 3CMGA 2AABH 5EZLB 2VABA 1KCUH 4MLIA 1JNLL 2AJVL 3ET9F 1WAAA 3NFPA 4PB0H 3CH1A 4UNUA 1KN4L 3DUSA 2RCSH 4YHPB 1OSPL 5EA0H 1N5AA 1EFQA 3MLSL 4G9DA 4NO2A 4P5KA 5EU6A 3UYOD 4KZEH 2X4SB 4L4VB 1RJZA 4AIXA 5H37G 3REWB 5AYQA 4PV9B 5HYJE 1AKJA 3BKYH 1T80A 5JW4N 2V2XA 5I8EA 2JIXA 5IMKA 2DQJL 3QHFH 3EBAA 4PRPB 4Z77A 3CK0H 5EIVA 1FFOB 3DBXA 5KSAB 4BFIA 4KV5F 1LO2H 5IW1B 5IB3A 1GH7A 4LKXA 3GUTB 1R3LB 2VDML 4DZ8A 2W65A 2F53A 4PRHE 1WT5A 1C7SA 3DROB 1MCSA 2HLAA 2D7TH 3ARGD 4WW1A 4K7FB 5CJOH 4I3SL 2ZUVA 5IOPB 3CXHK 3MXVH 5EU7E 1T7XA 5IFHH 1TJGL 4G6ML 2WM0A 3UBXA 5AAMA 3T0WA 3MJ9H 2X4TB 3A0OA 4GBXC 4XPBH 5DD0H 1W0YT 4N0YL 4ONGL 4K8RH 5ILTH 3IFPA 4Z6AT 5BS0D 5CEXB 1BJ1J 1A6PA 4APQC 4J7RA 4QWWD 5IEHA 2CLRA 3OR7A 1MY7A 3NPSB 3C5ZB 3NIFE 4PRIA 1OQOA 1KPRB 2AXHA 2VQUA 2QBWA 3C6LD 5FOBA 3CXDL 1D5BB 2P5EE 4RMSA 4WIQA 3RPKA 3VRIA 2EC9U 4LAQL 3BRDA 4QRRB 5HYQB 4MX7B 2V9QA 2XTJB 1I7UA 4QHKI 2FB4L 5HJ3B 1KENH 2B1AL 4BH7A 1FNAA 4XPAH 3MZTA 4H88H 1T4KA 1BBJA 1REIA 3NOIA 3M8OL 3IXTA 3BMWA 5L88L 5L6YH 4F9PC 4JPVL 2AV1A 5FGBA 3NFPB 4Y1AD 3G04A 3E8UL 2J8HA 4XNMB 1FC1A 4XAWH 3MRQA 4L3EB 5I18L 3IAQA 4UQ3B 2WZPD 4HT1L 1UFUA 1RZGB 1BBDH 3RVUD 3JSSA 4L4TA 4U1SA 3L3DB 4NC0B 3IETB 2HT4C 1RMFL 5CZXC 4HIXL 3VW3L 4JRXA 4WW2B 2P48B 2OJZH 2HTKC 3RP1A 2W9DL 4XNMA 1XIWD 3SE8L 5E8NB 1FNEA 4D9QD 3LPWA 2OP4L 3AB0C 2P44B 2X89D 1T2QL 1D6VL 4YHLH 5C09D 3UYPA 4IS6B 2VLRB 2BRRL 2CIKA 3I85A 1MWAL 1PYWB 4MGXA 3MGTA 5CEZD 1M6OB 1ZSDA 1CDJA 3LKOB 1A6VH 2DWDB 1D9KC 3R1GL 1C5BL 3MYJB 4AEIH 3SHSA 3NCJL 1N6UA 3QWOA 4P2QA 3DX9B 1CR9H 4CMHB 4YPGA 1XF2A 2CRZA 3VCLB 2E9JA 3MV9E 4HCRA 3RDTB 2VDQL 2P43B 1H5BC 4NNYB 3VD7A 3ARGA 5JMRA 3VG9C 3RZWA 4M7KH 2A38A 3H0TB 2Y36H 4JRYA 5DR5H 3QI9B 3LS4L 3EYSH 3VXSD 3ZTJG 1CDBA 5L2JA 1NUGA 4Y4KD 3LAFA 2C4FT 4YDJA 4NKMA 2MQ3A 2R1WA 4PJEF 4M4RA 1GPOH 5C0RL 4PJIA 4ZFGH 1IEBA 5DMYA 2PW2A 4NNPL 4LPWA 4PPTA 3UX9B 1YEEH 4FABH 3C60B 1B0WA 1DQQB 2YUZA 3GMPB 5I16A 4NNXA 1P1ZA 2D03L 4GOSA 2IG2L 5LXGL 2YZ8A 4X9BA 5JOPE 1PVHA 1MRFL 4XBGB 5IROA 1MCJA 3LKRA 4LSSH 1LNUA 3B5HA 4QWWC 4RCAA 5D7LB 1SYVB 4JANB 3RGVB 4CVZA 2F53E 3NZ8A 5ITFB 3IGAA 1RJZB 3GHEH 4EDWH 4ZTPL 1BWMA 1TIUA 2Z8RA 1OGAB 5IMOA 3C08L 3R0MA 3TVMB 2NY5H 4B50A 1NMCC 4ZAKA 1P2CA 4M1CC 4HC1H 3RIAF 1XGQB 4O5LL 3BZDA 2VLJE 1JRHL 1QOKA 3D2UA 2P5WE 4UV7H 5J13C 4OZFB 2WBJD 1GC1L 5DQJA 1LDPH 3OKNA 1LP9E 1DBJL 4JFDE 4W4NA 1AI1L 5KS9A 3AS1A 1SY6A 1RK0A 2VISA 3EUUA 3FQNA 3UMTA 2KH2B 1FYTE 1C1EH 4NJ9H 1CFVL 3U0WL 3ZT5A 2AKRA 4TNVK 1VFMA 1E4XI 4RA0C 2J8UF 2JCCB 3EDJA 1N6QH 1JK8A 3QXDA 3NIGF 1J0ZA 3B9VA 4P2QE 4ETQA 4MD0A 5IUSA 2Z35A 4C55A 1SMOA 1QTYT 4X5WB 4KK8C 1PY4A 4JG1H 4GAYB 3S98A 4KMQA 4Y4KC 3HCVA 1X4YA 1AGCB 4J1UB 1QA9B 5CJBA 3DVGA 1G7QA 4JFFE 4TOYH 4PGJA 4J3VA 2R4SH 3BQUC 3DX7A 4HEME 5I15H 4ZOEA 3C6LA 1T3FB 4NKDA 1T66C 4CKVX 2XT1B 3CX5K 3X3GH 2QKIA 4OM0H 4JZOA 1J0KA 2ZUYA 4UT7L 3ZKQD 2GY7B 4PGCB 1JGVH 4JZJA 3ZL4L 2HFFA 2VYRE 3CJJA 5LAXB 1Q0YL 3S9DB 3VWKB 1EAPA 1JL8A 3IFLH 1A6ZB 3FT3B 3OKYA 1KIRB 3SKUD 1DBAL 5ICZB 3MOBL 4P3CL 4F2MB 4LVOB 3MRLB 4OIBA 1GRWA 3AMLA 2HTKD 4KHTL 4NZDA 3WSQL 1YJDL 1FAKT 4R97B 1BIHA 3IDMB 4Z7NE 3RUGB 2HKHH 2HN7A 3UTPD 1BLNA 3Q5OA 4L4TD 2NX5E 2XWTA 2DQGL 2VNCA 2YUXA 3LIZL 3VRJA 3SBWA 5KVEL 4MQ7A 5L2KB 2FX8H 1X5AA 1SJHB 4MDJA 1QBMH 4JFDD 3W9DA 5IBLD 5FUOL 3L5XH 4F58H 2I9TB 3FFCD 5CD3A 4JM2B 3OGOE 1O0VA 3FQNB 5B3JE 1I1FA 4XRCA 1Q0XH 1VEMA 2FX9L 4EUPB 5TPWH 3H42H 2NTFA 4KKCC 2XY2A 3AC0A 5A43C 1U8MA 5GGSB 5LJYH 2BHZA 4G8FB 3ZL4H 2APVA 2AJYL 2B1AH 4HUMB 5FK9B 3TN0D 1QR4A 1Q0XL 1UXSA 2ZOKA 2LU4A 4AEIL 2HH0H 1I1FB 4XRCB 5A2JH 2F5AL 3LN4A 4XXDB 2VE6B 3ZDZF 3FB6B 1IGYA 3CSYA 3P40A 3T8XB 4KVNH 4XH2A 4P49A 4H26A 1CICB 5FYKE 4DKAA 2P5WD 3EOTH 4P46B 5ICYA 1TFHA 4M6NL 2Y5TA 3GB7B 3WE6B 5BQ7B 4LDLB 1NUFA 4ZUUA 1CT8A 4KVCH 3QR2A 1KEGL 2BNQB 1GZPB 4H8WH 3KXFE 3KPQA 2A83B 3LHPH 4OLWL 5DJXB 3ARFC 4F33B 3ZDZE 4FXKA 2Y5TB 2PW2B 1N59B 2EIZB 2J88H 3GGWB 4JDTH 4XX1E 4AENB 5BJTA 1S9YA 4XVJH 5CKGA 4M8VA 5KTEL 3G08B 4X6CE 2NW3A 2QHLA 4X83A 3OAZH 4QRSB 2O5YL 4OZFH 1H8OA 5I1EL 4V1DD 5JIHA 3OKDA 2HH0L 2QADC 4P57A 4QYOA 2VJXA 2I9LB 2ADFH 5BZDA 4L8DA 3FRUB 4U2ZA 4P9HL 3O0RH 4QRTB 1BVLB 4KU1A 4HV8A 4GFTB 2RB8A 3N9GH 3O8XC 3EOAB 1LP9F 1FL6B 1JVKA 1I1AB 3VXSA 3U48A 1AE6H 4JM2A 4NOFA 3EDKA 4P4RA 3HCVB 1BHGA 4PBWD 5L9DH 3SDYH 1BOGB 1CDYA 1UH4A 4OLZH 5F1NB 5EZOL 1OTSD 4RAVA 1X7QA 1HH6B 1XGYL 1MQKH 1NBVL 5D72H 2ICCA 3HAEG 3HR6A 4RWHA 4MZ2A 5DHXB 5I8OH 3GI8L 2FLBT 5E8NA 1FZMB 1YEEL 3G5ZA 4FABL 2MTPA 1OQXA 1C1EL 2OTUB 4X4YA 1OM3H 1NQBA 2ZSWB 4P23D 2FJGB 1EO5A 4M7ZB 4JVPA 1BZ7A 1MFBH 3RI5K 5DT1H 3BQUD 3NTCL 1W0VA 4K2UH 4OZFA 1A6TA 3EYQC 1D3CA 2EDBA 5BVJB 1IL1B 5CIPH 4PRIE 4OTXL 1NFIA 1UB6A 3O3EA 5HYSG 2Y06L 5E8DH 4ELME 1X5IA 5DGQA 5L7XH 2NXZB 1LDPL 1R3KB 3V0WH 4L3ED 3NZ8B 1EFXA 2Q87A 2AEPH 2P49B 5FUCC 4JQVA 2D7NA 2AJXH 4GMTL 4HLJA 2DBLL 4XVSL 2W91A 5IVOA 5IMLA 1ADQL 1MH5A 5IHZA 1VKXB 4QHLA 4LFHG 2NY1B 2IBZX 3FOMB 2UVFA 2RR3A 4NO0D 1VDGA 4OCYH 3SDCD 3OZ9H 1OB1B 4LSSL 5IEHB 2WUCL 2MCPH 3V52L 3BMVA 4NKQB 2WW8A 4GS7B 1ACZA 3T2OA 4KUCF 1CG9B 3GSVB 3RAJL 4RMTA 3GSQB 2H26A 2OK0L 3F8UB 4U0RC 3TJEL 4GG6B 5F88B 5DD5L 3BDBA 3QUMA 1RIUH 5DRNB 4YXKL 2LVCA 4M8QB 1XR9A 3CU7A 5JHDE 1CLZH 2WUBL 2PCPB 4JY4A 1JWUB 2D3VA 4I0PC 2OQJB 3V4UH 5HPMB 5TJWK 4XBEL 3HE6C 4MJ6A 3V6FA 5HHNA 4ZAKB 4AEFA 5FECA 2OL3B 1OWRM 4RX4D 5IMOB 4FFYH 4PJXF 2XKNB 4NQSA 4XH2B 3S37H 3B6SA 3OJVC 3DX9A 4MAUL 1EFXB 3S8WA 1TTUA 4HK0A 3O2VH 1GJIA 1D6VH 5AZEL 4Y5VC 2EDNA 4X4XA 1ZT7B 1LO3L 2LTQB 3OKOA 3QG6A 4IOFD 1QVOB 2V5SA 5L0QB 3OPZL 1S5IH 1HXYB 4EVNA 5ESVB 2WLYA 2JCCF 1IGFH 5HDLA 1DJSA 3BE1L 2ERJC 3K2UH 5CD3B 3Q5YA 1FV1B 4C58B 1SJEB 3DIFB 1M7IB 4Y89A 1A7PH 4CU8A 2GCYA 2FHBA 5JXAL 3LEVH 4LSDA 4YFEA 2MWCA 3FT2B 1MEXL 4IEFB 1SJXA 4TTDC 3O4LE 3RWJB 5DF0A 2DWEB 2J5LB 4IM8A 1LEIB 2DQTL 1C16B 3FOLB 5CLWA 3MODH 1QSVA 2XFXB 5FHAH 4YHKH 2Q8BL 3TC9A 3LV3A 1X5HA 4NJAL 4S1SH 2R0ZH 5EBMA 4V1DA 3K4AA 3NABH 4HUWB 3RWHB 4QOKD 5I19H 4GXVH 4ZNEE 3HPJB 1EPFA 3ARWA 1PZ5B 4E41A 2GJJA 5BRZD 4DJMA 4CADA 1KPRA 1RU9H 1FCCA 4NRYB 3U7YH 1M6OA 3MRDA 1A22B 1HKFA 2AERT 4PG9A 2IAND 3X3FH 3NABL 4U1KB 3R8QA 2VLME 4C83A 4HPOL 4UMGA 1L6ZA 4HS3B 5T1DL 4YZFE 2AQ1A 3MRGA 4RAUA 2OJZL 3SE8H 1PDKA 3MRRA 5A2IH 5FKPB 2FWOB 4D9RD 1A7OL 5CJOL 1F2XK 1KXTB 4X6CF 5EFIA 4EN3B 6FABL 2ICWI 1J1OH 4KMLB 1K3ZA 4YE4H 1WWBX 3WJJA 2BX5A 5D6CB 4R26H 2KL6A 3THML 3MFFA 3E8UH 2HWZH 4ETQB 4OD1L 4GKSB 3VA2C 2VO5A 4MHHI 1R0AL 3QHFL 2ITDA 1DDHB 1FSKC 2I26N 3ZLQC 4H8WC 4ZS6D 5C0DA 4KJWD 2WBKA 3WUWB 3B2UC 3HI6L 4U7SA 1FG2B 5KVGL 4QHNA 3U1SH 3CLFL 1TVHA 4KH2A 3NPZB 1CU4L 4IDJL 3LRHA 4PJHE 4ZOBA 4KV5E 4OFPA 1AFVH 3RL2A 5JIPA 2VITB 2HMID 5E94A 2COQA 4FQHB 4PFEA 3KJ6H 3U1SL 3GJFK 1HEZA 1B4RA 5J89A 3RJDA 1CL7I 5F72S 3ZKSD 2NTFB 1MI5B 2RCSL 3FFCB 1FG2A 5F88A 5DO2D 3BKJL 4RNRB 4TVPE 3DGGB 1GPOL 5C0RH 4FTVE 1CF8L 1HQRB 1SYSA 4OQ1A 4P5TD 1XF5B 4S2SB 3SE3C 3EZJB 3V4VL 1KLUB 3TN0B 1ZLWH 2Q20A 1N0LA 4WI5A 4RRPG 3T1FB 2YD6A 3SQOL 1T7YA 2J1KA 2YPLE 5DI8A 3F12B 2V2TA 5C7XL 3BQUA 3WFCL 3LKSB 1U8QB 1DBJH 1Q72H 4FNLL 3C60A 3HZYA 1BD2E 4EIZC 2FECL 3MRLA 2AK4D 4LSTH 2Y07L 4U7KA 1WAAF 4UNVA 5L8KB 1XEDA 4HQQH 5HHOB 3QPQD 1J12A 5HI5C 2WAHA 3FT3A 4E41D 1UZ6E 3PABA 2DQJH 3EFDL 1D5ZA 4XB8A 4D9RE 4I3RL 4UTBH 4WUKH 1WBXB 2YK1L 4EN3D 3UPRB 3UTQA 4BKLA 4HBCL 1SBSH 3QNZB 5HI3C 4HDIB 1D9KB 5I66B 2XTJC 1NMAL 4L29A 3CH1B 1FO0H 4NQCE 1NCDH 3FFDA 3SKNB 5J6GB 4HUKB 5F71A 4FQLL 3U9PL 2AS5M 1TXKA 3SDCA 2XQBL 4JO2H 4KUZH 3DVGB 3QWOB 1U3ZA 5HHME 4NZRL 3UTZB 3STBA 32C2B 4YBLB 3D0VB 5EBLA 1BVKA 1JWMB 5GGVH 1S7VB 3QIWD 3UJIH 5D1XC 1GIGL 2IAMA 4PJEA 3KWWB 4XBEH 3DWTA 4OB5H 5C71A 3BPCA 3C2AL 4NBYB 3GBMH 2AJZA 1I75A 3S88L 1MFAH 1TVBB 3MJ7B 1S5HA 4JFZH 1LE9A 2JCCA 3AMKA 3TZVA 5D7IB 1OARL 4NYLB 1YYMH 4NZRH 4RSVA 5F1NA 4B0MM 3T77A 1EV2E 3CPLA 1FRGH 1NGWA 2AP2A 2FJHB 1T83C 3MROA 3L3JA 3JWOH 2NR6D 1WUNT 1WFTA 4MZ3A 3EZ8A 5B3NA 4K7PY 3QIBA 1F42A 4MCZB 3W0WD 3H7BB 1NGPL 3PP4L 1S7XA 4ALAH 2DQIH 1CD0A 1A1OB 3B83A 1JGEA 1NEUA 2APFA 2I9LA 1SY6L 1MF2L 2C7UA 4TUOA 4HIHA 1PKOA 3M17B 1I8IB 3DMMC 3BP7B 1W0WA 1F4WL 2ZSVB 3G6JB 4ONGH 1BP3B 3UO1H 3UYRL 5GJSH 3LKNA 1CTOA 1TJGH 3ESUF 3FO2A 5JW4M 4NHUB 2DIJA 5AG8A 3BEWA 2LVEA 2EDOA 3IDIB 4HMCA 4N0FA 4OM1H 1OSZA 4Y19E 4FXKB 5MEOA 3TH4T 4YR6B 3LQMA 4N8VB 1DBKL 2VUYA 1TETL 4HT1H 1GGIL 2BSRA 2QQNH 5KVDL 5KJRH 4HJGA 1DQQA 1XR9B 3W39B 1YNTA 3KYOB 4XNZC 1LO2L 2H32H 3RPIB 2PYEE 2Z4QA 4XNQA 1HK6A 1NGZB 2IEPA 1J7VR 1KEGH 3SE4A 1HHGA 3MLUH 5HVFB 1UKSA 1OF2B 4DUVA 4XAKD 5BOPA 5FYJH 2BSTB 1CGXA 2DB8A 3MQIA 4JFOA 5J06A 1UACH 3P77A 3TYGH 3EOTL 4HJ0C 4MD5A 2R0ZL 3CFKA 5HYEA 2E7LA 3O81A 3RDTD 1XCQA 4BFIB 3ARXA 4PJ9D 1TENA 4FP8L 2W1NA 4GW1A 1NBZB 4EUPA 4ZUSA 2HT3C 4ONFH 3VD3A 2J2ZA 5EN2B 5ISZE 2W0FB 4JAMA 5EWIH 1M7XA 1HE7A 1U3HB 3OB0H 2BOBB 4NO2B 5EU6B 4AL8H 3W0WE 3P30H 5SX5H 2B1HL 1YNLL 2ENYA 4GW4B 5DD3H 3O3AB 4PP2A 2XKSA 5HYSB 4XCFH 5DJZA 1AD0A 1D5IL 4I4WB 1VPOL 4Z95L 4S1DD 5F97E 2AI0L 2R0KL 1TQCB 4YBQC 2ED8A 1LK3H 3S4SB 3ULUD 1FE8L 4R7NB 4XMKL 3O3AA 3UTSE 4NQED 4EDXA 1MCPH 2AK4A 5CD5C 4DVRH 1JZ5A 5I66A 4BELD 3U9PH 3QO0A 5T1LA 4HWBH 2IC2A 1RIHL 3RVVC 5MEPB 1LP9B 5DD1H 1RUAH 5E1HB 5BW7A 4FQQA 2IANA 4ZNCD 3MACL 2DI9A 5EOQH 4ZAKD 2B2XH 1GZQA 4H20H 1P5UA 4OZHA 4NQXA 1HQ4A 5F1SA 5GRVL 3U0TA 3ROOB 1P4IL 1NCWH 4R4BA 4DGYH 3V6OE 3T0EE 5AEAA 1BQSA 1ETZA 2IQ9H 3QDGE 1DEEA 4WI7A 4ACPA 4HQQL 2Z8VC 2J8UE 2CIIA 1SVCP 1Q9KA 1OAZL 3SOBL 2R2EA 5IESL 3LKSA 1PX3A 1RV6X 3TZVD 3DETD 3SE3A 3MRBA 2VXTH 1X4XA 3Q1SH 5FB8A 2QL1A 2VDNL 4M00A 1WVZA 3EHBC 1G0YR 2IH1A 1AJ7H 4X6EA 3MLXL 4BQBA 4M5ZH 4U1IB 3I6KB 3ILQD 3RPIA 4QKXB 1CE6A 3QYCA 4O02L 4XVSH 1CXLA 2MMXA 2WUCH 3DTXA 4RMWA 5HBBA 4YHZH 1K4CA 4DW2H 4RWYL 4Q6YA 1L7IH 1YJDH 3QFJA 3WE6A 1V5JA 3AREA 2VXUL 4FZEH 4GKNB 4YDLB 4G8EB 1TVHB 3WO4B 5FA4B 1GC1H 3ME0A 1KCVL 5DRZB 3GIZH 3WFZA 2V7NA 5JTWA 1QLRA 4PY7A 2A9NL 4PJHA 3KXFA 2Y07H 2A6KB 3GKZA 3M17A 5EC2A 3KG5A 4DTGH 3PE9A 3TBSB 5DT1L 3BESR 3BUTA 3HNSH 3MXWH 1OD7A 5T3XL 5K9JL 4PIRF 2FX9H 2A6DB 5D93C 1JNJA 1G9NH 2NY2B 3RY5A 1KCRH 2EEAA 5FUZH 4Z8FL 3VXRE 1NCAL 2FEEL 1JPFB 5KW9L 2F8VA 3GJFA 5ADPL 5GS1A 4MQ7B 1CFTB 1LE9B 1QR1B 4LNVA 2E8ZA 4KRPC 2X9XA 3HZVA 1AHWC 1H8SA 1Z2KA 3QG7H 5DMGD 1CE1H 5F9OL 4BSWB 3BX7C 4ONHB 3L3KA 2GYSA 3CFCL 4X6DB 2YD7A 5D93B 4HX1A 1HYRC 3DO7B 4JJ5B 4MYWB 1MHPH 1ADQA 3SDYL 4MA7H 5GS0C 4KROC 1Q0YH 4X99B 4V1DB 5B39G 4YC2C 1QHOA 3NA4A 5HTSA 4AG4L 2HFTA 1MCRA 2PN5A 1LEGB 5BMFL 1MLBA 3DO7A 4NJAH 2FHCA 3BVNA 2ZOLB 3W9EA 2X4QA 2A0LC 4L5FL 1D5XA 4OAWB 3GMLA 1NL0H 2ZCHL 4HZLB 3R1GH 5EU3A 4U1MB 1QD0A 3BEVA 1OP5H 5FKAA 2BNQD 3RL1A 1VESA 4Y4HD 3PWVB 3ARDD 3WUWG 2OCFD 3DUUA 2OP4H 3O2DA 1J86A 2R56H 2B20A 2VIRA 4KK5C 4P3DB 3KLSA 2Z8WC 4HMEA 2Y1VA 4U7MA 1QFUL 4FXGB 3UZEA 5I1JL 1XGPA 4BYHA 1WIOA 2DDQL 5D9SA 4F7MB 4XP4L 4LRIA 3MLZH 4LHUA 2DL2A 3P9WB 3GBNH 3MRKB 1MREL 4ELMF 4XBPB 1NCTA 2EDDA 3VWKD 3AXLA 4TSAH 5CGYC 1EX0A 4MAYC 2ITCB 3P0VH 2XZQL 3FFCA 4IRJD 1XR8B 3QP3A 4WJ5B 2HYMA 5SWZB 4XHJC 1S7RA 4JDZA 4AZ8A 1F3JB 1QO3B 2LU7A 3OX8A 3ARFB 3N85L 3U6RA 5F7MC 4KTDL 2Z0BA 2OXGA 1IQDB 4EDWL 1I3VA 1IQWH 4LBEB 1N7ML 3EO0B 4WI2A 3MJ9A 4WI3A 4WJ5A 2FZ3B 5HHPB 4XVJL 4NKIH 2BOCB 5C0BB 1DQJB 1MAML 5ID1A 1YEHL 1A6WH 5DJAB 4Y19A 2QR0A 4P5TC 3SDDB 4F8TA 3BIBX 2CKBL 4H0HB 2YR3A 4XNXL 1QP1A 2OMBA 4U6VH 1AO7B 4JFHD 1OAKL 5IOPA 4YHLL 4LSUH 5TQ2L 4LLUB 1XGPB 3I9GH 4UBDC 1DCLA 3NCCB 2CR6A 1S3KL 4HBCH 1C5CL 4OIIL 1XZ0A 1VACA 4OCYL 1JGUH 5JMOC 3QUYD 5IHUL 1TZGH 5IQ7H 1IKNA 2FGWL 3WHXA 3V6OA 4GBXB 1L4IA 2EXYD 4WTXA 5LWYL 3P30L 2BMKB 2W9EL 3NIGE 4Z7OF 2HKFL 3ARED 4I13B 4Z76B 4D2NA 3EYQD 1UM4H 3GRWL 3QEUA 5HGAB 1U36A 1F45A 2APWA 5MEPA 4KJPC 1HINH 4DUXA 4X4ME 2FD6L 4UDTB 4JR9H 2WBWB 2WUBH 3ULUF 1N5YH 1UJ3A 3HNVH 4HFWB 1J11A 5D5MA 3MV7E 4HH9B 2R2CA 3O6LH 1ZHLB 3QDJE 5EU4B 5JPMA 2FIRT 3K2MC 5J8OA 1U58A 1MFBL 3HMWH 5DJZB 1PQZA 4E42B 5FIEA 1I3RA 1I7TB 1U93A 2H2PD 3MV9A 4MQTB 1FNHA 5CEZE 2V9TA 1JV5B 5I1KL 5D2NC 3JWDL 4HMDA 2ZCHH 4UV7L 3VFSA 4MNHA 1G9NL 4NQCD 1KYOJ 1GSMA 1J88A 1NKRA 3HZMB 3CDGB 2R29L 4KROD 1F02I 1EBPA 1HIML 2ARWA 1D5XB 5E2VH 3I75A 4JPWH 4M7LL 4MD4A 2VDMH 3T0EC 1HDMA 5MHSD 4DN3H 5TE4L 1I7UB 1YN6B 4M6MH 2A6KA 1G7PB 1IAOB 2PYFB 3ARDA 1BFVH 2ID5A 4OFKA 4TOYL 5HI3D 3OV6A 1U9KA 1ORQA 3VGAC 5FOJA 5AWNH 5DMIL 3X13B 1HH9B 2NQCA 4NO3B 4WFFD 2YN3A 4HAFA 4YXHH 5F7LB 3PGFH 4GAJH 1YPZB 1XF4A 4DFIA 2Z4QB 4U6HB 1QSFE 4JFYB 1NBYB 3U4AA 3GSWA 1WFUA 4ORGB 1BZ9B 2ZJSL 1ZLUH 3GKWL 3DVFA 4MJIB 3CUPB 3JWDH 2PCPA 2QQKH 1ZHKB 1N6VA 5GZNC 5CAYB 3RWIB 3B9EA 4HAGA 1PX4A 4N0FB 3WIFA 1NH6A 4XXCC 4ODHH 3D5OF 3MRHA 4WFHD 4QCIB 5HD8C 4QY8B 4LCIL 4LDEB 4W4OC 4G3YL 3BAEL 2AXFB 2F74A 2VL4A 4NCDA 1IQWL 5BZWB 4ORZC 5DK3A 3QXWA 5FA3B 2XA3A 3EYUL 3WLBA 2EKJA 4Y5YA 4D0CB 5J7CC 4PJ8B 1T20B 4DFHA 5FYKU 3DBXB 2AK1H 2GW5A 5I8CA 3R06A 2IGFL 2PXYC 1WV7T 4RX4A 5DEZA