5GS0L

Crystal structure of the complex of tlr3 and bi-specific diabody
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
105
structure length
105
Chain Sequence
b'DIQLTQSTSSLPASLGDRVTISCRAGQDISNHLNWYQQKPDGTVKLLIYYTSRLHSGVPSRFSGSGSGTDYSLTISNLEQEDIATYFCQQGNTLPWTFGGGSKLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toll-like receptor 3
molecule tags Immune system
source organism Homo sapiens
publication title Crystal structure of mono- and bi-specific diabodies and reduction of their structural flexibility by introduction of disulfide bridges at the Fv interface.
pubmed doi rcsb
total genus 19
structure length 105
sequence length 105
chains with identical sequence Y
ec nomenclature
pdb deposition date 2016-08-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5gs0L00
3RDTA 5MEQA 3H7BA 3NGBC 3RNKA 2WINB 4DQOL 3TEUA 4BZYA 5H94A 4NBZB 1JFQL 4MJIA 2OJEA 3FQRA 4NT6A 3SJVD 1GGBH 4WTZA 5I15H 4NKOA 3BSZL 5CJBA 2XKNA 4LCIH 1OGTB 4HC1H 4N90D 4DGIH 2JCCA 5EC2B 1HKFA 5KVFH 4Q9RL 5A2JH 2R69H 4LFHG 4XI5D 1MCIA 2MKWA 2BY0A 3QPQD 2UVFA 3J7HA 3GIZH 1OAQH 5E4EC 2H6PA 5FOJA 1PG7X 4K3JL 3RP1A 2H32B 1NL0L 4NQXB 1RVFL 2GY7B 4XNQA 1F3DJ 3HUJA 5E2WL 4L4TB 1U0QA 3DPBA 4MB5A 4NIKB 3LKRB 4XP6H 1E4XL 1AHWC 3A6BL 1DL7L 1RFDL 4R2GD 4PJ7E 4TUOB 3QJHA 2ADJA 4G8IB 3QZWB 1JPSL 3MOAH 2CQVA 4OZHB 3KPNB 4D0DB 4QTHB 3CLEH 3P11H 2VLJE 5GGRY 3KPOA 3W81A 3BYYA 1QOKA 1AGDB 4RIRB 3BEWA 4PREA 2PYFB 4F2MB 3TZVC 3BPNB 1NCUA 1SJHA 2JB6B 2QQNH 4PJDA 1I9RH 4Y16A 2Z93A 5SX5H 5EU6A 5GIRA 2D7TL 3VXPB 3D69A 1CD0A 1EAJA 1IL1B 5AD0B 3GNMH 3WNLA 1F4XH 1KIPA 2FJGA 4S1DC 4UDUB 5IBTL 5LQBH 4YHKH 1DSFL 5D7IE 5F21B 5IR1B 1RZGB 2HJKB 2I9LB 5HI5C 5ADOL 1WTGT 5DGQA 4LLVB 5L9DH 3EJZD 5IJKA 1U8OA 4AG4L 5D7LA 2NPLX 3MMEA 4NO5A 1JNLL 2NZ9D 3AREA 1C5DB 5E5UB 4O4YH 2VN4A 1CGVA 1ZT4B 3CLFH 4P9MH 1NCAL 1NCBL 4HUUA 4M1DL 1YPZA 1M6OB 4ENED 2UYLA 3F5WA 4KKNA 5IHZA 2F53D 8FABA 2J8OA 4HJ0D 4X9IA 3T04D 4QRSB 3A0OA 3P4LA 4I3SH 3RNQB 4HWBL 2MCPL 1NCCH 5FUOH 3BMVA 2AEQL 4X4XA 4U6YB 5D7IF 2MQCA 4HH9B 2DQDL 5CEZH 4PJGF 5GRUH 1P7HL 3L9RA 3O9WB 2FZ3B 4J3OC 5BW7C 2HKHH 5EWIL 4FQ2H 4RGMB 5BRZD 1KLFA 1KLGA 2Q8BH 4DWHA 3QXWA 2X4SB 4ERSL 1YEEL 4YE4H 3FB5B 2B8OT 1A5FH 5IF0A 4HFWA 3CX5K 4MYWB 4ZUUB 3Q48A 1JGDB 3T0EC 5K59F 3SDAB 4H1LG 4P2QA 2HT4D 5BS0D 1GC1H 4O02H 5GGUB 4CJ0A 1HYSD 3VFPA 3WSQL 2AVGA 1FLTX 3TM6A 3OGCB 4Y5VC 5LGJA 3ULVD 2EDOA 3IDXH 4PG2C 3O4LD 2NNAA 3EUUA 3QIUA 3BH8A 3FFCA 1A64A 4HUMB 3DRQB 3D2UD 5FGCB 1F6LL 2YD3A 3QDHA 4JDTH 2FEDC 4ONHA 5TE4H 5F6HJ 5CUSL 5E8EB 5DUMH 4UIMA 1HHIB 1OF2B 3NCFB 3T3PE 5IT2L 4XX1G 1CICC 1QP1A 4FP8H 1KPRA 4JDZA 5I19H 5SWZE 2ZOLA 5E70A 1LO5A 5CILH 1LK2B 1YEFH 3OKLA 4XVUD 1UENA 1AQKL 2DM7A 3D85D 5D5MF 4HIHA 4PJAA 1TCMA 1CT8A 5LCVL 5AUMB 4H5SA 2ZCHH 2B7DT 5H35B 3S35H 3MBEB 5IQ7L 2APWA 2FB4L 1J0HA 3L3OB 4IDJL 1K8IA 3LKOA 3O4OC 2OL3L 1XGTB 4R90H 4LEXH 4RNRA 2Y07L 3WFEL 4PJ5A 4LP5A 3IU3B 4MJ6B 1T3FB 3PHOB 4ZS6C 3S98A 3QCVH 3O2DL 5F7FA 1AJ7L 2NY4D 5GQBA 4JFPA 5HJ3A 1KCRL 2CUIA 5C08D 1ZTXH 4WUUB 4MHHI 1RJCA 1CGSH 1U3HB 5D1ZA 4R6UA 4M48H 1XEDA 3GSUA 3PL6D 2ZWLT 5C0CD 4JDVB 4AENB 3RI5F 2YPLD 3FT2B 2OSLB 5CIPA 4LFHD 1F8TL 3MLYL 4OZIF 1YMHB 4PRID 1HILB 4JFHE 2OM5A 3BFOA 5FO9A 4POZC 5LGKA 3A67L 4UQ3A 3KGRA 5DA0B 5A3ID 3VFGH 2OK0L 4OLVL 4MDIA 4LHUB 2NY2B 3S9DB 5KVFL 2X1OA 3FRUA 4LLYA 4XC3H 4KC3B 1MHPL 1P9MC 5DT1H 2COQA 1AGFB 3HE7C 4B41A 5ESVA 5IVXF 1X4ZA 2UZYB 4HIEB 5C07D 2FL5A 4NM8L 2BOBB 1VGEH 1S9XA 1E4XH 1RHFA 5DUBB 3RIFF 4MB3A 4Z7QF 4MXWH 2ATPB 2B4CH 1CVRA 2APTA 3LSOB 3WL9A 4MJIE 5E2TH 2DLFH 5I2IB 4YWGH 3UJTL 3LPFA 5HDBE 3O3EB 4MQ7B 4OLZH 1A3LL 2UZIH 4PJ9B 4ZFGH 5CJXA 1W72B 2XTLA 5H37H 6FABL 1U8MA 1GIGL 4D0BB 2AJVH 4XPFH 4JG0L 1KPVB 5KVMC 1NCWH 1BIHA 1KC5H 3UC0L 4XHJC 2WQ8A 4XP1L 1NUFA 3MXWL 1NMAL 4MNGA 2NY4C 3LB6D 4R4BA 4N0UE 1R6VA 3BUYA 2GAZB 5EIVA 4HBCL 1YQ2A 1M7DA 1HEZB 4JHBA 1U3JA 2VLLB 1HHJB 1G7HB 3B5GA 3FMGL 4LIQH 4U1LB 4U2ZA 3S4SA 1C5BL 3K8KA 3L3DB 1OARH 4LHUG 4LARL 4IOIB 3ARPA 3DUSB 2O26U 4Z7VA 3GUTA 4B53A 4GRLC 3BKJL 1PD6A 3TBVB 2F8XC 2BCKA 3L3GB 4C4KO 3INUH 3G04B 4JY6A 1CD8A 2ZNWA 5ADPL 4NC2B 3T65A 2YMXH 1B0RB 2OP4H 2YD8A 1JYXA 1BJ8A 3FL7A 3VXQA 1GHFH 2A1WH 2OTWA 1VA9A 1H8NA 4Y2DB 3GB7A 2UWEF 5LWYL 5C9KA 5GSRA 5D6CB 2XN9E 5DD6B 3RUGB 2DIJA 5IESL 5E94B 5F3HB 4PGZA 4XB7A 4YDVA 1A4JA 4NQEE 1Y0LB 5BVJB 3VGBA 1FFRA 1I8MA 1LO3L 3HI6H 5K9KA 5FF6A 5EUOA 1AGCA 2DWDA 4OKDA 4IBLT 1KTLA 2RB8A 3H6JA 3H0TB 1FYTD 4TYUA 2D7NA 1BVLA 1Q1JL 4KPHH 4WFEE 5FO8B 1SBBA 3EFDL 1F11A 4KXZH 2M1KA 4NHUA 3MZGB 5E8OA 1BQHB 1D5ZB 2VAAA 4K7PH 4XWOC 4HV8A 5J57B 4G5ZL 4I8DA 3VXSD 5J4MA 2R2HA 1QD0A 4I0PA 5C86A 5D1XA 1EJ6A 5IJKC 3IAPA 4EDWL 3ILPA 4M00A 1IBGH 1ADQA 2F5AH 4OIBA 1VADB 2V7HB 1OL0A 3BZFB 3CFBB 2J5LC 3LH2L 4GQ9H 1NFIB 4K2UH 4YIQB 1VFMA 3WJJA 4JR9L 4KVCH 3GSXB 1BPVA 4PLJD 1XF2A 1MY7A 3CZFA 4JQXA 4WHTA 1HNFA 3TNNB 3S97C 3R4DA 1OP5H 1TMCB 1CD1A 2YUZA 3IJHB 2WBKA 4OAWA 5HHQA 2X4UB 4HUVA 1WT5A 5SWSA 5DUPL 2Q86A 4NPYB 3H9SD 4PJCB 3LS5H 3WN5C 3IAQA 4OFDA 2WIIA 3GMOA 5KVEL 4PGCB 1HHKA 4L8CA 5ERWA 3LIZL 5TQ0L 2VSCA 3BHBA 4G6KL 4N8PA 1ZLVH 1HWGB 2AXJA 4HS6A 4P2YA 2EDWA 3T1WA 5DMYA 3NACL 3QULB 5T1LB 2I25N 2BRRH 1IAOB 3JTSA 1MFDL 3QCUL 4AIZB 1MHCA 5DRZA 3RGVA 4K9EH 3ULSB 3AMKA 2E6JA 3HS0B 1MNUH 3HCVB 3MLYH 4J1UA 5HGHB 2P5WD 2DQFA 2EDRA 3E8UL 3MLTA 2RFXA 3TN0B 4L8SB 1ED3A 4DAGL 3IFOA 2DTMH 4OF7A 4ZOBA 1ZEAL 3I6GB 1MOEA 2HMID 4I77L 2W0KA 4WJ5B 5IVZB 2H3NB 4G6JH 2VZUA 2P5ED 1EVUA 1TITA 1UGNA 1MCFA 5J8OA 4H26B 1ZHNB 3L5XL 2BNRE 3F7YB 3GSNA 1AKJA 4Q6IB 2DQTL 3B2UC 1VGEL 4BH8B 3WS3A 1B0GA 1J8HE 1MJUL 1IQWH 4AEHH 4OCXH 4GMSL 1G7MB 2AK1L 2D4FA 5D2NE 2XKNB 4NWTL 2JCCB 4MVBD 1R5WA 1N4XH 2DD8H 3G6JA 4E41E 3O6LH 1SEQL 4F57L 2YPVH 5FYJU 2EKJA 1FVEA 1A3LH 2UZIL 4OJFL 2C1OA 3ETBF 1RHHB 3KWWA 4RAVA 1MCOH 4FQQB 1UCTA 5B38B 2KZ1B 4JKWA 5JW4R 5FYLL 3NN8A 1T2QL 1XIWC 1NUDA 2R0KH 4QRUB 3EO1A 3OKNA 4LIQE 4KMTH 4WTZG 3TT3H 3LOWA 3QJHB 4YAQA 1C1EL 3QZWA 3KPPA 3QDJD 1A7NL 2CDGB 2UWEA 4FQ1H 3KPNA 1EBPA 3ECBB 3VXUA 5CIPH 4X4ME 4JN2B 4YFDB 2EDNA 1OGAD 4XPGL 1EEYB 3CFKB 2X4PA 4WCYH 5T3ZD 3ARDB 4B7IA 4WW1B 4OQTA 3MRGB 4NHCH 1U8HB 1RIVL 3VMOA 2JB6A 4HT1H 4FQCH 4JFFD 3SY0A 2N4IA 3KPMB 2B2XL 4JO2H 4U1KB 3OG6B 3D69B 5HSFA 1NBYB 3O3UN 5JHDB 1FFOB 2VL5A 4D8PB 4KJWD 3VD7A 1MH5B 3HMWL 3REWB 2OX5A 3GK8L 3CDCA 5FEBA 3QNXA 1MCNA 1MCBA 4Y4FD 4I3RH 4JZJA 3BD5A 1VGKA 1JMZA 1CGYA 3HUJF 5GZOD 4NO3B 4DN4L 3LN4B 4HGKC 5EU7E 3NZHH 4GRLD 4XCNA 2FX9L 5D2LE 4JRXB 1K2DB 5SWZD 2IG2H 4YEEA 2GIYA 3BVNB 5EOQH 2XY2A 4J3XA 1PZ5A 3E6FA 4TUKL 4P4KB 5K9JL 3RY5A 3WNNA 5FV2A 3GBNH 1IARB 2XTJC 4HAGA 5TE7H 5BVPH 5DMIH 3DVGA 2NLJA 1FG9C 3QIBA 2XRAH 3AVEA 5DYOA 5C6WH 2DJUA 3U0TA 3C5SA 5I17A 2B1AH 1QFWL 3D2UA 3L9RB 1R5IB 2NR6D 3DO7A 2AK4E 2FBOJ 1BZQK 1F3JA 2APXA 3QNYA 1AIFA 5IW1A 4G80B 1S8DB 2HRLA 4WFED 2VXTL 4RFNB 3K2UL 3QQ4A 3W0WA 4K7PY 2X4SA 1QO3A 1NSNL 1AXIB 4GRLA 2JJVA 5J9PA 4M9OA 3QUYD 3VU2A 5ETUB 3TYFA 2AGJH 5IBLC 3RUGF 1A6UL 1JGDA 1N64H 5D70L 4PTUA 3AU1A 1ZLSH 4YUEL 1S5HB 3RZCA 3DMMD 2DM4A 1DBKL 4TRPH 5ID1B 2XXMB 3VFVB 3MRHB 4LSVL 5IMMA 5HI4D 2PW2A 1PY4A 4KQ4H 5L8LB 5E24E 4F7EB 1K6QH 3D3VA 1HI6B 3C09B 1UWGH 4UT6H 4XNMA 4ZDHA 3IS1X 1MI5B 1FBIH 4RQQB 1X3DA 3VD5A 3TVMD 5F1IB 4RDQF 2R56H 4PTTA 5ESAA 3VXTB 1CK0L 4XCEB 4DKAA 5I1EH 3D39A 4PJAB 1HZHH 1CL7I 3MNWA 3QDJA 4NQDD 4L8SC 4PJIB 5CMAB 3H7LA 4OTXH 3AC0A 4RGOH 3V6OC 1C12A 1XMWA 1MCJA 1XGTA 2X44D 4E42B 1TZHA 5D93C 5EG6C 3IU3A 3MBED 4HIXL 1I7TB 3OPZL 2VLME 5HHOD 4N9GA 3QWRD 3MBXH 3DBXB 5EZLA 5BZWB 1ZE3C 2J88L 3Q1SH 4G9FA 1OP3H 4ZOAA 2QQLL 3FQTB 4LVHB 5DJ6B 3RGVC 5JW3H 3QEHA 2SEBA 1XZ0B 2G9HA 4PB9H 3GMPB 1HDMB 1NC4B 1U91A 3WJLA 3HC4H 4FA8A 1Y18A 4JDVA 3QIWC 5HVWA 5J6HB 2JJTA 4XVSH 4JM2C 1MRCL 4FABL 1I3RB 2CLZB 4WUKL 3QHFH 1KGCD 4PPTA 1HILA 3UTQB 3HPLB 3S34H 1UZ6F 1AR1C 4L29B 2ZUQC 3V5KA 2DMKA 3PWJB 3TCLA 3MRQA 1QBML 3RDTB 2BERA 3ARFB 3TBSB 4M1CD 4NZTH 3L7EB 5J11B 5L88H 2B20A 1T83A 5D1QB 1DQTA 3F7RA 1DR9A 5C0AE 3ULVC 3KPOB 4GLRI 1A9EB 2QKIB 4YQXL 1ND0A 5ITFB 1J0YA 1KIRA 2BX5A 1QRKA 1KLUA 4FMKA 3SGEH 4DKEL 1G9ML 3CDGB 3PWUA 4Z7QE 1N7ML 5AG8A 4OZIB 2ATPA 4LNVA 4OCRH 1N6VA 3U7WH 4WEUD 5C07E 3W11C 1KG0B 5HHMD 4PJ9D 4O2EA 2B1HL 1U8JB 1DUYB 3SJVA 5L2KB 2E27L 1SJXA 2ADJB 3L3HB 4Y5YA 1WZ1H 1RZGA 1WFNA 35C8H 1A7PL 4LCYA 5I71C 3HAEA 1MCWW 3BRGC 5D7LB 4AMKH 3A6CH 4LSQH 1D5IL 1DCLA 3HPJB 1CGUA 3FKUS 3IDUA 3B9DA 4OQTH 4OFYA 1SJHB 1ZT4A 1DFBL 3LY6A 5KN5B 4Y1AE 4H0HB 1HSAA 5CSBA 4MDJB 5I66B 3KS0J 4GKZA 3V5HA 1HE7A 3EW3B 3MUGA 3P2TA 4WI6A 4OF3A 1MCHA 1EGJH 3QIWB 1KIQA 1X7QB 3PWLB 1AP2B 4O4YL 4UDUA 5BOPA 3V4VL 4FNLL 4GAFB 4CN4A 4XBEH 3VXME 5J7CC 5T1DL 1MHHB 3VG9B 4I0PD 1KTDA 3P73A 4DQOH 2VLKB 4X7TB 2GSIB 3QAZC 4XNYL 3RPKA 2JTDA 3ARFC 3ARUA 1BVKA 5DR5L 1PGRB 4JFHD 4M7LH 1EMTH 5TE6H 2WUBL 5E00A 1FP5A 4NNXA 1S9YA 2BY2A 2R1WB 2BNUB 4HUUB 3HN3A 3QDMB 1RJLA 1J1PL 3TP4A 4AJ0A 4OD3L 4YBLB 1IGJA 4F7MA 1KF9B 5C08B 3QCTH 4OI9A 1DLFL 3GIZL 4K71B 4RMRA 4QRPD 4I48B 4N90E 4YE4L 1Q9OB 4HF5H 4LPYA 5FDYA 2L7JA 4MXQD 3I84A 5IROA 3ARWA 2OI9C 1MLBB 3MLPA 3GO1L 5L8JB 3JVGC 4MA1B 4RGNB 3ZT5A 1E6OL 2W91A 3H0TA 1UB6B 3I02B 4ZAKB 5F72S 1IC1A 2YPKB 1F11B 4PJXE 2HH0L 1D5ZA 2VAAB 25C8L 3QEGH 5D7IB 1SM3L 2ZSVA 3DMMB 1MLCA 1T1XB 3GMLA 3ARGC 3O0RL 3V7AG 4QRPA 5LGHL 4MA8L 5BMFL 5D1XB 4HFWB 4IRJC 1JHKH 4GT7A 5H37G 5AUMA 4WV1A 1HKLH 3PJSA 1FL6A 5GS0D 4JY5L 1WWWX 1OGAE 3BOVA 4Y0GA 1T22B 1MVUA 3KPRD 4K8RH 2DYPA 1IC4H 3AS3A 4JZNA 4CVXB 1F4XL 5I30H 5KBNC 3BGAA 1Q38A 3KYOB 1FJ1B 2XWBA 3FFCB 5D2NB 4PJHB 3T4AB 3BW9B 4PJIF 5DHVB 1OAUL 4MAYC 1J8HB 1NGYB 4WGVB 1JZ3A 5TPWL 4MJ2A 3KLHD 1CTNA 3IXAB 3OWEA 1KJ3H 2WIIB 3D1MC 4MD4A 4PLKD 2MFNA 4G8GB 4HIHB 5E95B 2KKQA 4PGCA 4YX2L 1L9NA 2E3VA 1R3HA 5D7KD 1MIMH 3LEYH 2OBGA 3IU4L 4P4KD 3MV8E 2ADFH 3NOIA 2GFBA 4TVPD 3B2VH 4PB9L 3RU8H 5J3HD 1O5DT 4Y88A 3MLUH 5T1LA 2RCSH 4C4KT 2NY2C 5T33L 4LU5L 4LHUA 4Q6IC 4JHWH 2P7TA 2X41A 5FHAH 3KYMB 1L6XA 5JDSB 5GJTH 3PQYD 4OLEA 1T2XA 1WBXA 5KW9L 3TIDB 3AM8C 3U0PB 2Y5TB 2C4FT 5D1QC 4HIEA 1RIHL 4AEIL 3WLBB 3ULUF 2FECL 1ZOXA 5HBBA 1O7SA 1PKQB 1PLGL 4G3YH 1OHQA 2VJXA 1JUFB 2YBRB 5F1NB 2Z8RA 4PRHB 4PP1D 4OCLC 5ACLA 4OZFG 3GMMB 5FAAA 3IYLW 4MDIB 5EFIA 4YQXH 4MGXA 2IANA 3TYGH 1Q9KA 3OHXA 1B0GB 1MEXH 3QA3B 4KH2A 4YR6A 1GSMA 2ZPKL 1A47A 4ZTPL 1U9KA 5I1KH 4UB0L 4O51A 3OJVC 3BKCH 3X11A 4DCQA 1UJ3A 2XKUA 4GQPH 5IFJB 3G6JB 4H25A 5D1ZD 4M93C 2R0LL 4KMQA 5CILL 1A4KA 3GBML 1Q0YL 4J8RB 4XPAL 5DVMA 1OTSC 5DUBA 5B38A 1P1ZB 1D7FA 3VDBA 4LRIC 5TH2A 3T77A 3LQAC 2KH2B 4P46A 2QEJA 5I2IA 4GO6B 1CFVH 5B8CC 3D0VA 3L3DA 4XCYB 3OKMB 4NUJB 1NEZG 2NY7L 4OUOA 3HHRB 1CE6A 5D7KE 5EO0A 1SJEB 4LLUB 1AJ7H 3PWNB 2YA0A 2HT4C 5JQHC 2VXVL 3LKQA 4OUUB 1EEYA 3O6KL 4WU5A 3SDYL 1A14L 4OF0A 1ZLUH 1NJ9A 5HGBA 2VE6A 1QLEH 4M62H 3BP6B 2GAZA 2OJZL 4H88H 1U8KB 5I18H 4YXLH 2EEDA 3DNKA 3BP5A 3NTCH 5HTSA 3RVXC 1IKNA 2YMXL 1E28A 5DR5H 3QEUB 3QUMA 3F65A 3BGMB 2P49B 1QVOB 2C1PA 1FLRH 1Q9LB 3TBVA 3IRPX 5TDOA 2P8MA 4H8WC 4OLUL 4MHHG 5C09B 4XCFL 4OZFA 5EBGA 3MV8B 5IHBA 2R9HD 4LPXA 3DXAE 4FQIH 2X42A 3HI6L 4KKCD 1CE1H 2C3VA 5M95B 1CL7L 1B88A 1YEIL 5MEND 1NCDH 1LO4L 1JGEA 1Q72H 1YMME 5C0NC 2R2HB 4UNTA 1OTSD 5D6CA 3MV9B 3M1BB 4QKXB 4ZPTB 2IPUK 2AXHA 3DVGB 5CJQL 1A3QA 3T8XB 3GSQA 3EFDH 4ODWB 4OD1H 2PW1A 3FFDB 1P4BL 3K4DA 3FOLA 1NBQA 5CGYD 5I17B 4MLSA 4P5KB 4WHYG 4KZDH 4P2RD 5K9KB 3T2OA 1NGXA 1IQDB 4G8GE 5F7DA 5HDLA 4GW5A 1WBYA 5JORB 1QQDA 3STLB 2ICEB 1KJ2L 5DJZA 4Q9CA 4BK5A 1J05A 4P23C 2HFEA 5C2UB 3CCHB 5KJRH 3C09C 3NAAL 3ULUC 4X8JB 2MKLC 4ODUB 5ELIA 3HI1B 2EYTA 1T66D 1VESA 1G1YA 1JF5A 3CFEA 1BBDL 2ICWJ 3IKCA 4AT6B 1U92A 2Z31A 3KPSE 4Z7OE 3B43A 2EIBA 1TETH 5EU6E 3AU1B 3UTPE 5I1LB 2LTQB 3OB0H 1I9EA 3ILPB 4FQJH 4UI2A 4QRRB 3BDBA 4LIQL 2AEWA 2XN9A 4WFFD 4IDJH 4HS3A 3QXVA 1ERNA 4XT1C 3T0EE 4PJIE 2R1YB 5KVEH 4HCRA 1YN7A 4ZDHB 2AI0H 4JVUA 1UZ6E 1XCTB 4D9QD 4RQQA 2HG5A 5CP3A 1NFDF 5DI8A 5DJDA 4EVNB 5IB2B 5JOEA 5B39B 1MIEL 2ORBH 2IBZX 5SWSB 4ODSH 4E41A 2P5EB 1CIDA 4AEEA 3BGFB 3B9EA 3WIHH 1S9WB 3W9DB 3LVEA 1OAQL 1JZ4A 1GHFL 2A1WL 1V8HA 3T3ME 4YDLC 2JJSC 3R0MA 2G5RA 3LQAL 4Z7UB 3S7GA 4EN3D 4E42A 3QUZC 2Y9RT 1KJ2B 5A2KH 1F2XK 4YDJB 4HXBL 1IAOA 3V0AC 2WANA 4Q6IA 5T1LD 3FQTA 1IJ9A 4RRPG 5IK3B 3NIGF 3RJQB 4KK9C 3U7YH 4EQ3A 4UV7H 4PG2A 5EA0H 4OBSA 3MTRA 3EYOB 5JIHA 4KRPD 2XFXB 1IGYA 1JPGA 1LDSA 3DIFA 3X3FL 1VCAA 1WC7B 5CZXC 2F8OA 1JZ2A 4POUB 1ED3B 3LEVL 1NANH 2GJJA 2HFTA 5DVOA 4XRCB 1I9RL 5HPOA 1FSKC 2HT2C 5IVZA 1S7WA 4IIQC 4HW6A 3VXNB 4X7EC 4ONFL 4DK6A 2UY7A 2OMNA 2ZUXA 3MRQB 4HK0B 1PSKL 3UTPD 2NY0C 5IBTH 5LQBL 3U82B 3ARFA 3TBSA 3PGFH 4ZQKA 3QWQB 4P3CL 5E5RB 5DJYB 1YNLH 4WI5A 1OQOA 3EGSA 3ZYIA 3RAJL 4KUCF 1Q0YH 2UWEB 2FJFA 4N0RA 1JNHA 4LKXB 4M7JH 3GEWB 4D94A 3DHJA 5AYUL 4ZXBA 1UM4L 2AJSH 4G9DA 4FHBD 2WINA 2O5ZH 4JE4B 4Y5XB 3BX7C 1QNZH 4I5BA 2BNQB 3ARDA 2ZUYA 2O5YH 2ZG1A 4UAOC 3L5HA 4XVTH 4LMQE 3KPQA 1X5ZA 4Y8DC 4YK4C 4NT6B 3TH3T 3MRIB 4YEFA 3KYNB 3KPMA 1FFNA 2EDLA 3WJLC 1KN4H 5JHDE 3FO9A 3PP4L 3OG4B 3V2AR 3X12B 3KS0H 1FAIH 5H8DA 1F90H 2P5WA 5CGYC 1O0VA 2C4FU 4WO4A 5E8PB 3TT1L 1BFOB 4PJFF 1T21B 4YGVB 1S9KC 1VGKB 3CFCL 3LKRA 3W0WE 3RTQB 3VFWA 5IB5A 3W5MA 3SDAC 3S3PA 5DD5H 4U1HB 4WW1A 2MPAH 1T0NA 2VLMD 4BQBA 4OZHA 4D0DA 2CRIA 2DTML 4I2XB 4P4KA 4O02L 1PBYA 4F8TA 1NBYA 2BP3A 5JHDA 4ZTOL 3Q2CA 4R0LC 2A74B 1CZ8L 4R26L 3REWA 3HAEG 2NLJB 4LLMB 2EE3A 4FG6C 3IETA 5J89A 5FUCE 1VKXA 4ZFOL 1DQDL 1N3NA 4ISVB 3LZFH 4Y16B 3N1PC 1KTDB 3K1KC 2NCMA 3GBNL 1JHLL 1H15B 2Z8WC 3WEXA 1FG2A 1RZJH 4JN1L 5FOBB 3MYJA 2Y4SA 4OCWH 3KXFE 1F3JB 5JIIA 1WIUA 4HC1L 2OXGA 1S8DA 4DGIL 3R1GL 3QUZB 5SWZB 3F7VB 4GLRH 4LCCB 4BYHA 4YDKH 3WLWD 5E4IA 4KZDL 1A02N 2I5YH 1MCPL 5DHYB 3O3DA 4F7MB 3SDCD 2YN5A 4Z0XA 2HLAA 3SO5A 3HR5A 2FGWH 3AREB 1ADQH 2DWEB 3MUJA 1T04A 2Z92A 4PY7B 2DOCA 3MV11 3VFOB 5DYOB 4LVHC 2YA2A 4NOBA 4YXKH 3IXTB 4Z7UE 1IZJA 3CPLA 1A6UH 5CJ8A 5F96H 3TT3L 5HYIA 4HDIB 3SGKA 4O58L 1TETL 5CZVL 3O4LB 1AIFB 1B2WH 5IW1B 3LN9A 2EZ0C 1MI5A 1FZMB 2E9JA 4WY7H 2QSCH 5EZOL 2DBLL 2FLRT 5BS0B 1EO5A 1FGNH 3Q5TA 1TVHB 1UB5B 4L4VD 2OZ4A 4X9BA 3KYKL 3D0LA 3QDJB 1YPZF 4HIJA 2W60B 4P23D 4WNQA 3IFPA 3P30L 3V9FA 5IV2B 4NQCB 3MLVL 2VZOA 4JZNB 1CBVH 5JPNA 1FV1A 3MRDA 4HKZA 2D03L 1E4WL 4PJHA 4RMUA 3DX6B 4ORGA 4ZSOA 4MXVE 4JPIA 2FD6H 1HQRB 4CAGA 5DRNB 2O61A 4F8QA 1I7RB 5D5MB 3C2SA 5C92A 1I1RA 4Q0XL 4LSPH 3RIFK 4D9LL 1FYTE 3DI2B 5EU3B 5DZNA 5GS1A 1GGCL 1UADC 1ULVA 3VI4E 4PJIA 1S7VA 3SE3A 5I1CH 4WI7A 4XPTL 5E8EA 5EO9A 3RA7H 2CDEA 3DOSA 3W9EB 3ABZA 1I3RA 2DLFL 5T3XE 2GFBB 3FO1A 4GW1B 3KR3L 1Z9LA 4M6NH 5C0BD 1HSBB 4TSBL 1A6ZB 5GGVL 4LL9A 3HC3H 3U9PL 3MV9E 3CU7A 3MCLH 1GPOL 4H5SB 5TF1L 1P5VA 5GS2D 3MBEA 3OMZA 5DTFA 4X6CA 4PGJA 3UDWC 1MJUH 4R7NB 3L3KB 3DGGA 1GGBL 3UTSB 5ICYB 2YD1A 3BIKA 4ZNEE 3VFTA 1F4WL 2Y5TA 5KOMC 5KSAA 1LP9E 4JQXC 3WE6B 4HK3J 3UCRA 2IBBA 2A77L 5J6HA 5HJ3B 1KENH 3AAZB 5ILTL 5CJOL 4O2CA 1N5AB 1L7IH 5I9QB 3I85A 3LRSB 2AGJL 2XYCA 1TVDA 4PR5A 1I7UA 4HCRH 4XMLL 3U4BH 1OARL 1MCOL 5E4EB 3QDJE 3TCLB 2E5EA 4LMQI 2VKWA 4LAQH 4YC2C 5GRXG 5ACZB 1KJVA 2X9XA 3EHBD 2GT9A 3FT2A 3X3GH 1I1CA 5C0FB 2AXFA 2V5TA 3MRNA 3VFUA 2MQ3A 4X5XA 4KQ4L 4OZFH 1IRAY 3GMNA 1OT2A 5FA3B 1UWEL 4PV9A 2DI9A 4YDIH 2GYSA 3F6IA 2ESVA 4QCIA 1ZA3B 3HAEB 1MFAL 3ZL4L 3NABL 3FRUB 4LLYB 4XXDA 4PRBA 5C0AD 2R56L 3BKML 4JO1L 4QNPF 1S7XB 3CDGA 4F80A 1P1ZA 3RVVC 1BP3B 1N6UA 2XWTB 1V7NH 3H42H 3G6DL 2ZCHL 4LLQB 5KSBF 2AS5M 1AD9A 3RL2A 2ZSWA 2X7LB 3V5HB 5CGTA 3MUGB 4PJAF 3ULUH 2HLFC 3FT4A 3QDME 5CD5D 4O00A 3QIWA 1KIQB 1X7QA 1DUYA 3PWLA 4KRMB 3UBXG 4UT9L 3OXSB 5GRZA 1G9MC 3GSNH 4IIQA 3N50A 1KCLA 1T1ZB 3ZKMC 1QPPA 4N0YL 2ARJQ 5GGRA 3B4NA 1MHEB 3OKOB 1F58L 2MQ0A 4JM2F 3PWNA 3WL9B 5EOCH 4ALAL 4GMTL 2CKBH 4FZEL 3RPIA 5JW3L 1KB5A 1X9QA 1UXWB 4IRJB 2NY5C 4TUJA 4MS8D 1U3YA 2LVEA 3BP6A 2R23A 4L4JA 3O2VL 4R96A 2ED9A 3WXVH 3NZ8A 1YEGL 5DWUH 4P2QE 3VFSB 5AAWA 4N0FA 1MRFL 4NO0A 4J3UA 1HHGA 3LCYA 2J8HA 1B90A 3DSFL 2AV7A 3T0ED 2NY2D 2NXZB 2XRAL 5IOPA 2HVKA 3LDBB 3NIFF 5HHNA 4TOYL 1UZ8A 4X7TA 4M7LT 2R69L 3TFKD 4GG8B 2D7MA 1INDL 1EZVX 4YZFE 3KNBB 5DRXB 3WFZA 3GJEB 2RQ8A 3GUTB 5KANI 1I9IH 5E00B 4RGMC 1CXLA 5C0CA 1G9NH 5I8KH 1OAXL 3G04A 3PL6B 3X13A 3O6FB 4OM1H 5IHUH 1YMMD 2ZG2A 3M1BA 2XV6B 3FTGB 5GGQL 3OJDA 3QHTC 1HIMH 4S1RH 1T4KB 1CXFA 3MRMA 5ACMA 3CLEL 3N9GH 1F4YH 4OKVB 4ZPVB 4APQD 1CF8L 2FECI 4HS8H 4BH7A 4CVXA 5DJXA 2Q8AL 1PVHA 3GSWB 2Y72A 1UJTA 5HHXH 2XWBB 1RUQL 5F7LB 2HFEB 4G7YH 3S36H 3T4AA 4K55A 2CD0A 3V6FB 2D31A 2QQNL 3KYKH 2ADIB 2OR8A 4QHNA 1I1AA 5IT2H 1XF1A 3DV6A 4BZ1L 4XP1H 4NKDB 1NANI 5B21A 4S1QL 1CN4A 2DWDB 5CLWA 3IKCB 5TDPB 4AT6A 1EVTC 2P42B 5DVNA 1UM6H 5I8EB 2V2WA 4F58H 2DQIH 4N0UB 3RWEA 4F7TA 4L8DA 2VABA 4NP4L 1LEGB 1C5BH 1CDHA 1NLDH 1OVZA 1JP5A 3KAAA 4DUXA 1A7OH 3T2NH 4Q0XH 3MR9A 1RK1B 4PJEB 1JFQH 4BQ6A 4ONOA 4P46D 1G9EA 3ZMRA 4NQED 4H8WL 3WFHA 4QWWC 1MF2H 1YEJH 5I15L 2X4OA 2NY1D 1RUKH 3SPVB 3BZEB 4X6DE 4JLRB 5F6HI 1RUAL 3DX8A 3PP3K 4BSWB 5KSUA 1KIUA 3WUWB 1JWSA 1K5NA 4HWBH 4AEFA 5DJ2A 4XZUA 1P4IH 3G08A 3HNVL 4MD4B 3RVWC 3JVGA 3CZFB 4WHTB 3P4MA 4GRWB 4EJ1C 5EOCJ 5CJ5A 5HHQB 1J11A 2YPLE 4YHIA 3HE6A 3PQYA 3B6SB 2CLRB 3HE6C 1DN2A 4XPBH 5D9SA 4XVJL 1K3IA 1TQBB 2ENSA 5F9DC 4AEIH 2UV3A 2ICES 4FFVD 3G5ZB 3P11L 3EYUH 4H20H 4XP4L 3FT3B 3OHXB 5BV7L 1A6PA 4CADB 4DN3H 1NFKA 5CJOH 3G5YA 3VJ6B 1ETZA 2D0GA 5IWLA 1WEJL 4M5YH 2OR7A 4FZ8H 4DCQB 2W92A 2NX5D 1KCUL 3ARBB 3MLSH 2AK4B 1NMBL 3MV7A 3CIQA 4LF3A 4NZJA 2P24B 3MRKA 5GZND 2I60L 5EO1B 5ANME 4MAYA 3NCEB 2B4CL 4J1UB 1H0DA 4U49A 4S11A 3VWKD 1IT9H 3JSSA 3U0WL 4JZOA 3ORJA 1GAFL 1E6JH 2DYPD 3QG7H 1ACZA 4LPWA 4GFTB 5F9OH 2PN5A 3FN3A 5J13B 5GS2H 3G9AB 2LV4A 1X6LA 5EU6D 3ZTJH 4U6TA 2GSGA 5I71B 1AQKH 4LKXA 3FCTB 1U58A 1UJ3B 4QLRA 4WU7A 5DUPH 3VRLF 4EI5D 4W68A 3ZDYE 2VLJD 4EI5B 5IFJA 3RDTC 1CDIA 1D6VL 2PTVA 3HLAA 4UT9H 4IJ3C 5M94B 4ZYKB 1W0WA 3L3IA 4J8RA 1IAII 3WDHA 5TE7L 2DKMA 1FNSL 1OPGH 3KDMB 3FB7B 4L3EB 1MIML 3LEYL 4DW2L 5F93C 1V5JA 4NN7B 3VDCA 1YEKH 3TWCH 1BREA 1KXVC 1KB9K 4YHMH 1FVEB 3MFGB 3N1GC 1RHHA 4F33B 1JPFA 1L0XA 1QVOA 4KV5E 4LDLB 2QSVA 1EPFA 4K3JH 3KJ4B 4GG6A 1A2YB 5C0RL 2JF1A 4EIZC 2Q6WA 1A3RH 1GGIL 4YFLI 5JIKA 5C6PB 2V2TA 4DAGH 1U8IA 1NJ9B 2F8VA 1R5VB 2P8LB 2J6EL 4X9HA 3MNZB 4Y2OA 1HH6A 1BQSA 4QOKE 1LP9B 2OTUB 3HRZA 4YJZL 5DO2D 2HWZH 4NQSA 3SDXA 3R0NA 4YBHA 4I13B 1DLFH 3V0WL 5E08L 1T7XA 3ZDZF 1VKXB 2BVYA 2PW1B 3EO0B 4XMKH 1CDUA 3QI9A 3SY0B 5JPMA 4YZFF 5DUML 4QHMB 4CN1A 1U8PB 4PJFB 5JORA 3RWJA 4HUWB 2AK1H 5ABDE 1DQQA 5FUZL 1DVFD 1OTUD 3T0XA 3QUZA 2JCCE 5BRZE 4TSCH 3S35L 2HRPL 5HYSG 3HR6A 5DK2B 1CF8H 4RFEA 1NLBL 5HVFB 1U92B 1ZGLB 1AI1H 3NA4A 2IPTH 3CSPA 4XPAH 4EI5C 5IEHB 1G7QA 2RJMA 1T04B 4NKMA 2YC1A 3MA7A 4ODWA 5DJAB 1SY6H 3CLFL 3OKEB 1G84A 4Z9KB 1S7RA 5ALCH 4C56B 1U93A 2PXYB 3ZZ1A 2ATKA 4ZAKD 4RGND 2XA8L 4RAHA 1S7TA 1BWWA 2DQIL 2BMKA 1PZUB 4F15C 1RULH 4UBDC 4NQCE 3LN5A 3SN6N 1J05B 3ILQC 4L8BB 3VMNA 4R4ND 4HBCH 4X7SL 5BCAA 4WCYL 3RY6A 2I9TA 2AJYH 4MAYD 5IBLD 3CVHB 1UG9A 3O9WC 3QUYC 4ZNEA 3DO7B 1CLZL 4IMKA 4AIOA 4KK6D 4N1CA 3W9DA 3KYAA 3AY4A 1YY9C 1G0XA 3F8UB 2P1YA 2YA1A 5TQ0H 4NN5C 1M7IB 5HHVL 4G43B 5J9PB 4APQA 1MAJA 5JOPD 3F12A 4ZG1A 5ID0B 3MGAA 2PNDA 3UTTB 5F7HA 2GJ6A 3RU8L 1BF8A 2R1YA 3DX6A 1UXSA 2A6JA 2OP4L 4NZTL 1E4JA 4JPIB 3ZDYF 4JO3L 1Z5LB 3PGDB 4HWEL 4OV5A 4NZUH 1GC1L 1R24B 4JFYB 4OLUH 4CKVX 4ZS6D 5IIEB 4FTVA 5DO2C 3GSRB 4LLAA 1FL3A 4NZDA 3MSPA 3WFBH 1EHXA 3O3AA 4I4WB 3OAUL 1I85C 4JM2A 4I77H 2D0FA 4JFXA 4XNMB 4G6JL 2B5IB 1UH3A 4BSVB 3TH2T 1Q94A 2E7HA 2W59A 3P0GB 2EYRA 3T2QA 3VXTA 3D25B 2IADB 4UQ2A 5IEKA 4Y4FC 4M5YL 4EZMA 5J1AA 4S2SA 4ZQKB 2JK5B 3MLSL 3BZ4A 4I9WD 1C12B 1LNUB 4LCUA 2M2DA 4TPRH 4R7NA 3GSVA 4NQDA 1CCZA 4UT7H 5L2KD 3V4PH 4R0LA 1PKOA 4ZXBB 3SJVE 1UACH 4PS4L 3I6KB 4WEBL 2Y1VA 2DBJA 1R3LB 2ZUUA 4Y5XA 1DLHB 1CS6A 2V9TA 2H9GA 1ZTXL 2CRZA 4PR5B 4P4RA 4WI9A 3U1SH 3CC5B 3I9GH 3MROB 3UZVB 1ZLWK 3LRHA 5HDBF 1NAML 2EO9A 4EN3A 3MV01 1H3GA 4KZEH 1LD9B 3QWOB 3BDXA 3GHEH 4A6YL 1QHPA 5C8JB 4XC1H 1NDMB 3GMNB 1C08B 4U1NA 3LS5L 4IRSB 5IQ9A 3TO4B 3BYTA 4WO4B 5GRJH 1K4DB 3VWKC 4LPCA 5DS8B 1PKQE 4RA0C 4XCCH 4G9DB 3RTQA 2XTJE 4PREB 4R97B 4U1HA 2KL6A 4X6CF 4NQEB 2E7BA 3PGCA 5KOVC 1QLEL 2YKLL 3H2WA 3HFML 4GBXD 4RGOL 3RL2B 3M17B 4MA1C 2EDEA 1A9EA 2QKIA 3UMTA 4P5TA 5DD5L 1KIRB 43C9A 4U3HA 2FJGB 5INDA 1OLZA 3B2UD 2VLKD 2AJUH 3U30C 5GGRB 2X10A 4ISVA 4LSSL 4RSVA 4DFHA 5HI5D 4EBQL 4OCYH 5T3ZH 4G5ZH 4ODBD 2HH0H 3QEGL 3QISA 4HEPG 5AEAA 1C5DA 1HQ4B 5LVEA 2XQBL 4HAFA 3L3HA 3RVWD 3GI8H 2LVCA 3LS4L 4LCYB 2ZKHL 4H0IA 3BRFA 2K9UA 2H2PC 4N1HB 3B5TA 8FABB 5BVPL 2HLAB 2OR9H 4JCMA 1BECA 2M8XA 2X2YA 4U6YA 5D96B 9CGTA 2V17L 2NX5E 2AJXL 2Z35B 2YD9A 3MCG1 4KHTL 5EBLB 1H9VA 4JM2D 1V3MA 3WEXB 5HHMB 2EDHA 4WWKD 3O4LA 2PCPA 5C70A 1HINL 5DQJB 5D93B 2ZCLL 3F7VA 3K74B 3CSYA 3FB5A 2R0KL 4KKAC 1WIOA 3RTQD 4X6BA 2NXZD 5GHWL 1KACB 1TVHA 1FZOA 1BVKB 3SDAA 2XA8H 2HT2D 5GGUA 1FORH 4NNXB 1BJ1H 3E6HB 2LE9A 1BJMA 3BP7A 1S7UB 3IFLL 2XPGA 4U2YA 2AJ3A 5CZXD 5IVNA 2XIDA 3PP4H 2CR6A 5JXAH 5BRZA 2V2XB 1IC7L 1IGJB 2NNAB 5BV7B 3OKDB 3GSWA 2G5BA 3S3SA 3VGHA 2VERN 2HVJB 1Q9WA 4LPUA 3SKMA 5I1JH 4I48A 5FECB 1OF2A 1MUJA 3OZ9H 3AGVA 4I18C 2ITDA 4Y8AA 1P5UA 4XMPH 1BZ7A 5CGMA 2OI9B 4XWOD 5HGAB 4N0UA 3RWEB 1IAMA 5GS1B 4J4PC 4FFWD 3DHMA 1CT8B 1FHGA 3D0LB 1Z0NA 2IQAA 4Y4KB 2HJFB 4LASL 4HWEH 4NQVA 4PB0L 2Q76B 3BWAB 1GGYA 4QHKI 4MJID 3ZE1F 4NQCA 1BLNA 3OQ3B 3FO1B 2V9QA 4JRYE 4MD5A 4XB8A 4KK5C 3ARED 5I75B 4Z7NE 4BFEA 3KLAB 2CJUH 12E8H 4OZHF 1H3WM 1TVBB 1N5YH 1DE4B 3TIEA 2QR0B 3O6LL 1WZLA 1YN6B 3C2AL 2BJML 1LO0H 3HC4L 3HI5L 2OZ4H 1MFEL 1RZ7L 2QSQA 3KYOA 5D7JB 2YR3A 4JY4B 1CFNB 1HXMA 3LV3B 1RK0A 3T08A 2R0ZH 4D9RE 4Y16D 1UQSA 1NGYA 3G5XB 4CW1B 5I1DB 4LLWB 1W0VA 1U2HA 2J1KA 4YHYB 1QBMH 5E2VH 3P3YA 4PRIE 4CBPA 3SE4C 3DETD 2Q8BL 1MJ7H 4G8GA 1FNGA 3FQNB 3MOBH 1KJVB 2UUDK 1UACL 4PS4H 3JTTB 3QXDA 1VHPA 4O9HL 2FO4B 5C07B 3F7QA 1JIBA 1ETZB 1QSFA 1KYOJ 3VWJC 1GZQB 1A14H 3GSOA 4CUCA 2BHYA 3TA3C 4BA8A 5KVDL 2VDQL 2AJZB 1U95B 3QXAB 5E6ZA 2P7TB 3QCUH 4NNYA 3N1MC 3T0EB 4XVUC 3VG0H 3SCMB 5E8DL 3INUL 4PP1C 1H0DB 1I7UB 4C55A 4U1JA 5H2BA 3D6GA 5GRJL 1KT2A 2YK1H 2A9NH 3E8UH 1TNMA 4N68A 4JAMB 4YXHH 4WWKB 3KPSB 5EULV 2JIXD 2GT9B 4O2FB 2CLVB 3FN0H 4MQ7A 5DF0A 3WS6A 1IFHH 4KJPC 3L3JB 5LCVH 1I75A 4RZCA 4LOUD 5HYQB 2BDNH 2MSPA 3GHBH 3PWVA 3N1QC 4AMKL 1F3RB 3AREC 2YSSB 4QYOB 4R4NC 5DFVD 4JVPA 3W2DL 1T5WA 1NCDL 2A6DB 3KPRE 3VW3L 5IM7A 3RWIA 5DD1H 3KDMA 3WXWH 5HHPA 3QG6B 3T2PA 2P46B 4ELKB 4HZLB 3BKYL 3C6SA 4YPGB 4D3CL 2E6PA 2AQ2A 3QDAA 1FRGH 4GSDL 1G6RA 2QSTA 5E99L 4OCMC 1PAMA 1SHMA 4KKLC 3CUPA 3HC3L 3WN5A 5GJTL 5IOPB 1CR9H 1DQDH 5TH2B 2W9EL 3OKOA 4NUGH 3T77B 5HHNB 3RWFA 2X4NB 3QHFL 3D0VB 1AH1A 5JHDD 5F9JA 2X6MA 4ENEC 4OCWL 4Z6AT 2Z8VC 2Z91B 1WUNT 3C60B 1WZKA 3JXAA 4OLXH 2DIBA 4K7PX 5I75C 1MHPH 5F7MC 5SWSE 5F44A 3EO9H 4MQSB 2QQKH 3IDGB 3SKJH 4WU5B 4FXGA 4NM4L 4HPOH 3FTGA 4KMLB 4XPGH 3RTQC 2FGWL 1RU9H 3TPUB 4YDVB 1T4KA 4OB5H 3SO3C 4NM8H 4LLDB 4EI6B 1RZKH 3MREA 1HCVA 1GH7A 4ODVH 2DKSA 4J3VA 4LBEB 3VD3A 3LIZH 3BP5B 4M7ZB 5J13C 5DRXA 4TQEL 1DQQB 4JQIL 3V7AE 3QUMB 4QHNB 2PYEB 4UOW1 4PJGA 2NXYD 3BQUC 4FN0A 3RHWK 1IM9B 3PV6B 2QSCL 5EZOH 3NABH 2RAMA 3GBMH 4P2OB 1GJIA 3H3PH 1JHKL 1IILE 4U3XA 3D87B 4ZNCD 3S36L 4JG0H 2YD6A 1ZHKB 2JKXA 3UC0H 2GEEA 2VABB 1NCBH 2C7UA 1AQDB 4PBVC 2H41A 1WIPA 3P30H 4H0GA 3BDYL 1IKFL 2OTPA 2ATKB 3KHQA 3PWPB 5EA0L 4OQTL 2BMKB 4BUGA 3S88L 3NFNA 2NY0D 4L8BA 4X4YB 4D9RD 1PW3A 1MQ8A 2FD6L 5C1MB 2Z4QB 4OAWB 4RAUB 2X4UA 3EAKA 4HUXB 1UM5H 3KJ4C 4KK5D 4WUKH 2I26N 4YNYB 1SVZA 4JFOB 1TNNA 1MF2L 1YEJL 2HKHL 4J4PA 5KZCD 1IQWL 4F7TB 3VH8B 4QHLB 5F6IC 4LVNB 4ZS7H 3VXOB 4PP2A 2VLRB 3MLWL 1BWMA 4LCWB 5ID0A 5CEXA 1RK1A 3JBG7 4Z76A 4IRZH 4F57H 2IANE 1KBGH 3QULA 4TSBH 5A2IH 4MSWB 4LU5H 2APVA 5T1MB 4JFQA 3U9PH 1RVFH 1FGVL 1R24A 2D7PA 2XACC 1CFSB 2C3GA 3AMLA 4QGTA 5ITBL 3GSRA 2XN9B 4P5TD 2G2RB 5AYQA 3LQZA 5IG7B 1RFDH 5J6GA 2QADB 5HYEA 1K5NB 5DJ2B 1Q0XL 3VWJB 1QKZH 1YUHB 2RFXB 1KYOK 4ZFZA 5SX4H 1Z2KA 1KN2L 2XTJB 5BV7H 4JM4L 3IJYA 1VFAA 3P4MB 1NMCB 1CDJA 1YEHH 4ETQA 1FBIL 3SDAD 4X6FA 3QEQD 3UJIL 1KGCE 1WZMA 4E41B 3D25A 1RURH 4MNQD 5BZDA 2IADA 1P7QB 4NHCL 1KCUH 1LEKA 5J1AB 1AKJB 2ZCKH 4S10A 5EPMB 3MO1A 1A7PH 3VDAA 4L3CA 4Z7WB 3CXHJ 2FB4H 1C5CL 3HMXL 4UU9A 5EZJB 2ESVE 5FKAB 4MWFB 3GNML 1VACA 1JMXA 5T5FH 2HYMA 4K94L 4H1LH 4HJGA 5KANG 5CEYA 5IJVB 1IBGL 4ZO7A 3PNWB 3O2WL 3QSKB 3MBXL 1UEYA 4AL8H 3OX8A 4AG4H 2C5DC 4QOKA 2DQGL 2QQLH 4XXCC 4I18B 1IGYB 1WQVT 2FRGP 4NKOB 2CDFA 3FAWA 4NP4H 4UZGA 1FYTB 4Z7WF 1WAAF 2DN7A 3B83A 3RVTC 4KU1A 4XRCA 4N0CD 1CI5A 2WMPA 4HGMA 1C08A 4KGJA 3BWUC 4HKJB 5HVGB 1K4DA 4JN1H 4Q97A 1RD6A 4ZFOB 2OK0H 3HNTH 3SCMD 3FCTA 5FYJH 1MIEH 4L4TA 4M1GL 1U58B 2VXVH 2DQDH 1TZIB 1MPAL 4HHAA 1ZVSB 3EYVA 4YDKL 3NACH 3ALPA 1T0MA 1U8HA 1OAKL 3B5HA 4NRZB 3L3IB 3L1OH 2JELL 1AXSB 3CMGA 4FQLL 3WUWG 5I6XB 3FB7A 5C0RH 5BQ7A 4L3EA 3WXVL 5C08E 2VDKH 3OKKB 3EKCA 2RR3A 1EGJA 4DKEH 1LEIB 4M7KH 5D96C 4MXWL 2E7LA 1JRHL 3QIBC 4UUJB 1FLRL 1X6NA 4M61A 3QNXB 5EN2A 5D70H 4JG1H 1WLHA 2MOVA 4B7LA 3HUJB 3CVHL 1D5BB 1SM3H 2HWZL 3FO2B 1INDH 1LMKA 2NX5B 1AHWB 3I75B 5EB9A 5HI4C 1XGUB 3V0VA 1AO7B 1CE1L 3BVNA 4PJCE 4OB5L 4QXUL 3D3VE 3CXDH 3GRWL 3MNZA 1ZGLM 4Z8FL 1DBAL 1U8OB 2DTSA 2BSSA 4RFEB 1NMAH 5CJQH 4F37K 4RMWA 1G7QB 4JPKH 1TCRB 3NIGE 3UZQA 3HAEH 4I0KA 1CFTA 3RKPA 3U0TB 2Z35A 3FMGH 1DN0A 4Y5VA 4R3SB 4Y4KD 3RKDD 3RX5A 5C0IB 4TN9A 3DYMA 2UUDH 1XR8A 4PFEA 4R90L 4JQVC 3K7UA 4DK3A 4NCC1 1KJ3L 1NGZB 1JWUB 3MV8D 4EOWH 2AABH 5EU5B 3IDNB 1QNZL 3R06A 2YZ8A 4LLVA 1TXKA 1ZVYA 4OIAA 4X6BB 1LWRA 5MEOA 1XH3B 5MERA 2H8PB 4PGDB 4FQ1L 1RULL 4I3SL 3MYJB 4PTUB 4RX4A 4X6EB 5HI3C 2WBJD 4OT1L 4MCZB 4NKMB 3THMH 5CSZA 2CIIA 4U33A 4C56A 5HI3D 5CEZD 5FYLE 1F45A 3UTTA 3QI9D 1Q9WB 4WRLA 2J6EA 4H8WH 5GZOC 1AGEB 4EXPX 5IVOA 4OLVH 1Z5LA 2VSDA 4JFYA 2ORBL 3NIDF 1DQLL 4HH9A 4OD2A 1FO0A 4HMEA 1KCSH 3ARQA 3PXJA 1YEEH 1J5OL 2FEDD 4XCEA 4GOSA 3DRQA 1A1NB 3BGFC 1E6OH 1QFOA 4KPHL 1BFTA 5FGBA 1P2CA 1BLNB 4I3GA 3WSQH 4CDHA 1IAKB 5T1KD 3P77B 3BQUA 3ET9F 1EDQA 3RDTD 4UQ2B 4KKLD 2GJ6B 4N9GB 2GITB 4BELD 3DBXA 5EZLB 1QKZL 1P84K 4MNHB 2JK5A 2W60A 3GM8A 3ILQD 4JPVL 4YDIL 5D2LF 1CLYL 1UA6L 3V4UH 5EDXA 1YEIH 3NMEA 1FVDA 1I1YA 1K8IB 1LO4H 3LH2H 4K2UL 1OM3L 3MFFA 1I3UA 3ULVF 5IBUB 2J5LB 1FFPA 1ZS8A 1YEFL 4UILL 1HXMB 1I1AC 3ROLA 1V7NL 2R4RH 5EH1A 5IFHH 5DRNA 1WWAX 3O6ML 2DDQH 4YH6A 3BT2H 1ADQL 3MLXH 3ES6A 1KULA 1TFHA 3R8QA 2V9RA 3MRJB 3GSUB 1F42A 4FG6D 2NY7H 2EH7L 2Y07H 3VRIB 3WFEH 3ZTNH 3K2UH 5IEKB 5F1KC 4FQXA 5HHOB 3U46A 1ORQA 1S7VB 5LXGH 1LNUA 1KELL 3L3OA 4KTYA 3PHQB 1B2WL 1RV6X 1CGSL 2Y6SD 4NOFA 3PUCA 2RIKA 4R0LB 5KG9A 2QJDA 4FQJL 3DURB 4Z5RA 4CVWA 3MGTA 4BJLA 1TJGL 5F9WB 1RZKC 5DTFB 3FO0L 3ZYZA 4WUUA 3SBWA 1YEGH 5IVXA 1U3HA 1XCQA 4IRSD 1OAZL 1F8TH 4JREB 4K23L 3CC5A 1BD2D 4ELMA 4UT6L 1KT2B 4M7LL 4YHLH 1OGTA 1JF1B 2EXWC 3V79C 1YEKL 3TWCL 2P47B 5DSCB 3H9SE 5I9QC 5C8JA 1YYMH 4OSUH 4XC3L 3HA0A 5I1HL 3C5ZB 5FO9B 3PP3H 3RX7A 4JJ5B 5DT1L 1P7QD 1EHAA 1LO3H 1MJ8H 2AAVA 4JRWA 3SE4A 1HK6A 3BJLA 1TTFA 1T5WB 5C0FA 2VDNL 2IH3A 4NFCA 2MPAL 3UO1H 1T1WA 3JWDH 4JEGB 4UB0H 4NYLB 5KN5A 3MRFB 1HSAB 2DLHA 4HZLA 4S1RL 4NCDA 1VSCA 4DTGH 3CMOL 2EDYA 3K8LA 3FB8A 2NY1B 4R4BB 1ONQA 5DEFB 3MCLL 3FB6A 5B3NA 3CUPB 5D1XD 5DRWA 3M07A 7CGTA 5FDWB 1DJSA 1YJDC 3LS4H 4N5EC 4QXUH 6FABH 3DRTB 4PJDB 3C5ZD 1AGBB 3VXMD 3N06B 2I24N 2BVOA 3GRWH 2ERJC 3K4AA 4N8CL 3VXPA 1T1YB 4HWZA 2VUOA 1NEUA 4XAWL 1PEZA 3OXSA 3ESUF 4KY1L 5T3XD 4JR9H 4KVCL 2PCPB 2DQEL 3C60A 3MV7E 1MAML 4WI3A 5I8CB 5CP3H 3MGOA 3KLHC 4GXVH 4X7CC 3EYFA 1A6VH 5E6YA 4G9FD 1M71B 2R0WL 4JGUA 4PJHF 2CXGA 4Z0BH 3SDYH 4C83B 2FEEI 5F9WC 4EDXA 2NY6D 5F89A 4KKBD 1YYLL 2R23B 2GTWB 1YNKH 4EUPH 3BKJH 2N7AA 4H88L 5SWQA 3VFNA 5JO5A 1TQCC 4R2GB 3BPOB 2HJLB 4O58H 1UB6A 3I02A 3LKNA 3Q5YA 3GMQB 2BVPB 2EE9A 3SKMB 4X4MA 2BCKB 1QTYT 3L3GA 1M05A 2HVKB 5D7IA 5EBWB 4JHWL 4QO1A 2W0LA 5FHAL 4ELMF 1BZ7B 4GG8A 3Q6GL 1FAIL 1IM9D 4KI5D 5JQ6L 35C8L 2EH8L 1NAKL 1ITBB 4KK8D 5FKPB 3AY4C 1IMHC 4NQVB 2XPGB 4WI4A 2CGRL 4M1CC 2DYPB 3PL6A 3SQOH 3O6FC 5HYSB 2CR3A 3BW9A 1N2RB 3QP3A 1P6AB 5ECJE 3MUHL 3REVB 1I8MB 2DQTH 5JMRA 2OLDA 4M4PA 3P0VL 3SGJC 1AGCB 4FRWA 4ONFH 5DD3L 3HE7B 4R26H 3QIUB 2EXWD 4AEHL 1KTLB 5HGAA 4GKSA 4Y89A 1IAIM 2XQBH 3EYSH 2K1MA 4HUKB 5FGBC 1KOAA 1T0PB 4F37F 1I1AB 4AYFA 2HT3D 3BO8B 2BJMH 3PG2A 1JHLH 4CW1A 4RFNC 3HI5H 3LMJH 1MFEH 4OJFH 5GGVH 3MRLB 2IFFL 4GS7B 1BBDH 2V2WB 4W6YB 4KRLB 5DFTA 3TO2A 1F00I 4M7JL 2Z31C 1J1PH 1UM4H 2Y6SC 3VFRA 2YS4A 3K46A 2V7HA 4PLJC 3BZFA 4HS6B 4KKCC 1YA5A 4KTDH 3UTZB 3WKNA 4QXGH 4PJEA 5JA8B 3CD4A 1EEQA 5D7JA 5E8NB 4AIZA 3WUZA 1T3FA 1QSVA 3P40A 1C7TA 3WLBA 2DRUA 4K71C 4LK4A 4L4VB 4XNZB 2KUTA 4BSWA 1MCLA 4HUVB 4LLWA 4PRHA 5GRVL 5HGHA 4XZUB 1MCCA 1U2CA 4GAYB 5DZOA 4WEMB 4MNQE 3RFZC 3IFOB 4MJ5B 3GMOB 1L7TH 1QEWA 1FNGB 3FQNA 4WWKA 2BRRL 3BN3B 3T4YB 2DBLH 3T0VA 2Q8AH 3WHXB 1JPST 3N85L 4UTBH 1ZHNA 5GXBB 1MNUL 5IBUG 4RZCB 4O51B 5BXFA 2YK1L 3QDGD 3C5ZC 3X11B 1GXEA 1ZT1A 1QFUL 4KI1A 2AJZA 1TZGL 4PBWD 4XCCL 4D0CA 4QF1B 3CFDA 2NW3A 3DX9A 3FOMA 3I3BA 5D72H 4CADA 1A9BB 5IM7B 4BUHA 4OGZA 4KJPD 3HZMA 2YEZB 5I6XC 3X3FH 5HGGS 5KSAC 4PD4K 3W2DH 5J0BA 1XT5A 1QSEE 1ORSB 4BQ8A 5FGSA 2R29H 4WFHE 4D9LH 3MRKB 1OP3K 3TJHC 1IC5H 3TNMA 4JRYA 4XBPB 4FFYL 4X0KA 4GUPA 1AR1D 1CLOL 2AP2A 3HG1D 3EO1B 3OKNB 2H26A 4PRPD 1A1OA 4M6ML 2FH6A 2CDGA 3GZKA 3O2VH 1W72A 1RJZA 1U8MB 1DBML 1RZJC 4GBXA 2WBJC 3IKKA 4WIQA 3VXUB 1WICA 3I50L 1D9KA 4DEPB 4PRDB 1S78C 1WITA 3OKKA 4P2OD 4OZ4B 4FXGB 3MPCA 4TTGA 2P4AB 3BPLB 3K3QA 1Z9MA 4FQQA 3B9KB 3CX2A 4H20L 3V7MA 2RGSA 3SKUD 3P0YL 5ANMA 1NCNA 1BAFL 2P8MB 1M7DB 4PJ7A 2P8PB 3IAGC 3RWFB 1WEJH 2XG5A 2R9HC 3EHBC 5DJ8A 5JUEH 2PYEA 3ECBA 1IGFH 5HYJE 2C3VB 4GG6E 4FTVD 5KS9B 4JO2L 4G6AC 3LN4A 3A6CL 1N0LA 4B5EA 4JRXA 4ZPTA 3JV4A 4WV1C 3DLQR 4PGBA 3WLWC 1DFBH 4YXHL 2EC8A 4MNGE 2OTWB 4R3SA 3OAYK 3IGAB 1IQDA 3HRZB 5JXAL 1JNLH 1FFOA 2VL5B 5L8KB 2YRLA 4PRNA 5DJZB 5F1OB 1JWUA 5F3HA 3CCHA 1JF6A 2GUOB 1ZSDB 2BVQB 4OIIH 1Z3GH 3SDCB 4DZBA 4G6AD 4XPTH 2MWCA 3S37X 3EDDA 4X99A 3IDYB 1KFAL 1R5IA 1OQXA 5FUOL 2VDRL 4XCNB 2DQJH 4JPWL 4MVBC 1K2DA 4HJ0C 3TV3H 3KPRA 3S6CA 2YN3A 3RWHB 3VXOA 3PIQB 3A6OA 3P0VH 3SDXF 2CK0L 4PRPB 2ARJB 1MCDA 3ARVA 2VDOL 1YN7B 3SCMC 4UT7L 3IDIA 4ZS7L 3RUGE 5ID1A 1EEZB 1G0DA 1X4YA 3QHZL 4D9QE 4LGPB 5IMMB 4HUXA 1NSNH 4FFZL 1ZWIA 5CWSA 1NFIA 4YIQA 1LO0L 2W0FA 3PV7A 5C0CE 4ODTH 3QNYB 4G80A 2I27N 2FJHA 1EX0A 1C7SA 5KZCB 2HN7A 3RJDA 1EH9A 1UH4A 4KXZI 1GOGA 1IAKA 2I9TB 4Z7VF 1H3VA 4Y19E 4NPYA 2Q86B 2YUWA 5ESAB 5BMFH 2DQUH 1MFBL 5E08H 4LHUD 3EOTL 1RU9L 4AQOA 4F9LA 1MCWM 4MSWA 3WMSA 2NTFA 4J6RH 1CL7H 3LKSB 5EPMA 5T1MA 4DKFL 2BRQA 4Y2DD 3I6LD 1YEDA 5E6IA 3OJ2C 4MWFA 1IC4L 1TZHB 5FUZH 3LQZB 3SOBL 3F12B 2WV3A 2WP3T 3B8YA 1CK0H 1UXSB 4RFOL 2Y06L 3OAZK 1BFVL 1K85A 3U2SB 2BNQD 4LHJB 1NLBH 4Y4HB 4ZUWB 4AH2A 1CFQB 3QFJE 4NDMB 4O5LH 3VXNA 4FTVB 3H3PL 3DO3A 4WW2B 3AXLA 4X6FB 3HS0A 3GKWH 4OCSH 1N6QH 5T5NG 3GSNL 2Y36L 2CDFB 5FUCC 3VGAB 3OPZH 1LEKB 2AJUL 3O2DH 1F58H 2CIKA 5J1SC 5F9OL 3I6GA 3QUXB 2FWOA 2GK0A 4DOHE 4FXLA 1V3LA 4W6XB 5DFWH 5CP7A 3EDJA 4L29A 2YUVA 4X6DA 3S5LA 4ZFOA 3HZKB 3FONA 5K9QI 5CEYB 1MI5E 5IJVA 1XF4A 1JK8B 1GRWA 2VXUL 2BDNL 5DWUL 4JKPH 3RVUC 3LD8C 3QEHB 1EFXA 4PUBL 1HOCA 3RL1B 3GMPA 3G5VB 3HC0B 1X5AA 1AXSA 1MCRA 3UPCA 2D7OA 1JV5B 1JJUA 5L2KE 5GGSY 2QHRH 32C2A 1DLHA 1NGPH 2VZ1A 5MI0C 1CD9B 1VB9A 4Y19D 2R2EB 4P4RB 3TBTB 2EIDA 4HKJA 1PG7L 5F7NC 1KG0A 2VLRD 2X89D 4PJ8C 4YGVA 5CBAB 4PRAA 4GRWF 4NUGL 4EN3B 2X1XR 1TENA 4QHKJ 1ODAA 4WWKC 5GGTL 3T0DA 2NX5A 3I75A 2HMIC 3UTSD 2BOCB 4X4ZA 3DJ9A 2YRPA 2J6EH 4NRZA 3F62A 3FQUB 1L6ZA 1JPTH 5IP4A 4HX1B 5L2JB 1S9VA 4M5ZH 1BIIB 4XP4H 3SDDD 2XKSA 5IMKA 4DZ8B 3ZL4H 3EO9L 3ZKNC 3FRPA 3TZVD 3RIAF 1FIGL 2X4PB 1FFQA 4NM4H 4MA8H 4HPOL 1A0QL 3BKMH 2YXMA 4JO1H 4LLMA 4NQEA 4UUJA 2FBJL 3LEVH 4YHNA 5JUEL 3L95B 4Z77A 1CFTB 1FL5A 1WZ1L 4GKZB 5A16B 4DUWA 4NCC2 1SBSH 3EFFA 3MJ7A 5GS0L 1T1YA 4HWZB 2MMXA 1D5IH 2CMRH 3F7PC 2W1NA 4KDVA 1N59B 4PJCF 1W72L 4LCCC 4CMMA 1CU4L 2IAMC 3MRRB 4LCCA 3VH8G 4N0YH 4JZJB 3R06B 15C8H 2NY6B 3OR7A 2GSIA 5GGVY 2FHFA 8CGTA 2FX8H 5FK9A 5EOCL 4ALAH 3O3DB 4AL8L 4ZUSA 2EDTA 3QWRA 2H8PA 4PGDA 5FM8A 1P7KB 2KQNA 4LSRH 5FO7A 4C83A 3BI9X 4K8RC 2ZNXA 4Q7DA 5C0BE 5FGCE 2Z92B 3DX7A 1AO7E 5ALCL 2JJWA 4HWNA 3AS2A 3NBNA 1N5YL 1F4HA 3NPSC 1D6VH 2CXKA 1P4IL 3RWCA 4P3WA 4BFGA 3D85A 4JFZL 4CL7A 1NGZA 4J7RA 2Z0BA 3EOBA 3VCLA 1QLRA 3TVMC 1DQMH 4JFDB 4J3WA 4E5XA 4Z78B 3U6RB 2X4QA 3C5SB 3P73B 1EERB 3QFJD 1BOGB 5D5ME 3QAZB 3D2UB 4XPBL 1BGXL 4HIIA 3TBWA 2ARWA 2WLYA 2OL3B 3ROOA 1Z9SA 1A7RL 3FFCD 1CXHA 5HD8D 3HE7D 3QUML 4TSAH 1FC2D 1F4WH 4PJ9C 1ACYL 5IV2A 2AKRA 3QDMA 1U8QB 3DMMA 1S3KH 1QO3B 3BQUB 4LGSB 4O9HH 1NDGB 3TYFB 3ZKXB 4YBLC 3MRDB 2FYYA 4L4VE 2VRAA 4IRZL 3AB0C 3PJSB 1KNOA 1RZ8B 3TO4D 5KS9E 2L4OA 1I7RA 1S7UA 3V8OA 1CXIA 3WNKA 1T22A 4BKLB 1FVDB 1I1YB 3RHWF 1PEWA 2A83B 1T2JA 2PXYC 1MLBA 4BSJA 3WNMA 3HE7A 2G5BB 3GI8L 1G7IB 1MQKL 5JR1H 1IT9L 2WUCL 4MS8C 4PV8A 4DKFH 5EO9B 2HFFA 3BO8A 4NRYB 2EIZB 3UZEA 4R4FH 3HG1A 5TFSL 4JJHA 5GISL 1JZ5A 3VI3F 3CFJB 1GYAA 3P77A 3MRJA 3NIDE 3ARGB 1HSBA 4OGAC 3OGOE 4UINH 1UM6L 2DQHL 5JW4N 2GITA 2VL4A 5HHOA 1XIWB 2XZZA 1BFVH 3VGFA 3DGCR 3VFRB 2F53A 3QIUD 2VZVA 5MENE 2Q76A 4TPRL 1R3JA 3U4EA 5KSBB 2VISB 5EC1A 2X9WA 4TVPL 2ENYA 3HNSL 1S5IL 5IW6A 1FJ1A 3FJTA 4HKXB 3TA3A 1OPGL 5CLTA 4PJBF 1WFTA 2AEIT 1LK3L 1J0IA 3DURA 5JDSA 1QR4A 3ROLB 2KZWA 4RBPK 1H3UA 2F54E 3G6JE 4G9FB 5AWNL 3Q0HA 4QOKD 5I76A 4GMTH 2V7NB 1EAPA 1RUPH 5TQ2L 3MJ8B 3ES6B 4LQFL 2B0SL 4IM8A 1HN1A 1NC4A 1U91B 3VRIA 4YLQT 4JY4A 2IEPA 5ACZA 5FM4A 3QO0A 1X5KA 3LQAH 1ORQB 2HTKD 2VDML 5I1AA 4YXLL 3G5XA 5I1DA 4PUBH 5F1NA 1NUGA 3FFCE 4P57B 3UTQA 5BXFB 4JJ5A 1HYSC 3TO4C 3PWJA 5A2LH 1ZT1B 3OZ9L 3VXUE 3UTTE 4IS6B 2GJ6D 2IANB 4I0CC 1P4LB 5SV4A 1QA9B 5IVXB 5DEGA 4KUZH 2ESVD 1XCQB 2QQKL 3SKJL 1W2KT 2YEZA 3O45B 5D1QA 4FQLH 4XNUH 3N0PB 4NNYB 5ICZA 3BPOC 3WFCL 4FMFA 2X1QA 1JUFA 2YBRA 4U6VH 2DKUA 4IIQB 4OM1L 1LQSR 4QRTB 5GZNC 1JRHH 5FDWA 4TQEH 1OWWA 4POZD 4OCYL 2VLRE 5T3ZL 3JV6A 4KROD 4WI8A 3ZDXF 1Q9KB 1E6JL 4O2FA 1A1OB 1U8JA 3OKMA 5E9DB 3SJVB 5L2KA 2E9BA 2QQQA 5E56A 1KJ2H 5J1TC 2A6IA 2FIRT 2HKFL 2JJUA 1JBJA 4GBXB 5DK3A 5TF1H 4NYLA 4J3SA 4C58B 1D9KB 3NZ8B 4XNXH 5ICXA 1IVLA 2N1KA 5CSGA 2OR9L 4U7MA 5DD0L 5FYJE 5C09D 1OAYL 1P53A 3TZVA 5HGDA 2R2BB 4R97C 2J8UE 4K07A 1AXTL 2IGFH 1YDPA 1U3HC 1CG9B 3V6ZB 1KENL 3E1F1 3QJFB 3DRTA 4DGVH 5GS1C 4P46B 1DTUA 3NA9H 5D7SL 5I66A 2BVOB 5JO5B 3L7FA 2JJTC 5IKCA 3QIUC 5GPRA 4FS0A 1AP2A 2K7PA 3WKML 3V52L 3LKNB 2UY6A 4WHDA 2VOTA 2R8SH 5ISZB 4H1LB 5F8RC 4MA7H 1FVCB 4N8VB 3DUHA 4M62L 5I8CA 1MHHA 5E8DH 3LKQB 5F7UA 4P2CG 1AFVH 3W82A 3LD8B 5I0DA 3W39B 5FKPA 5HGBB 4KJWC 4WVRA 2DMCA 5F89B 4RMSA 3MRMB 3IDMB 4YHLL 1OB1A 2F5BL 3HB3C 4XGZB 3THML 1U8KA 3IGAA 4NC1E 5D7JC 4UV4H 1IC7H 1ITCA 1D6EB 5E2JA 2V5YA 1AC6A 4L5FH 1EFXD 3MRCB 2FX9H 1IKNC 4P48A 1U42A 2HJLA 1E28B 4XPHL 4WUUD 5KSVB 2PTTB 4E0RA 5K9QG 1N2RA 2GUOA 3BGMA 3GMQA 2JLLA 2NZIA 4NO2B 1R3IH 2XWJB 3MREB 1M05B 3TF7C 5C0BA 1S3KL 4PJ8B 4X99B 1KUMA 3MRPB 1YEHL 1M4KA 5KVGL 2GHWB 3SE9H 5DMIL 4XH2B 4G42A 3EOAA 5HDOA 2A73B 3MCKB 4FZ8L 2YPKA 1P4BH 5IMLA 3GJFK 4QHUA 5DQ9A 4K9EC 5D7LE 4IHOA 5L7XH 1NMBH 1F02I 1UVQB 1FN4A 1LGVA 2VLJA 1ZHBB 1AI1L 3WHE0 1ZHKA 2BVEA 3SBWC 3FFDA 1FL6B 3BPCA 3NAAH 4P5KA 1XF3B 4CVZA 1R0AL 5GISH 1YNLL 1YECL 3O4OB 5SV3A 1WBYB 2V5MA 5SX5K 2XZCL 3O8XA 3FZUC 4YUEH 1CDCA 3O8XC 2N56A 2BNRA 1HHHB 5JXEC 4OZGF 4L4VA 5IB2A 4KGLA 3MNVB 4OZIE 4IRJD 3DUUB 4X7SH 3BT2L 2R0WH 1I8KA 4JZJC 5D9SB 5C3LD 3VRLE 3RY6C 4WO4D 4Z0BL 3VA2C 2AXGA 3LQMA 3IVKA 5GJSH 4BFIA 1RQ5A 2L0DA 4JO4H 1MFCH 1QEWB 3VH8A 4ODVL 4Z7UA 4IMKC 5JZ7C 2ZUWA 5IB1A 5GGQH 5IGXL 4LCWA 2XZAL 1QR1B 3BAEH 4F7PA 4X8XA 4MX7B 5DQDL 1EO7A 4DGYL 3CH1B 3O11B 4JO3H 5ESQB 5IK3A 2X5PA 3RRQA 3CFDB 1BHGA 4RBPH 2AEPL 2F19H 5HHXL 1A9BA 2XFXA 5JOFA 1JRHI 1F6AA 4BZ1H 4C59B 2X09A 5HY9B 4JZOB 4MZ2A 3U0PA 2X70B 3OR6A 3ZE0E 3NFPB 4J12A 4KK8C 4ETQB 5C0JA 3ARFD 1J86A 1QYGH 2GSGB 4WO4C 3LEXA 1IEAA 5I1HH 4I0PC 1JNNL 4XBPA 3KJ6H 3GMMA 4PGEA 4X98A 4EI5A 2ZKHH 5EFIB 2QHLA 1BZ9A 1OGAB 5FKAA 5DJCA 5F1SA 2G60H 4BFBD 1KEGL 4CU7A 2GTZA 2J8UA 3V5DA 2FEEL 2OJEB 2VQUA 3FQRB 4HJGB 2XICA 3HZMB 4UIKH 1WC7A 5EC2A 1KEML 2ZP0T 4K3EL 1EEUA 1T83C 3W5NA 4YWGL 3ALXA 4JRXD 4H25B 3QEQE 1IM3A 4QOKB 4OF8A 1HXYB 1A4KB 1KPUB 2P5WE 3Q6FB 4OI7A 2QV2A 5AZ2H 1FDLH 1C16A 4JRYB 5ANMB 3HTLX 3MV7D 2EEAA 1RIUL 1NCWL 1D5MA 1UYWH 4FTVE 5CKAA 5MP6L 3IDJB 2Z9TA 2IFGA 4V2CB 5B3JF 4NUJA 1UWEH 1B4JH 4OGXH 1R5VA 2Q3ZA 1BAFH 2P8LA 2CUMA 1JNHB 1RI8A 5AZEL 4F7CA 4QEGA 1HH6B 1LP9A 2OTUA 3VFWB 1AGDA 4RIRA 1ZVSA 3ARDD 1NQBA 3EYVB 4G7VL 4Z7OF 3HZYB 3WKMH 1Z0MA 2BSTB 2DF3A 1QRNA 1R3KA 2ZOKA 1T7YA 2EECA 2LU3A 2P8PA 2NY5L 3FO9B 4P99A 3MRBB 4R9HA 1J10A 5ADPH 2A74A 4QRRE 1JGUL 4NRXB 3U0WH 1X5IA 4WHYH 1LEIA 4G8FB 1GOFA 4CMMB 5IR1A 2P5WB 5E8PA 1N3NB 1ZSDA 2C1PB 2FX7L 3QG7L 1TZGH 2E7MA 4GG6F 2VQ1A 1EHLL 1XGQB 2LABA 1F5WA 3F58L 1VDGA 4LSSH 5TDOB 4ZUSB 4DFIA 1D5BA 4EBQH 4IOSD 4NZUL 4OZFB 2XQYK 5LG1A 3MV8A 3K81A 4L3AA 2HFGH 1D9KD 1IGTB 5C9JA 3KPRB 5C7XL 5DVLA 4TVSa 2QTEA 1IKFH 3OKEA 3DVNB 2JCCF 3PIQA 5T3XH 1BBJB 2DQJL 4PRPA 1UCBL 5TE6L 1XGPB 1G7LB 3ARZA 1IAIL 3MLZL 1VFUA 4OCNC 3LHPH 2EC9U 3U6RA 4QRQB 3EJJX 4UILH 4NJAL 1DN0B 4Y5VB 4Y16C 4D3CH 2EKSB 3X17A 2R4RL 5IFHL 3S35X 1ZWIB 2HTLC 2I5YL 3EZJB 4L1DA 5E7BA 4WFHD 3KXFD 4W4NA 1AC0A 1QQDB 3DXAD 3E3QE 2ICEA 5D1QD 4WFGD 1I9IL 1H5BB 2H1PH 3QUXD 3EYSL 1G7JB 2XZQL 5TDNA 1Q8MA 4IOFD 4J3TA 1YNTB 3HI1A 2F5AL 3RWHA 4MNQB 2W9DH 5DHYA 1R0AH 5IF0B 4EXKA 1KBGL 4HCRL 4XMLH 3U4BL 1B0WA 5DC9B 3CAFA 5JW5A 4MCYA 3LKSA 4Y4HD 1YMMB 4WNQB 3UJJL 5I1LA 3VFPB 2E9WA 4OV5B 5FYKL 4CRPA 4HS8L 1NBVH 3IFLH 4L3ED 3VXRD 2CIIB 3MUY1 3MJ9A 1FZJB 2XN9D 1LVEA 4XMKL 3O3AB 5GRVK 1MFCL 1HKLL 1AGEA 4JY5H 1MREH 1IEBA 1YY8B 4HQQH 5DFVC 1CTOA 4S1QH 1CFQA 4JFFE 5DI8B 5DJDB 2KDGA 3UJIH 1ZANL 5B39A 5LBSL 4KWUA 1BEYH 1CVSC 4F58L 1IGMH 2BXYA 2NMSA 1XGYL 1YYML 5IMOB 2D03H 3FHAA 3MXVL 1NCTA 4S2SB 5B4MC 1J88A 1P2CB 1MCQA 3P4NB 2YKLH 1W8NA 3HFMH 3W9EA 3FAXA 3KHOA 5FCUH 3T2NL 1YEDB 2ZJSH 2VISA 3UYRH 4RNRB 3NCMA 2C3HA 2AV1A 5JPNB 1I9JL 4D2NA 3VW3H 5GS0C 3G6AA 2NY3B 3TA3B 3ARBC 3OV6A 3ZDZE 1SY6L 1XF4B 4FFVC 3G6JF 5BO1H 3SEPA 4DVRH 4ZFFA 4KKAD 3TVMB 4OLYH 5I76B 4OFIA 2EICA 4AH2B 1EFXB 1GGTA 2DMBA 2DLGA 1UC6A 3RL1A 3RIAK 3DGGB 5E99H 4HXAH 3T3MF 1XR9A 3C60D 2FH8A 3ZKQD 4W70A 3C6LB 2QBWA 1JV5A 4M4RA 4JVWA 5E1AB 1MCKA 3E0GA 4LNRA 2VXSH 5B39G 1A1MB 2Q7YB 1J0ZA 4Y7MA 1NDMA 1WV7T 1XAUA 3QQ9D 3TBTA 3OAZH 4PJXB 1GZPA 1B6UA 4M1GH 1DQLH 4GAJL 3FONB 4UIKL 2KBGA 1VPOL 4PRAB 4W6WB 1WTLA 3MJ6A 3TJHD 5FIEA 1SY6A 3SE8H 2GJZB 2AJXH 1PLGH 2AQ1A 1U36A 5DJYA 1L4IA 5H94B 3BE1H 1SEQH 1HOCB 2IPUG 4U1SB 4U0RB 1HWHB 3UTSA 5ICYA 1U6AL 4ACPA 2P43B 4OBRA 3TH4T 1TQCB 1I3GH 4R2GC 3DROA 2ESVB 1DBMH 1ZA3A 2LAAA 2FL5B 1YYLH 2QADD 4IDLA 2FO1A 3TYGL 4XXDB 5C6TH 4DZ8A 5IMKB 4L9LA 4PRBB 5IB3B 4UTAL 3K4ZA 4PBXA 3X3GL 1AE6L 2PYFA 4OGYH 4F2MA 1MFBH 3ARDC 3KVQA 1G6RH 4NJ9L 1FC1A 4L1HA 5FYKU 1OP5K 4Y19A 4JG1L 4YHNB 3QPQC 5J3HC 2Z93B 4X6CE 2X7LA 1KN2H 2H32A 3CSGA 4NQXA 1X5YA 2A9NL 2EEBA 4JFEB 3FZUD 3EFFB 3FT4B 2FR4A 4UNUA 1OW0C 3NH7L 5GGTA 3ARYA 4TUOA 2BOCA 4J4PD 3C5ZA 1P84J 1RMFH 3UTSE 1IGIH 1WSST 2ZCKL 3PABB 5EORL 2D7TH 2I9LA 4NNPH 4PJBB 1AY1L 4M93B 3GHBL 5A40E 1QSEB 5SWSD 1UXWA 4IRJA 4NO5B 5CINH 2IH3B 3BEWB 4YHKL 5CS7A 4G6MH 4WWID 1KCVL 3B9AA 3QUZD 1H3PL 1T0NB 4WEBH 4R96B 3QPXH 5DD1L 4LLQA 3IJSB 1HEZA 2BNQE 4HULB 3SKOA 3WXWL 3ULVL 5EBMA 1DQJB 3C87A 4W81A 5B8CB 1SYVB 2WP3O 3WJJC 3LRGA 4FZEH 4PB0H 1WAAE 3DUSA 1KV3A 4JFFB 1BX2B 4MMXC 3FB6B 4U31A 4H1LA 4K3DL 5DRWB 3JUZA 2W0PA 1FVCA 1CWVA 4N8VA 1MWAL 1URLA 4JFDA 3MYZA 2HJKA 4JANA 4RMTA 4CJ1A 2WWMD 5MHSE 5FK9B 4LSDA 1QFWM 5DJ0A 1KB5B 2AEQH 3C8DA 4X7DC 3TBWB 2FZ3A 2IALB 3EOYG 1FG2B 4M3JA 3W39A 5FOBA 3C2AH 4GXUN 2MHAB 1IAIH 5M7QA 1TJIL 3P9MB 3GB7B 3ARRA 4RRPA 1GL4B 1JGLH 4M9PA 5JDJA 4HG4K 5ITBH 3O6FA 5IHZB 3EIFA 3VFSA 3DYPA 3RUGA 2FIKB 1ZV5A 2CK2A 4P2RB 5E5MA 3ZHLA 1NFDE 3HR5B 1WCBB 1A4JB 3LKPA 4JCLA 5F3BB 3VI3E 3NCCB 2A6KA 5E2WH 3SDDC 1FNAA 3CX5J 5C0BB 2ITDB 4EEEA 1NKRA 5C2BH 5C0DA 2PUQT 2WM0A 5KAQF 4HIIB 4MQTB 4YFEA 4HDIA 1BVLB 4OM0H 2D31B 1ZLSL 2VR9A 4KVNL 2VXQH 1HIML 3VXRB 1A6TA 3DV6B 1A21A 2WWKO 4KQ3L 5J12C 1LDPL 3UJJH 4GXUM 3CVHH 3LB6C 3DV4A 4WI2A 1M1SA 2I60H 4L8DB 2Z8SA 1BM3H 3OJDB 1K6QL 3ZDXE 3NFSL 3KLAA 1XF5A 4G7YL 3MBEC 4R4FL 1UEMA 1TVBA 3E2HB 1MREL 3IFPB 1G6VK 1XF3A 4HQQL 4MMZC 5E6IC 3TIEB 4GJTB 4V1DD 1GVIA 4BH7B 3BDYH 3STZA 2EDBA 4OQ1A 3MJGX 5D72L 3WDJA 4DOHB 4P5TC 4HKXA 1T6VN 3T1FA 3PHOA 1A6VL 3B9KD 4KK9D 1HHHA 4ORGB 2B39A 4ZSOB 4YPJA 2ADIA 3WYRA 3REVA 5HHME 4JFPB 2FCBA 3IJHA 1WT5C 4NWUL 2AJYL 4P3DA 5KSUB 1QSZA 3MLXL 5D5MA 2BZDA 4U3CA 3QFDA 7FABL 2V7NA 1UM5L 1I7ZB 1LO5B 1LK2A 1Z9OA 4UBDD 4PD4J 1KJMA 3RI5K 4R7DA 3CH8A 1NBZB 5DURB 4I1NB 5DMKA 4M1DH 4AENA 4MZ3A 5H35A 2OSLA 1NGWB 2E8ZA 1I4FB 1RUAH 3B6SA 3BKYH 4ODSL 4P57A 4EUPG 4JFZH 3EJYC 1T89C 5JNYB 3L1OL 2IQ9H 2X4OB 3SPVA 3G5ZA 4ZOEA 2W9LA 5ESQA 2VXUH 3FT3A 5CEZE 3BRDA 1CR9L 3PDGA 1J1OH 2VDKL 1SYSA 1UH2A 4UOW0 2FNBA </