5GSPA

Ribonuclease t1/3'-gmp, 9 weeks
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE T1
publication title Hydrolysis of a slow cyclic thiophosphate substrate of RNase T1 analyzed by time-resolved crystallography.
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Endoribonuclease
total genus 25
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1997-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 5gspA00
1B2MA 1X1XA 1BRGA 1BNGA 1BNEA 1X1YA 1RN1A 1BRSA 1RGCA 3WHOA 1BIRA 7GSPA 1BRJA 1TRQA 4BIRA 1FW7A 1UCIA 3AHWA 2SARA 1GOUA 2KF4A 1LOWA 1RGHA 1BRNL 2HOHA 3AGOA 1BNSA 1RTUA 2F4YA 2F5WA 4J5KA 1RNTA 1BRHA 5BIRA 1X1WA 6GSPA 2AAEA 3BIRA 5HOHA 1B2XA 1T2HA 2KF3A 1FUSA 1RGGA 2RBIA 1RGFA 1GMPA 1RDSA 1BNIA 1JBSA 1MGWA 1DETA 3D4AA 1RMSA 1UCLA 1JBRA 4HAAA 1IYYA 1LRAA 1YVSA 1RHLA 1RN4A 1R4YA 1YNVX 1RCLA 1TRPA 1HYFA 4BU4A 1I3FA 1BOXA 1BNJA 2C4BA 1I2EA 1SARA 1BU4A 2KAAA 1B27A 1RCKA 1I8VA 3DGYA 3DH2A 1BSEA 1ZGXA 1BUJA 1B2UA 1G02A 1UCJA 2RNTA 1C54A 1Q9EA 3AGNA 3WR2A 1BAOA 2KF5A 1I70A 1CH0A 1MGRA 1AQZA 1TTOA 3AHSA 3D5GA 1LOYA 1I0XA 1RLSA 2AADA 4GHOA 7RNTA 1HZ1A 1RGKA 3KCHA 3A5EA 1YGWA 1PY3A 5RNTA 1FYSA 2BIRA 1I0VA 2F5MA 1PYLA 1B2ZA 1DE3A 1X1UA 4RNTA 1RGEA 1RNBA 1I2GA 2ZA4A 3Q3FA 1GOYA 1UCKA 4HOHA 3BU4A 1B20A 1BNFA 5BU4A 1FZUA 3GSPA 4GSPA 1BSBA 2KF6A 1T2IA 3HOHA 1A2PA 8RNTA 1GSPA 3D5IA 3SYUA 6RNTA 1I2FA 1BRKA 1RGLA 1RSNA 1AY7A 1FUTA 2GSPA 1BRIA 1RGAA 2BU4A 1BVIA 1GMRA 4J5GA 1GMQA 1LNIA 1LOVA 1JBTA 1BNRA 2F56A 5GSPA 1B21A 3RNTA 1B2SA 1BSDA 1BSCA 1I3IA 1BSAA 3URPA 1B3SA 1GOVA 9RNTA 1BANA 1BGSA
chains in the Genus database with same CATH superfamily
1IV9A 3KSPA 1X1XA 1WTHA 3JUQA 4JF8A 1UUVB 2HMOB 3WHOA 1DYUA 1BIRA 2JDIH 3NQYA 4BIRA 1UI8A 2QIYA 2P38A 3B8LA 1FW7A 1L5GB 5M18A 1GOUA 3CCV3 2KF4A 3NBBA 4HKVB 1U5OA 1BRNL 1RTUA 3LH4A 5AIIA 5BIRA 1BRHA 4XM4A 5AEWB 3QRDA 2CIUA 2HMMB 2Z76A 3VF1A 2IY2A 3F40A 2E2TA 2W9QA 3BLZA 4FCJA 4L8OA 2R41A 2F99A 2KF3A 2BT3A 2L4VA 1RGGA 4XBXA 2P05A 2O9UX 1RGFA 4KVHA 1GMPA 1KSIA 2XGNA 5CLKA 2J8XB 3KSED 3EHCA 1JB5A 1OCVA 3DGNA 2Z77A 3NBRA 5M19A 5IG0A 4R1KA 3OXAA 4AEQA 3G8ZA 1QJGA 1RRLA 1IYYA 3VSYA 3IJEB 4N6UA 4PEJA 1JZDA 2ML6A 2C10A 1R4YA 1KD14 1Z1SA 1ROAA 1HYFA 3SLUA 3G6E3 5IW9A 1J2BA 4BU4A 2Y73A 4HM7B 2CG0A 3LZAA 3KIIA 3N8BA 3OWSA 4LGQA 1MWTA 3KKGA 1GYBA 4IPBA 3JUPA 1TP6A 1UGHI 2UX0A 3DGYA 3F8HA 3S67A 1VQK3 1ZGXA 3D79A 2D42A 4L8PA 5CF2A 1D6ZA 1FGRA 3ECFA 1YIJ3 1E97A 1EQKA 3EQQB 3OWUA 3X3XA 4HBRA 3NBJA 2FNQA 4NHFA 1I70A 5AYRB 1M904 1MGRA 1OACA 2CX1A 4OK0A 1K28A 2H0GA 3CCE3 4ZM8A 3PXMA 4N3VA 3UB1A 3RGRA 3CCU3 2YFJB 2P09A 3LTBA 4WYKA 1Q7Y4 1RGKA 3KCHA 1OGZA 4HVNA 3F9SA 2HMNB 3T8UA 1Q42A 1YGWA 3FH1A 4AKZA 1FYSA 3S5CA 5IG5A 3MHEA 1W5ZA 4R9LA 5DREA 1I0VA 1N9JA 2F5MA 2MF7A 3NM2A 1K734 1DE3A 5EVHA 1Q824 4FMDA 3EB8A 1G0TA 3DY5A 1GOYA 3FKAA 2K0MA 1F8NA 1GD4A 1B20A 1BNFA 4WYKB 1DMMA 3JUNA 3WDGB 1N8R4 2D1WA 4EXRA 3IPTA 5LC7A 2IUJA 3X3YA 2XSHB 1GSPA 3D5IA 2IA7A 4N6MA 1BRKA 3GZBA 3FG3A 4LEHA 1WQLB 1FUTA 3DGMA 3OV4A 4MMXB 4K1UA 2OQEC 1STFI 4STDA 5IF6A 1GMQA 1V57A 2JQ5A 3CME3 1EUIC 1B21A 3V98A 4NPBA 1LOXA 1ISKA 1BSCA 3DXOA 2K54A 5CF1A 3G16A 3I0YA 1I3IA 3BNDA 3CNMA 3DH2A 3SOAA 1BGSA 1D6YA 1V74A 2IYJA 4MMZB 1BNGA 1BNEA 2OOVC 1C7HA 5BXQA 3T0UA 1RN1A 3CCS3 1BRSA 2CHCA 1W6GA 2BMRB 4NREA 4RNYA 1BRJA 1TRQA 3DGOA 2ML5A 3NV0A 1TJDA 2SARA 2XH9A 3KFQC 3ROBA 3UNLA 3WOFB 2CWTA 1Q7HA 1OHOA 3WA3A 1BNSA 3E99A 4J5KA 3V99A 1X1WA 4I5QA 2AAEA 3F7SA 3RGAA 1AVLA 1SIHA 3BIRA 3MG3A 1G96A 5A0OB 5HOHA 1PU4A 3EX9A 1B2XA 1QVG2 3UL6A 5D81A 1T2HA 3K5TA 1FUSA 1NWWA 2RBIA 1KWIA 1LQGC 3NV0B 5IERA 3LTCA 1FGTA 2E2UA 4JRFA 3CCQ3 1DVCA 1RDSA 4WHAA 1VQM3 1JBSA 3HIGA 1N9EA 4J9AA 1VQN3 1RMSA 1UCLA 2XSOB 1ZO2A 4HAAA 1JBRA 1N5HA 3CC43 4L7KA 3PCRA 2HMKB 4XB5A 2XFSA 1YNVX 2ZL8A 1RCLA 5LC6A 3FCSB 3UJMA 2CW9A 1OHPA 2W0QA 4N6OB 4O2HA 3I553 2R4IA 3GWRA 4MMYB 2GEYA 4R80A 1BNJA 3G713 3G4S3 1NO3A 1FGOA 1BU4A 3KZTA 4H61A 1T5YA 4KFDA 2KAAA 1B27A 4K61A 2BNGA 3KE7A 1S723 3OX9A 1VZZA 4XDWA 1BUJA 1YJ93 3ER7A 1G02A 4N6LA 3K0ZA 3Q1CA 4I4KA 3SXXA 3WR2A 3NHXA 1IT8A 1IVVA 1UI7A 2FXTA 2MC8A 1CH0A 3FF0A 1M9GA 1U8CB 5G1LA 1TTOA 3AHSA 3D5GA 1VQ63 1I0XA 1MWRA 3EF8A 4GHOA 1ULIB 3HIIA 3LXUX 4CCVA 1JKGA 1ZX2A 5DRVA 1RRHA 1LQMB 1RKYA 1RN7A 4HM3B 2WO0A 3N54B 4HZBB 4G1MB 1TIJA 2WOFA 1W00A 2B24B 3F8XA 3CC23 3CXC2 1IVUA 1X1UA 3HK4A 1RGEA 1V58A 3D3LA 2ZA4A 1VQ73 3DMCA 1IK3A 1JKGB 2W03A 1UCKA 1YGEA 4HOHA 3BU4A 8CHOA 1FZUA 5JPUA 2XEPA 3F7XA 1N8QA 2L1SA 4FMBA 5KP1A 3X42A 4XBTA 3CPW2 1KQS2 1MOLA 4EYCA 3Q2PA 1OPYA 4EBGA 6RNTA 3WA2X 1RGLA 1RSNA 5CXOA 1LXEA 1STDA 1TU5A 3O8YA 4EW5A 3HX8A 1VQ43 1RGAA 2BU4A 1BVIA 4HJLB 1JB2A 5D82A 5JBSA 1Q814 1QALA 3EE1A 3CC73 2CK3H 1BSDA 3X3ZA 4HM2B 3STDA 2Z6BA 1BSAA 3CPOA 4HM4B 3URPA 1GOVA 9RNTA 3SX1A 5HGRA 1B2MA 1OF5A 1IDPA 2CFKA 1AR0A 1JN5A 3PYJA 4HM8B 1X1YA 3SOYA 1MWSA 3TDGA 5ELUA 5STDA 2GU3A 4K1VA 2GXFA 3WOEB 2LYXA 1UCIA 3AHWA 3J7Yd 1KC84 1LVNA 4CJNA 4KZ1A 1LOWA 1RGHA 3GZYB 2KXGA 1JNQA 2HOHA 2F4YA 1S5AA 3JUOA 3V92A 1RNTA 2UUGC 1WMNA 1CEWI 1RJOA 1GY5A 2XR8B 2OCTA 1SJWA 1OUNA 1QVF2 4MEIA 1OF5B 2W56A 4OVMA 1JN5B 6STDA 2HMLB 2E2VA 1OH0A 3CCJ3 1W6YA 2QGUA 3S28A 1DVDA 1GY7A 3MSOA 1UUWB 3BNEA 1IT7A 4RNZA 4DKIA 2OTJ3 3FG4A 3GAXA 4HZ9B 1BUQA 2INXA 1VQ53 1BNIA 2LQVA 2W9PA 4LSOA 1UGIA 2CX0A 4KT3B 1GS3A 1O7WB 1ASKA 2GU1A 3JUMA 3T8NA 4O3VA 4HYZA 2W56B 1RN4A 2F98A 2H0HA 2CWVA 4FMAA 1W6CA 2W2CA 3LYGA 4LYLB 2GEXA 4J8TA 1EG9B 1TRPA 5AYSC 1PFPA 2K3DA 1D6UA 2QEX3 1IVWA 1O7GB 3VGNA 4RBNA 1I3FA 1W02A 2Q07A 4OUQA 5AIFA 1IQXA 4LZIA 3DZLA 3LT9A 1SARA 1O7MB 1IQ8A 1R4CA 1A2KA 1RCKA 1I8VA 4K90B 2WGOA 3MKIA 1B2UA 4O02B 2GBXB 2RNTA 1UCJA 3LMLA 1Q9EA 2IMJA 3AGNA 3M8CA 1O7NB 1ZS7A 2FGTA 2H0IA 3QK9A 2CFDA 3Q90A 1BAOA 1N5PA 1W7CA 2KF5A 5G2GA 2M7OA 3RDEA 1AQZA 2CFWA 2AADA 1SQWA 7RNTA 3PZWA 1HZ1A 1FUWA 3BB9A 1FGMA 5FW5A 1GD3A 3CCM3 1JJ22 1A90A 1QAFA 1Q40A 2YFIB 3A5EA 3DGLA 3NQZA 1HU9A 1PY3A 2RGQA 1VQL3 5D83A 2BO9B 2W6JH 2CG1A 5RNTA 3B7CA 3CU3A 1O7PB 3EBYA 1YIT3 1JB4A 4RNTA 1Q864 2CFGA 3X41A 1YJN3 1M1K4 1RNBA 1YI23 2WOHA 1SPUA 3HZPA 1W01A 4QWTA 3S29A 3ZG0A 1TUHA 4RZMA 2C11A 3U97A 5BU4A 1MNLA 3GSPA 4GSPA 3S27A 1BSBA 1Q40B 2KF6A 3H51A 3HOHA 1E3RA 1A2PA 1EA2A 5ELJA 8RNTA 1DMQA 4BTYA 1AV4A 3NXJA 5FGOA 3FSDA 2GSPA 4BL3A 3FF2A 2I9WA 2F86B 1BRIA 4KFFA 5CK6A 1OHSA 1GMRA 2BHMA 4J5GA 1Y4KA 1LNIA 3N9HA 2GBWB 3CNXA 1LOVA 4R9KA 1JBTA 1BNRA 1YJW3 2HMJB 4Q53A 5EEOA 2XRXB 3FGYA 1IVXA 2V1LA 4N6V0 1NNVA 5IEOA 1OGXA 1WMOA 2PNCA 1CYUA 1B3SA 1NDOB 4FCZA 2CFLA 3CD63 1WNHA 1BRGA 7STDA 1W2ZA 4FMCA 2CC3A 3EJVA 2Y74A 1AVKA 1RGCA 7GSPA 5AI1A 1VQO3 1UUGB 4XDVA 4CDLA 2RFRA 4WP5A 3X40A 1NU3A 1IV7A 2O3OA 2PZVA 3AGOA 3A76A 2RCDA 1QMAA 5G1KA 2F5WA 2CKFB 3ALAA 1JRQA 1UDII 4IIAA 6GSPA 2YX9A 1O7HB 5AEUB 3GZRA 2YFLB 3EBTA 4BL2A 3CCR3 3ZG5A 3B4OA 3DUKA 1W2B2 5KP4A 1IU7A 3U1WA 4EV5A 3G0KA 2IUKA 4EC6A 4H3UA 2UGIA 3FG1A 4BTXA 3MG2A 3NM7A 1E3VA 3PGBA 2CH9A 3K9MC 1MGWA 1DETA 3D4AA 1LNHA 1US1A 5IG3A 1W4NA 2STDA 1LRAA 5IG4A 1YVSA 1RHLA 3GZXB 1SIIA 3WMDA 3PS8A 5KP3A 3LT8A 3SEDA 1VQP3 4EV2A 1EEJA 2XGLA 2ZHXB 4O8SA 3UL5A 5JPPA 1VQ93 1CYVA 1BOXA 1EKMA 4BTWA 1ROVA 2C4BA 4XBYA 1WMPA 1I2EA 3LTDA 2KCDA 3MWZA 2RSXA 3LTAA 4HM0B 2OQEA 4MJDA 4KFEA 3OW22 1K9M4 1BSEA 1YHQ3 3CMA3 2OTL3 2XF3A 2WGQA 1C54A 3HI7A 2A15A 5BVBA 3I563 2QA43 2ZDJA 1ULJB 1UW1A 4IT7A 3BNBA 2KRTA 1JZOA 4WFOA 1LOYA 1RLSA 2BMOB 3WODG 2P0MA 4N6TA 5IEPA 3MPHA 3NX0A 4HM1B 1TFKA 1IQYA 4FCMA 3BNCA 2OOVA 1A2VA 2B1XB 4FR9A 3D9RA 5AIHA 4ORLA 3PCSA 4AKYA 5I97A 4ILFA 4U13A 2BIRA 1K41A 2P0XA 3KN4A 5IENA 1YVBI 3CCL3 1K8A4 3K63A 1A67A 3L0RA 1DMNA 4N6NB 4LMIA 1PYLA 1B2ZA 3EN1B 3DM8A 3H3HA 4HM5B 2SBLA 3NUVA 4GL6A 1QAKA 1GY6A 1I2GA 2Z7AA 3F14A 3Q3FA 3ZFZA 1FA3A 1JV2B 3MG1A 2CWUA 3AMOA 1TFOA 1FGQA 1NB3I 3EC9A 2XFTA 5EQLA 4TX4A 1T2IA 4GB5A 3GRDA 1MWUA 1T3BA 3SYUA 4X2HA 1I2FA 1AY7A 4CPKA 1HKXA 2OWPA 3MYTA 5M1AA 1CQSA 2W04A 3EN8A 3IMAB 4WWUC 3FZWA 5AIGA 4HM6B 1NJI4 3LOYA 2F56A 3AMOB 3FLJA 4R4KA 3OWYA 4X2OA 5GSPA 3RNTA 1B2SA 3K7CA 3JVCA 3SVAA 1VQQA 5TGNA 3B4PA 1VQ83 2BMQB 1NB5I 1BANA 1M1XB
chains in the Genus database with same CATH topology
1B2MA 1X1XA 1BRGA 1BNGA 1BNEA 1X1YA 1RN1A 1BRSA 1RGCA 3WHOA 1BIRA 7GSPA 1BRJA 1TRQA 4BIRA 1FW7A 1UCIA 3AHWA 2SARA 1GOUA 2KF4A 1LOWA 1RGHA 1BRNL 2HOHA 3AGOA 1BNSA 1RTUA 2F4YA 2F5WA 4J5KA 1RNTA 1BRHA 5BIRA 1X1WA 6GSPA 2AAEA 3BIRA 5HOHA 1B2XA 1T2HA 2KF3A 1FUSA 1RGGA 2RBIA 1RGFA 1GMPA 1RDSA 1BNIA 1JBSA 1MGWA 1DETA 3D4AA 1RMSA 1UCLA 1JBRA 4HAAA 1IYYA 1LRAA 1YVSA 1RHLA 1RN4A 1R4YA 1YNVX 1RCLA 1TRPA 1HYFA 4BU4A 1I3FA 1BOXA 1BNJA 2C4BA 1I2EA 1SARA 1BU4A 2KAAA 1B27A 1RCKA 1I8VA 3DGYA 3DH2A 1BSEA 1ZGXA 1BUJA 1B2UA 1G02A 1UCJA 2RNTA 1C54A 1Q9EA 3AGNA 3WR2A 1BAOA 2KF5A 1I70A 1CH0A 1MGRA 1AQZA 1TTOA 3AHSA 3D5GA 1LOYA 1I0XA 1RLSA 2AADA 4GHOA 7RNTA 1HZ1A 1RGKA 3KCHA 3A5EA 1YGWA 1PY3A 5RNTA 1FYSA 2BIRA 1I0VA 2F5MA 1PYLA 1B2ZA 1DE3A 1X1UA 4RNTA 1RGEA 1RNBA 1I2GA 2ZA4A 3Q3FA 1GOYA 1UCKA 4HOHA 3BU4A 1B20A 1BNFA 5BU4A 1FZUA 3GSPA 4GSPA 1BSBA 2KF6A 1T2IA 3HOHA 1A2PA 8RNTA 1GSPA 3D5IA 3SYUA 6RNTA 1I2FA 1BRKA 1RGLA 1RSNA 1AY7A 1FUTA 2GSPA 1BRIA 1RGAA 2BU4A 1BVIA 1GMRA 4J5GA 1GMQA 1LNIA 1LOVA 1JBTA 1BNRA 2F56A 5GSPA 1B21A 3RNTA 1B2SA 1BSDA 1BSCA 1I3IA 1BSAA 3URPA 1B3SA 1GOVA 9RNTA 1BANA 1BGSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B2M A;  1X1X A;  1BRG A;  1BNG A;  1BNE A;  1X1Y A;  1RN1 A;  1BRS A;  1RGC A;  3WHO A;  1BIR A;  7GSP A;  1BRJ A;  1TRQ A;  4BIR A;  1FW7 A;  1UCI A;  3AHW A;  2SAR A;  1GOU A;  2KF4 A;  1LOW A;  1RGH A;  1BRN L;  2HOH A;  3AGO A;  1BNS A;  1RTU A;  2F4Y A;  2F5W A;  4J5K A;  1RNT A;  1BRH A;  5BIR A;  1X1W A;  6GSP A;  2AAE A;  3BIR A;  5HOH A;  1B2X A;  1T2H A;  2KF3 A;  1FUS A;  1RGG A;  2RBI A;  1RGF A;  1GMP A;  1RDS A;  1BNI A;  1JBS A;  1MGW A;  1DET A;  3D4A A;  1RMS A;  1UCL A;  1JBR A;  4HAA A;  1IYY A;  1LRA A;  1YVS A;  1RHL A;  1RN4 A;  1R4Y A;  1YNV X;  1RCL A;  1TRP A;  1HYF A;  4BU4 A;  1I3F A;  1BOX A;  1BNJ A;  2C4B A;  1I2E A;  1SAR A;  1BU4 A;  2KAA A;  1B27 A;  1RCK A;  1I8V A;  3DGY A;  3DH2 A;  1BSE A;  1ZGX A;  1BUJ A;  1B2U A;  1G02 A;  1UCJ A;  2RNT A;  1C54 A;  1Q9E A;  3AGN A;  3WR2 A;  1BAO A;  2KF5 A;  1I70 A;  1CH0 A;  1MGR A;  1AQZ A;  1TTO A;  3AHS A;  3D5G A;  1LOY A;  1I0X A;  1RLS A;  2AAD A;  4GHO A;  7RNT A;  1HZ1 A;  1RGK A;  3KCH A;  3A5E A;  1YGW A;  1PY3 A;  5RNT A;  1FYS A;  2BIR A;  1I0V A;  2F5M A;  1PYL A;  1B2Z A;  1DE3 A;  1X1U A;  4RNT A;  1RGE A;  1RNB A;  1I2G A;  2ZA4 A;  3Q3F A;  1GOY A;  1UCK A;  4HOH A;  3BU4 A;  1B20 A;  1BNF A;  5BU4 A;  1FZU A;  3GSP A;  4GSP A;  1BSB A;  2KF6 A;  1T2I A;  3HOH A;  1A2P A;  8RNT A;  1GSP A;  3D5I A;  3SYU A;  6RNT A;  1I2F A;  1BRK A;  1RGL A;  1RSN A;  1AY7 A;  1FUT A;  2GSP A;  1BRI A;  1RGA A;  2BU4 A;  1BVI A;  1GMR A;  4J5G A;  1GMQ A;  1LNI A;  1LOV A;  1JBT A;  1BNR A;  2F56 A;  5GSP A;  1B21 A;  3RNT A;  1B2S A;  1BSD A;  1BSC A;  1I3I A;  1BSA A;  3URP A;  1B3S A;  1GOV A;  9RNT A;  1BAN A;  1BGS A; 
#chains in the Genus database with same CATH topology
 1IV9 A;  3KSP A;  1X1X A;  1WTH A;  3JUQ A;  4JF8 A;  1UUV B;  2HMO B;  3WHO A;  1DYU A;  1BIR A;  2JDI H;  3NQY A;  4BIR A;  1UI8 A;  2QIY A;  2P38 A;  3B8L A;  1FW7 A;  1L5G B;  5M18 A;  1GOU A;  3CCV 3;  2KF4 A;  3NBB A;  4HKV B;  1U5O A;  1BRN L;  1RTU A;  3LH4 A;  5AII A;  5BIR A;  1BRH A;  4XM4 A;  5AEW B;  3QRD A;  2CIU A;  2HMM B;  2Z76 A;  3VF1 A;  2IY2 A;  3F40 A;  2E2T A;  2W9Q A;  3BLZ A;  4FCJ A;  4L8O A;  2R41 A;  2F99 A;  2KF3 A;  2BT3 A;  2L4V A;  1RGG A;  4XBX A;  2P05 A;  2O9U X;  1RGF A;  4KVH A;  1GMP A;  1KSI A;  2XGN A;  5CLK A;  2J8X B;  3KSE D;  3EHC A;  1JB5 A;  1OCV A;  3DGN A;  2Z77 A;  3NBR A;  5M19 A;  5IG0 A;  4R1K A;  3OXA A;  4AEQ A;  3G8Z A;  1QJG A;  1RRL A;  1IYY A;  3VSY A;  3IJE B;  4N6U A;  4PEJ A;  1JZD A;  2ML6 A;  2C10 A;  1R4Y A;  1KD1 4;  1Z1S A;  1ROA A;  1HYF A;  3SLU A;  3G6E 3;  5IW9 A;  1J2B A;  4BU4 A;  2Y73 A;  4HM7 B;  2CG0 A;  3LZA A;  3KII A;  3N8B A;  3OWS A;  4LGQ A;  1MWT A;  3KKG A;  1GYB A;  4IPB A;  3JUP A;  1TP6 A;  1UGH I;  2UX0 A;  3DGY A;  3F8H A;  3S67 A;  1VQK 3;  1ZGX A;  3D79 A;  2D42 A;  4L8P A;  5CF2 A;  1D6Z A;  1FGR A;  3ECF A;  1YIJ 3;  1E97 A;  1EQK A;  3EQQ B;  3OWU A;  3X3X A;  4HBR A;  3NBJ A;  2FNQ A;  4NHF A;  1I70 A;  5AYR B;  1M90 4;  1MGR A;  1OAC A;  2CX1 A;  4OK0 A;  1K28 A;  2H0G A;  3CCE 3;  4ZM8 A;  3PXM A;  4N3V A;  3UB1 A;  3RGR A;  3CCU 3;  2YFJ B;  2P09 A;  3LTB A;  4WYK A;  1Q7Y 4;  1RGK A;  3KCH A;  1OGZ A;  4HVN A;  3F9S A;  2HMN B;  3T8U A;  1Q42 A;  1YGW A;  3FH1 A;  4AKZ A;  1FYS A;  3S5C A;  5IG5 A;  3MHE A;  1W5Z A;  4R9L A;  5DRE A;  1I0V A;  1N9J A;  2F5M A;  2MF7 A;  3NM2 A;  1K73 4;  1DE3 A;  5EVH A;  1Q82 4;  4FMD A;  3EB8 A;  1G0T A;  3DY5 A;  1GOY A;  3FKA A;  2K0M A;  1F8N A;  1GD4 A;  1B20 A;  1BNF A;  4WYK B;  1DMM A;  3JUN A;  3WDG B;  1N8R 4;  2D1W A;  4EXR A;  3IPT A;  5LC7 A;  2IUJ A;  3X3Y A;  2XSH B;  1GSP A;  3D5I A;  2IA7 A;  4N6M A;  1BRK A;  3GZB A;  3FG3 A;  4LEH A;  1WQL B;  1FUT A;  3DGM A;  3OV4 A;  4MMX B;  4K1U A;  2OQE C;  1STF I;  4STD A;  5IF6 A;  1GMQ A;  1V57 A;  2JQ5 A;  3CME 3;  1EUI C;  1B21 A;  3V98 A;  4NPB A;  1LOX A;  1ISK A;  1BSC A;  3DXO A;  2K54 A;  5CF1 A;  3G16 A;  3I0Y A;  1I3I A;  3BND A;  3CNM A;  3DH2 A;  3SOA A;  1BGS A;  1D6Y A;  1V74 A;  2IYJ A;  4MMZ B;  1BNG A;  1BNE A;  2OOV C;  1C7H A;  5BXQ A;  3T0U A;  1RN1 A;  3CCS 3;  1BRS A;  2CHC A;  1W6G A;  2BMR B;  4NRE A;  4RNY A;  1BRJ A;  1TRQ A;  3DGO A;  2ML5 A;  3NV0 A;  1TJD A;  2SAR A;  2XH9 A;  3KFQ C;  3ROB A;  3UNL A;  3WOF B;  2CWT A;  1Q7H A;  1OHO A;  3WA3 A;  1BNS A;  3E99 A;  4J5K A;  3V99 A;  1X1W A;  4I5Q A;  2AAE A;  3F7S A;  3RGA A;  1AVL A;  1SIH A;  3BIR A;  3MG3 A;  1G96 A;  5A0O B;  5HOH A;  1PU4 A;  3EX9 A;  1B2X A;  1QVG 2;  3UL6 A;  5D81 A;  1T2H A;  3K5T A;  1FUS A;  1NWW A;  2RBI A;  1KWI A;  1LQG C;  3NV0 B;  5IER A;  3LTC A;  1FGT A;  2E2U A;  4JRF A;  3CCQ 3;  1DVC A;  1RDS A;  4WHA A;  1VQM 3;  1JBS A;  3HIG A;  1N9E A;  4J9A A;  1VQN 3;  1RMS A;  1UCL A;  2XSO B;  1ZO2 A;  4HAA A;  1JBR A;  1N5H A;  3CC4 3;  4L7K A;  3PCR A;  2HMK B;  4XB5 A;  2XFS A;  1YNV X;  2ZL8 A;  1RCL A;  5LC6 A;  3FCS B;  3UJM A;  2CW9 A;  1OHP A;  2W0Q A;  4N6O B;  4O2H A;  3I55 3;  2R4I A;  3GWR A;  4MMY B;  2GEY A;  4R80 A;  1BNJ A;  3G71 3;  3G4S 3;  1NO3 A;  1FGO A;  1BU4 A;  3KZT A;  4H61 A;  1T5Y A;  4KFD A;  2KAA A;  1B27 A;  4K61 A;  2BNG A;  3KE7 A;  1S72 3;  3OX9 A;  1VZZ A;  4XDW A;  1BUJ A;  1YJ9 3;  3ER7 A;  1G02 A;  4N6L A;  3K0Z A;  3Q1C A;  4I4K A;  3SXX A;  3WR2 A;  3NHX A;  1IT8 A;  1IVV A;  1UI7 A;  2FXT A;  2MC8 A;  1CH0 A;  3FF0 A;  1M9G A;  1U8C B;  5G1L A;  1TTO A;  3AHS A;  3D5G A;  1VQ6 3;  1I0X A;  1MWR A;  3EF8 A;  4GHO A;  1ULI B;  3HII A;  3LXU X;  4CCV A;  1JKG A;  1ZX2 A;  5DRV A;  1RRH A;  1LQM B;  1RKY A;  1RN7 A;  4HM3 B;  2WO0 A;  3N54 B;  4HZB B;  4G1M B;  1TIJ A;  2WOF A;  1W00 A;  2B24 B;  3F8X A;  3CC2 3;  3CXC 2;  1IVU A;  1X1U A;  3HK4 A;  1RGE A;  1V58 A;  3D3L A;  2ZA4 A;  1VQ7 3;  3DMC A;  1IK3 A;  1JKG B;  2W03 A;  1UCK A;  1YGE A;  4HOH A;  3BU4 A;  8CHO A;  1FZU A;  5JPU A;  2XEP A;  3F7X A;  1N8Q A;  2L1S A;  4FMB A;  5KP1 A;  3X42 A;  4XBT A;  3CPW 2;  1KQS 2;  1MOL A;  4EYC A;  3Q2P A;  1OPY A;  4EBG A;  6RNT A;  3WA2 X;  1RGL A;  1RSN A;  5CXO A;  1LXE A;  1STD A;  1TU5 A;  3O8Y A;  4EW5 A;  3HX8 A;  1VQ4 3;  1RGA A;  2BU4 A;  1BVI A;  4HJL B;  1JB2 A;  5D82 A;  5JBS A;  1Q81 4;  1QAL A;  3EE1 A;  3CC7 3;  2CK3 H;  1BSD A;  3X3Z A;  4HM2 B;  3STD A;  2Z6B A;  1BSA A;  3CPO A;  4HM4 B;  3URP A;  1GOV A;  9RNT A;  3SX1 A;  5HGR A;  1B2M A;  1OF5 A;  1IDP A;  2CFK A;  1AR0 A;  1JN5 A;  3PYJ A;  4HM8 B;  1X1Y A;  3SOY A;  1MWS A;  3TDG A;  5ELU A;  5STD A;  2GU3 A;  4K1V A;  2GXF A;  3WOE B;  2LYX A;  1UCI A;  3AHW A;  3J7Y d;  1KC8 4;  1LVN A;  4CJN A;  4KZ1 A;  1LOW A;  1RGH A;  3GZY B;  2KXG A;  1JNQ A;  2HOH A;  2F4Y A;  1S5A A;  3JUO A;  3V92 A;  1RNT A;  2UUG C;  1WMN A;  1CEW I;  1RJO A;  1GY5 A;  2XR8 B;  2OCT A;  1SJW A;  1OUN A;  1QVF 2;  4MEI A;  1OF5 B;  2W56 A;  4OVM A;  1JN5 B;  6STD A;  2HML B;  2E2V A;  1OH0 A;  3CCJ 3;  1W6Y A;  2QGU A;  3S28 A;  1DVD A;  1GY7 A;  3MSO A;  1UUW B;  3BNE A;  1IT7 A;  4RNZ A;  4DKI A;  2OTJ 3;  3FG4 A;  3GAX A;  4HZ9 B;  1BUQ A;  2INX A;  1VQ5 3;  1BNI A;  2LQV A;  2W9P A;  4LSO A;  1UGI A;  2CX0 A;  4KT3 B;  1GS3 A;  1O7W B;  1ASK A;  2GU1 A;  3JUM A;  3T8N A;  4O3V A;  4HYZ A;  2W56 B;  1RN4 A;  2F98 A;  2H0H A;  2CWV A;  4FMA A;  1W6C A;  2W2C A;  3LYG A;  4LYL B;  2GEX A;  4J8T A;  1EG9 B;  1TRP A;  5AYS C;  1PFP A;  2K3D A;  1D6U A;  2QEX 3;  1IVW A;  1O7G B;  3VGN A;  4RBN A;  1I3F A;  1W02 A;  2Q07 A;  4OUQ A;  5AIF A;  1IQX A;  4LZI A;  3DZL A;  3LT9 A;  1SAR A;  1O7M B;  1IQ8 A;  1R4C A;  1A2K A;  1RCK A;  1I8V A;  4K90 B;  2WGO A;  3MKI A;  1B2U A;  4O02 B;  2GBX B;  2RNT A;  1UCJ A;  3LML A;  1Q9E A;  2IMJ A;  3AGN A;  3M8C A;  1O7N B;  1ZS7 A;  2FGT A;  2H0I A;  3QK9 A;  2CFD A;  3Q90 A;  1BAO A;  1N5P A;  1W7C A;  2KF5 A;  5G2G A;  2M7O A;  3RDE A;  1AQZ A;  2CFW A;  2AAD A;  1SQW A;  7RNT A;  3PZW A;  1HZ1 A;  1FUW A;  3BB9 A;  1FGM A;  5FW5 A;  1GD3 A;  3CCM 3;  1JJ2 2;  1A90 A;  1QAF A;  1Q40 A;  2YFI B;  3A5E A;  3DGL A;  3NQZ A;  1HU9 A;  1PY3 A;  2RGQ A;  1VQL 3;  5D83 A;  2BO9 B;  2W6J H;  2CG1 A;  5RNT A;  3B7C A;  3CU3 A;  1O7P B;  3EBY A;  1YIT 3;  1JB4 A;  4RNT A;  1Q86 4;  2CFG A;  3X41 A;  1YJN 3;  1M1K 4;  1RNB A;  1YI2 3;  2WOH A;  1SPU A;  3HZP A;  1W01 A;  4QWT A;  3S29 A;  3ZG0 A;  1TUH A;  4RZM A;  2C11 A;  3U97 A;  5BU4 A;  1MNL A;  3GSP A;  4GSP A;  3S27 A;  1BSB A;  1Q40 B;  2KF6 A;  3H51 A;  3HOH A;  1E3R A;  1A2P A;  1EA2 A;  5ELJ A;  8RNT A;  1DMQ A;  4BTY A;  1AV4 A;  3NXJ A;  5FGO A;  3FSD A;  2GSP A;  4BL3 A;  3FF2 A;  2I9W A;  2F86 B;  1BRI A;  4KFF A;  5CK6 A;  1OHS A;  1GMR A;  2BHM A;  4J5G A;  1Y4K A;  1LNI A;  3N9H A;  2GBW B;  3CNX A;  1LOV A;  4R9K A;  1JBT A;  1BNR A;  1YJW 3;  2HMJ B;  4Q53 A;  5EEO A;  2XRX B;  3FGY A;  1IVX A;  2V1L A;  4N6V 0;  1NNV A;  5IEO A;  1OGX A;  1WMO A;  2PNC A;  1CYU A;  1B3S A;  1NDO B;  4FCZ A;  2CFL A;  3CD6 3;  1WNH A;  1BRG A;  7STD A;  1W2Z A;  4FMC A;  2CC3 A;  3EJV A;  2Y74 A;  1AVK A;  1RGC A;  7GSP A;  5AI1 A;  1VQO 3;  1UUG B;  4XDV A;  4CDL A;  2RFR A;  4WP5 A;  3X40 A;  1NU3 A;  1IV7 A;  2O3O A;  2PZV A;  3AGO A;  3A76 A;  2RCD A;  1QMA A;  5G1K A;  2F5W A;  2CKF B;  3ALA A;  1JRQ A;  1UDI I;  4IIA A;  6GSP A;  2YX9 A;  1O7H B;  5AEU B;  3GZR A;  2YFL B;  3EBT A;  4BL2 A;  3CCR 3;  3ZG5 A;  3B4O A;  3DUK A;  1W2B 2;  5KP4 A;  1IU7 A;  3U1W A;  4EV5 A;  3G0K A;  2IUK A;  4EC6 A;  4H3U A;  2UGI A;  3FG1 A;  4BTX A;  3MG2 A;  3NM7 A;  1E3V A;  3PGB A;  2CH9 A;  3K9M C;  1MGW A;  1DET A;  3D4A A;  1LNH A;  1US1 A;  5IG3 A;  1W4N A;  2STD A;  1LRA A;  5IG4 A;  1YVS A;  1RHL A;  3GZX B;  1SII A;  3WMD A;  3PS8 A;  5KP3 A;  3LT8 A;  3SED A;  1VQP 3;  4EV2 A;  1EEJ A;  2XGL A;  2ZHX B;  4O8S A;  3UL5 A;  5JPP A;  1VQ9 3;  1CYV A;  1BOX A;  1EKM A;  4BTW A;  1ROV A;  2C4B A;  4XBY A;  1WMP A;  1I2E A;  3LTD A;  2KCD A;  3MWZ A;  2RSX A;  3LTA A;  4HM0 B;  2OQE A;  4MJD A;  4KFE A;  3OW2 2;  1K9M 4;  1BSE A;  1YHQ 3;  3CMA 3;  2OTL 3;  2XF3 A;  2WGQ A;  1C54 A;  3HI7 A;  2A15 A;  5BVB A;  3I56 3;  2QA4 3;  2ZDJ A;  1ULJ B;  1UW1 A;  4IT7 A;  3BNB A;  2KRT A;  1JZO A;  4WFO A;  1LOY A;  1RLS A;  2BMO B;  3WOD G;  2P0M A;  4N6T A;  5IEP A;  3MPH A;  3NX0 A;  4HM1 B;  1TFK A;  1IQY A;  4FCM A;  3BNC A;  2OOV A;  1A2V A;  2B1X B;  4FR9 A;  3D9R A;  5AIH A;  4ORL A;  3PCS A;  4AKY A;  5I97 A;  4ILF A;  4U13 A;  2BIR A;  1K41 A;  2P0X A;  3KN4 A;  5IEN A;  1YVB I;  3CCL 3;  1K8A 4;  3K63 A;  1A67 A;  3L0R A;  1DMN A;  4N6N B;  4LMI A;  1PYL A;  1B2Z A;  3EN1 B;  3DM8 A;  3H3H A;  4HM5 B;  2SBL A;  3NUV A;  4GL6 A;  1QAK A;  1GY6 A;  1I2G A;  2Z7A A;  3F14 A;  3Q3F A;  3ZFZ A;  1FA3 A;  1JV2 B;  3MG1 A;  2CWU A;  3AMO A;  1TFO A;  1FGQ A;  1NB3 I;  3EC9 A;  2XFT A;  5EQL A;  4TX4 A;  1T2I A;  4GB5 A;  3GRD A;  1MWU A;  1T3B A;  3SYU A;  4X2H A;  1I2F A;  1AY7 A;  4CPK A;  1HKX A;  2OWP A;  3MYT A;  5M1A A;  1CQS A;  2W04 A;  3EN8 A;  3IMA B;  4WWU C;  3FZW A;  5AIG A;  4HM6 B;  1NJI 4;  3LOY A;  2F56 A;  3AMO B;  3FLJ A;  4R4K A;  3OWY A;  4X2O A;  5GSP A;  3RNT A;  1B2S A;  3K7C A;  3JVC A;  3SVA A;  1VQQ A;  5TGN A;  3B4P A;  1VQ8 3;  2BMQ B;  1NB5 I;  1BAN A;  1M1X B; 
#chains in the Genus database with same CATH homology
 1B2M A;  1X1X A;  1BRG A;  1BNG A;  1BNE A;  1X1Y A;  1RN1 A;  1BRS A;  1RGC A;  3WHO A;  1BIR A;  7GSP A;  1BRJ A;  1TRQ A;  4BIR A;  1FW7 A;  1UCI A;  3AHW A;  2SAR A;  1GOU A;  2KF4 A;  1LOW A;  1RGH A;  1BRN L;  2HOH A;  3AGO A;  1BNS A;  1RTU A;  2F4Y A;  2F5W A;  4J5K A;  1RNT A;  1BRH A;  5BIR A;  1X1W A;  6GSP A;  2AAE A;  3BIR A;  5HOH A;  1B2X A;  1T2H A;  2KF3 A;  1FUS A;  1RGG A;  2RBI A;  1RGF A;  1GMP A;  1RDS A;  1BNI A;  1JBS A;  1MGW A;  1DET A;  3D4A A;  1RMS A;  1UCL A;  1JBR A;  4HAA A;  1IYY A;  1LRA A;  1YVS A;  1RHL A;  1RN4 A;  1R4Y A;  1YNV X;  1RCL A;  1TRP A;  1HYF A;  4BU4 A;  1I3F A;  1BOX A;  1BNJ A;  2C4B A;  1I2E A;  1SAR A;  1BU4 A;  2KAA A;  1B27 A;  1RCK A;  1I8V A;  3DGY A;  3DH2 A;  1BSE A;  1ZGX A;  1BUJ A;  1B2U A;  1G02 A;  1UCJ A;  2RNT A;  1C54 A;  1Q9E A;  3AGN A;  3WR2 A;  1BAO A;  2KF5 A;  1I70 A;  1CH0 A;  1MGR A;  1AQZ A;  1TTO A;  3AHS A;  3D5G A;  1LOY A;  1I0X A;  1RLS A;  2AAD A;  4GHO A;  7RNT A;  1HZ1 A;  1RGK A;  3KCH A;  3A5E A;  1YGW A;  1PY3 A;  5RNT A;  1FYS A;  2BIR A;  1I0V A;  2F5M A;  1PYL A;  1B2Z A;  1DE3 A;  1X1U A;  4RNT A;  1RGE A;  1RNB A;  1I2G A;  2ZA4 A;  3Q3F A;  1GOY A;  1UCK A;  4HOH A;  3BU4 A;  1B20 A;  1BNF A;  5BU4 A;  1FZU A;  3GSP A;  4GSP A;  1BSB A;  2KF6 A;  1T2I A;  3HOH A;  1A2P A;  8RNT A;  1GSP A;  3D5I A;  3SYU A;  6RNT A;  1I2F A;  1BRK A;  1RGL A;  1RSN A;  1AY7 A;  1FUT A;  2GSP A;  1BRI A;  1RGA A;  2BU4 A;  1BVI A;  1GMR A;  4J5G A;  1GMQ A;  1LNI A;  1LOV A;  1JBT A;  1BNR A;  2F56 A;  5GSP A;  1B21 A;  3RNT A;  1B2S A;  1BSD A;  1BSC A;  1I3I A;  1BSA A;  3URP A;  1B3S A;  1GOV A;  9RNT A;  1BAN A;  1BGS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...