5GSUD

Crystal structure of nucleosome core particle consisting of human testis-specific histone variants, th2a and th2b
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
97
structure length
97
Chain Sequence
RKRTRKESYSIYIYKVLKQVHPDTGISSKAMSIMNSFVTDIFERIASEASRLAHYSKRSTISSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Structural analyses of the nucleosome complexes with human testis-specific histone variants, hTh2a and hTh2b
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 36
structure length 97
sequence length 97
chains with identical sequence H
ec nomenclature
pdb deposition date 2016-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5gsuD00
1M19B 3W99A 4ZUXB 5AV5C 3AZHA 4J8UB 2PYOA 1M19C 4ZUXC 4WU9D 4J8UC 3LELB 1KX3A 2BYKA 3KUYD 1P3IB 3W96B 2AROB 3LELC 3AV1D 5B40A 4JJND 3C1BB 4UUZA 1P3IC 3X1VB 1M1AC 5GT3B 3MNND 1WWSA 1P3PB 5DNNA 5G49B 3RELA 1M18B 3X1VC 5BO0A 1Q9CA 5GT3C 3AZIA 5AY8A 3AZKB 1P3PC 1KX4A 3REKA 1M18C 5B33B 3AZKC 5CPKA 3B0CW 3AFAB 5AV9B 4KUDD 3MVDA 3MGQA 3AV2B 5GT0B 5B33C 5B32A 2NZDB 5B1MD 3X1UA 5AV9C 3AFAC 1BH8B 5KDMB 3AV2C 1AOIB 5GT0C 3MGSB 1P3OB 2NZDC 1F66C 5BNXB 3AZND 1AOIC 1EQZB 3MGSC 1WWIA 1P3OC 3VH5W 4J8VB 4YS3A 3WTPB 1EQZC 5B0ZC 3WKJD 4HGAB 3WAAB 4J8VC 3WTPC 2YFVA 3REHA 3KWQB 5E5AD 5B0YB 1HQ3B 1TAFA 4HGAC 3WAAC 4YM6A 3KWQC 3W97A 4XZQD 5B0YC 1HQ3C 1ZLAD 5AV5D 3REJD 3AZFD 4WU8B 5B2IB 3LZ1D 5B31B 4J8UD 4WU8C 5B2IC 5B31C 2RVQD 5AVBA 3LELD 1S32B 3W96D 1P3ID 2AROD 5BT1D 3W98A 4H9RB 4NE6A 1S32C 3KXBB 3C1BD 3X1VD 5GT3D 3KXBC 4CAYA 3AN2B 5B1MA 5CP6D 3AZKD 3LZ0B 3AN2C 4Z66D 3TU4D 3VH5T 5DNMD 5B24D 5B33D 3LZ0C 3WA9D 3B6FA 3AFAD 3AZMA 3O62B 4H9NB 2PYOD 5GSUB 3WKJA 2HUEB 3O62C 1P3OD 1TZYB 5AV8B 5GSUC 4WV4B 5E5AA 2HUEC 1KX3D 1EQZD 1TZYC 5AV8C 4XZQA 5B40D 3WTPD 5AV5A 5BNVB 1M19A 4ZUXA 3A6NB 3KWQD 3RELD 3B6GB 2IO5B 4G91B 5BS7C 5B0YD 1HQ3D 4J8UA 5AY8D 3AZID 3A6NC 3B6GC 1P3MB 2IO5C 4G91C 3LELA 5AV6C 5CPKD 4WU8D 1P3MC 3W96A 1P3IA 3MGQD 2F8NB 3C1BA 3X1VA 5GT3A 1P3PA 3VH6W 5G49A 1M18A 2HIOB 3AZKA 1P3KB 4YS3D 2HIOC 4KGCC 4E45A 5B33A 1P3KC 5B1LB 3AFAA 5AV9A 3REHD 3AN2D 3AV2A 5GT0A 5B1LC 2NZDA 1F1EA 1BH8A 5KDMA 1AOIA 4YM6D 3MGSA 3W97D 1KU5A 1P3OA 3X1SC 5BNXA 1EQZA 5B0ZA 5AVCB 4NE3A 1P3BB 1M1AB 4J8VA 1ID3B 4J8XB 3WTPA 5AVCC 5F99B 2NQBB 5GSUD 1KX5B 3C1CB 1P3BC 3WAAA 4R8PB 1ID3C 4J8XC 5F99C 5AVBD 3KWQA 1KX5C 2NQBC 3AYWB 3C1CC 5B0YA 1HQ3A 4R8PC 2FJ7B 4EO5B 4Z5TB 3W98D 3MGRB 1ULYA 3AYWC 1U35B 2FJ7C 4EO5C 4Z5TC 4WU8A 3MGRC 4H9QB 1A7WA 5B2IA 3VH6T 3A6ND 1U35C 3B6GD 4H9PA 5B31A 1F66B 2L5AA 4H9SC 4H9OB 4LD9B 3UTBB 3AZLC 1S32A 5B0ZB 3B6FD 4LD9C 5CPJB 3AZMD 2JSSA 4H9RA 3UTBC 2F8ND 3KXBA 3UTAC 5CPJC 4ZBJB 5B2JB 3AN2A 4WZSB 5B32G 1P34B 4ZBJC 5B2JC 2YFWB 3LZ0A 1P3KD 3B0BA 3LJAC 1P34C 4NE5A 4DRAA 1M19D 3O62A 4H9NA 4ZUXD 5CPIB 4H9PB 1H3OB 5GSUA 3MGPB 5CPIC 4M6BA 1TZYA 5AV8A 3MGPC 5AVCD 1P3BD 3AZEB 1M1AD 1ID3D 5F99D 5BNVA 5BS7A 3AZEC 1P3PD 3A6NA 1M18D 3B6GA 4J8WB 3B0DB 2FJ7D 1P3MA 4J8WC 3B0DC 4X23B 5AV9D 3AV2D 4KHAB 5GT0D 2F8NA 2NZDD 4X23C 1F66D 1AOID 3MGSD 4LD9D 2HIOA 3UTBD 4KGCA 5B0ZD 4QLCB 5JA4B 1P3KA 4J8VD 4QLCC 1P3GB 5B1LA 4WU9B 3WAAD 1P3AB 1P3GC 4WU9C 3KUYB 3X1SA 5AV6B 3AV1B 1P3AC 3KUYC 3AV1C 5AVCA 3MNNB 4JJNC 1P3BA 5B2ID 1M1AA 1ID3A 5CPID 4J8XA 5B31D 5F99A 3MNNC 2NQBA 1KX5A 3C1CA 3MGPD 1BH9B 4R8PA 5FUGB 3AYWA 1S32D 4KGCB 4KUDB 4CSRB 2FJ7A 4Z5TA 1P3FB 3MGRA 3V9RB 3KXBD 3X1TB 1U35A 5JRGB 4KUDC 1P3FC 4H9QA 3X1TC 4H9SA 5JRGC 3AZNB 1F66A 4XUJB 3X1SB 3LZ0D 4J8WD 1JFIB 4H9OA 4LD9A 3AZNC 4XUJC 3UTBA 3UTAA 5CPJA 3O62D 2LY8A 1P3LB 3NQJB 3VH5A 5B2JA 1P3LC 1ZLAB 1TZYD 3REJB 5AV8D 1B67A 3AZFB 1P34A 2YFWA 3AZJB 1ZLAC 3REJC 3AZFC 3LZ1B 3AZJC 1P3GD 3LZ1C 3R45B 5CPIA 5GXQB 1P3AD 1H3OA 5AV6D 2RVQC 3AZLB 1N1JB 4WNNB 3MGPA 5GXQC 4XZQC 3UT9B 1P3MD 3W96C 2AROC 4E44A 5BT1C 3UTAB 3UT9C 1HTAA 3C1BC 3AZEA 2CV5B 5CP6B 4Z2MG 4Z66B 3TU4B 2CV5C 5CP6C 5B24B 5DNMB 4DRBA 3LJAB 3AZGB 3REIB 3WA9B 2HIOD 5B31G 4Z66C 3TU4C 3NQUB 2F8NK 4KGCD 3W99B 5DNMC 5B24C 4J8WA 3AZGC 3AZHB 3REIC 1P3FD 3WA9C 2PYOB 3X1TD 5JRGD 3W99C 5B1LD 4X23A 3AZHC 2PYOC 4KHAA 5C3IB 1R4VA 1KX3B 2BYKB 2CWEA 4XUJD 3X1SD 5C3IC 5B40B 1KX3C 4UUZB 2F8NH 4AWLB 5CHLB 4QLCA 5B40C 5JA4A 5DNNB 3RELB 4J8XD 1P3LD 5BO0B 4AWLC 3AZIB 1KX4B 5AY8B 2NQBD 5DNNC 1P3GA 1KX5D 3C1CD 3REKB 3RELC 4WU9A 4R8PD 1KX4C 3AZIC 5AY8C 1P3AA 5CPKB 3AYWD 3REKC 3KUYA 3MVDB 5AV6A 3MGQB 3AZJD 4G92B 4NFTA 4Z5TD 5B32B 3AV1A 3MGRD 5CPKC 4JJNA 3X1UB 1U35D 3MVDC 3MGQC 4G92C 1B6WA 5B32C 3MNNA 3X1UC 5GXQD 3B0CT 3AZLD 1BH9A 4YS3B 3UT9D 3VH6A 5FUGA 3UTAD 4YS3C 4CSRA 4KUDA 3REHB 2YFVB 5CPJD 1P3FA 3V9RA 2CV5D 1TAFB 3X1TA 5JRGA 3REHC 4YM6B 5B2JD 3W97B 3KSYA 3LJAD 3AZGD 3REID 3AZNA 2F8NG 1P34D 4YM6C 3W97C 4XUJA 3W99D 1JFIA 3AZHD 4JJNB 5AVBB 1P3LA 3NQJA 2BYMA 5AVBC 3W98B 1ZLAA 3REJA 1BFMA 3AZFA 3W98C 3AZJA 5DNND 4CAYB 3AZED 3LZ1A 1KX4D 5B1MB 3REKD 3WTPE 5B1MC 3R45A 5GXQA 4Z2MH 3B6FB 3MVDD 2AROA 3AZMB 3AZLA 1N1JA 4WNNA 5B32D 3UT9A 3B6FC 3X1UD 3WKJB 3AZMC 4X23D 3WKJC 5E5AB 2CV5A 5CP6A 2BYMB 4Z66A 3TU4A 4XZQB 5E5AC 5DNMA 5B24A 5AV5B 3LJAA 3AZGA 3REIA 3WA9A 3NQUA 4QLCD
chains in the Genus database with same CATH superfamily
1M19B 3W99A 4ZUXB 5AV5C 3AZHA 2Y2OA 4J8UB 2PYOA 1M19C 4ZUXC 4WU9D 4J8UC 3H0LC 3LELB 1KX3A 2BYKA 3KUYD 1P3IB 3W96B 2AROB 3LELC 3AV1D 5B40A 4JJND 3C1BB 4UUZA 1P3IC 3X1VB 1M1AC 5GT3B 3MNND 1WWSA 1P3PB 5DNNA 5G49B 3RELA 1M18B 3X1VC 5BO0A 1Q9CA 5GT3C 3AZIA 5AY8A 3AZKB 1P3PC 1KX4A 3REKA 1M18C 5B33B 3AZKC 5CPKA 3B0CW 2BG1A 5AV9B 3AFAB 4KUDD 3MVDA 3MGQA 3AV2B 5GT0B 5B33C 5B32A 2NZDB 5B1MD 3X1UA 5AV9C 3AFAC 1BH8B 5KDMB 3AV2C 1AOIB 5GT0C 3MGSB 1P3OB 2NZDC 1F66C 5BNXB 3AZND 1AOIC 1EQZB 3MGSC 1WWIA 1P3OC 3VH5W 3H0MC 4J8VB 4YS3A 3WTPB 1EQZC 5B0ZC 2RIQA 3WKJD 4HGAB 3WAAB 4J8VC 2Y2QA 3WTPC 2YFVA 3REHA 3KWQB 5E5AD 5B0YB 1HQ3B 1TAFA 4HGAC 3WAAC 4YM6A 3KWQC 3A1IA 1T3UA 3W97A 4XZQD 5B0YC 1HQ3C 1ZLAD 5AV5D 3REJD 3AZFD 4WU8B 2W8SA 5B2IB 3LZ1D 5B31B 4J8UD 4WU8C 2JE5A 5B2IC 5B31C 2RVQD 5AVBA 3LELD 1S32B 3W96D 1P3ID 2AROD 5BT1D 2ZY2A 3W98A 4H9RB 4NE6A 1S32C 3KXBB 3C1BD 2J8PA 3X1VD 5GT3D 3KXBC 4CAYA 4DQYB 3AN2B 5B1MA 5CP6D 3AZKD 3LZ0B 3AN2C 4Z66D 3TU4D 3AL0C 3VH5T 5DNMD 5B24D 5B33D 3LZ0C 3WA9D 3B6FA 3AFAD 3AZMA 3O62B 4H9NB 3F6TA 2PYOD 5GSUB 3WKJA 2HUEB 3O62C 1P3OD 1TZYB 5AV8B 5GSUC 4WV4B 5E5AA 2HUEC 1KX3D 1EQZD 1TZYC 1W2EA 5AV8C 2Y2JA 5B40D 4XZQA 3WTPD 5AV5A 5BNVB 1M19A 4ZUXA 3A6NB 3KWQD 3RELD 3B6GB 2IO5B 4G91B 5BS7C 5B0YD 1HQ3D 4J8UA 5AY8D 3AZID 3A6NC 3B6GC 1P3MB 2IO5C 4G91C 2UWXA 3LELA 5AV6C 5CPKD 4WU8D 1P3MC 3W96A 1P3IA 3MGQD 2F8NB 3C1BA 3X1VA 5GT3A 1P3PA 3VH6W 5G49A 1M18A 2HIOB 3AZKA 1P3KB 4YS3D 2HIOC 4KGCC 4E45A 5B33A 1P3KC 1Z2CB 5B1LB 3AFAA 5AV9A 3REHD 3AN2D 3AV2A 5GT0A 5B1LC 2NZDA 1F1EA 1BH8A 5KDMA 1AOIA 4YM6D 3MGSA 3W97D 1KU5A 1P3OA 3X1SC 5BNXA 1EQZA 5B0ZA 5AVCB 4NE3A 1P3BB 1M1AB 4J8VA 1ID3B 4J8XB 3WTPA 5AVCC 5F99B 2NQBB 5GSUD 1KX5B 3C1CB 1P3BC 3WAAA 4R8PB 1ID3C 4J8XC 5F99C 5AVBD 3KWQA 1KX5C 2NQBC 3AYWB 3C1CC 5B0YA 1HQ3A 4R8PC 2FJ7B 4EO5B 4Z5TB 3W98D 3MGRB 1ULYA 3AYWC 1U35B 2FJ7C 4EO5C 4Z5TC 4WU8A 3MGRC 4H9QB 1A7WA 5B2IA 3VH6T 3A6ND 1U35C 3B6GD 4H9PA 5B31A 1F66B 2L5AA 3KFUG 4H9SC 4H9OB 4LD9B 3UTBB 3AZLC 1S32A 5B0ZB 3B6FD 4LD9C 5CPJB 3AZMD 2JSSA 4H9RA 3UTBC 2F8ND 3A1KA 3KXBA 3UTAC 5CPJC 4ZBJB 5B2JB 3AN2A 4WZSB 5B32G 1P34B 4ZBJC 5B2JC 2YFWB 3LZ0A 1P3KD 3B0BA 3LJAC 1P34C 4NE5A 4DRAA 1M19D 3O62A 4H9NA 2F2AC 4ZUXD 5CPIB 4H9PB 1H3OB 5GSUA 2VQRA 3MGPB 5CPIC 4M6BA 1TZYA 5AV8A 3MGPC 5AVCD 2ZY4A 1P3BD 3AZEB 1M1AD 1ID3D 3IP4C 5F99D 5BNVA 2XD5A 5BS7A 3AZEC 1P3PD 3A6NA 1M18D 3P5JB 3B6GA 4J8WB 3B0DB 2FJ7D 1P3MA 4J8WC 3B0DC 4X23B 5AV9D 3AV2D 4KHAB 5GT0D 2DF4C 2F8NA 2NZDD 4X23C 1F66D 1AOID 3MGSD 4LD9D 2Y2PA 2HIOA 3UTBD 4KGCA 5B0ZD 4QLCB 5JA4B 1P3KA 4J8VD 4UPKA 4QLCC 1P3GB 5B1LA 4WU9B 3WAAD 2JCHA 1P3AB 1P3GC 4WU9C 3KUYB 3X1SA 5AV6B 2Y2KA 3AV1B 1P3AC 3KUYC 3AV1C 5AVCA 3MNNB 4JJNC 1P3BA 5B2ID 1M1AA 1ID3A 5CPID 4J8XA 5B31D 5F99A 3MNNC 2NQBA 1KX5A 3C1CA 3MGPD 1BH9B 4R8PA 5FUGB 3AYWA 1S32D 4KGCB 4KUDB 4CSRB 2FJ7A 4Z5TA 1P3FB 3MGRA 3V9RB 3KXBD 3X1TB 1U35A 5JRGB 4KUDC 1P3FC 4H9QA 3X1TC 4H9SA 5JRGC 2Y2GA 3AZNB 1F66A 4XUJB 3X1SB 3LZ0D 4J8WD 2DQNC 1JFIB 2Y2LA 4H9OA 4LD9A 3AZNC 4XUJC 3UTBA 3UTAA 5CPJA 3O62D 2LY8A 1P3LB 3NQJB 3VH5A 5B2JA 1P3LC 1ZLAB 1TZYD 3REJB 5AV8D 1B67A 3AZFB 1P34A 2YFWA 2ZY3A 3AZJB 1ZLAC 3REJC 3AZFC 3LZ1B 3H0RC 3AZJC 1P3GD 3LZ1C 3R45B 5CPIA 5GXQB 1P3AD 1H3OA 5AV6D 2RVQC 3AZLB 1N1JB 4WNNB 3MGPA 5GXQC 4XZQC 3UT9B 2Y2MA 1P3MD 3W96C 2AROC 4E44A 5BT1C 3UTAB 3UT9C 1HTAA 3C1BC 3AZEA 2CV5B 5CP6B 4Z2MG 4Z66B 3TU4B 2CV5C 5CP6C 5B24B 5DNMB 4DRBA 3LJAB 3AZGB 3REIB 3WA9B 2HIOD 2Y2HA 5B31G 4Z66C 3NQUB 3TU4C 2F8NK 4KGCD 3W99B 5DNMC 5B24C 4J8WA 3AZGC 3AZHB 3REIC 1P3FD 3WA9C 2PYOB 3X1TD 5JRGD 3W99C 5B1LD 4X23A 3AZHC 2PYOC 4KHAA 3EPLA 5C3IB 1R4VA 1KX3B 2BYKB 2CWEA 4XUJD 3X1SD 5C3IC 5B40B 1KX3C 4UUZB 2F8NH 2ZY5A 4AWLB 5CHLB 4QLCA 5B40C 5JA4A 5DNNB 3RELB 4J8XD 1P3LD 5BO0B 4AWLC 3AZIB 1KX4B 5AY8B 2NQBD 5DNNC 1P3GA 1KX5D 3C1CD 3REKB 3RELC 4WU9A 4R8PD 1KX4C 3AZIC 5AY8C 1P3AA 5CPKB 3AYWD 3REKC 3KUYA 3MVDB 5AV6A 3MGQB 2G5HC 2ZM5A 4G92B 3AZJD 4NFTA 4Z5TD 5B32B 3AV1A 3MGRD 5CPKC 4JJNA 3X1UB 1U35D 3MVDC 3MGQC 4G92C 1B6WA 5B32C 2G5IC 3MNNA 3EPHA 3X1UC 5GXQD 3B0CT 3EG5B 3AZLD 1BH9A 4YS3B 3UT9D 3VH6A 5FUGA 3FDDA 3UTAD 4WJ3C 4YS3C 4CSRA 4KUDA 3REHB 2YFVB 5CPJD 1P3FA 3V9RA 2CV5D 1TAFB 3X1TA 5JRGA 3REHC 4YM6B 5B2JD 3W97B 3KSYA 3LJAD 3AZGD 3REID 3AZNA 2F8NG 1P34D 4YM6C 3W97C 4XUJA 3W99D 1JFIA 3AZHD 4JJNB 5AVBB 1P3LA 3NQJA 2BYMA 5AVBC 3W98B 2Y2NA 1PZRA 2XD1A 1ZLAA 3REJA 1BFMA 3AZFA 3W98C 3AZJA 5DNND 4CAYB 2FFFB 3AZED 3LZ1A 1KX4D 5B1MB 2Y2IA 3REKD 3WTPE 5B1MC 3R45A 5GXQA 4Z2MH 3B6FB 3MVDD 2AROA 3AZMB 3EPKA 3AZLA 1N1JA 4WNNA 5B32D 3UT9A 3B6FC 3X1UD 3WKJB 3AZMC 4X23D 3WKJC 5E5AB 2CV5A 5CP6A 3EPJA 2BYMB 4Z66A 3TU4A 4XZQB 5E5AC 5DNMA 5B24A 5AV5B 3LJAA 3AZGA 3REIA 3WA9A 3NQUA 4QLCD
chains in the Genus database with same CATH topology
1M19B 3W99A 4ZUXB 5AV5C 3AZHA 2Y2OA 4J8UB 2PYOA 1M19C 4ZUXC 4WU9D 4J8UC 3H0LC 3LELB 1KX3A 2BYKA 3KUYD 1P3IB 3W96B 2AROB 3LELC 3AV1D 5B40A 4JJND 3C1BB 4UUZA 1P3IC 3X1VB 1M1AC 5GT3B 3MNND 1WWSA 1P3PB 5DNNA 5G49B 3RELA 1M18B 3X1VC 5BO0A 1Q9CA 5GT3C 3AZIA 5AY8A 3AZKB 1P3PC 1KX4A 3REKA 1M18C 5B33B 3AZKC 5CPKA 3B0CW 2BG1A 5AV9B 3AFAB 4KUDD 3MVDA 3MGQA 3AV2B 5GT0B 5B33C 5B32A 2NZDB 5B1MD 3X1UA 5AV9C 3AFAC 1BH8B 5KDMB 3AV2C 1AOIB 5GT0C 3MGSB 1P3OB 2NZDC 1F66C 5BNXB 3AZND 1AOIC 1EQZB 3MGSC 1WWIA 1P3OC 3VH5W 3H0MC 4J8VB 4YS3A 3WTPB 1EQZC 5B0ZC 2RIQA 3WKJD 4HGAB 3WAAB 4J8VC 2Y2QA 3WTPC 2YFVA 3REHA 3KWQB 5E5AD 5B0YB 1HQ3B 1TAFA 4HGAC 3WAAC 4YM6A 3KWQC 3A1IA 1T3UA 3W97A 4XZQD 5B0YC 1HQ3C 1ZLAD 5AV5D 3REJD 3AZFD 4WU8B 2W8SA 5B2IB 3LZ1D 5B31B 4J8UD 4WU8C 2JE5A 5B2IC 5B31C 2RVQD 5AVBA 3LELD 1S32B 3W96D 1P3ID 2AROD 5BT1D 2ZY2A 3W98A 4H9RB 4NE6A 1S32C 3KXBB 3C1BD 2J8PA 3X1VD 5GT3D 3KXBC 4CAYA 4DQYB 3AN2B 5B1MA 5CP6D 3AZKD 3LZ0B 3AN2C 4Z66D 3TU4D 3AL0C 3VH5T 5DNMD 5B24D 5B33D 3LZ0C 3WA9D 3B6FA 3AFAD 3AZMA 3O62B 4H9NB 3F6TA 2PYOD 5GSUB 3WKJA 2HUEB 3O62C 1P3OD 1TZYB 5AV8B 5GSUC 4WV4B 5E5AA 2HUEC 1KX3D 1EQZD 1TZYC 1W2EA 5AV8C 2Y2JA 5B40D 4XZQA 3WTPD 5AV5A 5BNVB 1M19A 4ZUXA 3A6NB 3KWQD 3RELD 3B6GB 2IO5B 4G91B 5BS7C 5B0YD 1HQ3D 4J8UA 5AY8D 3AZID 3A6NC 3B6GC 1P3MB 2IO5C 4G91C 2UWXA 3LELA 5AV6C 5CPKD 4WU8D 1P3MC 3W96A 1P3IA 3MGQD 2F8NB 3C1BA 3X1VA 5GT3A 1P3PA 3VH6W 5G49A 1M18A 2HIOB 3AZKA 1P3KB 4YS3D 2HIOC 4KGCC 4E45A 5B33A 1P3KC 1Z2CB 5B1LB 3AFAA 5AV9A 3REHD 3AN2D 3AV2A 5GT0A 5B1LC 2NZDA 1F1EA 1BH8A 5KDMA 1AOIA 4YM6D 3MGSA 3W97D 1KU5A 1P3OA 3X1SC 5BNXA 1EQZA 5B0ZA 5AVCB 4NE3A 1P3BB 1M1AB 4J8VA 1ID3B 4J8XB 3WTPA 5AVCC 5F99B 2NQBB 5GSUD 1KX5B 3C1CB 1P3BC 3WAAA 4R8PB 1ID3C 4J8XC 5F99C 5AVBD 3KWQA 1KX5C 2NQBC 3AYWB 3C1CC 5B0YA 1HQ3A 4R8PC 2FJ7B 4EO5B 4Z5TB 3W98D 3MGRB 1ULYA 3AYWC 1U35B 2FJ7C 4EO5C 4Z5TC 4WU8A 3MGRC 4H9QB 1A7WA 5B2IA 3VH6T 3A6ND 1U35C 3B6GD 4H9PA 5B31A 1F66B 2L5AA 3KFUG 4H9SC 4H9OB 4LD9B 3UTBB 3AZLC 1S32A 5B0ZB 3B6FD 4LD9C 5CPJB 3AZMD 2JSSA 4H9RA 3UTBC 2F8ND 3A1KA 3KXBA 3UTAC 5CPJC 4ZBJB 5B2JB 3AN2A 4WZSB 5B32G 1P34B 4ZBJC 5B2JC 2YFWB 3LZ0A 1P3KD 3B0BA 3LJAC 1P34C 4NE5A 4DRAA 1M19D 3O62A 4H9NA 2F2AC 4ZUXD 5CPIB 4H9PB 1H3OB 5GSUA 2VQRA 3MGPB 5CPIC 4M6BA 1TZYA 5AV8A 3MGPC 5AVCD 2ZY4A 1P3BD 3AZEB 1M1AD 1ID3D 3IP4C 5F99D 5BNVA 2XD5A 5BS7A 3AZEC 1P3PD 3A6NA 1M18D 3P5JB 3B6GA 4J8WB 3B0DB 2FJ7D 1P3MA 4J8WC 3B0DC 4X23B 5AV9D 3AV2D 4KHAB 5GT0D 2DF4C 2F8NA 2NZDD 4X23C 1F66D 1AOID 3MGSD 4LD9D 2Y2PA 2HIOA 3UTBD 4KGCA 5B0ZD 4QLCB 5JA4B 1P3KA 4J8VD 4UPKA 4QLCC 1P3GB 5B1LA 4WU9B 3WAAD 2JCHA 1P3AB 1P3GC 4WU9C 3KUYB 3X1SA 5AV6B 2Y2KA 3AV1B 1P3AC 3KUYC 3AV1C 5AVCA 3MNNB 4JJNC 1P3BA 5B2ID 1M1AA 1ID3A 5CPID 4J8XA 5B31D 5F99A 3MNNC 2NQBA 1KX5A 3C1CA 3MGPD 1BH9B 4R8PA 5FUGB 3AYWA 1S32D 4KGCB 4KUDB 4CSRB 2FJ7A 4Z5TA 1P3FB 3MGRA 3V9RB 3KXBD 3X1TB 1U35A 5JRGB 4KUDC 1P3FC 4H9QA 3X1TC 4H9SA 5JRGC 2Y2GA 3AZNB 1F66A 4XUJB 3X1SB 3LZ0D 4J8WD 2DQNC 1JFIB 2Y2LA 4H9OA 4LD9A 3AZNC 4XUJC 3UTBA 3UTAA 5CPJA 3O62D 2LY8A 1P3LB 3NQJB 3VH5A 5B2JA 1P3LC 1ZLAB 1TZYD 3REJB 5AV8D 1B67A 3AZFB 1P34A 2YFWA 2ZY3A 3AZJB 1ZLAC 3REJC 3AZFC 3LZ1B 3H0RC 3AZJC 1P3GD 3LZ1C 3R45B 5CPIA 5GXQB 1P3AD 1H3OA 5AV6D 2RVQC 3AZLB 1N1JB 4WNNB 3MGPA 5GXQC 4XZQC 3UT9B 2Y2MA 1P3MD 3W96C 2AROC 4E44A 5BT1C 3UTAB 3UT9C 1HTAA 3C1BC 3AZEA 2CV5B 5CP6B 4Z2MG 4Z66B 3TU4B 2CV5C 5CP6C 5B24B 5DNMB 4DRBA 3LJAB 3AZGB 3REIB 3WA9B 2HIOD 2Y2HA 5B31G 4Z66C 3NQUB 3TU4C 2F8NK 4KGCD 3W99B 5DNMC 5B24C 4J8WA 3AZGC 3AZHB 3REIC 1P3FD 3WA9C 2PYOB 3X1TD 5JRGD 3W99C 5B1LD 4X23A 3AZHC 2PYOC 4KHAA 3EPLA 5C3IB 1R4VA 1KX3B 2BYKB 2CWEA 4XUJD 3X1SD 5C3IC 5B40B 1KX3C 4UUZB 2F8NH 2ZY5A 4AWLB 5CHLB 4QLCA 5B40C 5JA4A 5DNNB 3RELB 4J8XD 1P3LD 5BO0B 4AWLC 3AZIB 1KX4B 5AY8B 2NQBD 5DNNC 1P3GA 1KX5D 3C1CD 3REKB 3RELC 4WU9A 4R8PD 1KX4C 3AZIC 5AY8C 1P3AA 5CPKB 3AYWD 3REKC 3KUYA 3MVDB 5AV6A 3MGQB 2G5HC 2ZM5A 4G92B 3AZJD 4NFTA 4Z5TD 5B32B 3AV1A 3MGRD 5CPKC 4JJNA 3X1UB 1U35D 3MVDC 3MGQC 4G92C 1B6WA 5B32C 2G5IC 3MNNA 3EPHA 3X1UC 5GXQD 3B0CT 3EG5B 3AZLD 1BH9A 4YS3B 3UT9D 3VH6A 5FUGA 3FDDA 3UTAD 4WJ3C 4YS3C 4CSRA 4KUDA 3REHB 2YFVB 5CPJD 1P3FA 3V9RA 2CV5D 1TAFB 3X1TA 5JRGA 3REHC 4YM6B 5B2JD 3W97B 3KSYA 3LJAD 3AZGD 3REID 3AZNA 2F8NG 1P34D 4YM6C 3W97C 4XUJA 3W99D 1JFIA 3AZHD 4JJNB 5AVBB 1P3LA 3NQJA 2BYMA 5AVBC 3W98B 2Y2NA 1PZRA 2XD1A 1ZLAA 3REJA 1BFMA 3AZFA 3W98C 3AZJA 5DNND 4CAYB 2FFFB 3AZED 3LZ1A 1KX4D 5B1MB 2Y2IA 3REKD 3WTPE 5B1MC 3R45A 5GXQA 4Z2MH 3B6FB 3MVDD 2AROA 3AZMB 3EPKA 3AZLA 1N1JA 4WNNA 5B32D 3UT9A 3B6FC 3X1UD 3WKJB 3AZMC 4X23D 3WKJC 5E5AB 2CV5A 5CP6A 3EPJA 2BYMB 4Z66A 3TU4A 4XZQB 5E5AC 5DNMA 5B24A 5AV5B 3LJAA 3AZGA 3REIA 3WA9A 3NQUA 4QLCD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M19 B;  3W99 A;  4ZUX B;  5AV5 C;  3AZH A;  4J8U B;  2PYO A;  1M19 C;  4ZUX C;  4WU9 D;  4J8U C;  3LEL B;  1KX3 A;  2BYK A;  3KUY D;  1P3I B;  3W96 B;  2ARO B;  3LEL C;  3AV1 D;  5B40 A;  4JJN D;  3C1B B;  4UUZ A;  1P3I C;  3X1V B;  1M1A C;  5GT3 B;  3MNN D;  1WWS A;  1P3P B;  5DNN A;  5G49 B;  3REL A;  1M18 B;  3X1V C;  5BO0 A;  1Q9C A;  5GT3 C;  3AZI A;  5AY8 A;  3AZK B;  1P3P C;  1KX4 A;  3REK A;  1M18 C;  5B33 B;  3AZK C;  5CPK A;  3B0C W;  3AFA B;  5AV9 B;  4KUD D;  3MVD A;  3MGQ A;  3AV2 B;  5GT0 B;  5B33 C;  5B32 A;  2NZD B;  5B1M D;  3X1U A;  5AV9 C;  3AFA C;  1BH8 B;  5KDM B;  3AV2 C;  1AOI B;  5GT0 C;  3MGS B;  1P3O B;  2NZD C;  1F66 C;  5BNX B;  3AZN D;  1AOI C;  1EQZ B;  3MGS C;  1WWI A;  1P3O C;  3VH5 W;  4J8V B;  4YS3 A;  3WTP B;  1EQZ C;  5B0Z C;  3WKJ D;  4HGA B;  3WAA B;  4J8V C;  3WTP C;  2YFV A;  3REH A;  3KWQ B;  5E5A D;  5B0Y B;  1HQ3 B;  1TAF A;  4HGA C;  3WAA C;  4YM6 A;  3KWQ C;  3W97 A;  4XZQ D;  5B0Y C;  1HQ3 C;  1ZLA D;  5AV5 D;  3REJ D;  3AZF D;  4WU8 B;  5B2I B;  3LZ1 D;  5B31 B;  4J8U D;  4WU8 C;  5B2I C;  5B31 C;  2RVQ D;  5AVB A;  3LEL D;  1S32 B;  3W96 D;  1P3I D;  2ARO D;  5BT1 D;  3W98 A;  4H9R B;  4NE6 A;  1S32 C;  3KXB B;  3C1B D;  3X1V D;  5GT3 D;  3KXB C;  4CAY A;  3AN2 B;  5B1M A;  5CP6 D;  3AZK D;  3LZ0 B;  3AN2 C;  4Z66 D;  3TU4 D;  3VH5 T;  5DNM D;  5B24 D;  5B33 D;  3LZ0 C;  3WA9 D;  3B6F A;  3AFA D;  3AZM A;  3O62 B;  4H9N B;  2PYO D;  5GSU B;  3WKJ A;  2HUE B;  3O62 C;  1P3O D;  1TZY B;  5AV8 B;  5GSU C;  4WV4 B;  5E5A A;  2HUE C;  1KX3 D;  1EQZ D;  1TZY C;  5AV8 C;  4XZQ A;  5B40 D;  3WTP D;  5AV5 A;  5BNV B;  1M19 A;  4ZUX A;  3A6N B;  3KWQ D;  3REL D;  3B6G B;  2IO5 B;  4G91 B;  5BS7 C;  5B0Y D;  1HQ3 D;  4J8U A;  5AY8 D;  3AZI D;  3A6N C;  3B6G C;  1P3M B;  2IO5 C;  4G91 C;  3LEL A;  5AV6 C;  5CPK D;  4WU8 D;  1P3M C;  3W96 A;  1P3I A;  3MGQ D;  2F8N B;  3C1B A;  3X1V A;  5GT3 A;  1P3P A;  3VH6 W;  5G49 A;  1M18 A;  2HIO B;  3AZK A;  1P3K B;  4YS3 D;  2HIO C;  4KGC C;  4E45 A;  5B33 A;  1P3K C;  5B1L B;  3AFA A;  5AV9 A;  3REH D;  3AN2 D;  3AV2 A;  5GT0 A;  5B1L C;  2NZD A;  1F1E A;  1BH8 A;  5KDM A;  1AOI A;  4YM6 D;  3MGS A;  3W97 D;  1KU5 A;  1P3O A;  3X1S C;  5BNX A;  1EQZ A;  5B0Z A;  5AVC B;  4NE3 A;  1P3B B;  1M1A B;  4J8V A;  1ID3 B;  4J8X B;  3WTP A;  5AVC C;  5F99 B;  2NQB B;  5GSU D;  1KX5 B;  3C1C B;  1P3B C;  3WAA A;  4R8P B;  1ID3 C;  4J8X C;  5F99 C;  5AVB D;  3KWQ A;  1KX5 C;  2NQB C;  3AYW B;  3C1C C;  5B0Y A;  1HQ3 A;  4R8P C;  2FJ7 B;  4EO5 B;  4Z5T B;  3W98 D;  3MGR B;  1ULY A;  3AYW C;  1U35 B;  2FJ7 C;  4EO5 C;  4Z5T C;  4WU8 A;  3MGR C;  4H9Q B;  1A7W A;  5B2I A;  3VH6 T;  3A6N D;  1U35 C;  3B6G D;  4H9P A;  5B31 A;  1F66 B;  2L5A A;  4H9S C;  4H9O B;  4LD9 B;  3UTB B;  3AZL C;  1S32 A;  5B0Z B;  3B6F D;  4LD9 C;  5CPJ B;  3AZM D;  2JSS A;  4H9R A;  3UTB C;  2F8N D;  3KXB A;  3UTA C;  5CPJ C;  4ZBJ B;  5B2J B;  3AN2 A;  4WZS B;  5B32 G;  1P34 B;  4ZBJ C;  5B2J C;  2YFW B;  3LZ0 A;  1P3K D;  3B0B A;  3LJA C;  1P34 C;  4NE5 A;  4DRA A;  1M19 D;  3O62 A;  4H9N A;  4ZUX D;  5CPI B;  4H9P B;  1H3O B;  5GSU A;  3MGP B;  5CPI C;  4M6B A;  1TZY A;  5AV8 A;  3MGP C;  5AVC D;  1P3B D;  3AZE B;  1M1A D;  1ID3 D;  5F99 D;  5BNV A;  5BS7 A;  3AZE C;  1P3P D;  3A6N A;  1M18 D;  3B6G A;  4J8W B;  3B0D B;  2FJ7 D;  1P3M A;  4J8W C;  3B0D C;  4X23 B;  5AV9 D;  3AV2 D;  4KHA B;  5GT0 D;  2F8N A;  2NZD D;  4X23 C;  1F66 D;  1AOI D;  3MGS D;  4LD9 D;  2HIO A;  3UTB D;  4KGC A;  5B0Z D;  4QLC B;  5JA4 B;  1P3K A;  4J8V D;  4QLC C;  1P3G B;  5B1L A;  4WU9 B;  3WAA D;  1P3A B;  1P3G C;  4WU9 C;  3KUY B;  3X1S A;  5AV6 B;  3AV1 B;  1P3A C;  3KUY C;  3AV1 C;  5AVC A;  3MNN B;  4JJN C;  1P3B A;  5B2I D;  1M1A A;  1ID3 A;  5CPI D;  4J8X A;  5B31 D;  5F99 A;  3MNN C;  2NQB A;  1KX5 A;  3C1C A;  3MGP D;  1BH9 B;  4R8P A;  5FUG B;  3AYW A;  1S32 D;  4KGC B;  4KUD B;  4CSR B;  2FJ7 A;  4Z5T A;  1P3F B;  3MGR A;  3V9R B;  3KXB D;  3X1T B;  1U35 A;  5JRG B;  4KUD C;  1P3F C;  4H9Q A;  3X1T C;  4H9S A;  5JRG C;  3AZN B;  1F66 A;  4XUJ B;  3X1S B;  3LZ0 D;  4J8W D;  1JFI B;  4H9O A;  4LD9 A;  3AZN C;  4XUJ C;  3UTB A;  3UTA A;  5CPJ A;  3O62 D;  2LY8 A;  1P3L B;  3NQJ B;  3VH5 A;  5B2J A;  1P3L C;  1ZLA B;  1TZY D;  3REJ B;  5AV8 D;  1B67 A;  3AZF B;  1P34 A;  2YFW A;  3AZJ B;  1ZLA C;  3REJ C;  3AZF C;  3LZ1 B;  3AZJ C;  1P3G D;  3LZ1 C;  3R45 B;  5CPI A;  5GXQ B;  1P3A D;  1H3O A;  5AV6 D;  2RVQ C;  3AZL B;  1N1J B;  4WNN B;  3MGP A;  5GXQ C;  4XZQ C;  3UT9 B;  1P3M D;  3W96 C;  2ARO C;  4E44 A;  5BT1 C;  3UTA B;  3UT9 C;  1HTA A;  3C1B C;  3AZE A;  2CV5 B;  5CP6 B;  4Z2M G;  4Z66 B;  3TU4 B;  2CV5 C;  5CP6 C;  5B24 B;  5DNM B;  4DRB A;  3LJA B;  3AZG B;  3REI B;  3WA9 B;  2HIO D;  5B31 G;  4Z66 C;  3TU4 C;  3NQU B;  2F8N K;  4KGC D;  3W99 B;  5DNM C;  5B24 C;  4J8W A;  3AZG C;  3AZH B;  3REI C;  1P3F D;  3WA9 C;  2PYO B;  3X1T D;  5JRG D;  3W99 C;  5B1L D;  4X23 A;  3AZH C;  2PYO C;  4KHA A;  5C3I B;  1R4V A;  1KX3 B;  2BYK B;  2CWE A;  4XUJ D;  3X1S D;  5C3I C;  5B40 B;  1KX3 C;  4UUZ B;  2F8N H;  4AWL B;  5CHL B;  4QLC A;  5B40 C;  5JA4 A;  5DNN B;  3REL B;  4J8X D;  1P3L D;  5BO0 B;  4AWL C;  3AZI B;  1KX4 B;  5AY8 B;  2NQB D;  5DNN C;  1P3G A;  1KX5 D;  3C1C D;  3REK B;  3REL C;  4WU9 A;  4R8P D;  1KX4 C;  3AZI C;  5AY8 C;  1P3A A;  5CPK B;  3AYW D;  3REK C;  3KUY A;  3MVD B;  5AV6 A;  3MGQ B;  3AZJ D;  4G92 B;  4NFT A;  4Z5T D;  5B32 B;  3AV1 A;  3MGR D;  5CPK C;  4JJN A;  3X1U B;  1U35 D;  3MVD C;  3MGQ C;  4G92 C;  1B6W A;  5B32 C;  3MNN A;  3X1U C;  5GXQ D;  3B0C T;  3AZL D;  1BH9 A;  4YS3 B;  3UT9 D;  3VH6 A;  5FUG A;  3UTA D;  4YS3 C;  4CSR A;  4KUD A;  3REH B;  2YFV B;  5CPJ D;  1P3F A;  3V9R A;  2CV5 D;  1TAF B;  3X1T A;  5JRG A;  3REH C;  4YM6 B;  5B2J D;  3W97 B;  3KSY A;  3LJA D;  3AZG D;  3REI D;  3AZN A;  2F8N G;  1P34 D;  4YM6 C;  3W97 C;  4XUJ A;  3W99 D;  1JFI A;  3AZH D;  4JJN B;  5AVB B;  1P3L A;  3NQJ A;  2BYM A;  5AVB C;  3W98 B;  1ZLA A;  3REJ A;  1BFM A;  3AZF A;  3W98 C;  3AZJ A;  5DNN D;  4CAY B;  3AZE D;  3LZ1 A;  1KX4 D;  5B1M B;  3REK D;  3WTP E;  5B1M C;  3R45 A;  5GXQ A;  4Z2M H;  3B6F B;  3MVD D;  2ARO A;  3AZM B;  3AZL A;  1N1J A;  4WNN A;  5B32 D;  3UT9 A;  3B6F C;  3X1U D;  3WKJ B;  3AZM C;  4X23 D;  3WKJ C;  5E5A B;  2CV5 A;  5CP6 A;  2BYM B;  4Z66 A;  3TU4 A;  4XZQ B;  5E5A C;  5DNM A;  5B24 A;  5AV5 B;  3LJA A;  3AZG A;  3REI A;  3WA9 A;  3NQU A;  4QLC D; 
#chains in the Genus database with same CATH topology
 1M19 B;  3W99 A;  4ZUX B;  5AV5 C;  3AZH A;  2Y2O A;  4J8U B;  2PYO A;  1M19 C;  4ZUX C;  4WU9 D;  4J8U C;  3H0L C;  3LEL B;  1KX3 A;  2BYK A;  3KUY D;  1P3I B;  3W96 B;  2ARO B;  3LEL C;  3AV1 D;  5B40 A;  4JJN D;  3C1B B;  4UUZ A;  1P3I C;  3X1V B;  1M1A C;  5GT3 B;  3MNN D;  1WWS A;  1P3P B;  5DNN A;  5G49 B;  3REL A;  1M18 B;  3X1V C;  5BO0 A;  1Q9C A;  5GT3 C;  3AZI A;  5AY8 A;  3AZK B;  1P3P C;  1KX4 A;  3REK A;  1M18 C;  5B33 B;  3AZK C;  5CPK A;  3B0C W;  2BG1 A;  5AV9 B;  3AFA B;  4KUD D;  3MVD A;  3MGQ A;  3AV2 B;  5GT0 B;  5B33 C;  5B32 A;  2NZD B;  5B1M D;  3X1U A;  5AV9 C;  3AFA C;  1BH8 B;  5KDM B;  3AV2 C;  1AOI B;  5GT0 C;  3MGS B;  1P3O B;  2NZD C;  1F66 C;  5BNX B;  3AZN D;  1AOI C;  1EQZ B;  3MGS C;  1WWI A;  1P3O C;  3VH5 W;  3H0M C;  4J8V B;  4YS3 A;  3WTP B;  1EQZ C;  5B0Z C;  2RIQ A;  3WKJ D;  4HGA B;  3WAA B;  4J8V C;  2Y2Q A;  3WTP C;  2YFV A;  3REH A;  3KWQ B;  5E5A D;  5B0Y B;  1HQ3 B;  1TAF A;  4HGA C;  3WAA C;  4YM6 A;  3KWQ C;  3A1I A;  1T3U A;  3W97 A;  4XZQ D;  5B0Y C;  1HQ3 C;  1ZLA D;  5AV5 D;  3REJ D;  3AZF D;  4WU8 B;  2W8S A;  5B2I B;  3LZ1 D;  5B31 B;  4J8U D;  4WU8 C;  2JE5 A;  5B2I C;  5B31 C;  2RVQ D;  5AVB A;  3LEL D;  1S32 B;  3W96 D;  1P3I D;  2ARO D;  5BT1 D;  2ZY2 A;  3W98 A;  4H9R B;  4NE6 A;  1S32 C;  3KXB B;  3C1B D;  2J8P A;  3X1V D;  5GT3 D;  3KXB C;  4CAY A;  4DQY B;  3AN2 B;  5B1M A;  5CP6 D;  3AZK D;  3LZ0 B;  3AN2 C;  4Z66 D;  3TU4 D;  3AL0 C;  3VH5 T;  5DNM D;  5B24 D;  5B33 D;  3LZ0 C;  3WA9 D;  3B6F A;  3AFA D;  3AZM A;  3O62 B;  4H9N B;  3F6T A;  2PYO D;  5GSU B;  3WKJ A;  2HUE B;  3O62 C;  1P3O D;  1TZY B;  5AV8 B;  5GSU C;  4WV4 B;  5E5A A;  2HUE C;  1KX3 D;  1EQZ D;  1TZY C;  1W2E A;  5AV8 C;  2Y2J A;  5B40 D;  4XZQ A;  3WTP D;  5AV5 A;  5BNV B;  1M19 A;  4ZUX A;  3A6N B;  3KWQ D;  3REL D;  3B6G B;  2IO5 B;  4G91 B;  5BS7 C;  5B0Y D;  1HQ3 D;  4J8U A;  5AY8 D;  3AZI D;  3A6N C;  3B6G C;  1P3M B;  2IO5 C;  4G91 C;  2UWX A;  3LEL A;  5AV6 C;  5CPK D;  4WU8 D;  1P3M C;  3W96 A;  1P3I A;  3MGQ D;  2F8N B;  3C1B A;  3X1V A;  5GT3 A;  1P3P A;  3VH6 W;  5G49 A;  1M18 A;  2HIO B;  3AZK A;  1P3K B;  4YS3 D;  2HIO C;  4KGC C;  4E45 A;  5B33 A;  1P3K C;  1Z2C B;  5B1L B;  3AFA A;  5AV9 A;  3REH D;  3AN2 D;  3AV2 A;  5GT0 A;  5B1L C;  2NZD A;  1F1E A;  1BH8 A;  5KDM A;  1AOI A;  4YM6 D;  3MGS A;  3W97 D;  1KU5 A;  1P3O A;  3X1S C;  5BNX A;  1EQZ A;  5B0Z A;  5AVC B;  4NE3 A;  1P3B B;  1M1A B;  4J8V A;  1ID3 B;  4J8X B;  3WTP A;  5AVC C;  5F99 B;  2NQB B;  5GSU D;  1KX5 B;  3C1C B;  1P3B C;  3WAA A;  4R8P B;  1ID3 C;  4J8X C;  5F99 C;  5AVB D;  3KWQ A;  1KX5 C;  2NQB C;  3AYW B;  3C1C C;  5B0Y A;  1HQ3 A;  4R8P C;  2FJ7 B;  4EO5 B;  4Z5T B;  3W98 D;  3MGR B;  1ULY A;  3AYW C;  1U35 B;  2FJ7 C;  4EO5 C;  4Z5T C;  4WU8 A;  3MGR C;  4H9Q B;  1A7W A;  5B2I A;  3VH6 T;  3A6N D;  1U35 C;  3B6G D;  4H9P A;  5B31 A;  1F66 B;  2L5A A;  3KFU G;  4H9S C;  4H9O B;  4LD9 B;  3UTB B;  3AZL C;  1S32 A;  5B0Z B;  3B6F D;  4LD9 C;  5CPJ B;  3AZM D;  2JSS A;  4H9R A;  3UTB C;  2F8N D;  3A1K A;  3KXB A;  3UTA C;  5CPJ C;  4ZBJ B;  5B2J B;  3AN2 A;  4WZS B;  5B32 G;  1P34 B;  4ZBJ C;  5B2J C;  2YFW B;  3LZ0 A;  1P3K D;  3B0B A;  3LJA C;  1P34 C;  4NE5 A;  4DRA A;  1M19 D;  3O62 A;  4H9N A;  2F2A C;  4ZUX D;  5CPI B;  4H9P B;  1H3O B;  5GSU A;  2VQR A;  3MGP B;  5CPI C;  4M6B A;  1TZY A;  5AV8 A;  3MGP C;  5AVC D;  2ZY4 A;  1P3B D;  3AZE B;  1M1A D;  1ID3 D;  3IP4 C;  5F99 D;  5BNV A;  2XD5 A;  5BS7 A;  3AZE C;  1P3P D;  3A6N A;  1M18 D;  3P5J B;  3B6G A;  4J8W B;  3B0D B;  2FJ7 D;  1P3M A;  4J8W C;  3B0D C;  4X23 B;  5AV9 D;  3AV2 D;  4KHA B;  5GT0 D;  2DF4 C;  2F8N A;  2NZD D;  4X23 C;  1F66 D;  1AOI D;  3MGS D;  4LD9 D;  2Y2P A;  2HIO A;  3UTB D;  4KGC A;  5B0Z D;  4QLC B;  5JA4 B;  1P3K A;  4J8V D;  4UPK A;  4QLC C;  1P3G B;  5B1L A;  4WU9 B;  3WAA D;  2JCH A;  1P3A B;  1P3G C;  4WU9 C;  3KUY B;  3X1S A;  5AV6 B;  2Y2K A;  3AV1 B;  1P3A C;  3KUY C;  3AV1 C;  5AVC A;  3MNN B;  4JJN C;  1P3B A;  5B2I D;  1M1A A;  1ID3 A;  5CPI D;  4J8X A;  5B31 D;  5F99 A;  3MNN C;  2NQB A;  1KX5 A;  3C1C A;  3MGP D;  1BH9 B;  4R8P A;  5FUG B;  3AYW A;  1S32 D;  4KGC B;  4KUD B;  4CSR B;  2FJ7 A;  4Z5T A;  1P3F B;  3MGR A;  3V9R B;  3KXB D;  3X1T B;  1U35 A;  5JRG B;  4KUD C;  1P3F C;  4H9Q A;  3X1T C;  4H9S A;  5JRG C;  2Y2G A;  3AZN B;  1F66 A;  4XUJ B;  3X1S B;  3LZ0 D;  4J8W D;  2DQN C;  1JFI B;  2Y2L A;  4H9O A;  4LD9 A;  3AZN C;  4XUJ C;  3UTB A;  3UTA A;  5CPJ A;  3O62 D;  2LY8 A;  1P3L B;  3NQJ B;  3VH5 A;  5B2J A;  1P3L C;  1ZLA B;  1TZY D;  3REJ B;  5AV8 D;  1B67 A;  3AZF B;  1P34 A;  2YFW A;  2ZY3 A;  3AZJ B;  1ZLA C;  3REJ C;  3AZF C;  3LZ1 B;  3H0R C;  3AZJ C;  1P3G D;  3LZ1 C;  3R45 B;  5CPI A;  5GXQ B;  1P3A D;  1H3O A;  5AV6 D;  2RVQ C;  3AZL B;  1N1J B;  4WNN B;  3MGP A;  5GXQ C;  4XZQ C;  3UT9 B;  2Y2M A;  1P3M D;  3W96 C;  2ARO C;  4E44 A;  5BT1 C;  3UTA B;  3UT9 C;  1HTA A;  3C1B C;  3AZE A;  2CV5 B;  5CP6 B;  4Z2M G;  4Z66 B;  3TU4 B;  2CV5 C;  5CP6 C;  5B24 B;  5DNM B;  4DRB A;  3LJA B;  3AZG B;  3REI B;  3WA9 B;  2HIO D;  2Y2H A;  5B31 G;  4Z66 C;  3NQU B;  3TU4 C;  2F8N K;  4KGC D;  3W99 B;  5DNM C;  5B24 C;  4J8W A;  3AZG C;  3AZH B;  3REI C;  1P3F D;  3WA9 C;  2PYO B;  3X1T D;  5JRG D;  3W99 C;  5B1L D;  4X23 A;  3AZH C;  2PYO C;  4KHA A;  3EPL A;  5C3I B;  1R4V A;  1KX3 B;  2BYK B;  2CWE A;  4XUJ D;  3X1S D;  5C3I C;  5B40 B;  1KX3 C;  4UUZ B;  2F8N H;  2ZY5 A;  4AWL B;  5CHL B;  4QLC A;  5B40 C;  5JA4 A;  5DNN B;  3REL B;  4J8X D;  1P3L D;  5BO0 B;  4AWL C;  3AZI B;  1KX4 B;  5AY8 B;  2NQB D;  5DNN C;  1P3G A;  1KX5 D;  3C1C D;  3REK B;  3REL C;  4WU9 A;  4R8P D;  1KX4 C;  3AZI C;  5AY8 C;  1P3A A;  5CPK B;  3AYW D;  3REK C;  3KUY A;  3MVD B;  5AV6 A;  3MGQ B;  2G5H C;  2ZM5 A;  4G92 B;  3AZJ D;  4NFT A;  4Z5T D;  5B32 B;  3AV1 A;  3MGR D;  5CPK C;  4JJN A;  3X1U B;  1U35 D;  3MVD C;  3MGQ C;  4G92 C;  1B6W A;  5B32 C;  2G5I C;  3MNN A;  3EPH A;  3X1U C;  5GXQ D;  3B0C T;  3EG5 B;  3AZL D;  1BH9 A;  4YS3 B;  3UT9 D;  3VH6 A;  5FUG A;  3FDD A;  3UTA D;  4WJ3 C;  4YS3 C;  4CSR A;  4KUD A;  3REH B;  2YFV B;  5CPJ D;  1P3F A;  3V9R A;  2CV5 D;  1TAF B;  3X1T A;  5JRG A;  3REH C;  4YM6 B;  5B2J D;  3W97 B;  3KSY A;  3LJA D;  3AZG D;  3REI D;  3AZN A;  2F8N G;  1P34 D;  4YM6 C;  3W97 C;  4XUJ A;  3W99 D;  1JFI A;  3AZH D;  4JJN B;  5AVB B;  1P3L A;  3NQJ A;  2BYM A;  5AVB C;  3W98 B;  2Y2N A;  1PZR A;  2XD1 A;  1ZLA A;  3REJ A;  1BFM A;  3AZF A;  3W98 C;  3AZJ A;  5DNN D;  4CAY B;  2FFF B;  3AZE D;  3LZ1 A;  1KX4 D;  5B1M B;  2Y2I A;  3REK D;  3WTP E;  5B1M C;  3R45 A;  5GXQ A;  4Z2M H;  3B6F B;  3MVD D;  2ARO A;  3AZM B;  3EPK A;  3AZL A;  1N1J A;  4WNN A;  5B32 D;  3UT9 A;  3B6F C;  3X1U D;  3WKJ B;  3AZM C;  4X23 D;  3WKJ C;  5E5A B;  2CV5 A;  5CP6 A;  3EPJ A;  2BYM B;  4Z66 A;  3TU4 A;  4XZQ B;  5E5A C;  5DNM A;  5B24 A;  5AV5 B;  3LJA A;  3AZG A;  3REI A;  3WA9 A;  3NQU A;  4QLC D; 
#chains in the Genus database with same CATH homology
 1M19 B;  3W99 A;  4ZUX B;  5AV5 C;  3AZH A;  2Y2O A;  4J8U B;  2PYO A;  1M19 C;  4ZUX C;  4WU9 D;  4J8U C;  3H0L C;  3LEL B;  1KX3 A;  2BYK A;  3KUY D;  1P3I B;  3W96 B;  2ARO B;  3LEL C;  3AV1 D;  5B40 A;  4JJN D;  3C1B B;  4UUZ A;  1P3I C;  3X1V B;  1M1A C;  5GT3 B;  3MNN D;  1WWS A;  1P3P B;  5DNN A;  5G49 B;  3REL A;  1M18 B;  3X1V C;  5BO0 A;  1Q9C A;  5GT3 C;  3AZI A;  5AY8 A;  3AZK B;  1P3P C;  1KX4 A;  3REK A;  1M18 C;  5B33 B;  3AZK C;  5CPK A;  3B0C W;  2BG1 A;  5AV9 B;  3AFA B;  4KUD D;  3MVD A;  3MGQ A;  3AV2 B;  5GT0 B;  5B33 C;  5B32 A;  2NZD B;  5B1M D;  3X1U A;  5AV9 C;  3AFA C;  1BH8 B;  5KDM B;  3AV2 C;  1AOI B;  5GT0 C;  3MGS B;  1P3O B;  2NZD C;  1F66 C;  5BNX B;  3AZN D;  1AOI C;  1EQZ B;  3MGS C;  1WWI A;  1P3O C;  3VH5 W;  3H0M C;  4J8V B;  4YS3 A;  3WTP B;  1EQZ C;  5B0Z C;  2RIQ A;  3WKJ D;  4HGA B;  3WAA B;  4J8V C;  2Y2Q A;  3WTP C;  2YFV A;  3REH A;  3KWQ B;  5E5A D;  5B0Y B;  1HQ3 B;  1TAF A;  4HGA C;  3WAA C;  4YM6 A;  3KWQ C;  3A1I A;  1T3U A;  3W97 A;  4XZQ D;  5B0Y C;  1HQ3 C;  1ZLA D;  5AV5 D;  3REJ D;  3AZF D;  4WU8 B;  2W8S A;  5B2I B;  3LZ1 D;  5B31 B;  4J8U D;  4WU8 C;  2JE5 A;  5B2I C;  5B31 C;  2RVQ D;  5AVB A;  3LEL D;  1S32 B;  3W96 D;  1P3I D;  2ARO D;  5BT1 D;  2ZY2 A;  3W98 A;  4H9R B;  4NE6 A;  1S32 C;  3KXB B;  3C1B D;  2J8P A;  3X1V D;  5GT3 D;  3KXB C;  4CAY A;  4DQY B;  3AN2 B;  5B1M A;  5CP6 D;  3AZK D;  3LZ0 B;  3AN2 C;  4Z66 D;  3TU4 D;  3AL0 C;  3VH5 T;  5DNM D;  5B24 D;  5B33 D;  3LZ0 C;  3WA9 D;  3B6F A;  3AFA D;  3AZM A;  3O62 B;  4H9N B;  3F6T A;  2PYO D;  5GSU B;  3WKJ A;  2HUE B;  3O62 C;  1P3O D;  1TZY B;  5AV8 B;  5GSU C;  4WV4 B;  5E5A A;  2HUE C;  1KX3 D;  1EQZ D;  1TZY C;  1W2E A;  5AV8 C;  2Y2J A;  5B40 D;  4XZQ A;  3WTP D;  5AV5 A;  5BNV B;  1M19 A;  4ZUX A;  3A6N B;  3KWQ D;  3REL D;  3B6G B;  2IO5 B;  4G91 B;  5BS7 C;  5B0Y D;  1HQ3 D;  4J8U A;  5AY8 D;  3AZI D;  3A6N C;  3B6G C;  1P3M B;  2IO5 C;  4G91 C;  2UWX A;  3LEL A;  5AV6 C;  5CPK D;  4WU8 D;  1P3M C;  3W96 A;  1P3I A;  3MGQ D;  2F8N B;  3C1B A;  3X1V A;  5GT3 A;  1P3P A;  3VH6 W;  5G49 A;  1M18 A;  2HIO B;  3AZK A;  1P3K B;  4YS3 D;  2HIO C;  4KGC C;  4E45 A;  5B33 A;  1P3K C;  1Z2C B;  5B1L B;  3AFA A;  5AV9 A;  3REH D;  3AN2 D;  3AV2 A;  5GT0 A;  5B1L C;  2NZD A;  1F1E A;  1BH8 A;  5KDM A;  1AOI A;  4YM6 D;  3MGS A;  3W97 D;  1KU5 A;  1P3O A;  3X1S C;  5BNX A;  1EQZ A;  5B0Z A;  5AVC B;  4NE3 A;  1P3B B;  1M1A B;  4J8V A;  1ID3 B;  4J8X B;  3WTP A;  5AVC C;  5F99 B;  2NQB B;  5GSU D;  1KX5 B;  3C1C B;  1P3B C;  3WAA A;  4R8P B;  1ID3 C;  4J8X C;  5F99 C;  5AVB D;  3KWQ A;  1KX5 C;  2NQB C;  3AYW B;  3C1C C;  5B0Y A;  1HQ3 A;  4R8P C;  2FJ7 B;  4EO5 B;  4Z5T B;  3W98 D;  3MGR B;  1ULY A;  3AYW C;  1U35 B;  2FJ7 C;  4EO5 C;  4Z5T C;  4WU8 A;  3MGR C;  4H9Q B;  1A7W A;  5B2I A;  3VH6 T;  3A6N D;  1U35 C;  3B6G D;  4H9P A;  5B31 A;  1F66 B;  2L5A A;  3KFU G;  4H9S C;  4H9O B;  4LD9 B;  3UTB B;  3AZL C;  1S32 A;  5B0Z B;  3B6F D;  4LD9 C;  5CPJ B;  3AZM D;  2JSS A;  4H9R A;  3UTB C;  2F8N D;  3A1K A;  3KXB A;  3UTA C;  5CPJ C;  4ZBJ B;  5B2J B;  3AN2 A;  4WZS B;  5B32 G;  1P34 B;  4ZBJ C;  5B2J C;  2YFW B;  3LZ0 A;  1P3K D;  3B0B A;  3LJA C;  1P34 C;  4NE5 A;  4DRA A;  1M19 D;  3O62 A;  4H9N A;  2F2A C;  4ZUX D;  5CPI B;  4H9P B;  1H3O B;  5GSU A;  2VQR A;  3MGP B;  5CPI C;  4M6B A;  1TZY A;  5AV8 A;  3MGP C;  5AVC D;  2ZY4 A;  1P3B D;  3AZE B;  1M1A D;  1ID3 D;  3IP4 C;  5F99 D;  5BNV A;  2XD5 A;  5BS7 A;  3AZE C;  1P3P D;  3A6N A;  1M18 D;  3P5J B;  3B6G A;  4J8W B;  3B0D B;  2FJ7 D;  1P3M A;  4J8W C;  3B0D C;  4X23 B;  5AV9 D;  3AV2 D;  4KHA B;  5GT0 D;  2DF4 C;  2F8N A;  2NZD D;  4X23 C;  1F66 D;  1AOI D;  3MGS D;  4LD9 D;  2Y2P A;  2HIO A;  3UTB D;  4KGC A;  5B0Z D;  4QLC B;  5JA4 B;  1P3K A;  4J8V D;  4UPK A;  4QLC C;  1P3G B;  5B1L A;  4WU9 B;  3WAA D;  2JCH A;  1P3A B;  1P3G C;  4WU9 C;  3KUY B;  3X1S A;  5AV6 B;  2Y2K A;  3AV1 B;  1P3A C;  3KUY C;  3AV1 C;  5AVC A;  3MNN B;  4JJN C;  1P3B A;  5B2I D;  1M1A A;  1ID3 A;  5CPI D;  4J8X A;  5B31 D;  5F99 A;  3MNN C;  2NQB A;  1KX5 A;  3C1C A;  3MGP D;  1BH9 B;  4R8P A;  5FUG B;  3AYW A;  1S32 D;  4KGC B;  4KUD B;  4CSR B;  2FJ7 A;  4Z5T A;  1P3F B;  3MGR A;  3V9R B;  3KXB D;  3X1T B;  1U35 A;  5JRG B;  4KUD C;  1P3F C;  4H9Q A;  3X1T C;  4H9S A;  5JRG C;  2Y2G A;  3AZN B;  1F66 A;  4XUJ B;  3X1S B;  3LZ0 D;  4J8W D;  2DQN C;  1JFI B;  2Y2L A;  4H9O A;  4LD9 A;  3AZN C;  4XUJ C;  3UTB A;  3UTA A;  5CPJ A;  3O62 D;  2LY8 A;  1P3L B;  3NQJ B;  3VH5 A;  5B2J A;  1P3L C;  1ZLA B;  1TZY D;  3REJ B;  5AV8 D;  1B67 A;  3AZF B;  1P34 A;  2YFW A;  2ZY3 A;  3AZJ B;  1ZLA C;  3REJ C;  3AZF C;  3LZ1 B;  3H0R C;  3AZJ C;  1P3G D;  3LZ1 C;  3R45 B;  5CPI A;  5GXQ B;  1P3A D;  1H3O A;  5AV6 D;  2RVQ C;  3AZL B;  1N1J B;  4WNN B;  3MGP A;  5GXQ C;  4XZQ C;  3UT9 B;  2Y2M A;  1P3M D;  3W96 C;  2ARO C;  4E44 A;  5BT1 C;  3UTA B;  3UT9 C;  1HTA A;  3C1B C;  3AZE A;  2CV5 B;  5CP6 B;  4Z2M G;  4Z66 B;  3TU4 B;  2CV5 C;  5CP6 C;  5B24 B;  5DNM B;  4DRB A;  3LJA B;  3AZG B;  3REI B;  3WA9 B;  2HIO D;  2Y2H A;  5B31 G;  4Z66 C;  3NQU B;  3TU4 C;  2F8N K;  4KGC D;  3W99 B;  5DNM C;  5B24 C;  4J8W A;  3AZG C;  3AZH B;  3REI C;  1P3F D;  3WA9 C;  2PYO B;  3X1T D;  5JRG D;  3W99 C;  5B1L D;  4X23 A;  3AZH C;  2PYO C;  4KHA A;  3EPL A;  5C3I B;  1R4V A;  1KX3 B;  2BYK B;  2CWE A;  4XUJ D;  3X1S D;  5C3I C;  5B40 B;  1KX3 C;  4UUZ B;  2F8N H;  2ZY5 A;  4AWL B;  5CHL B;  4QLC A;  5B40 C;  5JA4 A;  5DNN B;  3REL B;  4J8X D;  1P3L D;  5BO0 B;  4AWL C;  3AZI B;  1KX4 B;  5AY8 B;  2NQB D;  5DNN C;  1P3G A;  1KX5 D;  3C1C D;  3REK B;  3REL C;  4WU9 A;  4R8P D;  1KX4 C;  3AZI C;  5AY8 C;  1P3A A;  5CPK B;  3AYW D;  3REK C;  3KUY A;  3MVD B;  5AV6 A;  3MGQ B;  2G5H C;  2ZM5 A;  4G92 B;  3AZJ D;  4NFT A;  4Z5T D;  5B32 B;  3AV1 A;  3MGR D;  5CPK C;  4JJN A;  3X1U B;  1U35 D;  3MVD C;  3MGQ C;  4G92 C;  1B6W A;  5B32 C;  2G5I C;  3MNN A;  3EPH A;  3X1U C;  5GXQ D;  3B0C T;  3EG5 B;  3AZL D;  1BH9 A;  4YS3 B;  3UT9 D;  3VH6 A;  5FUG A;  3FDD A;  3UTA D;  4WJ3 C;  4YS3 C;  4CSR A;  4KUD A;  3REH B;  2YFV B;  5CPJ D;  1P3F A;  3V9R A;  2CV5 D;  1TAF B;  3X1T A;  5JRG A;  3REH C;  4YM6 B;  5B2J D;  3W97 B;  3KSY A;  3LJA D;  3AZG D;  3REI D;  3AZN A;  2F8N G;  1P34 D;  4YM6 C;  3W97 C;  4XUJ A;  3W99 D;  1JFI A;  3AZH D;  4JJN B;  5AVB B;  1P3L A;  3NQJ A;  2BYM A;  5AVB C;  3W98 B;  2Y2N A;  1PZR A;  2XD1 A;  1ZLA A;  3REJ A;  1BFM A;  3AZF A;  3W98 C;  3AZJ A;  5DNN D;  4CAY B;  2FFF B;  3AZE D;  3LZ1 A;  1KX4 D;  5B1M B;  2Y2I A;  3REK D;  3WTP E;  5B1M C;  3R45 A;  5GXQ A;  4Z2M H;  3B6F B;  3MVD D;  2ARO A;  3AZM B;  3EPK A;  3AZL A;  1N1J A;  4WNN A;  5B32 D;  3UT9 A;  3B6F C;  3X1U D;  3WKJ B;  3AZM C;  4X23 D;  3WKJ C;  5E5A B;  2CV5 A;  5CP6 A;  3EPJ A;  2BYM B;  4Z66 A;  3TU4 A;  4XZQ B;  5E5A C;  5DNM A;  5B24 A;  5AV5 B;  3LJA A;  3AZG A;  3REI A;  3WA9 A;  3NQU A;  4QLC D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...