5GS0D

Crystal structure of the complex of tlr3 and bi-specific diabody
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
122
structure length
122
Chain Sequence
b'QVQLQQSGPGLVKPSQTLSLTCAISGDSVSSNSAAWGWIRQSPGRGLEWLGIIQKRSKWYNNYAVKVKSKITINPDTSKNQFSLQLSSVTPEDTAVYYCARYSYPFYSIDYWGQGTLVTVSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toll-like receptor 3
publication title Crystal structure of mono- and bi-specific diabodies and reduction of their structural flexibility by introduction of disulfide bridges at the Fv interface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 25
structure length 122
sequence length 122
chains with identical sequence F
ec nomenclature
pdb deposition date 2016-08-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5gs0D00
2PO6B 5MEND 1KC5H 1A47A 1ZS8B 4ZXBA 4JFYA 2GAZA 4PJIA 4Q2ZA 2B4CC 1ITBB 5IB4B 4HFWA 1PKQA 1K5NA 5GS0D 1Q94A 1R3HB 2CJUL 2FJHA 5IT2H 4HCRH 4QXGH 4XNMB 3MJGX 1I9IL 3CIQA 4F7MA 2P8PA 4EI5B 1HHGB 3ZYJA 4RGNC 4FFYL 1E4KA 4I4WA 1CDBA 3MACH 5KVGH 4JY4A 3S3SA 4X7SH 3SDDA 1I4FB 4NQXB 5DJCA 5D9SB 5EU5A 4RGNE 4U1NB 1N5YL 2BSRB 3RPIA 5L2KD 3DTXA 1CIUA 1ONQB 2HFEB 1A6ZB 4QRPE 3S5LG 4X98B 2F8XC 1GVIA 3LQAL 1NEUA 1TZIB 2BOCA 3OQ3B 1MLCB 4FZ8H 4HJGB 3S7GA 3NIDF 1A1OB 1W0WA 3T09A 2VZ1A 1YEGL 1CL7I 4YHOH 5H94A 5I74B 2R0ZH 5I15L 4IMKC 2Q86B 1ZT4A 2Q7NA 3CPLB 3ZMRA 5ICZA 5I30L 2EE2A 4F37F 1KT2B 2D7MA 3HI1A 5HD8C 3DUSA 1UKQA 2VH5H 3GJFH 2VLME 1RPQA 1NPUA 1QLRB 3OKNB 4N9GA 1HOCA 2H2SC 5BOPA 1PY4A 1U8NA 3O4LE 1BJ8A 4YFEA 1KPUB 1S78C 3CX5K 1DBJL 4XWOD 3FQXB 3P4LA 2D7PA 5IB5B 4Z0XA 4JO3H 3IDGA 5E8PB 4MA8L 1AY1L 4YBHA 2FBJL 2IG2L 2WQ8A 1NGYB 1BGXL 1NBYB 4R4BB 4UAOB 4PJFA 5D1ZB 3VFTA 4KVNH 3C8HA 4MJ6B 3QEUB 4HEPG 3T3PF 2QQLH 3D39E 4HCRA 2XXCB 2GTWB 2BOBA 4J8RB 3CC5B 3H42H 3U4BL 5D1XD 3WD5L 4ZS7H 3VCLB 5CFHA 4JDTL 5I1IL 5JW4R 5TFSL 1CGUA 3V6ZA 1AI1H 2VLJD 1IL1A 5I1AB 4X6CE 4D9QD 1N0XH 1VKXB 1NAMH 4NRZB 3SJVE 2W60B 4XP4L 3PWNB 1DE4B 5EC2B 1M1SA 5HGHB 3BFOA 1QRND 3EDDA 4WGWB 3WDJA 3PG2A 1JIBA 4OZHF 3LAFA 4WVRA 3O11B 1RJZB 4M61A 3LSOA 1BQLL 3BWAB 4MXVF 5FO9B 4WCYH 3HNSL 3K4DA 5ALCL 4B7LA 4BH8B 4TPRL 2DJSA 2CGRH 2E3VA 3C60C 3JVGA 1FN4B 4EQ3A 2VDRH 3QIBB 5KOMC 1OQXA 2DMCA 2H26B 5SWSB 2ENSA 3FB8B 3GM8A 2VN7A 4P2CG 1IGYA 3QDMA 3B5GA 3U7AA 1LMKA 4S1SL 3SKJL 3P9WB 4XX1E 5E08L 3GJFA 1HSBB 1IKNC 1WTGT 4BUHA 4K7FB 2DKUA 3HC0A 1TQCB 4TSCH 3T2OA 1RVFL 4AEHL 5A16B 2JK5B 1GSMA 2AGJL 3SDYL 4WV1B 2X89A 5DD3L 4OZ4B 2WUCL 2Y25A 4YK4B 1C1EH 1Q0YL 1X3DA 3ZT7A 5GRJL 3HAEG 2VL5B 3VXPA 1DCLA 1IM3A 4G7VL 4MHHI 5EOCL 2IANA 4PJ5A 1IQWH 5FHAL 4K2UL 1TVHA 2DD8H 1KB9J 4I3RL 3V8OA 3OKEA 4WUUE 4QLRA 2IAMA 4WDIA 5T3XD 1F6LL 2QQNH 1DDHA 3VXTA 4LARL 4QXUL 4Y19B 3RVTD 3PNWB 1MJJB 1AP2B 2NXZB 4P3DB 4O2FB 5GZND 1VACA 1NAMA 2AI0L 2NZ9C 2NY1C 5ID0B 1KJ3L 4H25A 1HZHL 4MA3B 1U8LB 3H0TA 3UEZA 4JVWA 2UVFA 5F7FA 3V4VL 1CT8B 1RULL 4JEGB 1RIUH 5A2FA 4P2RD 4NOFA 1EIBA 4F15C 5KAQF 1TJIH 1MCPL 4LLWB 4JY6B 1KIPA 4F3FA 1FNAA 5SV3A 4JLRA 4JM2D 5E2UL 2QHRH 3GSUB 1YEHL 5C7XL 3EJYC 2J1KA 4KZEL 1Z9MA 5JW3L 4KK9C 2ZKHH 1ES0A 4OB5L 2BFVL 2DQGL 4Y89A 2A77H 3I6GB 2VC2H 5JHDD 1DLFH 3AROA 5DQJA 1G6RH 1UACL 5F9WC 4C83A 5D1QC 1WIOA 1XGUA 1PX3A 4YXKL 3JWDL 4WFHE 3N1GC 3BAEH 4U0RC 2P5WB 8FABA 3V2AR 5B8CB 3AY4A 3V52H 2BNUB 5C0IB 4TQEL 1KG0B 2E5EA 2EIBA 3SCMB 3OKYA 4Y2DD 2KZWA 2WBWB 3NA9L 3RI5F 3LN9A 1HWHB 5CWSA 3S5LB 1YEKL 2ITCB 2VDMH 4MNQD 4WFFD 1MCEA 1F3JB 4M9PA 2NY2B 4G8GA 3BEVA 1VHPA 2IPUG 5I66A 1JGDB 1M05B 3GMOA 3E0GA 2V7HB 2IF7A 4PJEA 3L9RB 4IOFD 5EFIB 1NGPL 1AR1C 1F11B 1AXTH 3LY6A 5TPWH 1YJDH 5MP6H 4OIAA 3RX8A 3GI8H 1IVLA 1PG7L 5I1KH 1A14H 1BD2D 4XVJL 3QB7C 1RZKH 3WKML 4E41E 1TVBA 1HXYA 4KWUA 2Y7QA 5TF0A 4S10A 2E8ZA 3KXFA 1IFHH 4RISH 1PQZA 4YR6A 1YMME 1BIIA 3V4UH 2Q1EA 3PUCA 4NKIL 1QKZH 4HIIB 3STBA 1G0YR 4NQCE 3LEYH 3BIKA 4JFEA 1OP5H 5AZ2H 1UQSA 4IIQA 4L3EE 2PYFB 3G5YA 3U79A 1DUYA 1M7DA 2OZ4H 2VITB 4XCCH 3OB8A 4LDOB 1G6RA 2Z9TA 1RJLA 5HHVH 5F1OB 1WUNT 3OV6A 4Y7MA 4LRIA 2NYYC 2LABA 1P4BL 3UAJD 2X09A 1JZ4A 3QEGH 4YQXH 5C0RH 1A6TB 2KZ1B 5IESH 3UYOD 2H32B 2YWZA 4XPBL 1OGAA 4C56B 4N0UE 5FM5M 4KQ3L 3D87B 4JHZA 4WHDA 2F53D 1FIEA 4L29B 5IB3A 2CLRB 3MQIA 2AK1L 3RWCB 4HXAL 4GBXB 1A4JA 3WXVH 4GAYB 1KN4H 3UPAA 1YN7A 1ODAA 1WQVT 2ADJA 2E27H 5L2JB 2VDLL 4WU5A 2CLVA 4R4ND 1T21B 1HEZB 1C5DB 3VFGL 5DVMA 1GZQB 4XBGB 4NWUH 4X5WA 2V7NB 3VH8B 3QQ4A 3TYGH 1JZ7A 2YUWA 2DLGA 3O9WD 4N8VB 2DMBA 4FQPA 4RMTA 3QCVL 2GK0A 5IP4A 2BJMH 4FS0A 4R4FL 4S1DC 3TPUA 5IVZA 3P4MA 5TH2B 4L9DA 1J8HD 1CK0L 4TSAL 2H3NA 1LK3L 3AREB 5CJBA 2AW2A 2DQCL 3H6JA 3C08L 3VE0A 1QEWA 4F9LA 4QRUB 3P0VL 3E8UH 2OZ4A 1UWGH 1T1XA 5FYJL 3GEWB 2CRIA 3K8LA 3MJ6A 4QRQA 1X7QA 3SQOH 4BZ2L 3WCYA 2GY7B 4WTWA 4YFDB 1P5UA 1D5ZB 2ADFL 3G6AA 4WUKH 4U1GC 2AJVL 5I8EB 4OCMC 2EIDA 3FHQA 2PXYA 5JA9A 1KXQE 1TMCB 3T0XA 3HUJF 2VDKL 3VFRA 4UDUB 3ES6A 1CFTA 5A1AA 5F3BB 2EIZB 2R15A 1CXIA 3NAAH 2NY7L 3DURA 1UYWH 2OMBA 2VE6A 2AXGB 2ESVB 1Z0NA 4GKSB 4K94H 5J57B 4PG2C 4PFEA 1UG9A 4NP4L 3BH9B 3WEXA 3QP3A 4WFEE 2JIXD 2X4SA 1MFBL 4HFUH 2Y06L 3KPQB 3LMJL 4R90L 1QSEE 4J3XA 2DQUL 5EH1A 1FYHB 4JRYD 3HI5L 2MNUA 3NFPA 3WL9A 1NLBL 1QSFE 4YUEH 5B39G 2X42A 4NRYA 2A2QT 2AJXL 1DUZA 2EICA 2EZ0D 2ZUTA 2NNAA 3RY6C 4Y88A 4DN3H 1BJ1H 3PWPA 4KDTA 3MXVL 4GG6B 1UB6B 4U1LB 2C4XA 2JE8A 5F6IB 1WFNA 3UZEA 4W4OA 4LCYA 4XPGH 1PAMA 3GI9L 5TE6H 1PJ9A 4MQXC 3DV4A 1IEAA 4GMTL 4IRSB 5F88A 3A6BH 1C16B 4FNLH 3SDXB 3J8F7 3RWIA 1KEML 2BCKA 1D5XA 1DQLL 2B1HH 1FYTA 2XNAA 4N5EC 1AO7A 1HSAB 3QFJD 4JY5L 4L8CA 3NFSL 1NLDL 1N7MH 3OXSA 3VXRA 4FZEH 1A6WH 4N0CC 1H3UA 3HS0B 3RRQA 4M9OA 4DFIA 5TDOA 2DQJL 3DMMA 3RTQD 1KC5L 3RGHA 1A2YA 1KPRB 3VFVB 3A67H 3O6FC 5E5MA 2HWZH 1SYVA 4F7EB 3AS0A 3MRIA 3C6LD 4PJ7A 2ERJC 1QYGH 5MHSE 4Z7WA 5IT2L 2H45A 4HCRL 4QXGL 5HVHC 3K2MC 2DWDB 2DLFH 3ARBC 1MCDA 3DROA 3EZ8A 1ZGLB 3TJHD 5E6IA 3L3JB 4P5TA 1MI5E 2HTKC 2W07A 5IW6A 5JPNA 1PGRB 1S9WB 1C5CH 4QOKB 2UWEF 3MACL 4D0DB 5KVGL 3UBXB 4X7SL 4Z7UB 1UJ3C 2BDNH 2GK2A 2R29H 2BSED 2YRPA 2R23B 4G5ZH 4CUCA 4HUVB 3VXSB 1UCTA 5FYKH 4LKCA 5IMLA 1MCJA 3FO1A 2X41A 3CFBA 1LE9B 3MR9B 4Y4KA 2YKLH 4FZ8L 2O26U 2Q87A 4YO0A 3IS0X 1FE8H 1BLNA 1RJYA 4CW1B 4YHOL 1PW3A 2R0ZL 4P99A 2ZJSH 4XVUD 1Q9OA 4HWNA 2OJEA 1EO5A 4I0PC 3L3KA 5TQ0H 1IC5H 3SHSA 3D85D 1YMHA 5F8RC 3CDFA 4H20H 2WK2A 5IQ7L 3REWA 1RK1A 2XWJB 1ZA3A 5JW4M 1GOGA 2VH5L 1DANT 1P7QB 1A4KA 5K9QI 2XXMB 4UMGA 4NM8H 1KCSH 2UWEA 3BPCB 3IRPX 5C6PB 2YSSB 3V0VA 3OKDA 2XZAH 5HYJB 5IMMB 3QIUD 3T8XA 4ZOEA 1JWUB 1R5WA 1S7UA 5MEQB 3PF2A 4JO3L 2F74A 1QOKA 2BHYA 2NX5D 1AGFB 4NQUA 1UM6H 4KVNL 5D93B 2MMXA 5I1EH 1NC2A 4QRSA 1X4YA 2QQLL 3TA3A 1UH2A 3GJEB 3H42L 1BHGA 2JELH 4ZS7L 2V9RA 4RA3A 5BV7C 1EEUA 1MHCA 4BA8A 1AI1L 3BGAA 4ODHH 4JFYB 4Q2ZB 3R0NA 4G7YH 3CCHB 1N0XL 3W5NA 5TF1H 1FZJA 5SWZE 1NAML 4A2LA 3F58H 1D9KC 4H26A 1PKQB 4M00A 1LEGA 1ULVA 2FJHB 2CDGB 4G6AC 4DN4H 1JRHH 2H41A 5B3JE 1PEWA 1TZGL 2C7UA 4HULB 2BNQB 4PRPE 4HF5H 4PBXA 2Y07H 5LQBH 4WCYL 4GUPA 1P84K 1G7HB 1NFDA 1CTNA 1FNFA 4M6MH 5DJCB 4UIMB 5EU5B 5L7XH 4PJCE 2CGRL 4KJPD 5JDJA 5LVEA 3HE6D 2H6PA 4U1IB 3DTXB 2EDNA 2VDRL 3RVWC 1KTKE 1UZ6F 1WWWX 1T0MA 1K4DB 4ODBD 1T4KA 2YN5A 4APQA 3EYSH 4NYLB 2EH7H 4OFKA 3F7QA 4DEPB 4JFFE 1W0WB 4ONFH 1H9VA 4YHKH 5FA3A 2R0KH 3UTPE 4TSCL 4P23A 1EK3A 4P46C 1GAFH 4YZFE 2W65A 5T1DH 3BPNC 2HJFA 4I9WD 5E6ZA 5J56B 2EDYA 3DWTA 3TYFA 3RVXD 1HNFA 1KIQB 4JN1H 4HIEB 1C1EL 4LU5H 4PGEB 3QUKA 4CMHB 4GRLB 5AG9A 4EDXB 2AP2A 5HYQA 5C0CD 4JRXD 5F7HA 1WITA 5ITFB 4ODXA 2W0FB 4Y1AA 1IQWL 3KYNA 4XHJC 1B88A 2DD8L 1D6EA 4N9GB 1MHHB 2QQNL 1U8NB 4ZSOA 2CIIA 2GJ6D 3ILQC 3TJEH 3X14B 3CMGA 4TUOB 1A7RH 4Z0XB 3QI9C 4JG1H 1LE5A 4MD5B 2QEJA 5IROA 1HI6A 4TUJA 3VFTB 1INQA 1VGEH 3RKDC 1IEBA 2V2WB 5E7FA 3LKNA 1BFOA 2IH3A 1IT9H 2QBWA 5GS1A 2ICWJ 1RIUL 1X5IA 4BYHA 1CD0A 4NZDA 1TJIL 3U6RA 5D7IF 3V6ZB 2V6HA 1IL1B 3G9AB 2QHRL 2DM3A 4Y16A 1BPVA 3QDHA 4JZJB 4LLMA 2ZKHL 5ESAA 4Z76A 5I18H 1IC7H 4KVCH 3UMTA 4PRBA 2A77L 1MY5A 1WIUA 3QUYB 3VRLE 3HPLA 2VC2L 1DLFL 2MJWA 3LOWA 3IJHA 1G6RL 3VI3E 1LP9F 3IS1X 3LB6C 3QDGE 4XCYA 3RWGA 4AQOA 1B2WH 5FOJA 2X4UA 4R3SB 1CVSC 1NMBH 3PXJA 2D0HA 3SBWC 5F9AC 3BAEL 4HUUA 1B4JL 1C08B 3V52L 3QQ3A 2IPUK 4XAKE 1RUKH 5CZVH 3IVKA 4GRWF 3EOBA 4YAQA 3VG9B 2I07A 3LKRA 3RBSA 1UENA 3BGMB 1VGKB 4YHMH 1DVFA 1SJHB 4KDVA 4Q6IA 3T4YA 1ZEAH 3QAZB 2AS5M 2VDML 2AJ3A 1HHKB 1IGYB 2ARJQ 5GGUA 3DX9A 4J4PA 2BVPA 3CFIC 4P48A 1JPFA 4JFHE 4WI7A 5BVPH 4WIQA 3GJFB 2V5YA 4LSQH 4ZFZA 2ZCHH 2NCMA 4UU9A 5KSUB 3EHBC 2ZUWA 4R96A 2FJFA 2B8OT 4JPKH 2L4OA 1AXTL 3BIAX 1YJDL 5TPWL 3GKWH 1LP9A 5MP6L 4OZHB 4OZFG 3GI8L 5I1KL 1EHLH 1A14L 3GSQA 1RZGA 3GGWA 3UZQA 1RZKL 2IANB 5DFVC 3VGGA 4X7CC 1TVHB 4CJ1A 3RHWK 3E2HC 4PRHD 2P5ED 3RZCA 3LHPH 1IFHL 3VXMA 3TC9A 3HR5A 5I74C 3V4UL 3VGDA 5F7YC 1U95A 2EC9U 3LEYL 1NAMB 1I1FB 5AZ2L 1TENA 3HE7D 4R7DA 3O8XD 3ARVA 4HV8B 2OZ4L 3GMNA 1I7TA 5DRWA 4XCCL 5ADPH 1Q1JH 3ARFA 3MROB 1OAUH 1H0DA 2WIIB 4BSVB 2F54D 1G0XA 2WSKA 3QYCA 1XGQB 3NCYP 3NZ8B 4N1HB 4YXLH 4HS3A 3G5ZA 1S9VA 4YQXL 2K7QA 2J88H 3FO9B 1YNKH 5C0RL 1J86A 2ED8A 3OAZH 5DK2B 3CUPB 5IESL 4PJHF 4LGRB 1ITCA 5FXCH 3GNMH 4QNPE 4Q7DA 1LVEA 3WIFB 4C83B 3PQYB 1M7XA 5GRYA 5HPMB 3MBED 1WISA 2ZSVA 4LCWD 2HJKB 1CFQA 2VLLA 3WXVL 1KN4L 3UPRB 3RGVD 3RL2A 1GGBH 2B1AH 3O3AB 4AH2A 5FAAA 2E27L 1D5IH 1L9NA 5EIQA 3SKNA 4NWUL 5CWSB 3TYGL 3Q1SH 2N1KA 4QHLA 5CINH 5C09A 3NTCH 2NY3C 3NFNB 3IAGC 3BEVB 2OR7A 1S9YA 1A6VL 4MVBC 5DHYA 5I66B 1WBZB 1I8KB 3SDCA 3T77B 1HHJA 2BJML 4V1DA 4PJHA 5J6HB 5KN5A 1GYAA 1X9QA 3ZTJG 4JJ5A 4TVPH 3PP4H 5SX4I 5CBAA 4ZAKD 4J3OC 3TIDA 1IGIH 5BRZA 4NKDB 2B5IB 3LEXB 5IW1A 3P73B 2EXYD 4P3CH 3E8UL 3MRJB 1UWGL 1TVBB 1KTLA 2OLDA 4PP2A 5GSVB 2Y7QB 2YPLD 3DUUA 3SQOL 4ALAH 1YY9C 3KLHC 5C0JA 4OCYH 2YD2A 5SWSE 1XF3B 4CU7A 1WC7A 3EFFB 3BWUC 1FORH 4WFGE 3TVMC 5C0AD 4PS4H 3IB4A 1TQCC 4WUKL 4MJIB 3DYPA 5FDWB 1V7MH 3BIKB 1MWAL 2P24A 3TFKD 1UQSB 3L3IA 4IIQB 4WV1C 3G5YB 1RZJC 1ZV5A 1NJ9B 1CLZH 3B9KB 1RJLB 1IGJB 3HB3D 1A64A 2OXGA 2J4WH 3NAAL 4LRNH 3BPLB 1VADB 3ZDYF 3MCG1 4MMXC 3FT2B 3BHBA 2Y23A 4K94L 2PN5A 3QIWD 3WIIH 3DX6A 3MJ8A 3WXWH 4LSVH 4R9HA 4HFUL 3W11C 4LHUA 4PJAF 2W59A 1V05A 2FDBP 3TIEA 4KTYA 3MFFA 5DRNB 3PDDA 5IB3B 3NVQA 5EU6D 1VFAA 4KRLB 4YUEL 4RA0C 3T3MF 5GZOD 1P53A 3BZFA 3H2WA 1PG7W 3GMRA 3Q6FA 4ZPTB 5J1SC 1LO5B 4Y4HA 3QBTB 1U2CA 5IBTH 4PJDF 4UZGA 5CKGA 3G5VB 3M17B 1G7PA 3MRFA 5FCSH 3BH8A 5C71A 3LN4A 4XPGL 2PF6A 1WK0A 5DJ6B 1YUHA 1IGTB 5TE6L 3QH3A 3EYOA 3ILPA 1S3KH 3A6BL 4RMUA 4QTIH 4FNLL 3I6LE 5SX5H 2WUBH 3LQAC 2XACC 1I3RB 3BN9C 2B1HL 3ZDXF 1LEKA 3NMEA 3P0YH 1TZHB 1IM9A 3U0TA 1N7ML 1J1OH 4DKFH 3S96B 3UPCA 4FZEL 5F6HJ 1A6WL 2VZVA 3SCMC 2ORBH 2GKIA 4HIHA 1A8JH 4OZFB 5LAXB 3VE0B 5MEOA 2R2HA 3A67L 3C5SA 2J8OA 1KOAA 5HHOE 2HWZL 3VU2A 2NY2C 1A9BB 4PJDA 4NQDA 4JO1L 4KROC 2X9XA 2A6IA 1QYGL 4FRWA 3PDOA 3DRTA 4PTTB 4HIJA 2QHLA 3G6AB 4D0CA 4IRJD 3MX0A 4OT1H 2DLFL 2AK4B 3WNNA 5JORB 3X11B 3FJTA 3D25A 2CDEA 1AXSA 2HVJB 4ZQKA 3QCUH 1JYXA 4EIGB 1G84A 3VFRB 4R97B 1CFTB 3KPRD 2BDNL 2R29L 1S7VB 3I02A 5HD8D 5KJRH 4G5ZL 5GSRA 2AXFA 1DEEB 4IOSD 1NGXA 3TBYB 5FYKL 4KMTH 4IHOB 2O5ZH 3UJJH 2HFFB 2BSSA 3O4LD 3WEXB 3R4DA 2F58H 3UCRA 1T7YA 2YKLL 5D7SH 1U8MB 2AEPH 2EDEA 2FZ3B 1FE8L 1R5IA 1HQRA 4K3JH 2W9DH 4Z0BH 4OCRH 1PZUB 3P9MB 4HKBA 1FSKC 3WL9B 2ZJSL 1RU9H 4YNYB 3GIVB 3ZKMC 1T2JA 5I71C 5TQ0L 1IC5L 1JWSA 3D39D 5C2BH 3LRSB 3LN5A 5E1HB 4X9GA 4H20L 4JHWH 1FVCA 3HC3L 5GGSA 3UTSE 3PWPB 4ZDHA 1OAKH 3SN6N 5D5MF 5DK0B 3VFMB 2Z35B 4JFXB 2Z93B 1ZHLB 3HUJB 1KCSL 4NM8L 1YNLH 4QHKJ 5ACZB 1MVUA 1W72B 3SJVD 3JXAA 2XZAL 5T5NG 3DV4B 2CO7B 3DXAB 4NKMA 2P8LA 2HA1A 4ACPA 2CDFA 4DZ8A 3RWIB 4AIZB 3LKOB 5ANMA 5TE7H 5EWIH 1D5XB 1UGNA 4C56E 1UM6L 1RK0A 1AO7B 3KVQA 4GBXC 1MHEA 5I1EL 5FV1L 1LWRA 3OXSB 2NQCA 1WBXB 2JELL 1HINH 2A9MH 1MWAB 4X4MA 1G1CA 1FO0H 4AENB 4ODHL 4JDVA 1KV3A 4G7YL 1Y6MR 5TF1L 5CEZH 5BOZG 5C2UB 2VXUH 4KXZH 4U6HA 3MRIB 4LEOA 2BZDA 3F58L 2Q7YA 4F33B 2YBRB 3B43A 5FUZH 1XF4B 4XI5C 1XGPB 1I3UA 1T7XA 5DJ2A 5EZLA 4DN4L 1IGFH 1JRHL 4FFVD 1SYSA 5FDYA 3DROB 4LCCA 1MH5A 1LGVA 5E6IB 3J7HA 4L3CB 4OZGA 3LEVH 5LG1A 4HF5L 2Y07L 2GFBB 5LQBL 3AREC 4OSUH 4M6ML 1BX2A 5L7XL 4DUVA 4MJ4A 1G7QB 3TLRA 5DQ9B 4PD4J 3TF7C 1U8OB 4HH9B 3O3UN 4DKAA 3C6SA 4WUUD 5JHLH 2KPNA 2YUXA 4Y4FA 4ZFFA 1F6AA 2WM0A 3EYSL 5ENWA 3ARYA 4Y4KB 2EH7L 5F1NA 5A3IC 4GW1B 4Z7OF 3AMKA 5GRUH 4IOIB 1EV2E 1NL0H 4ONFL 4YHKL 4D3CH 2NY0D 2R0KL 4FQJL 2OJEB 5T1DL 1GAFL 2P45B 3MJ9H 1ZA6B 1J05A 2NZ9D 4JN1L 1QP1A 4YDIH 5J9PB 4LU5L 1YC7A 3REWB 5T1LB 3JWDC 3V6FB 3P4OA 1YEDB 1A4KB 2UWEB 3FFCB 2R8SL 4KU1A 3ARXA 3VJ6A 4Y5XA 4GW5A 3MGTA 1BWMA 1WAAF 1BF2A 3NIFE 2I26N 4EN3C 1L0QA 2VSCA 2QLVB 3EJYD 1FO0A 3TJEL 5KVFH 4R7NB 1A7RL 4KK9D 3WFEH 4JG1L 1P9MA 1E28B 3O2WH 1DR9A 1M7IA 3H9SD 4GS7B 1VGEL 3DECA 1BMGA 4QRPA 2VIRA 5D1QD 2FSEA 4LAQH 3FQTA 1C7TA 2ADGB 1IT9L 1N8ZA 3BQUB 3SDAA 1W8OA 5FA4B 3UTQA 3AAZA 4X6BB 3MJ7B 4XXDA 2QADC 4JFQB 5DFTA 2E9WA 3Q3GA 3RWJA 2VLRA 4YHPA 4W68A 4AJ0A 4NC2B 5I18L 1IC7L 3KYOA 4KVCL 1DTUA 3OF6D 3KLDA 2IADB 4U1SB 2BY3A 5F72S 1BOGA 1CGSH 2WIMA 1QFWI 4KH2A 1FHGA 1INEH 5GISH 1A1MA 1B2WL 4YLQT 5C0NC 3SDXE 2CRZA 1WAAA 1NMBL 3EYVA 4LF3B 2C7UB 3BP5B 4P49A 4WHCA 5DVNA 3KLAA 2RCSH 1UFUA 3GBLA 2WWMC 3PJSB 2NY4C 1RUKL 3FQRB 5F9JB 5CZVL 1R3JA 1FFQA 3MJ9A 5JMOC 4X5XB 4YHML 4RMWA 1T4KB 1ZEAL 4AYFA 1YMMD 2J8UA 1F2XK 4MSWB 4J3VA 1G7IA 5BVPL 1AGDA 4NQCD 5IB2A 5HHNA 4LSQL 2P46B 1H8SA 2ZCHL 5EU4B 2OTPA 5D7JC 4O51A 3MUGA 4NFDA 3M07A 4XB7A 4LPWA 4JFOB 4JPKL 4X4XB 1O5DT 1UJTA 3GKWL 1I8MA 4EKXA 2A74A 3MRRB 1QBLH 2QTEA 1KJ2B 1D5MA 4Y2OA 5E9DE 1EHLL 3UDWA 4Z7UE 5D7LB 4NPYB 2GSGA 1HILB 1HNGA 4OZIF 4DZBB 4JFPA 1AKJB 2OP4H 2NYYD 5D2LA 2LVCA 2QJDA 4WRLA 4ZSOB 3FMGH 3LHPL 1JV5A 2B39A 4U33A 1IMHC 3GSOA 4PGCB 5T3XH 5D1XA 1LE5B 4HIXL 3EGSA 3L3GA 1C8PA 4TUJB 4X83A 3VGEA 1Q1JL 1OAUL 3QA3B 4UB0H 4JDZB 1NDGB 2CH8A 5CJ8A 2C1PB 5I1LA 1A1NA 3U6RB 3FRPA 2A6JB 4YXLL 4TTGA 1U8QA 4Z77A 2J88L 3VWKB 2VABA 3QUZB 4CDHA 1YNKL 7CGTA 4UOJA 1JF6A 2VERN 2G5BA 3UYRH 1J9CT 3U7YH 4LLMB 4HZLB 3V7MA 4ELMF 4ZOAA 3OBAA 3TBSA 3WS3A 3GNML 4LLYA 4BFIA 4OZIA 5HJ3A 3KPSA 3RWGB 3QEQB 2BC4A 5KOVC 4IMLA 3FB7A 3FO2A 4KK6C 4XCNA 1F97A 5FYJE 4LNRA 3WUWG 3U46A 1YYMH 1EFXB 4O02H 2X70A 3MV11 1GGBL 2B1AL 5EO9B 4ZXBC 4S1DD 2EO1A 1MOEA 1D5IL 1KIRB 5A43C 4OQTH 4BFGA 1U3HD 2O93L 3Q1SL 4G6FD 5CINL 2EDKA 2AJ3B 4LSRL 3NTCL 4ELKB 4Z7NE 4PJIE 3ARGD 1RURH 2CXKA 5GGUB 4RRPA 4JM2F 4ZFOA 2NW2A 5D7IB 4EUPG 2VZ3A 5E8EA 3E1F1 1KTDA 1PKQE 1ZWIB 4ZFZB 1FP5A 2I9TA 1MQKH 1JF1B 3DI2B 2X4NB 5IV2A 4YXHH 2EH8H 3SDDC 1CDGA 1OTUC 3IF1A 4TVPL 3I3EA 4PRIA 3PP4L 5ETUB 4CADB 1LP9B 1QBMH 5GGVY 5C0FB 4NDMB 2BNQE 1IGIL 4JQIH 4GW4A 1A6PA 2WV3A 3LS4H 4OI7A 3SKMB 4P3CL 1A7NH 1XCTB 3MC0A 1I7ZB 1UH3A 1IQDA 5EIVA 2PETA 3H7BA 4Z78A 1IAII 4ALAL 4DEPC 4GRWB 2X4QA 3PHOB 4OCYL 3RZCB 2OJZH 5I2IA 1FORL 1NGZA 3GUTA 2R0WH 1OAZH 1JCKA 4PS4L 1KELH 1WTLA 2HTLC 2X2YA 4C57C 3KPMB 1JP5A 2VTFA 1QSFD 1BQUA 1V7ML 3RWFA 3P4NA 4X4ZA 5H8DA 1GGIH 2BY0A 2FD6H 4MQSB 2N4IA 1N2RA 3KWWA 4CMMB 1I7TB 5DRWB 1K85A 4X0KB 1CLZL 1SEBA 3QR2A 3K7UA 2B0SH 4FQXA 3E6FB 5CJOH 3R8QA 3MSPA 5EOCJ 4ZS6D 2J4WL 1KB5B 1ZVSA 1QHOA 4KKCC 4LRNL 5E24E 5IFJB 1L0XA 2E7MA 1UXSA 3KDMB 2Y6SC 3QCTH 3WIIL 3UJIH 3TO4A 3PV7A 4MDJA 5C0EA 3WXWL 4LSVL 4R8WH 4PG9B 3WSQL 4NO3A 2ZUXA 4U05A 3ZKQD 3CDYA 4M8QA 4Q58C 3G6JF 4QO1A 3SKOA 2VQ1B 2OTWA 4OQTA 5HI4C 3QHZL 3ZKXC 3DBXA 3UO1H 4FXKB 3W0WD 4U6XA 1CLYH 3GMPB 1CICA 4MAUH 2W0LA 2X4OA 4Y2DA 3QRFM 1EEYA 5ICXA 4E41A 3STZA 1I85A 3IDXH 4PJFE 5KS9F 5CJQH 5IBTL 5HGBB 3VD3A 4MNQA 4OBSA 4HD9A 3F5WA 2NR6C 2A38A 2X4TB 5GGRB 2I60H 2UZIH 3OSKA 3BO8B 3SKNB 1FAKT 2FEDD 5C6TH 2UY7A 4NN5B 5JDSA 3QUYC 5ISZB 1S3KL 4QWWC 5LCVH 5BS0D 4UOW1 1BZ7A 4JPVH 2WUBL 5IHZB 1S9YB 1KYOK 2ZCLH 3P0YL 4P57A 1ZLWH 5ESQA 3SDCB 5FUOH 1HHJB 2VZUA 4IDJH 4U1JB 4V1DB 4QHUA 4R2GC 4PJHB 2HFGH 3RNKB 1J1OL 4DKFL 3VGHA 5JIKA 2LQRA 3MV8B 4JJ5B 5L0QB 5GQBA 5FF6B 4HDIB 2ORBL 1R5VA 3VG9C 1I1AA 3CFEB 1XEDA 3JTTA 1U8JA 1KSRA 3SO3C 1JMXA 2EDJA 5A2LH 4IBLT 5KS9A 5L8LB 1FFNB 4PP2B 1DQJB 3T3PE 5HYEA 2DQDH 1WC7B 5HHMB 3PHQA 2KBGA 3NN8B 4TOYH 1ACYH 4OT1L 4XPFH 1TCMA 2F5AH 2A73A 4HAFA 1E4JA 4BKLA 5K9KA 1TNMA 1F4WH 3L3IB 3QCUL 4IDLA 2IJ0C 4IRZH 2JJSA 3KPPB 4LLUA 2FGZA 2DYPB 4P4RB 5K59F 3KAAA 4HK0B 5E4EB 4U4BA 4J6RH 1JN6A 1CR9H 3BHBB 4KMTL 5DT1H 2O5ZL 4WNQA 1G6VK 2IAMC 3UJJL 5DMGC 2EDXA 1ZLUH 2WANA 4PRDA 2F58L 4NQEA 4ZYKA 2IANE 4PJ5E 3PWLA 4X8JA 3C9NB 2CMRH 2AEPL 5KSAA 4M8VA 4RIRA 4G43B 4P0DA 4K3JL 2W9DL 4OCRL 3CFDB 5D96B 3WDHA 1RU9L 5IVXA 2DJ4A 4QXTB 4XMLH 5C2BL 1FZOA 3N85H 2VLKD 4JHWL 3MLXH 2HG5B 2MKLC 4M7ZC 5DJ8B 3WUWB 5F89B 1K8IA 1OAKL 4NN7C 3HI6H 2UUDH 4V2CB 2HMIC 2G75A 3MRFB 3LN4B 4YHIA 1YNLL 1AFVH 3NBNA 2ICWA 4MNGA 4J1UA 4XHQA 3RWEB 2C26A 4WWKB 3ILPB 4LVEA 4M4RA 3PWVA 3T08A 1PY9A 2AKRA 2WZPD 3HA0A 1Q9LA 4LIQH 1J8HA 2JCCF 1D9KD 5TE7L 4EUPB 5EWIL 5IOPB 4POZD 2YUVA 4MZ3A 1R3LB 1IM9B 2F8OA 4PJAB 4KV5F 4DVRH 5IM7A 4G6AD 3BVNA 4XNZB 3AY4C 4J2XA 3CDCA 5T3ZD 4URTB 1FGNH 4MXWH 1HINL 5CSBA 4ZPVB 2A9ML 1II4E 5HSFA 2OSLA 3GSRA 5DRXB 1FO0L 1UEMA 1I1YA 2YD4A 3MRQA 1FFPA 2X40A 4PB9L 5CEZL 2VXUL 1DN0A 3MLUH 4PJDB 4GMSH 4NQDB 3RVWD 5L9DH 2EE9A 4JFFD 3PDOB 1P7HL 4Y5YB 5BO1H 3UTPD 4D0CB 3GMLA 2GTZA 1IGFL 4G8GE 4HWZB 1KJMB 3HPJB 3LEVL 3SGEI 4ZQKB 5ACLA 3OHXA 4KRPB 4OSUL 4PJEE 4F57H 4P46D 3C2SA 3QWOA 5DMYA 2JIXA 1NCNA 4PRNB 3WO4B 1TVDA 3VWJB 1AE6H 4NKOB 3A6OA 1CLOH 4NO0A 5C0DB 5JHLL 4HJJH 1R24A 4RDQF 3D69B 5GIRA 4MCZB 3LDBB 3ULVH 2DIAA 5BQ7B 4XHJD 1ETZB 2V2TA 3T4AB 5GRUL 1R5IB 3EYQD 4HMEA 1NL0L 1RIVH 3UC0H 3QG6A 3KXFE 4D3CL 4HKBB 4KGLA 2JJVA 4IIQC 4OBRA 4YFLI 5AWNH 3MJ9L 3QI9D 5KZCB 4PTUA 1XR8A 4JFEE 1FVEA 1FVCB 4R0LB 1NCAH 4ZUTA 4LRIC 3KPNA 4L1DA 1BVLB 3RKDD 1K3IA 4GO6B 1NMCB 3D2UD 4P2OB 1YPZA 2NXYB 1MIMH 1NEZG 1ZOXA 3M45A 3SGDI 4ZOBA 3QWRD 4RQQB 5F7EH 3VRIA 4FMFA 3T0EB 5HGAA 3QDJB 5AEAA 4WI6A 3LKSB 1ZT1B 2XY2A 3QFJA 5DUBA 4ODUB 4L4TB 4NKMB 3MLSH 3BKJH 5I76A 4UQ3B 1OQOA 1EGJH 2X10A 3QDGD 4PY8J 5BJTB 4NN6C 5KVFL 3ARBA 3RBGA 3WUZA 5ANMB 3WFEL 3EDJA 3QXAB 4UILH 1OVZA 5INCA 2UYLB 2ZWLT 5DD0H 3LB6D 3ZZ1A 3DHJA 4LQFH 4BH7A 4LAQL 1GCFA 3EO0B 2WINA 1CS6A 4HW6A 2GITA 4PJ8B 3C6LA 5JXEA 3BP6B 1CDJA 4F2MA 1YJDC 2EO9A 5C8JB 4MMZC 1UWEH 1Y6NR 4KFZC 4EVNB 2VNCA 4U6HB 4NZJA 3OR6A 5D5MB 3IAQA 1RZKC 3DGGA 1U36A 3X3GH 3VFWA 1CGSL 5DJ2B 1NSNH 3S4SA 1INEL 5GISL 1SYSB 4I0PA 3C2AH 4LCCB 4N0FA 3TZVD 2RCSL 3UTTD 5I1DB 5F21B 3VDBA 4KJWD 3QUXA 3KYMA 1OT2A 2V2XA 2R2EA 1X6NA 5E8DH 4N0RA 3FB5B 5ERWB 3RWDB 4LPUA 1WLHA 1CG9B 4MAYB 3E6HA 4OUUB 1ZTXH 4N0YH 5C9JA 1HKFA 4CU6A 5C0BA 4HK3J 3RKPA 4XVSL 4YBLB 2I27N 1DBKH 1NFIA 2MKWA 1BZ9B 4MA1B 5IUSA 1X5LA 3CFKA 1I9RH 1NBZB 5HHPA 2P8MA 3GSNH 1I1CA 2ZUQC 4JAMA 2EC8A 3BUYB 4XH2A 2VSDA 4R97C 5JLZA 3NCFB 1EGJA 4RWYH 4YJZL 1J05B 3I50H 1PLGL 1D5BA 1KEGH 3T2PA 5IHUH 1T1YA 1QBLL 3BRDA 2DL9A 5C07A 4ZFOL 4OIBA 2WBJD 1NKOA 5DJAB 5GGQH 5FM8A 2OP4L 4PV9A 4RMRA 4Y5XB 1B6DA 4ZUWB 1AGBA 2HRPH 1S7XA 3MGTB 3FMGL 3IFOB 2LU7A 2JJTA 1GZPA 4PRPA 3DARA 4CAGA 4HKXB 3DXAD 3P9LB 4L8DA 4MD0A 5T3XL 4PJCA 4E42A 1EVTC 5MENB 2AXHA 3FN9A 4YDJB 3TP4A 3RU8H 3D0LA 4ONGH 4NUJA 3D3VD 2VMFA 2ENYA 4KDTC 3F12A 4MX7A 4AK1A 2Q6WB 5T33L 3L7FB 4ZUSA 2VQUA 4UB0L 3AAZB 5DJXA 1F4XH 2M2DA 4Q74A 1QR1A 5I0ZA 1V5JA 4W4OC 3PWPE 1S7RA 4P2YA 5EU3B 4HHAB 4FXGB 3ZYOA 3ELAT 5J1TC 3UYRL 3U7YL 4RAVA 3HUJE 4KY1H 3UZVB 1JL8A 1LD9A 1CIDA 4KQ4H 4ERSH 1BOGB 3QULB 2W0KA 5DJZB 4XTRD 1SJEA 2NY3D 1INDH 1KLGB 2YXMA 3EYVB 3IGAB 5L2KB 5IR1B 4MVBD 1REIA 1FYTE 4M7LH 1AO7E 4K7PX 3FT3A 32C2A 1YYML 4LCUA 4O02L 4XGZB 3DMMC 5IEKB 3VXRE 5EPMA 1R3JB 1NC4A 4I48B 5TGBA 3BT2H 1Z9LA 4OQTL 4K07A 5LJYH 4ETQA 4OKVB 4NUGH 4PR5A 4Z95H 4S1RH 3VGBA 2QQQA 3C5ZD 5DD5H 3HRZA 1RURL 4WFGD 2NY5H 2X4RA 4K94C 3IXTB 1SHMA 4CN6A 3D6GA 4PJ7E 1YY9D 1AIFA 5E6IC 3KLHD 4P5TC 1MQKL 4O51B 1MCCA 4Z7WE 4F8TA 3TVMD 1IC4H 4YXHL 4PP1C 2EH8L 3QQNA 5I75C 3L95A 3VFPA 1QBML 1TITA 4JQIL 4DKDC 4XPHH 1EHNA 1JGVH 4AT6B 1FQ9C 1UKTA 3LS4L 5JOPD 4LVNB 3EYFA 2GJ6A 3BGFB 3CXHK 1A7NL 4Q97A 1NEZB 4ORGB 5EO1B 4Y4KC 4U1KB 2R2BA 2HVKA 4HKZA 3WFHB 4QGTA 3N1FC 3MOAH 2VOTA 4YHYB 4F7TA 1BAFH 2OJZL 4JFDA 5CD3A 1T2XA 2R0WL 3FCTB 1OAZL 3GSOB 2DQFB 2HT2C 3MMEB 5D8JH 4EBQH 1KELL 3W11D 4C59B 5D1XB 4B50A 3SBWA 1OTSC 4NFBA 5D2NB 1GGIL 4K7PH 3O45A 2FD6L 2GUOA 2VLJB 4X6FB 3X17A 4PJBA 5D6CA 3VFSB 1RQ5A 1CZ8H 2PO6A 1ZS8A 2B0SL 5CJOL 4MNHB 3BKCH 3KPTA 1U42A 1BQHB 1QRNB 4OLZL 3QCTL 3L3DB 3UJIL 4HXBH 1PZ5B 1R3HA 2WBKA 4R8WL 2UWEE 3D5OF 3TBSB 1MLBB 4EI5A 2PW1B 3TBTB 1HHGA 3MRHB 3R06A 3UO1L 4KKLC 3S36X 3EW3B 3W9DA 1BBJA 1CLYL 4GS7C 2AV7A 3AM8A 3ZKNC 4M1CD 1P5VA 4MAUL 3GKZA 5CSZB 2VDNH 3TA3C 2ATPB 4LNRB 5LXGH 3U46B 3IDXL 4U1NA 3UBXI 2BSRA 1I1RA 5CJQL 1ONQA 3PV6B 1N6VA 3BOVA 1WV7T 1IKFH 1MHPH 1T22B 4M62H 4PBWD 2I60L 1TPXB 2VUOA 5HHOD 1MLCA 4HJGA 5BZWB 4MD4A 5C6TL 1A1OA 1V7NH 2BXYA 4QKXB 1TTFA 1OWRM 5LCVL 3JSSA 2Q86A 3KR3H 4HUXB 4JPVL 1EO8H 3PP3K 3CPLA 2ZCLL 3I3BA 4XNXL 4WW1A 1KT2A 5FUOL 4IDJL 5FYKE 2HFGL 4ELMB 1G7LB 3EIFA 2AJUH 4HQQH 5KTEH 1F3RB 3DX7B 2P4AB 1AQDA 3RUGF 1CTOA 2D03H 1TIUA 3AFLA 4KMLB 1QLRA 1VFBB 3MA7A 3MPCA 1NFDE 4RNRB 4APQC 1KPUA 4Q9QH 5MI0B 4M48L 1IQDB 1CLCA 2FCBA 3OKKA 3RDTD 4TUKH 5LGHH 2DQDL 5E8PA 3W81A 2D7NA 1NGZB 4R4BA 1NGYA 1NBYA 4TOYL 3SE3A 1ACYL 1VFUA 5D1ZA 1SM3H 2F5AL 4P23C 4MJ6A 3LKQB 3QEUA 4P2RB 1Q9KB 4O2EB 4MDIB 3QPQC 2GTWA 1F4WL 4J8RA 3CC5A 4JM2B 3VCLA 2C3VB 2FBOJ 5B38A 3UTSD 3ZKMD 1SEBB 3IDYC 2OQJB 4HWUA 5EN2A 5DSCB 5I1AA 1RMFH 3VXQA 1WSST 4JJHA 2X7LB 3FT4B 1A3LH 5JOFB 1ORQB 4J6RL 4NRZA 5DT1L 1CR9L 2W60A 5JHDB 3HZYB 3PWNA 5EC2A 5HGHA 3RUGA 5D7LE 4Y1AE 2CMRL 5B4MC 3DUHA 3O11A 1RJZA 4ZSOE 2O5YH 2AEQH 4F9PA 5IROC 3BWAA 3F8UB 1GH7A 5FO9A 5F7NC 3LD8B 1UZ6E 4MHHG 4Y2DB 4XMLL 1UXWA 3N85L 2XI9A 3QEQD 3TNNB 4LQ1A 3MLXL 5CJ5A 5EZIH 1FN4A 2W38A 3GSWA 3QIBA 1AD9B 3HI6L 4MNQB 4LBEA 2MOVA 3ULUD 2H26A 5SWSA 3O41B 3VWKC 3FB8A 1EUUA 3QUZC 4Y16C 1AFVL 1XIWD 2CLZB 3UTZB 1YC8A 3D9AH 1QSVA 2WAHA 4QYOB 4K7FA 5I17B 4LIQL 1M6OB 5A16A 2JK5A 1TQBC 4XI5D 4WV1A 4OZ4A 4DVRL 2FHBA 4QHUB 1BD2B 4U7MA 4NSKB 3U9PH 2VL5A 3G6JB 1BREA 3ZHLA 4LDLB 3GK8H 4MXWL 4OF5A 4YHNA 1OAXH 2AQ2A 4JG0H 4WEBH 1WCBB 3JTTB 1CDIA 1DVFC 5C0AA 2P49B 3CU1A 4RSVA 1OTTD 5CBEB 3IKCB 4KKAC 5KS9B 4Y19A 2DI9A 3PNWA 3MLUL 1MJJA 5FEBA 1AP2A 5L9DL 4J4PC 1W8NA 4P3DA 4O2FA 4MA8H 3PHQB 5IJKA 5BO1L 5ID0A 3HNVH 3ALPA 4MA3A 1U8LA 1N6QH 5A3ID 3SY0B 1CT8A 4DQOH 3L3OA 1UT9A 3WD5H 3QIWA 4OFVA 4F57L 2ZNXA 4LLUB 4LLWA 4QRRD 5TFSH 4JY6A 4CBPA 4WEMB 3GSUA 1JI1A 4HG4K 1LP9E 1YYLH 1CLOL 4UT9H 4QRTB 3GDBA 1QVOB 4HJJL 4WNQB 2F53B 3FQUA 1TCRB 3RZCC 2DM7A 3I6GA 3TT3L 1MAKA 3ULVL 4AM0B 3ZSSA 2AQ1A 4LL9A 3OGCA 1JBJA 4OCWH 1RIVL 3RNQA 5HI5C 3JTSB 3VXME 4L1HA 2P5WA 2EDLA 3B9AA 4JGUA 4JCLA 5B8CA 4U6YB 5AWNL 2BNUA 1FZOB 1KXTB 4H1LG 5C0IA 2H32H 1XCQB 3QXDB 5F7LB 1HIMH 1NCAL 4YDVB 4LGSB 5DDHB 3VXNB 1MIML 5DUMH 2CK0H 5DC4B 3S5LA 3O9WB 2ITCA 2QSQA 5F7EL 4MCYB 1F3JA 4DK3A 2QADD 2CR3A 3MRDB 1YN6B 2XZCH 1JGDA 3MLSL 3AS2A 3NGBB 4UBDC 2V7HA 1EGJL 3NABH 3L9RA 3FFDB 1J8HB 3TN0D 4FTVB 5EFIA 3KPOA 4UILL 1F11A 4MS8D 4NC0B 1P6AB 2F19H 3BVNB 4OD1H 3VXUD 5C0ND 1BJ1J 4LQFL 1ZANH 3ZE0E 5J12B 5FHAH 1ROWA 2WWMD 4HPYH 5KVEL 2DBLH 1NDMB 2NY4D 4IRJA 3LRHA 1UWEL 1I1YB 2ZOLB 4W6WB 1IEHA 1FFPB 2XRAH 4PGDA 5EA0H 2I5YH 3DI3B 1P4IL 2PW2B 4HIIA 1CBVH 2R9HD 3I9GH 5IMKA 3X3GL 2VJXA 3KPRA 3SDCC 3GMLB 5C09E 4JPWH 1NSNL 2PYFA 5DRZB 3C2AL 3WNPA 2VITA 4ISVB 3C09B 4ZTPH 1T66C 2BX5A 3ZYIA 4MZ2A 3EOYG 4QTHB 5D7JD 4V1DE 2JCCB 1T5WB 4PJHE 5E9DD 5E8DL 2JIXB 4OLVH 4YPGA 1A6TA 1FJ1B 5DEFB 1ZTXL 2P7TB 5BRZE 2H32A 4CGTA 1OP5K 1R24B 4JRYB 4C56A 5GIRB 1T2QH 2IFFH 5J11B 5KANI 4L29A 1DBKL 2V2TB 4QY8B 4TSBH 2CLRA 4H5SA 3LV3B 3ZT6A 2HJLB 2P42B 3RWCA 4KPHH 1I9RL 3W9EB 3U48A 2YN3A 3GSNL 2YD6A 4GAYA 1K8DB 1T5XB 4PLJC 3HZKB 4RWYL 2FR4B 3I50L 5L2JA 5JW4Q 3MV9D 1KEGL 3MYJA 2XN9D 5IHUL 5J13B 5FKPA 1JZ2A 3T0WA 1HEZA 1C5DA 1GZQA 4XBGA 5FGRA 2V7NA 4ZNCD 1WEJH 5I73C 3GBMH 5GGQL 3VRIB 4G6JH 5HGAB 4BM7A 4OV6F 4U1MA 5DO2C 2HRPL 4N8VA 3QFJB 3FOLB 1TTUA 2ED9A 4UV7H 4PJ9D 1CGVA 2XT1B 3OXRA 5D96C 2EYSB 3IU3B 4FG6C 4M7KH 4CVUA 5INCB 5DI8B 5FYJD 5TH2A 3RTQB 4HGWB 3ECBA 1ED3A 1FV1B 3RU8L 3VXOB 4Y4HC 4ONGL 2YC1B 1B0WA 1F90H 1YZZA 1YDPB 4DFHA 1EHXA 1J88A 1GRWA 4KK6D 4QRUA 1S5IH 5CAYB 3C6LB 4OI9A 1F4XL 1H3VA 4F2MB 3H3BC 4LHUG 5MERB 5HYSB 4ZXBD 3STLA 3QUMB 4TULL 2F15A 4G9FD 5CILH 4JQVA 4KY1L 3OG4B 3DIFA 2ATKB 4TVPE 5I8EA 3DGGB 1AGCB 1MNUH 2FHCA 4KQ4L 4ERSL 5DJYB 1LHZA 3QJFA 3S4SB 3ZDYE 1INDL 1UZ8B 4UDUA 2NY6C 5F3BA 2EIZA 2Q76A 1IAKA 2R2EB 3DVGB 2AXGA 3M1BB 2ESVA 3SDDD 4GKSA 1OTUD 1DBBH 1TXKA 3X13B 2FECL 1U8PA 1FC1A 3BT2L 4NUGL 3QEHB 3T3ME 4Z95L 1OSPL 4S1RL 4M7JH 5DD5L 4HUNB 3R1GH 2NY5L 5EUOF 3D85B 4D8PB 4PJDE 2VKXA 1JFQH 2AK1H 4NQDE 3VDCA 2PR4L 4X7DC 4X6DF 5H37G 2Q3AA 3ZKSD 4OD3H 3CFKB 4P2QD 1IC4L 3TO2B 4OLYH 2R0LH 4BSJA 4GG6A 1UB6A 2OXHA 1D5BB 4U1LA 5I8KH 3QIUB 3U0PB 5JA8B 4XPHL 2W92A 1JGVL 3BIBX 3VFGH 1DQDH 2BVQA 2ICES 1U93B 3BXNB 4IRSA 1QBBA 1S7WB 2NX5B 1AGBB 5ITBH 2Y6SD 3KNBB 3MOAL 2EIEA 3H9SA 3IFNH 1BAFL 2VISA 3IJYB 4EBQL 5D8JL 2Z92B 4MWFA 5DMKB 1HSAA 5GJSH 1NMAH 2XTJC 4MD0B 5JQHC 5HI4D 4K7PL 1MFCH 2CQVA 3HS0A 2XTJE 4K9EH 4X6DA 1EZVY 3F12B 2AERT 1CZ8L 4M93B 1NMCC 1KACB 4P2OC 4ZUSB 1KPRA 1QACA 3BKCL 4U6TA 2HN7B 4F7EA 4QHMB 2R4SH 1JYWA 5GJTH 4UT7H 4HXBL 1CVRA 1MJ7H 4K8RD 5DZOA 4PGZA 2NR6D 2PYED 3BDYH 4YC2C 4WENB 3MNZB 2APBA 4PREB 2ZZUT 2DWDA 4Y5VB 3DPBA 1MUJB 4O9HH 1ZGLA 1LD9B 3SEPA 5CUSH 2Z0BA 1E4WH 4L4TE 4QWWD 1S9WA 4QOKA 2JLLA 4D0DA 3HE6B 4Z7UA 5ANME 5EBGA 3G04B 2BRRH 5LXGL 2R23A 3FT3B 5IHBA 4LCUB 3ARRA 4HUVA 3VXSA 5E4IA 3FZUC 1ADQH 1IKFL 1MHPL 1LE9A 3GSNB 4M62L 1JHKH 5DZLA 1DQMH 3MR9A 3W2DH 4MJ2A 5K9OA 4X4ME 1V7NL 5E8OA 2GYSA 4OGYH 2ID5A 3TT1H 4WW2F 4CW1A 1UEYA 3U30C 3S9DB 2IPTL 2WLZA 3KR3L 2LAGB 3QDMD 2DQIH 1EO8L 3TWCH 1UADC 4GSDH 4LCCC 1AIFB 5CLWA 4WO4D 3BESR 4OM0H 4X7TA 4EQ2A 5C0CB 3K80A 4JRXB 4XMPH 3LPFA 2XZZA 3PGFL 1TETH 2AJUL 5KG9B 4HQQL 5CSGA 2XWJA 5GPRA 5KTEL 2GCYB 2JJUA 1P7QA 4OZGE 1G1YA 2X89D 5DMIH 4IEFB 2D03L 3BPCA 3GI9H 1HYRC 4FQQA 5HYJA 5IMMA 3CSPA 4Y4FC 3SGKA 4Q9QL 1JWUA 4PJ5D 4RAUA 2GJZB 2HVKB 5MEQA 2XA8H 3I84A 2AEIT 4TUKL 1ZT7B 5LGHL 2IAMD 4GAGH 5C3TA 1AGFA 1NUDA 1NCBH 1KENH 3ZE2E 1IJ9A 4FQHB 1SM3L 3BI9X 3NCBB 1JHTB 1KCKA 2KH2B 1OB1B 4H8WC 1CFSB 3GJEA 4J23A 4TTDD 3WN5B 1B3JA 4LEXL 3RVUD 4PJXF 3DOSA 3DYMA 1RMFL 3KYKL 1KLFA 1A3LL 3CCHA 3CSYA 3LZFH 4IS6A 4Y5XC 3CH1B 2AQ3A 2HMID 5DJ0B 3O3BB 2CDGA 2M26A 4WI3A 3VFNB 3QO0A 1ADQA 2OL3B 2D4DA 1P9MC 3R06B 2Y5TA 2O5YL 3PL6D 9CGTA 2AEQL 3W9DB 2BNQA 1ZHNB 1BBJB 3B2UD 3HCVB 3BEWB 2AV7B 1G7HA 4UIMA 5CEZE 2AABH 3SDAC 5JTWA 1PD6A 4GFTB 5E95B 5EZIL 4U1IA 3U36A 4OCXH 1GXEA 1ZHBB 5D7KD 4XNUH 3ARGA 1K4DA 2LTQC 4NYLA 2Z8WC 4OCLC 4MD4B 5JQ6H 1PBYA 4FFZH 1FG9C 1RI8A 1RZ7H 2IGFH 3D9AL 1KCUH 3JWOH 1GGTA 3L6FB 4UTAH 2VLRE 4G8GD 2JB5H 4Z7QE 4WW1B 4E9LA 1KIQA 4HIEA 5C08D 5IQ7H 2D4FA 3U9PL 4PGEA 3GSVB 4GRLA 2V5RA 4EDXA 3GK8L 1WAAE 4ENED 5ITFA 4XBPB 3IETA 2GQHA 2W0FA 3FB6B 1AQDB 3NIGF 4PRHB 1OAXL 2P5EB 3K0WA 4OD2A 4JG0L 1FAIH 3MA7B 4WEBL 1MHHA 5HPOA 1VFMA 3QRGH 1O7VA 4OF0A 1ZKAA 1Z5LB 1Z6JT 2VDPL 1KJVB 1LK2B 4AEEA 3X14A 3OKKB 2KQNA 5JMRA 4TUOA 3HE7B 3O8XB 4MD5A 1QSZA 4N9OB 3KXFD 3FKUS 3HNVL 1H5BA 1F42A 1U41A 1N6QL 1WWAX 2J8UE 2V2WA 2F54B 2IBZX 5GRXG 4DQOL 4KJQC 4NO5B 3EDFA 1OAYH 4JFED 3V5KB 1E6JH 2VQTA 5B38B 1HKLH 2NLJB 5EN2B 3UDWC 3FTGB 3VXQB 4JGJA 4PLNC 3HZMA 5HGDA 1LO4H 1YYLL 4UT9L 5KSBF 4JZJA 2OI9C 2XWTB 4TNVK 2J5LB 1CXHA 3W0WA 3QUYA 3RUGB 4YHYC 3DO7B 3MBEB 4WI5A 12E8H 4LCWB 4OCWL 3BPOB 5D2LE 3TCXA 1KF9B 5FYJU 4R3SA 4H0HB 5D1XC 4Y8DC 1OGAD 1OSZB 1TZGH 3RGVB 1C08A 1UXWB 4I0KA 4WJ5A 5DC9B 3CZFB 3GBNH 1HIML 2FO4B 2X44D 4LVOC 3BGMA 3GSWB 1VGKA 4LBEB 5DUML 3ZDZE 4FABH 1SJHA 5FK9B 5BS0A 5EBLB 2CK0L 5CEYB 1SMAA 1MRFH 4PGBB 3RP1A 1HHKA 3SE8H 1E27A 4I2XB 5FECB 1CGXA 1V3JA 4DUXA 2XZCL 1XZ0B 4U3HA 5K9JH 5KSBA 3NABL 1CI5A 4K71B 5EO0B 5KSUA 5HYFA 3TH2T 4ZAKB 3UYPA 3I2CH 3O4OB 1M4KA 3MCKB 4OZIE 2F19L 1GGCL 4OZHA 3KPSE 4OD1L 3OKOB 1ZANL 4LVHB 2KQMA 2HLFD 4PV8B 4XX1G 4YHNB 4N1CA 5EC1B 2YPLB 4HPYL 3P2TA 1BZQK 2DBLL 2UZYB 4JN2B 5T3ZH 5C0AB 1WBYB 2CXGA 1PEZA 1QO3B 2XRAL 5EA0L 1CCZA 2I5YL 1HHIB 4XNQB 3SE9H 1U91A 1CBVL 5JZ7C 3I9GL 5DS8B 1I1FA 3L5HA 4XMKH 3IDIB 1ZGLM 4I18B 4JPWL 4JKMA 1MAJA 1FDLH 4PJGF 4HV8A 2GSIB 1CD8A 3L3OB 4ZTPL 2PXYD 3MROA 1XGRB 4U6VH 1MFNA 2WIIA 5B3JF 3QIWB 4JREB 4BSVA 1XGQA 3NZ8A 2HLAB 1JRHI 4OLVL 3T1WA 1A6UH 3FO9A 4ZFGH 3G6DH 4PRIE 4LPCA 5JW5B 5T3XE 4MLSA 5DK2A 3CUPA 2R4RH 3FQUB 5EU6B 2V17H 1T2QL 2IFFL 2HKHH 4ODSH 1AQKH 3WIFA 3OGCB 1G0DA 5F7DB 4TSBL 3PQYA 3CFJB 4HPOH 5HPMA 1BOYA 1SY6H 3RNQB 3VMPA 1TLKA 4KPHL 2FX8H 2HJKA 3MRNB 1X5FA 4LKXB 1B4JH 3GIZH 5J4MA 3UPRA 3CDGB 3O3AA 1DLHB 3OAZK 4FQXC 3BW9B 4PJGA 4D9RE 2EDOA 2WLYA 4FQLH 3TO4C 1RHHB 3MZTA 1WEJL 3TCLB 3GBML 2D31B 3NFNA 4G6JL 3U82B 1B6UA 2QKIA 3MREB 3V5HB 2XYCA 4UV7L 3V6OE 1WBZA 1I8KA 4FP8H 3T77A 3OB0H 1OLLA 4B53A 5J6HA 1CICC 3TGXA 3KPOB 4M7KL 4Y2DC 3VGAC 5AYQA 4JM4H 1I85C 1F90L 4X99B 4A6YB 4NKDA 3LEXA 3P73A 3VXRD 1S5IL 4M03A 4NZTH 1OAQH 3MRJA 2DL2A 3BUTA 3PHSA 1P1ZB 1FZMB 3X12A 5GSVA 3DMMD 5DLMH 4IRJB 4MNQE 4WFFE 4KKBC 4ZNEE 1XF3A 3EFFA 2ZOKB 4PGDB 4JZNB 5CILL 5IQ9B 1GOHA 4MJIA 3S88H 1MNUL 5FDWA 5IMKB 3CVHB 4GXVH 3L3HB 3KPRB 3QNZB 4OZFH 3PABB 3GM0A 1NJ9A 5E94B 4U49A 4CVXB 3VI3F 5AUMB 3ARDD 3B9KA 1IGJA 4P5TD 3OJMB 1HWGB 3WFZA 1SY6A 3O4LB 2EEAA 1VADA 1I1AC 3FT2A 1DBBL 4YPGB 5CGYD 5J1AA 4M3KB 1JPGB 1F6FB 1HDMB 4XP1H 2GT9B 3B5TA 5DK3A 5LWYH 1A3RH 3SKUD 4M7JL 4CVZB 1JE6A 3AXLA 1I8IA 1L9MA 4QHNA 3D39B 3R1GL 5DD1H 5DRNA 5KS9E 1QFUH 1H3WM 4H5SB 1JFQL 3OKMB 4OD3L 1NGQH 5JUEH 4WI2A 4ZPTA 1BFTA 3D2UA 1A7OH 4BQ6A 1LO5A 2HT2D 4OLYL 2WP3O 2R0LL 3LKPB 4JZOA 2JJSC 4Q9RH 3WJJA 3G5VA 4KAQH 3M17A 1N0LA 3A6CH 3SJVB 3OKLB 5I8KL 3FRUB 2JB6B 3MYJB 3LPWA 5FKPB 3MV7D 5DJ6A 5DWUH 1IGTA 1DQDL 3DRQB 2ARJB 4U1MB 5F70A 4MQ7B 5ITBL 3WS6A 4X8XA 5KSAC 3IFNL 1I3RA 2L7JA 1M71B 1A6VH 2F53E 4YHLH 1TZHA 3OXRB 4L9LA 3QFDA 2W1NA 4KMQA 5GJSL 4NQEE 1NMAL 3CK0L 3EKCA 3S96A 1KB9K 1MFCL 1W72H 4YGAB 3ECBB 1ED3B 4KKLD 2X05A 5L6YH 4FTVD 1JZ3A 1CWVA 1V3LA 1JJUA 3G5XA 4K9EL 3C60B 3D0VB 5IVXE 3HAEB 1KPVB 1NC2D 4OZFA 5LAXA 1NGWB 4PLKD 2BVOA 3TA3D 4HX1A 1MREH 2Q8AH 1FZKB 4G8EB 1A9BA 2R4SL 2VAAB 5GJTL 4TRPH 1U6AH 4UT7L 3WNMA 2DIBA 1MJ7L 4HGMA 3STLB 3CFCH 4PTTA 3BDYL 4MB5A 1R6VA 3BD4A 3NGBC 5FGSA 3DIFB 2AK4A 4O9HL 4MNGE 3ZTJH 3UTTA 1Z9SA 5JORA 3TV3H 3X11A 5CUSL 4AQ1B 1E4WL 3QJFB 1MWAH 2HVJA 2XPGB 1TTGA 4XCEB 3KHQA 5L8KB 3AC0A 1J8HE 3C5JB 5EBWB 3EOTH 2BRRL 1S7VA 4WUUB 2Q76B 2EDFA 3CSBA 4BFBD 1DEEA 1N64L 1IAKB 1W2KT 3EBAA 3TBYA 2ILLA 3G9VA 5IWLA 3K3QA 4NRXB 4IHOA 1ADQL 3V8CA 2HFFA 3RVVC 2APTA 1JHKL 1U8PB 2C1OB 1DQML 3W2DL 2WMPA 1ACZA 4HBCH 2NY0B 1U8MA 2FZ3A 3JV5A 1S7TB 3QJHA 4OGYL 3TT1L 2BNRD 5HDBE 3P9MA 5EG6C 4APQD 5E7BA 4YNYA 2DQIL 2DWEB 3GIVA 3TWCL 3MO1B 4GSDL 3LRSA 4OM0L 1Q8MA 5JO5B 2NTFB 3TNMB 3N9GH 4XMPL 3RFZC 3QNXB 4P23D 1SJVA 1TETL 2E9JA 2WBJA 3VFMA 5DK0A 3PXHA 3QPQD 4F15B 1L7TH 2Z35A 3LCYA 4JFXA 2Z93A 1ZHLA 5DMIL 3HUJA 5ACZA 2EDHA 1W72A 4LPXA 2JCCE 2BVQB 2EDDA 3DXAA 4KV5E 4Y1AD 1FFOB 5AYUH 2XA8L 2LFGA 4AIZA 3LKOA 3H9SB 2EZ0C 4GAGL 1J18A 2VISB 3D3VA 5F9WB 5IKCB 1NCBL 5D1QB 1QPXA 4MWFB 1OCWH 1KENL 4XXCA 5B4MD 4U0RB 3BDBA 4FQCH 1WBXA 2CD0A 5EUOB 1UM5H 1WZLA 1WICA 2C3WA 4X6DB 3OJDA 1MWAA 2GJJA 1DBML 4AENA 1N26A 1SBSH 3LZFL 4LIQE 4DCQB 4JO1H 4F33A 2YBRA 3H9YA 3EAKA 1YPZE 1XF4A 1XGPA 4Y16D 1T20B 4OLWH 4RZCA 4L3CA 3QFJE 4PRAB 5BZDB 2YPKB 2GFBA 1JYNA 1AGEB 1N6UA 1RFDH 4I3GA 4NZUH 2V5TA 5HHQA 2AABL 1G7QA 5DQ9A 3OGOE 3C6LC 3MFGB 3HFMH 5JXEC 4ONHB 1U8OA 4OCXL 4HH9A 3C5ZA 4NCC2 3O6LH 4XNUL 1YMMB 5C0GA 2DJUA 4CN1A 2AJSH 3CXDL 4NQCB 4ZODA 5JQ6L 4GW1A 4FFZL 1YNTB 5K9OB 4IOIA 1RZ7L 1DVFD 2BHZA 2IGFL 3IYLW 4BZYA 5E8OB 1KCUL 3JWOL 3MXWH 4KKAD 1XF2B 4QEGA 4UTAL 5H2BB 2JB5L 4J4PD 3BP7B 3ULVC 3ZT5A 2Z31D 4X7TB 1BECA 1ZA6A 5J9PA 2W9EH 2ADIB 3HC3H 2ITDB 3QUXC 1HH9B 5T1LA 3NPSB 3V6FA 3ULVE 1I7UB 1YEDA 2R69H 3KJ6H 3FFCA 1FAIL 3C87A 4FQQB 3QRGL 4XVUC 4FFWC 2FWOA 3L5WB 4RAUB 6FABH 4R7NA 5E8NB 4J7RA 5C0BE 5F7KC 5F1IA 1E28A 1KJ2H 3VXMD 2Y4SA 3TEUA 3KS0H 3IU4H 5LGKA 5A2JH 5E03A 2DTMH 5HY9B 4NCC1 4ZO6A 4KJYB 4I8DA 2ADGA 4WW2B 3BQUA 5HI5D 4Q9CA 1OAYL 2HH0H 4V2BA 5FA4A 4X9HA 1E6JL 2P43B 4X6BA 4E0RB 3MJ7A 3QZWG 1HKLL 5E2TH 1Q72H 2IH1B 4JFQA 4X80H 4XZUB 4YDLB 4YEFA 3ARFD 3CSYB 5EUKB 4L5FH 1LO4L 4BSWB 2GW5A 4IS6B 3ZTNH 1VDGA 1VB9A 1ZK9A 2IADA 3H8NA 4U1SA 5C07E 2JJTC 2APFA 4GJTB 1QLFB 3QO0B 12E8L 3U2SB 2YD7A 1A7BA 3VD4A 5FOBB 4LF3A 3BP5A 3P11H 2Y5TB 3DX8B 3PWUB 2FJGA 1EEZB 4UBDD 2VDQH 1NBVH 3PJSA 1DANU 3FQRA 5F9JA 4M93C 1FNLA 3GBNL 2MCPH 1U3HB 3QISA 4OGXH 5T5NF 3OTTA 3E3QC 4G6FB 3U36B 4X5XA 1XF5A 1B0RB 4LSUH 1NH6A 3ARGB 1NCWH 4FABL 1CD9B 1XGYH 1MRFL 2DIJA 4KUCD 4KK5C 3N1PC 2D0GA 3SE8L 3E3QE 2RFXB 3F7YA 4PJXB 4MSWA 5EB9A 1A6AB 1IAMA 3ULUH 1CF8H 5DVKA 2D3VA 3TPKA 5K9JL 5EU4A 5C09D 4FQJH 3T0AA 2XOTA 3ROOB 4KJPC 3ARTA 3TH3T 4JFOA 3I2CL 4HC1H 4X4XA 1OF2B 4YPJA 2PKDA 5B39B 5HDLA 4W4NA 1QA9A 3F6IA 3MRRA 1KJ2A 3IETB 3MLVH 5K33A 1T66D 1A9EB 4NPYA 3MNWB 5D7LA 1U9KA 3PGDB 1IARB 2H9GB 1HILA 4DZBA 4OD2B 4K3HA 2R8SH 1AKJA 5BRZD 1AHWB 5T3ZL 4Z5RB 1BF8A 4J12A 5IGXL 1QSFB 4PGCA 3ULUF 3SE9L 2CR6A 1FPTH 3CX2A 4XMKL 3I6KB 1H5BB 4DOHB 1YEEH 1FDLL 2D2OA 1YY8A 4KXZI 4L4VD 2E7LA 1F02I 4U6VL 3QA3A 4JDZA 1NDGA 4QCIB 5C0CE 4GRWH 2QV2A 2C1PA 4PLJD 2A6JA 2MQ0A 2QL1A 1Z0MA 4NWTH 2H1PH 4XNYH 1A6UL 2CK2A 5DUPH 3VWKA 4ZFGL 2J3SA 3QUZA 3HZMB 3G6DL 5HGDB 1BBDH 1S9XB 1PVHA 3H7LA 5BVJA 4CJ0A 5AAMA 5E5UB 4HZLA 2F5BH 2R4RL 3MRPA 3W0WB 5EORH 3K2UH 2V17L 2GJ6E 5INDB 3P77A 2HKHL 4ODSL 1AQKL 1BFVL 3QEQA 4LHUD 4WHYH 5DO2D 4HPOL 2VXSH 1KB5H 1SY6L 1ZHKA 5T1MA 1XH3B 2FX8L 3H3PH 4JFDE 1JTTA 2RHEA 5GGTL 3GIZL 1EFXA 2X4PB 4MQTB 4WJ5B 1XIWA 1CXFA 3FQNA 2FB4H 2PO6C 5EO9A 3HG1D 3MTRA 4NBYB 1KIRA 4DWHA 4Y4HD 5IVOA 2FLRT 4HC1A 3MRKB 4C55A 1TJHH 4PJBE 4OAWB 2IALB 5BS0B 4FQLL 4POYA 5DYOA 1MAMH 4OGAC 2ERJB 4ELKA 1E27B 3MOQA 5IK3A 4X9FA 5D7IA 2DAVA 4HWEH 4TVPD 2IBBA 1QUNA 5HVHB 4EI5C 1ZWIA 1EUTA 4FP8L 5KSBB 3BKYH 1JF1A 3BSZH 4RBPH 5CIPB 1H3PH 1KCLA 2X4NA 3AM8C 3NIFF 3V4PH 2NY5C 4JM4L 3RWHB 4NHUB 5ETUA 4CADA 5C0FA 4NDMA 1QG3A 4LMQE 4EOWL 1LO2H 3SKMA 4NZTL 1OAQL 2NY6D 1XCTA 1X5KA 1I7ZA 4MB4A 5DLML 5TDNB 5E0QA 4LLVA 5FM4A 3PHOA 4OFDA 2G5RA 3NCCB 2N7BA 2WP3T 4OF3A 1U91B 3S88L 3KPMA 1GHFH 3HLAB 3P0GB 4GXVL 4HIXH 2CRYA 3EDEA 4Y0GA 2QSVA 5M95B 2RBLA 5EIIA 4CMMA 4X0KA 2C9AA 1S8DB 3E6FA 1N59B 4HAGA 1KB5A 5IFJA 1J10A 1K6QH 5KVMC 3KDMA 4P4KD 3EJJX 4XP1L 4PG9A 4GLRH 3FN3A 5LWYL 4F7PB 1A3RL 1CFNA 3RIFK 3HE7C 2VQ1A 1JWMA 4HWBH 5DD1L 1KFAH 4FXKA 4UAOC 1QFUL 3SE3C 5D1ZC 3R8BB 2VLKB 2KDGA 3GMPA 5FYLD 4HBQA 3MGOA 1T3FB 2E9BA 1P7KB 1NGQL 5GGRY 5IW3A 5JUEL 4EZMA 2AJZB 1A7OL 4LOUC 4ZMAT 4G8IB 5I1CH 4QT5B 2XTJD 4GXUN 5HGBA 4Q9RL 4KRMB 3JV6B 5ELIA 4KAQL 3A6CL 5GGRA 2X4TA 4PJGB 1FL5B 2XKNB 5ID1B 1WVZA 5DWUL 3BO8A 4JKWA 5ISZA 1D9KB 4LSRH 3MBEC 4JB9H 2QKIB 5IHZA 5J0BA 5CEXA 2Q8BH 4YHLL 4WHTA 5DFWH 3ZE1E 2MPAH 2ZNWA 3RUGE 3CX5J 4U1JA 4F9PC 1EH9A 3ULSB 3RNKA 1R3KB 2HP4A 35C8H 2MHAB 3WJLA 1IRAY 3MV8A 1W72L 5EZJA 1HHHA 5L6YL 5FF6A 1I7RB 4HDIA 4HKJB 2ICEB 2HYMA 3QIBC 3CFEA 1LO3H 4HZAA 1MREL 2Q8AL 4JFFB 4EUPH 3X12B 4XBEH 3QXVA 5D72H 1FFNA 1MCFA 4TRPL 1U6AL 1DQJA 3HTLX 1ZLWK 1BVKB 4OLUH 3MBXH 5C6WH 3CFCL 4KI1A 3NN8A 4P9HH 3TV3L 3L7EB 5FV2A 4P46B 3O4OC 3MRMB 3BPNB 4YK4C 5TDPB 1CDYA 2EXYC 3KPPA 4HWBA 3BYTA 3EOTL 4EJ1C 1PDKA 2DYPA 4P4RA 4I13B 1YQVH 1XGTB 4HK0A 4IM8A 3CU7A 5HTSA 1B90A 4A2MA 5DTFB 1W0VA 1T7ZA 4UDTB 5J1AB 2WNGA 2V9TA 3LH2H 4F7CB 1IC1A 3CZJA 2YPLE 3A0OA 3WSQH 4HBCL 4Q9BA 5GHWH 3L5IA 3C9NA 2GEEA 4GKZB 2FEEL 1MJ8L 1X5YA 2NXZC 4P5MB 4CNIA 4G43A 5C0AE 3AXLB 4Y4FD 3BZ4B 1I8IB 3QHZH 5IJKC 3CFDA 4QHNB 3QI9B 1F3DJ 4I18C 3OPZH 4Y19E 1EX0A 1DQQB 1KCRH 4QXTA 3MV9A 3V7AE 3WFBH 2VXVH 2XN9A 1MCBA 5CD5C 5C9KA 3GHEH 3D2UB 3RPKA 3T04D 3N9GL 3OR7B 3QIWC 2HG5A 3WUWA 5DJ8A 1ZLUK 4JZOB 5F89A 4OCSH 1L7TL 4CRPA 5GRVK 1EMTH 4BK5A 4RFEB 4EXPX 4PJ9A 3GB7B 1RZIB 3QDGB 3RWEA 1Y0LA 1H3GA 3BJLA 4POUB 4WWKA 1FRGL 1FNGB 2VO5A 5GZOC 5AYUL 4FQIH 1D6VH 4YBQC 3T65B 3INUH 5IOPA 4EUPA 2I25N 3IKKA 2A9NH 3BMWA 4D9LH 4L9LB 3EUUA 1OCWL 1R3LA 3QFDB 5HYIA 4PJAA 4PBVC 5B8CC 3TM6A 5IVNA 1AC0A 1J0KA 2PCPB 4OFIA 4RGND 4FQCL 4S2SB 5DEZA 2XKSA 3CLEH 1UWXK 4N8PA 1UM5L 5BW7A 3DV6A 3S3JA 1UH4A 2P5WE 4ZPVA 3G5XB 1J0HA 3FAXA 1LO0H 4G9FA 4QRPD 2DLEA 5DRXA 5E70A 3I85A 2BVOB 1E4XH 4HX1B 3SDAD 1MFAH 1SBSL 2RQ8A 3CH8A 4TYUA 3Q48A 4M02A 4OFPA 5DD6B 4Y5YA 3TZVB 5IJVB 2VLRD 4OLWL 4HWZA 1KJMA 3UTTB 3HPJA 5IIEB 2IQ9H 4K8RH 1EPFA 5IBUG 1WF5A 4P5KB 5ESVB 2CKBH 3CMOH 5DJDA 2ZCKH 3PP3H 1RFDL 4Y8AA 4NZUL 4PRNA 4KHTH 5HI3C 3VWJA 3FQWA 3HFML 2GIYA 2VLMD 4NKOA 4U0QB 5F96H 3O6LL 5C0DA 1MCWW 4IRJC 2X6MA 4PJFF 2AJSL 3D69A 4MCZA 3E2HB 5FO8A 4NT6B 3IT8D 5BQ7A 3ALXA 2IWGA 1ETZA 2Z4QA 4P2QA 3T4AA 4OF7A 1EHAA 2H2SD 1F8TL 3QJHB 1RY7B 4LP4A 2BVEA 1S78D 3MXWL 4GG8B 1J5OH 2IQAB 5F7WC 1NANH 5GGSY 1U8KA 4H88H 4NZRH 2R1YB 5CP3H 1QNZL 4KRNA 5I16B 4F58H 3MLTB 3RY4A 2W9EL 1NCCH 3KPRE 4R0LA 1BVLA 2HRLA 1YEJH 2WBJB 4P2OA 1OWWA 1WT5C 1HH6B 2FH6A 4KJQD 1ZVHA 2R69L 4RQQA 3KJ6L 3T0EA 3QDJA 3LKSA 1ZT1A 5I6XB 4ODUA 4L4TA 2ICWI 2LU4A 6FABL 4UQ3A 3WE6B 5BJTA 4H8WH 1VEPA 3Q5YA 5J6GB 3QXAA 3D3VB 1K2DB 2KKQA 1KJ2L 2MQ3A 4OUOA 3HZVB 1JZ5A 2UYLA 3IU4L 3AU1B 4DAGH 1N3NB 2DTML 4ZO7A 3EO0A 3MYZA 3NACH 2HH0L 1VA9A 4PJ8A 1MCOH 1PYWB 1RD6A 3BP6A 5E2TL 1Q72L 3OJDB 5C92A 2PYEA 4X80L 2DOCA 5C8JA 4DUWA 2CKBA 1LNUA 2G60H 3C60D 4EVNA 1P4LB 1QLEH 4L5FL 4DGIH 4PB9H 3ZTNL 5D5MA 5E2VH 2NY3B 3RQ3A 5TE4H 1HXMB 1J0ZA 1FVDA 1XR9B 3WLWC 1Y18B 4RZCB 5GS0H 1UVQB 3P11L 3MRGB 2QR0B 2VDQL 1NBVL 5I1DA 3KPSD 1CGYA 3NCEB 5TQ2H 4KZDH 4HUWB 1URLA 1RZ8B 3HR6A 4EDWH 4NQVB 5HHQB 4AMKH 5DC0A 3FB5A 5CP3A 5ERWA 1KBGH 4OGXL 2MCPL 3RWDA 3VH8G 1CG9A 4MAYA 4OUUA 5F7MC 5J7CC 3C5ZB 4LSUL 1NCWL 2FL5B 4HT1H 1XGYL 5C0GB 4N8VG 4FFVC 5JPMB 1A7PH 4HUMB 4JQVC 4WO4A 3MODL 1BZ9A 2R56H 3ULUL 1CF8L 3TVMB 4QF1A 1T6WA 1NBZA 3OAYH 1FLTX 3BUYA 2L7UA 5JZ7D 4HC1L 2FX7H 2NY1D 2I9LA 5HHXH 1T83A 1T1WB 4NJ9H 1F45A 3MLVL 4HMCA 5B22A 1WZ1H 5FCUH 2NMSA 4PRID 1UKSA 3ESVF 5DJAA 4KI5C 1NCUA 5E5RB 2DQEH 2A6KA 4ZUWA 2NY0C 2R1WB 3IFOA 2ESVE 3VFUA 2FWOB 1RZFH 3OX8A 3B6SA 5CHNB 4HKXA 4KI5E 4I3SH 3S3PA 5E2WH 3P9LA 3SE4A 2FIRT 1FPTL 1L6ZA 4WFHD 5F1IB 4OTXH 3EYUH 4YGVB 4KDWA 3WBDA 1FL6B 5CMAB 1YEEL 5MENA 4YDJA 1X5AA 2BERA 5F9OH 2Q6WA 3L7FA 3R0MA 4D9RD 1U58B 5F6IC 1QBAA 1MPAH 5ALBH 4NWTL 4AZ8A 2H1PL 4XNYL 5DUPL 1RUPH 5EU3A 4HHAA 1ZLVH 4FXGA 4GG6E 4FQXD 5JR1H 1NFKA 4PJEF 1BBDL 4IRSC 3PL6A 2F5BL 4NBZB 1JGEB 5EORL 3K2UL 3TO4D 1A0QL 3QULA 5DJZA 1L4IA 4BQCA 2VXSL 1KB5L 1KLGA 3IGAA 3H9SE 5L2KA 5IR1A 8CGTA 3H3PL 3MLYL 2FJGB 4QXWA 4OIIH 5IBUB 1HE7A 3MV01 4XGZA 3K8MA 5JIHA 1CICD 4HLJA 3BZEA 5IEKA 5HHOB 1OARH 2FB4L 1AR1D 2DBJA 4NOBA 3KYAA 4E41D 4I48A 3B3IB 4LPYA 1CXLA 1FFRA 5EUOE 3QPXH 3LIZH 1XF5B 1TJHL 4OKVA 5GRWA 5J89A 4X6DE 2FGWH 5EOTB 1MAML 4DKEH 4KROB 4XVSH 2ZUYA 3F7YB 4HWEL 3IXTA 2G9HA 5C08A 1VERA 4KKBD 3BKMH 3BKYL 3BSZL 1YEFH 4L3ED 2FRGP 1H3PL 2MQCA 3V4PL 3KHOA 4PUBH 3ETBF 4K3GA 4Z7VF 1PLGH 1OOAA 4AEIH 1AC6A 3FONB 4YX2H 1K3ZA 2PTUA 1KXVC 1QA9B 2OCFD 4QOKE 3DETC 4AT6A 5FO7B 1MCNA 1LO2L 1NBQA 1BVZA 4XP9H 2Y9RT 3RDTB 1NEZA 4PY7A 4ORGA 5EO1A 4U1KA 5D70H 1SJXA 3WFHA 1I1AD 3VXSE 4BK4A 2FATH 3IXAB 4M43H 4TVSa 4LLDB 3FCTA 2EYTB 2DQFA 3MMEA 1DFBH 4NNYB 2A6DA 1GHFL 4KTEH 1FSKB 1Y6KR 3UBXG 3UTSB 5D2NA 5I8CB 5I71B 2JKXA 2YOCA 3RZWA 1K4CB 2VLJA 4X6FA 3WLBA 1YY8B 4LSTH 1FL3B 3VFSA 5T33H 3NPSC 4LSPH 5JIPA 3O3EB 4MNHA 1G9NL 4ORZC 1K6QL 3S35X 1BQHA 1QRNA 3L3DA 1CN4A 4KKNA 1BJMA 4Z7VA 1U8IB 5HVWA 2J12B 1PZ5A 1T04B 4K9EC 3SGKC 4XWGH 5BVJB 1X5XA 2BXZA 5DEGB 3H9HB 3MRPB 2OTUB 1MLBA 3IDJB 5HYJE 2PW1A 3TBTA 4G42B 3MRHA 3P77B 3B2VL 4HWBL 1KFAL 2O5XH 4NQED 4PD4K 5D93C 3EOAA 5CSZA 1ZHKB 5KSAD 5T1MB 2EDTA 3GMMA 5FKAB 2ATPA 2VR9A 4WW2C 2MTPA 2XQBH 5I1CL 4PYGA 3PV6A 1V3KA 1XIWB 3FQNB 4YDLC 4DVBB 3KPLB 2CUHA 1T22A 4GRMB 3IFPB 2X1QA 5BZWA 5CP7B 5DYOB 2XWBB 5F6HI 4L8BB 1I3VA 1C12B 5EOQL 3OMZA 4JB9L 3MRBB 1T1ZB 5IK3B 1MF2H 4HUXA 2EEBA 2UVEA 2Q8BL 1J7VR 5E00B 2MPAL 2AV1B 1BWWA 3IFLH 1EBAA 4ELMA 1G7LA 2H8PB 4X9BA 35C8L 1J87A 3VRJB 1T0NA 4XPTH 3DX7A 3V5DB 1U3HC 3S35H 4ZO9A 5KSVA 3VD7A 3DHMA 1VFBA 3V79C 1LO3L 3JV4B 4C4KO 1FLRL 3ARGC 4RNRA 3VD9A 4WFED 1WZMA 2NTSP 4XBEL 1P2CB 5D72L 2GY5A 2D7QA 2QQKH 4OLUL 4LLVB 1QSED 3MBXL 3QNYA 5AD0B 1T80A 3RVVD 2EDRA 1ZAGA 4P9HL 5IFAH 4PJXE 4XB8A 3LKQA 1SEQH 4P2RA 1Q9KA 4O2EA 1JVKA 3PE9A 4MDIA 2ZSWB 4QRRB 1MRCH 3FOMB 4JM2A 2E6JA 2NZIA 5EIIB 2C3VA 5DHVH 4CMHC 4GRLC 3QO1B 2OQJA 5IB1B 5DSCA 4OGZA 3PGCB 1G7MA 1YQVL 4G8FB 2CRMA 1U3YA 2X7LA 3FT4A 3OZ9H 2VB5A 5JOFA 1DSFH 1ORQA 2APVA 1ZLSH 5JHDA 1P84J 1AHWC 1QZ1A 4OLZH 3HZYA 2BMKA 3V6OA 3LH2L 2NW3A 5GXBB 4ZUUB 15C8L 4NQSB 5A2IH 5GHWL 2MSPA 4NO0D 4EN3B 1CFNB 3DNKA 4MQXD 2YWYA 1JWMB 3U0WH 1H5BC 3OPZL 5H35B 1RUAH 2FECI 4QHKI 4D94A 1KCRL 3MGOB 4ZS6C 2VXVL 3UXFA 3WFBL 2XQYG 3B83A 3GHEL 4N5ED 3TNNA 4LMQI 4KTDH 4DOHE 4PJ7F 3DGCR 1CL7H 2Y36H 4OCSL 3VG0H 1AD9A