5GSUD

Crystal structure of nucleosome core particle consisting of human testis-specific histone variants, th2a and th2b
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
97
structure length
97
Chain Sequence
RKRTRKESYSIYIYKVLKQVHPDTGISSKAMSIMNSFVTDIFERIASEASRLAHYSKRSTISSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analyses of the nucleosome complexes with human testis-specific histone variants, hTh2a and hTh2b
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
molecule keywords Histone H3.1
total genus 36
structure length 97
sequence length 97
chains with identical sequence H
ec nomenclature
pdb deposition date 2016-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5gsuD00
5AVBB 5GXQA 4ZBJB 5F99D 5B33D 1P34A 3W99B 1P34C 5BS7C 2NQBD 4QLCC 3LJAB 5CPIC 5E5AA 3NQUB 5E5AC 3MGRD 2NZDD 4YS3A 1ZLAB 4AWLC 5F99C 3AZLC 3LJAC 5B2JD 3B0DB 1F66B 4XZQB 5BO0B 5B24B 5B40D 3REID 5F99B 1P3PC 3VH5A 5GXQB 1U35D 3UTBB 3MNND 4YM6C 4WU9C 3UT9D 5GT0B 1P3BD 3W96B 5CPIB 5B1LA 1S32D 3W99A 4J8XC 3AFAB 5B32D 4WNNA 3VH5T 5B0ZD 3REJD 2HIOB 3LELD 1F66A 3W96A 3KUYA 1ID3C 4J8VB 4J8XD 5DNNA 2HUEB 5DNNC 4WU8D 1KX3D 2YFVB 2NZDA 5B31D 2HUEC 5CP6C 5GT0A 3AZMB 4YM6B 5B2IC 3UTAA 1P3KA 1P3PA 1F1EA 3WAAC 3REKD 4YS3B 4UUZB 1KX5C 1P3FD 1N1JA 5CHLB 3WA9B 3KUYD 5B24C 3KXBC 3LZ0D 1TAFA 1KX5B 4UUZA 1ID3B 4WU9B 1BH8B 5GT3B 1ID3D 3KUYC 1P3OA 4ZUXB 4G91B 4Z66C 4JJNC 3B6FD 4JJNA 1M19C 5AV6A 4CAYA 3KUYB 5CPKB 2IO5C 3A6NA 3MVDC 3AZMA 1M1AB 2F8NB 3AZHB 2BYMB 4CSRB 5B2IB 3UTBC 4WZSB 1P3KB 3RELC 1WWSA 3RELA 1H3OA 3B6GB 5GSUA 4QLCB 3C1BB 2YFVA 4LD9C 3AV1B 3X1UA 4J8XB 3V9RA 5B40C 2BYKA 3LZ1C 1ZLAC 3LELA 4WU9A 3VH6T 3MGPC 3NQJB 5AV9C 1AOIB 4EO5B 3KWQA 5FUGB 4H9OA 1P3AB 1JFIA 1AOID 1A7WA 2HIOD 3LZ1D 4H9RA 3W98A 3RELB 3B6GA 3MGRA 3W98C 3X1VD 4XUJD 1S32A 3LZ0A 1TAFB 3AZMC 1BH8A 5B2ID 3O62B 4E45A 3X1VA 3UTBD 2HIOC 3AZLA 5KDMB 3AV1C 4JJNB 3AV1A 3WTPC 5C3IC 5CP6A 3R45A 1TZYA 4H9NA 1ZLAD 2NZDB 3LELC 4J8WB 3X1TB 4R8PD 1P3GA 3AZGA 5B0ZA 3KXBA 4KGCC 1JFIB 5GSUD 4M6BA 3MGQA 5B0YC 5GXQC 3W97D 4YM6D 1P3OC 5AV5D 3AZND 1P3ID 5BS7A 5DNMD 4NE6A 5AVBC 5B33A 5B32G 3AZFB 1Q9CA 4YS3C 2F8NG 3WAAB 3UTBA 3UTAB 1P3FA 2AROA 4X23D 2RVQC 4WU8B 3NQUA 1P3KD 1KX3B 4X23B 2FJ7C 3WA9A 1ZLAA 3AZEB 3MGPA 5AV5B 4H9NB 1P3MB 3AFAD 5B0YA 5AY8D 3AZJC 3MGSA 1P3BC 1KX4A 3AZFA 5AV8C 4HGAB 1B6WA 1B67A 3AYWB 3MGRC 3W96C 4WU8A 1KX3A 4WU8C 1KX3C 5AVBA 4H9SA 3AZIC 2HIOA 1EQZB 5BNXB 3MGQB 3LJAA 5G49A 3C1CD 1R4VA 3WKJC 4H9PA 3WA9C 1TZYC 5DNMA 1P3LB 2NQBC 5BNXA 3REHA 5B40A 3MVDD 5JA4A 1WWIA 1P3GC 5AVCB 3R45B 4XUJB 4WV4B 4Z2MG 4G92B 1P3PD 4XZQA 5BO0A 3O62D 1TZYD 3W99C 3KWQC 3AN2D 5B1MB 5AV8A 4KUDC 4J8WA 3X1TA 4KUDA 5AVCA 3UT9A 1S32B 5CPID 2CV5C 4Z66A 1P3AD 5B1LD 3MGPD 3AZIA 3WTPB 5G49B 1P3OD 5KDMA 4ZUXA 3REJC 3WAAD 1HTAA 3REJA 1P3FC 4LD9D 5GT0C 3TU4D 4WU9D 3WTPE 3W97B 3MGSD 1KX4D 4HGAC 3MGQD 4EO5C 5AV9D 1BFMA 1H3OB 3X1UD 3AZKD 4J8VC 4YM6A 3AZKB 3X1SD 1P34D 5B2JA 3MGSC 1KX4C 3AYWD 5AY8B 1U35A 4YS3D 3X1TD 4J8WD 1BH9A 1KX5D 3AZJD 4KHAB 2AROD 3TU4B 5B31B 4XUJA 5CPIA 5DNNB 3MGSB 1M19A 1KX4B 5B33C 1M18B 3REKB 4H9QA 1M19D 3REIC 2YFWA 3AZMD 3REIA 2AROC 3WTPA 3AV2C 5CP6D 4LD9A 1HQ3B 2JSSA 2FJ7A 4Z5TB 3B6FA 3X1VB 1EQZC 1ULYA 3MGPB 4J8UC 4J8UA 3A6ND 3AZKC 3AZFD 5B0ZC 5B0YB 2PYOC 4J8VD 3KXBD 5AV9A 3AN2B 1TZYB 4NE5A 2F8NH 5B24A 5B31A 5GXQD 3UT9C 3TU4A 1N1JB 3REIB 3KWQD 3AN2C 1AOIA 3REKA 3AZEC 5B2JB 5GT0D 3VH5W 4R8PB 3C1CB 3C1BD 3X1VC 5AVCD 3MGRB 4WNNB 4ZBJC 1HQ3A 4X23C 1U35B 4ZUXC 2FJ7B 3C1CC 2PYOB 4XZQD 3O62A 3C1CA 3WKJA 3AZIB 4KGCD 4JJND 3B6FC 3VH6A 1EQZD 3NQJA 4KUDD 5CPKA 1M1AA 2F8NA 5CPKC 1M1AC 5B32C 3WKJB 4DRBA 3AFAA 3AV2B 4H9OB 4XZQC 3AFAC 1P3AA 5B1MA 5AV8B 3W99D 3RELD 5BT1C 3AZNC 1P3IC 1P3GB 3LZ0B 5CPJD 4J8UB 2CWEA 4R8PA 1M18C 2BYKB 3W98B 3LZ1B 1U35C 2CV5A 5B0YD 3AZEA 3A6NB 5JRGC 5AV6C 5BNVB 5JRGA 3B6GC 4AWLB 3AZLB 2CV5B 4H9RB 5AV6B 1HQ3D 1M19B 5E5AD 4Z2MH 3W97A 4Z5TD 3B6GD 3REHC 1EQZA 3LZ1A 2BYMA 4CSRA 5B2IA 3UTAC 3AZKA 3V9RB 1KX5A 5DNMB 1P3LA 5JRGB 5BNVA 4Z5TC 1P3BA 1M18D 3W98D 5B31C 3AYWC 3B0CW 5GSUB 3C1BA 5B1LC 3X1UB 3X1SB 5AV9B 3AN2A 1AOIC 4Z66D 3LZ0C 1KU5A 3AZGD 5B24D 1P3FB 3X1SC 4LD9B 3W97C 4NE3A 3O62C 5DNMC 2NQBA 1P3MA 1P3MC 3AZHC 5B33B 5CPJC 5C3IB 3KWQB 5B1MC 4KGCA 2CV5D 1P3AC 3AYWA 3MNNA 1P3OB 5FUGA 5GT3C 5B2JC 4J8WC 5B0ZB 4R8PC 3X1TC 1M18A 5B31G 4H9QB 1P3PB 5B1MD 3AZJA 3AZFC 3KXBB 3AV1D 3UT9B 4QLCD 3B0DC 1P3BB 1F66C 5AV8D 4QLCA 3AV2D 1S32C 4H9SC 3WKJD 5CP6B 5JA4B 5F99A 3AZHD 5B40B 5CPKD 5CPJA 1M1AD 1P3LD 1F66D 2F8ND 3KSYA 3AZID 4KGCB 5GSUC 2RVQD 2AROB 2PYOD 4G92C 3AZGB 3AZJB 2FJ7D 3B0CT 5DNND 1P3KC 4ZUXD 3WAAA 5GT3D 3AZNA 1P3IA 2F8NK 3LJAD 4Z5TA 3B6FB 5JRGD 1P3LC 2NQBB 3AZGC 3TU4C 1P34B 5AVBD 3AZED 4J8XA 4Z66B 3B0BA 4XUJC 3MGQC 5AV5A 1ID3A 5BT1D 3REHD 1P3MD 3WA9D 3VH6W 3X1SA 1BH9B 1HQ3C 4X23A 3UTAD 4DRAA 3AV2A 3A6NC 3MVDA 2NZDC 2YFWB 3AZHA 5AV6D 3AZLD 5B32A 3AZNB 3WTPD 1P3IB 3REJB 5E5AB 2PYOA 3REHB 5B1LB 3X1UC 4J8UD 3W96D 1P3GD 4H9PB 4KHAA 3C1BC 5GT3A 4G91C 5AY8C 5B32B 3MNNC 5AY8A 5AVCC 5CPJB 4E44A 3LELB 2LY8A 4J8VA 3REKC 5AV5C 2L5AA 2IO5B 4NFTA 3MVDB 4CAYB 3MNNB 4KUDB
chains in the Genus database with same CATH superfamily
5AVBB 5GXQA 4ZBJB 5F99D 5B33D 1P34A 3W99B 1P34C 5BS7C 2NQBD 4QLCC 3LJAB 5CPIC 5E5AA 3NQUB 5E5AC 3MGRD 2NZDD 4YS3A 1ZLAB 4AWLC 5F99C 3AZLC 3LJAC 5B2JD 2JE5A 3B0DB 1F66B 4XZQB 5BO0B 5B24B 5B40D 3REID 5F99B 1P3PC 3VH5A 5GXQB 1U35D 3UTBB 3MNND 4YM6C 4WU9C 3UT9D 5GT0B 1P3BD 3W96B 5CPIB 5B1LA 1S32D 3W99A 4J8XC 3AFAB 5B32D 4WNNA 3VH5T 5B0ZD 3REJD 2HIOB 3LELD 1F66A 3W96A 3KUYA 1ID3C 4J8VB 4J8XD 5DNNA 2HUEB 5DNNC 4WU8D 1KX3D 2YFVB 2RIQA 2NZDA 5B31D 2HUEC 5CP6C 5GT0A 3AZMB 4YM6B 2F2AC 5B2IC 3UTAA 1P3KA 1P3PA 1F1EA 3WAAC 3REKD 4YS3B 4UUZB 1KX5C 1P3FD 1N1JA 5CHLB 3WA9B 2DF4C 3KUYD 2Y2MA 5B24C 3KXBC 3LZ0D 1TAFA 1KX5B 4UUZA 1ID3B 4WU9B 1BH8B 5GT3B 4DQYB 1ID3D 3KUYC 1P3OA 4ZUXB 4G91B 4Z66C 4JJNC 3B6FD 4JJNA 1M19C 5AV6A 4CAYA 3KUYB 5CPKB 2IO5C 3A6NA 3MVDC 3AZMA 1M1AB 2F8NB 3AZHB 2BYMB 4CSRB 5B2IB 3UTBC 4WZSB 1P3KB 2ZM5A 3RELC 1WWSA 3RELA 1H3OA 3B6GB 5GSUA 4QLCB 3C1BB 3EPKA 2YFVA 4LD9C 3AV1B 3X1UA 4J8XB 3V9RA 5B40C 2BYKA 3LZ1C 1ZLAC 3LELA 4WU9A 3VH6T 3MGPC 3NQJB 5AV9C 1AOIB 4EO5B 3KWQA 5FUGB 4H9OA 1P3AB 1JFIA 1AOID 1A7WA 2HIOD 3LZ1D 2Y2HA 4H9RA 3W98A 3RELB 3B6GA 3MGRA 1W2EA 3X1VD 3W98C 4XUJD 1S32A 3LZ0A 1TAFB 3AZMC 1BH8A 5B2ID 4E45A 3O62B 3X1VA 3UTBD 2HIOC 3AZLA 2Y2JA 5KDMB 3AV1C 4JJNB 3AV1A 3WTPC 5C3IC 5CP6A 3R45A 1TZYA 4H9NA 1ZLAD 2NZDB 3LELC 4J8WB 3X1TB 4R8PD 1P3GA 3AZGA 5B0ZA 3KXBA 4KGCC 1JFIB 3H0LC 5GSUD 4M6BA 3MGQA 5B0YC 5GXQC 3W97D 4YM6D 1P3OC 5AV5D 3AZND 1P3ID 5BS7A 5DNMD 4NE6A 5AVBC 5B33A 5B32G 3AZFB 1Q9CA 4YS3C 2F8NG 3WAAB 3UTBA 2G5HC 3UTAB 1P3FA 2AROA 4X23D 2RVQC 4WU8B 3NQUA 1P3KD 1KX3B 4X23B 2FJ7C 3WA9A 1ZLAA 3EPLA 3AZEB 3MGPA 5AV5B 4H9NB 1P3MB 3AFAD 5B0YA 5AY8D 2FFFB 3MGSA 3AZJC 1P3BC 3AZFA 1KX4A 3H0MC 5AV8C 4HGAB 1Z2CB 1B6WA 1B67A 3AYWB 3MGRC 3W96C 4WU8A 1KX3A 4WU8C 1KX3C 5AVBA 4H9SA 3AZIC 2HIOA 1EQZB 5BNXB 3MGQB 3LJAA 5G49A 3C1CD 1R4VA 3WKJC 4H9PA 3WA9C 1TZYC 5DNMA 1P3LB 2NQBC 5BNXA 3REHA 5B40A 3MVDD 5JA4A 1WWIA 1P3GC 5AVCB 3R45B 4XUJB 4WV4B 4Z2MG 4G92B 1P3PD 4XZQA 5BO0A 3O62D 1TZYD 3W99C 3KWQC 3AN2D 5B1MB 2XD5A 5AV8A 4KUDC 4J8WA 3X1TA 4KUDA 5AVCA 3UT9A 4WJ3C 1S32B 5CPID 2CV5C 4Z66A 1P3AD 5B1LD 3MGPD 3AZIA 3WTPB 5G49B 1P3OD 5KDMA 4ZUXA 3REJC 3WAAD 1HTAA 3REJA 1P3FC 4LD9D 5GT0C 3TU4D 2ZY2A 4WU9D 3WTPE 3W97B 3MGSD 1KX4D 4HGAC 3MGQD 2Y2OA 4EO5C 5AV9D 1BFMA 1H3OB 3X1UD 3AZKD 4J8VC 4YM6A 3AZKB 3X1SD 3EPJA 5B2JA 1P34D 3MGSC 1KX4C 3AYWD 5AY8B 1U35A 4YS3D 3X1TD 4J8WD 1BH9A 1KX5D 3AZJD 4KHAB 2AROD 3TU4B 3KFUG 5B31B 4XUJA 5CPIA 5DNNB 3MGSB 1M19A 1KX4B 5B33C 2XD1A 1M18B 3REKB 4H9QA 3F6TA 1M19D 3REIC 1PZRA 2YFWA 3AZMD 3REIA 2AROC 3WTPA 3AV2C 5CP6D 4LD9A 1HQ3B 2JSSA 2FJ7A 4Z5TB 3B6FA 3X1VB 1EQZC 1ULYA 3MGPB 3AL0C 4J8UC 4J8UA 3A6ND 3AZKC 3AZFD 5B0ZC 5B0YB 2PYOC 4J8VD 3KXBD 5AV9A 3AN2B 1TZYB 2Y2NA 4NE5A 2F8NH 5B24A 5B31A 5GXQD 3UT9C 3TU4A 1N1JB 3REIB 3KWQD 3AN2C 1AOIA 3REKA 3AZEC 5B2JB 5GT0D 3VH5W 4R8PB 3C1CB 3C1BD 3X1VC 5AVCD 3MGRB 4WNNB 3A1IA 4ZBJC 1HQ3A 4X23C 1U35B 4ZUXC 2FJ7B 3C1CC 2PYOB 4XZQD 3O62A 3C1CA 3WKJA 3AZIB 4KGCD 4JJND 3H0RC 3B6FC 3VH6A 1EQZD 3NQJA 4KUDD 5CPKA 1M1AA 2F8NA 5CPKC 1M1AC 5B32C 2Y2LA 3WKJB 4DRBA 2VQRA 3AFAA 2Y2PA 4H9OB 4XZQC 3AFAC 3AV2B 1P3AA 5B1MA 5AV8B 3W99D 3RELD 2Y2QA 5BT1C 3AZNC 1P3IC 1P3GB 3LZ0B 2ZY4A 5CPJD 4J8UB 2CWEA 4R8PA 1M18C 2BYKB 3W98B 3LZ1B 1U35C 2CV5A 5B0YD 3AZEA 3A6NB 2Y2IA 5JRGC 5AV6C 5BNVB 5JRGA 3B6GC 4AWLB 3AZLB 2W8SA 2CV5B 2BG1A 4H9RB 3EG5B 1T3UA 5AV6B 1HQ3D 1M19B 5E5AD 4Z2MH 3W97A 4Z5TD 3B6GD 3REHC 1EQZA 2ZY5A 3LZ1A 4UPKA 2BYMA 4CSRA 5B2IA 3UTAC 3EPHA 3AZKA 3V9RB 1KX5A 5DNMB 1P3LA 2Y2KA 5JRGB 5BNVA 4Z5TC 1P3BA 1M18D 3W98D 5B31C 3AYWC 3B0CW 5GSUB 3C1BA 5B1LC 3X1UB 3X1SB 5AV9B 3AN2A 1AOIC 3FDDA 4Z66D 3LZ0C 1KU5A 3AZGD 5B24D 1P3FB 3X1SC 4LD9B 3W97C 4NE3A 3O62C 5DNMC 2NQBA 1P3MA 1P3MC 3AZHC 5B33B 5CPJC 5C3IB 3KWQB 3A1KA 5B1MC 4KGCA 2CV5D 1P3AC 3AYWA 3MNNA 1P3OB 5FUGA 5GT3C 2ZY3A 5B2JC 5B0ZB 4R8PC 4J8WC 3X1TC 1M18A 5B31G 4H9QB 1P3PB 5B1MD 3AZJA 3AZFC 3KXBB 3AV1D 3UT9B 4QLCD 3B0DC 1P3BB 1F66C 5AV8D 4QLCA 3AV2D 1S32C 4H9SC 3WKJD 5CP6B 5JA4B 5F99A 3AZHD 5B40B 5CPKD 5CPJA 1M1AD 1P3LD 1F66D 2F8ND 3KSYA 3AZID 4KGCB 5GSUC 2RVQD 2AROB 2PYOD 4G92C 3AZGB 3AZJB 2FJ7D 3B0CT 5DNND 1P3KC 4ZUXD 3WAAA 2G5IC 5GT3D 3P5JB 3AZNA 1P3IA 3LJAD 2F8NK 4Z5TA 3B6FB 5JRGD 1P3LC 2NQBB 3AZGC 3TU4C 1P34B 5AVBD 3AZED 4J8XA 4Z66B 3B0BA 3IP4C 4XUJC 3MGQC 5AV5A 1ID3A 5BT1D 3REHD 1P3MD 3WA9D 2UWXA 3VH6W 3X1SA 1BH9B 1HQ3C 4X23A 3UTAD 4DRAA 3AV2A 2DQNC 3A6NC 3MVDA 2Y2GA 2NZDC 2YFWB 3AZHA 5AV6D 3AZLD 5B32A 3AZNB 2J8PA 2JCHA 3WTPD 5E5AB 3REJB 1P3IB 2PYOA 3REHB 5B1LB 3X1UC 4J8UD 3W96D 1P3GD 4H9PB 4KHAA 3C1BC 5GT3A 4G91C 5AY8C 5B32B 3MNNC 5AY8A 5AVCC 5CPJB 4E44A 3LELB 2LY8A 4J8VA 3REKC 5AV5C 2L5AA 2IO5B 4NFTA 3MVDB 4CAYB 3MNNB 4KUDB
chains in the Genus database with same CATH topology
5AVBB 5GXQA 4ZBJB 5F99D 5B33D 1P34A 3W99B 1P34C 5BS7C 2NQBD 4QLCC 3LJAB 5CPIC 5E5AA 3NQUB 5E5AC 3MGRD 2NZDD 4YS3A 1ZLAB 4AWLC 5F99C 3AZLC 3LJAC 5B2JD 2JE5A 3B0DB 1F66B 4XZQB 5BO0B 5B24B 5B40D 3REID 5F99B 1P3PC 3VH5A 5GXQB 1U35D 3UTBB 3MNND 4YM6C 4WU9C 3UT9D 5GT0B 1P3BD 3W96B 5CPIB 5B1LA 1S32D 3W99A 4J8XC 3AFAB 5B32D 4WNNA 3VH5T 5B0ZD 3REJD 2HIOB 3LELD 1F66A 3W96A 3KUYA 1ID3C 4J8VB 4J8XD 5DNNA 2HUEB 5DNNC 4WU8D 1KX3D 2YFVB 2RIQA 2NZDA 5B31D 2HUEC 5CP6C 5GT0A 3AZMB 4YM6B 2F2AC 5B2IC 3UTAA 1P3KA 1P3PA 1F1EA 3WAAC 3REKD 4YS3B 4UUZB 1KX5C 1P3FD 1N1JA 5CHLB 3WA9B 2DF4C 3KUYD 2Y2MA 5B24C 3KXBC 3LZ0D 1TAFA 1KX5B 4UUZA 1ID3B 4WU9B 1BH8B 5GT3B 4DQYB 1ID3D 3KUYC 1P3OA 4ZUXB 4G91B 4Z66C 4JJNC 3B6FD 4JJNA 1M19C 5AV6A 4CAYA 3KUYB 5CPKB 2IO5C 3A6NA 3MVDC 3AZMA 1M1AB 2F8NB 3AZHB 2BYMB 4CSRB 5B2IB 3UTBC 4WZSB 1P3KB 2ZM5A 3RELC 1WWSA 3RELA 1H3OA 3B6GB 5GSUA 4QLCB 3C1BB 3EPKA 2YFVA 4LD9C 3AV1B 3X1UA 4J8XB 3V9RA 5B40C 2BYKA 3LZ1C 1ZLAC 3LELA 4WU9A 3VH6T 3MGPC 3NQJB 5AV9C 1AOIB 4EO5B 3KWQA 5FUGB 4H9OA 1P3AB 1JFIA 1AOID 1A7WA 2HIOD 3LZ1D 2Y2HA 4H9RA 3W98A 3RELB 3B6GA 3MGRA 1W2EA 3X1VD 3W98C 4XUJD 1S32A 3LZ0A 1TAFB 3AZMC 1BH8A 5B2ID 4E45A 3O62B 3X1VA 3UTBD 2HIOC 3AZLA 2Y2JA 5KDMB 3AV1C 4JJNB 3AV1A 3WTPC 5C3IC 5CP6A 3R45A 1TZYA 4H9NA 1ZLAD 2NZDB 3LELC 4J8WB 3X1TB 4R8PD 1P3GA 3AZGA 5B0ZA 3KXBA 4KGCC 1JFIB 3H0LC 5GSUD 4M6BA 3MGQA 5B0YC 5GXQC 3W97D 4YM6D 1P3OC 5AV5D 3AZND 1P3ID 5BS7A 5DNMD 4NE6A 5AVBC 5B33A 5B32G 3AZFB 1Q9CA 4YS3C 2F8NG 3WAAB 3UTBA 2G5HC 3UTAB 1P3FA 2AROA 4X23D 2RVQC 4WU8B 3NQUA 1P3KD 1KX3B 4X23B 2FJ7C 3WA9A 1ZLAA 3EPLA 3AZEB 3MGPA 5AV5B 4H9NB 1P3MB 3AFAD 5B0YA 5AY8D 2FFFB 3MGSA 3AZJC 1P3BC 3AZFA 1KX4A 3H0MC 5AV8C 4HGAB 1Z2CB 1B6WA 1B67A 3AYWB 3MGRC 3W96C 4WU8A 1KX3A 4WU8C 1KX3C 5AVBA 4H9SA 3AZIC 2HIOA 1EQZB 5BNXB 3MGQB 3LJAA 5G49A 3C1CD 1R4VA 3WKJC 4H9PA 3WA9C 1TZYC 5DNMA 1P3LB 2NQBC 5BNXA 3REHA 5B40A 3MVDD 5JA4A 1WWIA 1P3GC 5AVCB 3R45B 4XUJB 4WV4B 4Z2MG 4G92B 1P3PD 4XZQA 5BO0A 3O62D 1TZYD 3W99C 3KWQC 3AN2D 5B1MB 2XD5A 5AV8A 4KUDC 4J8WA 3X1TA 4KUDA 5AVCA 3UT9A 4WJ3C 1S32B 5CPID 2CV5C 4Z66A 1P3AD 5B1LD 3MGPD 3AZIA 3WTPB 5G49B 1P3OD 5KDMA 4ZUXA 3REJC 3WAAD 1HTAA 3REJA 1P3FC 4LD9D 5GT0C 3TU4D 2ZY2A 4WU9D 3WTPE 3W97B 3MGSD 1KX4D 4HGAC 3MGQD 2Y2OA 4EO5C 5AV9D 1BFMA 1H3OB 3X1UD 3AZKD 4J8VC 4YM6A 3AZKB 3X1SD 3EPJA 5B2JA 1P34D 3MGSC 1KX4C 3AYWD 5AY8B 1U35A 4YS3D 3X1TD 4J8WD 1BH9A 1KX5D 3AZJD 4KHAB 2AROD 3TU4B 3KFUG 5B31B 4XUJA 5CPIA 5DNNB 3MGSB 1M19A 1KX4B 5B33C 2XD1A 1M18B 3REKB 4H9QA 3F6TA 1M19D 3REIC 1PZRA 2YFWA 3AZMD 3REIA 2AROC 3WTPA 3AV2C 5CP6D 4LD9A 1HQ3B 2JSSA 2FJ7A 4Z5TB 3B6FA 3X1VB 1EQZC 1ULYA 3MGPB 3AL0C 4J8UC 4J8UA 3A6ND 3AZKC 3AZFD 5B0ZC 5B0YB 2PYOC 4J8VD 3KXBD 5AV9A 3AN2B 1TZYB 2Y2NA 4NE5A 2F8NH 5B24A 5B31A 5GXQD 3UT9C 3TU4A 1N1JB 3REIB 3KWQD 3AN2C 1AOIA 3REKA 3AZEC 5B2JB 5GT0D 3VH5W 4R8PB 3C1CB 3C1BD 3X1VC 5AVCD 3MGRB 4WNNB 3A1IA 4ZBJC 1HQ3A 4X23C 1U35B 4ZUXC 2FJ7B 3C1CC 2PYOB 4XZQD 3O62A 3C1CA 3WKJA 3AZIB 4KGCD 4JJND 3H0RC 3B6FC 3VH6A 1EQZD 3NQJA 4KUDD 5CPKA 1M1AA 2F8NA 5CPKC 1M1AC 5B32C 2Y2LA 3WKJB 4DRBA 2VQRA 3AFAA 2Y2PA 4H9OB 4XZQC 3AFAC 3AV2B 1P3AA 5B1MA 5AV8B 3W99D 3RELD 2Y2QA 5BT1C 3AZNC 1P3IC 1P3GB 3LZ0B 2ZY4A 5CPJD 4J8UB 2CWEA 4R8PA 1M18C 2BYKB 3W98B 3LZ1B 1U35C 2CV5A 5B0YD 3AZEA 3A6NB 2Y2IA 5JRGC 5AV6C 5BNVB 5JRGA 3B6GC 4AWLB 3AZLB 2W8SA 2CV5B 2BG1A 4H9RB 3EG5B 1T3UA 5AV6B 1HQ3D 1M19B 5E5AD 4Z2MH 3W97A 4Z5TD 3B6GD 3REHC 1EQZA 2ZY5A 3LZ1A 4UPKA 2BYMA 4CSRA 5B2IA 3UTAC 3EPHA 3AZKA 3V9RB 1KX5A 5DNMB 1P3LA 2Y2KA 5JRGB 5BNVA 4Z5TC 1P3BA 1M18D 3W98D 5B31C 3AYWC 3B0CW 5GSUB 3C1BA 5B1LC 3X1UB 3X1SB 5AV9B 3AN2A 1AOIC 3FDDA 4Z66D 3LZ0C 1KU5A 3AZGD 5B24D 1P3FB 3X1SC 4LD9B 3W97C 4NE3A 3O62C 5DNMC 2NQBA 1P3MA 1P3MC 3AZHC 5B33B 5CPJC 5C3IB 3KWQB 3A1KA 5B1MC 4KGCA 2CV5D 1P3AC 3AYWA 3MNNA 1P3OB 5FUGA 5GT3C 2ZY3A 5B2JC 5B0ZB 4R8PC 4J8WC 3X1TC 1M18A 5B31G 4H9QB 1P3PB 5B1MD 3AZJA 3AZFC 3KXBB 3AV1D 3UT9B 4QLCD 3B0DC 1P3BB 1F66C 5AV8D 4QLCA 3AV2D 1S32C 4H9SC 3WKJD 5CP6B 5JA4B 5F99A 3AZHD 5B40B 5CPKD 5CPJA 1M1AD 1P3LD 1F66D 2F8ND 3KSYA 3AZID 4KGCB 5GSUC 2RVQD 2AROB 2PYOD 4G92C 3AZGB 3AZJB 2FJ7D 3B0CT 5DNND 1P3KC 4ZUXD 3WAAA 2G5IC 5GT3D 3P5JB 3AZNA 1P3IA 3LJAD 2F8NK 4Z5TA 3B6FB 5JRGD 1P3LC 2NQBB 3AZGC 3TU4C 1P34B 5AVBD 3AZED 4J8XA 4Z66B 3B0BA 3IP4C 4XUJC 3MGQC 5AV5A 1ID3A 5BT1D 3REHD 1P3MD 3WA9D 2UWXA 3VH6W 3X1SA 1BH9B 1HQ3C 4X23A 3UTAD 4DRAA 3AV2A 2DQNC 3A6NC 3MVDA 2Y2GA 2NZDC 2YFWB 3AZHA 5AV6D 3AZLD 5B32A 3AZNB 2J8PA 2JCHA 3WTPD 5E5AB 3REJB 1P3IB 2PYOA 3REHB 5B1LB 3X1UC 4J8UD 3W96D 1P3GD 4H9PB 4KHAA 3C1BC 5GT3A 4G91C 5AY8C 5B32B 3MNNC 5AY8A 5AVCC 5CPJB 4E44A 3LELB 2LY8A 4J8VA 3REKC 5AV5C 2L5AA 2IO5B 4NFTA 3MVDB 4CAYB 3MNNB 4KUDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AVB B;  5GXQ A;  4ZBJ B;  5F99 D;  5B33 D;  1P34 A;  3W99 B;  1P34 C;  5BS7 C;  2NQB D;  4QLC C;  3LJA B;  5CPI C;  5E5A A;  3NQU B;  5E5A C;  3MGR D;  2NZD D;  4YS3 A;  1ZLA B;  4AWL C;  5F99 C;  3AZL C;  3LJA C;  5B2J D;  3B0D B;  1F66 B;  4XZQ B;  5BO0 B;  5B24 B;  5B40 D;  3REI D;  5F99 B;  1P3P C;  3VH5 A;  5GXQ B;  1U35 D;  3UTB B;  3MNN D;  4YM6 C;  4WU9 C;  3UT9 D;  5GT0 B;  1P3B D;  3W96 B;  5CPI B;  5B1L A;  1S32 D;  3W99 A;  4J8X C;  3AFA B;  5B32 D;  4WNN A;  3VH5 T;  5B0Z D;  3REJ D;  2HIO B;  3LEL D;  1F66 A;  3W96 A;  3KUY A;  1ID3 C;  4J8V B;  4J8X D;  5DNN A;  2HUE B;  5DNN C;  4WU8 D;  1KX3 D;  2YFV B;  2NZD A;  5B31 D;  2HUE C;  5CP6 C;  5GT0 A;  3AZM B;  4YM6 B;  5B2I C;  3UTA A;  1P3K A;  1P3P A;  1F1E A;  3WAA C;  3REK D;  4YS3 B;  4UUZ B;  1KX5 C;  1P3F D;  1N1J A;  5CHL B;  3WA9 B;  3KUY D;  5B24 C;  3KXB C;  3LZ0 D;  1TAF A;  1KX5 B;  4UUZ A;  1ID3 B;  4WU9 B;  1BH8 B;  5GT3 B;  1ID3 D;  3KUY C;  1P3O A;  4ZUX B;  4G91 B;  4Z66 C;  4JJN C;  3B6F D;  4JJN A;  1M19 C;  5AV6 A;  4CAY A;  3KUY B;  5CPK B;  2IO5 C;  3A6N A;  3MVD C;  3AZM A;  1M1A B;  2F8N B;  3AZH B;  2BYM B;  4CSR B;  5B2I B;  3UTB C;  4WZS B;  1P3K B;  3REL C;  1WWS A;  3REL A;  1H3O A;  3B6G B;  5GSU A;  4QLC B;  3C1B B;  2YFV A;  4LD9 C;  3AV1 B;  3X1U A;  4J8X B;  3V9R A;  5B40 C;  2BYK A;  3LZ1 C;  1ZLA C;  3LEL A;  4WU9 A;  3VH6 T;  3MGP C;  3NQJ B;  5AV9 C;  1AOI B;  4EO5 B;  3KWQ A;  5FUG B;  4H9O A;  1P3A B;  1JFI A;  1AOI D;  1A7W A;  2HIO D;  3LZ1 D;  4H9R A;  3W98 A;  3REL B;  3B6G A;  3MGR A;  3W98 C;  3X1V D;  4XUJ D;  1S32 A;  3LZ0 A;  1TAF B;  3AZM C;  1BH8 A;  5B2I D;  3O62 B;  4E45 A;  3X1V A;  3UTB D;  2HIO C;  3AZL A;  5KDM B;  3AV1 C;  4JJN B;  3AV1 A;  3WTP C;  5C3I C;  5CP6 A;  3R45 A;  1TZY A;  4H9N A;  1ZLA D;  2NZD B;  3LEL C;  4J8W B;  3X1T B;  4R8P D;  1P3G A;  3AZG A;  5B0Z A;  3KXB A;  4KGC C;  1JFI B;  5GSU D;  4M6B A;  3MGQ A;  5B0Y C;  5GXQ C;  3W97 D;  4YM6 D;  1P3O C;  5AV5 D;  3AZN D;  1P3I D;  5BS7 A;  5DNM D;  4NE6 A;  5AVB C;  5B33 A;  5B32 G;  3AZF B;  1Q9C A;  4YS3 C;  2F8N G;  3WAA B;  3UTB A;  3UTA B;  1P3F A;  2ARO A;  4X23 D;  2RVQ C;  4WU8 B;  3NQU A;  1P3K D;  1KX3 B;  4X23 B;  2FJ7 C;  3WA9 A;  1ZLA A;  3AZE B;  3MGP A;  5AV5 B;  4H9N B;  1P3M B;  3AFA D;  5B0Y A;  5AY8 D;  3AZJ C;  3MGS A;  1P3B C;  1KX4 A;  3AZF A;  5AV8 C;  4HGA B;  1B6W A;  1B67 A;  3AYW B;  3MGR C;  3W96 C;  4WU8 A;  1KX3 A;  4WU8 C;  1KX3 C;  5AVB A;  4H9S A;  3AZI C;  2HIO A;  1EQZ B;  5BNX B;  3MGQ B;  3LJA A;  5G49 A;  3C1C D;  1R4V A;  3WKJ C;  4H9P A;  3WA9 C;  1TZY C;  5DNM A;  1P3L B;  2NQB C;  5BNX A;  3REH A;  5B40 A;  3MVD D;  5JA4 A;  1WWI A;  1P3G C;  5AVC B;  3R45 B;  4XUJ B;  4WV4 B;  4Z2M G;  4G92 B;  1P3P D;  4XZQ A;  5BO0 A;  3O62 D;  1TZY D;  3W99 C;  3KWQ C;  3AN2 D;  5B1M B;  5AV8 A;  4KUD C;  4J8W A;  3X1T A;  4KUD A;  5AVC A;  3UT9 A;  1S32 B;  5CPI D;  2CV5 C;  4Z66 A;  1P3A D;  5B1L D;  3MGP D;  3AZI A;  3WTP B;  5G49 B;  1P3O D;  5KDM A;  4ZUX A;  3REJ C;  3WAA D;  1HTA A;  3REJ A;  1P3F C;  4LD9 D;  5GT0 C;  3TU4 D;  4WU9 D;  3WTP E;  3W97 B;  3MGS D;  1KX4 D;  4HGA C;  3MGQ D;  4EO5 C;  5AV9 D;  1BFM A;  1H3O B;  3X1U D;  3AZK D;  4J8V C;  4YM6 A;  3AZK B;  3X1S D;  1P34 D;  5B2J A;  3MGS C;  1KX4 C;  3AYW D;  5AY8 B;  1U35 A;  4YS3 D;  3X1T D;  4J8W D;  1BH9 A;  1KX5 D;  3AZJ D;  4KHA B;  2ARO D;  3TU4 B;  5B31 B;  4XUJ A;  5CPI A;  5DNN B;  3MGS B;  1M19 A;  1KX4 B;  5B33 C;  1M18 B;  3REK B;  4H9Q A;  1M19 D;  3REI C;  2YFW A;  3AZM D;  3REI A;  2ARO C;  3WTP A;  3AV2 C;  5CP6 D;  4LD9 A;  1HQ3 B;  2JSS A;  2FJ7 A;  4Z5T B;  3B6F A;  3X1V B;  1EQZ C;  1ULY A;  3MGP B;  4J8U C;  4J8U A;  3A6N D;  3AZK C;  3AZF D;  5B0Z C;  5B0Y B;  2PYO C;  4J8V D;  3KXB D;  5AV9 A;  3AN2 B;  1TZY B;  4NE5 A;  2F8N H;  5B24 A;  5B31 A;  5GXQ D;  3UT9 C;  3TU4 A;  1N1J B;  3REI B;  3KWQ D;  3AN2 C;  1AOI A;  3REK A;  3AZE C;  5B2J B;  5GT0 D;  3VH5 W;  4R8P B;  3C1C B;  3C1B D;  3X1V C;  5AVC D;  3MGR B;  4WNN B;  4ZBJ C;  1HQ3 A;  4X23 C;  1U35 B;  4ZUX C;  2FJ7 B;  3C1C C;  2PYO B;  4XZQ D;  3O62 A;  3C1C A;  3WKJ A;  3AZI B;  4KGC D;  4JJN D;  3B6F C;  3VH6 A;  1EQZ D;  3NQJ A;  4KUD D;  5CPK A;  1M1A A;  2F8N A;  5CPK C;  1M1A C;  5B32 C;  3WKJ B;  4DRB A;  3AFA A;  3AV2 B;  4H9O B;  4XZQ C;  3AFA C;  1P3A A;  5B1M A;  5AV8 B;  3W99 D;  3REL D;  5BT1 C;  3AZN C;  1P3I C;  1P3G B;  3LZ0 B;  5CPJ D;  4J8U B;  2CWE A;  4R8P A;  1M18 C;  2BYK B;  3W98 B;  3LZ1 B;  1U35 C;  2CV5 A;  5B0Y D;  3AZE A;  3A6N B;  5JRG C;  5AV6 C;  5BNV B;  5JRG A;  3B6G C;  4AWL B;  3AZL B;  2CV5 B;  4H9R B;  5AV6 B;  1HQ3 D;  1M19 B;  5E5A D;  4Z2M H;  3W97 A;  4Z5T D;  3B6G D;  3REH C;  1EQZ A;  3LZ1 A;  2BYM A;  4CSR A;  5B2I A;  3UTA C;  3AZK A;  3V9R B;  1KX5 A;  5DNM B;  1P3L A;  5JRG B;  5BNV A;  4Z5T C;  1P3B A;  1M18 D;  3W98 D;  5B31 C;  3AYW C;  3B0C W;  5GSU B;  3C1B A;  5B1L C;  3X1U B;  3X1S B;  5AV9 B;  3AN2 A;  1AOI C;  4Z66 D;  3LZ0 C;  1KU5 A;  3AZG D;  5B24 D;  1P3F B;  3X1S C;  4LD9 B;  3W97 C;  4NE3 A;  3O62 C;  5DNM C;  2NQB A;  1P3M A;  1P3M C;  3AZH C;  5B33 B;  5CPJ C;  5C3I B;  3KWQ B;  5B1M C;  4KGC A;  2CV5 D;  1P3A C;  3AYW A;  3MNN A;  1P3O B;  5FUG A;  5GT3 C;  5B2J C;  4J8W C;  5B0Z B;  4R8P C;  3X1T C;  1M18 A;  5B31 G;  4H9Q B;  1P3P B;  5B1M D;  3AZJ A;  3AZF C;  3KXB B;  3AV1 D;  3UT9 B;  4QLC D;  3B0D C;  1P3B B;  1F66 C;  5AV8 D;  4QLC A;  3AV2 D;  1S32 C;  4H9S C;  3WKJ D;  5CP6 B;  5JA4 B;  5F99 A;  3AZH D;  5B40 B;  5CPK D;  5CPJ A;  1M1A D;  1P3L D;  1F66 D;  2F8N D;  3KSY A;  3AZI D;  4KGC B;  5GSU C;  2RVQ D;  2ARO B;  2PYO D;  4G92 C;  3AZG B;  3AZJ B;  2FJ7 D;  3B0C T;  5DNN D;  1P3K C;  4ZUX D;  3WAA A;  5GT3 D;  3AZN A;  1P3I A;  2F8N K;  3LJA D;  4Z5T A;  3B6F B;  5JRG D;  1P3L C;  2NQB B;  3AZG C;  3TU4 C;  1P34 B;  5AVB D;  3AZE D;  4J8X A;  4Z66 B;  3B0B A;  4XUJ C;  3MGQ C;  5AV5 A;  1ID3 A;  5BT1 D;  3REH D;  1P3M D;  3WA9 D;  3VH6 W;  3X1S A;  1BH9 B;  1HQ3 C;  4X23 A;  3UTA D;  4DRA A;  3AV2 A;  3A6N C;  3MVD A;  2NZD C;  2YFW B;  3AZH A;  5AV6 D;  3AZL D;  5B32 A;  3AZN B;  3WTP D;  1P3I B;  3REJ B;  5E5A B;  2PYO A;  3REH B;  5B1L B;  3X1U C;  4J8U D;  3W96 D;  1P3G D;  4H9P B;  4KHA A;  3C1B C;  5GT3 A;  4G91 C;  5AY8 C;  5B32 B;  3MNN C;  5AY8 A;  5AVC C;  5CPJ B;  4E44 A;  3LEL B;  2LY8 A;  4J8V A;  3REK C;  5AV5 C;  2L5A A;  2IO5 B;  4NFT A;  3MVD B;  4CAY B;  3MNN B;  4KUD B; 
#chains in the Genus database with same CATH topology
 5AVB B;  5GXQ A;  4ZBJ B;  5F99 D;  5B33 D;  1P34 A;  3W99 B;  1P34 C;  5BS7 C;  2NQB D;  4QLC C;  3LJA B;  5CPI C;  5E5A A;  3NQU B;  5E5A C;  3MGR D;  2NZD D;  4YS3 A;  1ZLA B;  4AWL C;  5F99 C;  3AZL C;  3LJA C;  5B2J D;  2JE5 A;  3B0D B;  1F66 B;  4XZQ B;  5BO0 B;  5B24 B;  5B40 D;  3REI D;  5F99 B;  1P3P C;  3VH5 A;  5GXQ B;  1U35 D;  3UTB B;  3MNN D;  4YM6 C;  4WU9 C;  3UT9 D;  5GT0 B;  1P3B D;  3W96 B;  5CPI B;  5B1L A;  1S32 D;  3W99 A;  4J8X C;  3AFA B;  5B32 D;  4WNN A;  3VH5 T;  5B0Z D;  3REJ D;  2HIO B;  3LEL D;  1F66 A;  3W96 A;  3KUY A;  1ID3 C;  4J8V B;  4J8X D;  5DNN A;  2HUE B;  5DNN C;  4WU8 D;  1KX3 D;  2YFV B;  2RIQ A;  2NZD A;  5B31 D;  2HUE C;  5CP6 C;  5GT0 A;  3AZM B;  4YM6 B;  2F2A C;  5B2I C;  3UTA A;  1P3K A;  1P3P A;  1F1E A;  3WAA C;  3REK D;  4YS3 B;  4UUZ B;  1KX5 C;  1P3F D;  1N1J A;  5CHL B;  3WA9 B;  2DF4 C;  3KUY D;  2Y2M A;  5B24 C;  3KXB C;  3LZ0 D;  1TAF A;  1KX5 B;  4UUZ A;  1ID3 B;  4WU9 B;  1BH8 B;  5GT3 B;  4DQY B;  1ID3 D;  3KUY C;  1P3O A;  4ZUX B;  4G91 B;  4Z66 C;  4JJN C;  3B6F D;  4JJN A;  1M19 C;  5AV6 A;  4CAY A;  3KUY B;  5CPK B;  2IO5 C;  3A6N A;  3MVD C;  3AZM A;  1M1A B;  2F8N B;  3AZH B;  2BYM B;  4CSR B;  5B2I B;  3UTB C;  4WZS B;  1P3K B;  2ZM5 A;  3REL C;  1WWS A;  3REL A;  1H3O A;  3B6G B;  5GSU A;  4QLC B;  3C1B B;  3EPK A;  2YFV A;  4LD9 C;  3AV1 B;  3X1U A;  4J8X B;  3V9R A;  5B40 C;  2BYK A;  3LZ1 C;  1ZLA C;  3LEL A;  4WU9 A;  3VH6 T;  3MGP C;  3NQJ B;  5AV9 C;  1AOI B;  4EO5 B;  3KWQ A;  5FUG B;  4H9O A;  1P3A B;  1JFI A;  1AOI D;  1A7W A;  2HIO D;  3LZ1 D;  2Y2H A;  4H9R A;  3W98 A;  3REL B;  3B6G A;  3MGR A;  1W2E A;  3X1V D;  3W98 C;  4XUJ D;  1S32 A;  3LZ0 A;  1TAF B;  3AZM C;  1BH8 A;  5B2I D;  4E45 A;  3O62 B;  3X1V A;  3UTB D;  2HIO C;  3AZL A;  2Y2J A;  5KDM B;  3AV1 C;  4JJN B;  3AV1 A;  3WTP C;  5C3I C;  5CP6 A;  3R45 A;  1TZY A;  4H9N A;  1ZLA D;  2NZD B;  3LEL C;  4J8W B;  3X1T B;  4R8P D;  1P3G A;  3AZG A;  5B0Z A;  3KXB A;  4KGC C;  1JFI B;  3H0L C;  5GSU D;  4M6B A;  3MGQ A;  5B0Y C;  5GXQ C;  3W97 D;  4YM6 D;  1P3O C;  5AV5 D;  3AZN D;  1P3I D;  5BS7 A;  5DNM D;  4NE6 A;  5AVB C;  5B33 A;  5B32 G;  3AZF B;  1Q9C A;  4YS3 C;  2F8N G;  3WAA B;  3UTB A;  2G5H C;  3UTA B;  1P3F A;  2ARO A;  4X23 D;  2RVQ C;  4WU8 B;  3NQU A;  1P3K D;  1KX3 B;  4X23 B;  2FJ7 C;  3WA9 A;  1ZLA A;  3EPL A;  3AZE B;  3MGP A;  5AV5 B;  4H9N B;  1P3M B;  3AFA D;  5B0Y A;  5AY8 D;  2FFF B;  3MGS A;  3AZJ C;  1P3B C;  3AZF A;  1KX4 A;  3H0M C;  5AV8 C;  4HGA B;  1Z2C B;  1B6W A;  1B67 A;  3AYW B;  3MGR C;  3W96 C;  4WU8 A;  1KX3 A;  4WU8 C;  1KX3 C;  5AVB A;  4H9S A;  3AZI C;  2HIO A;  1EQZ B;  5BNX B;  3MGQ B;  3LJA A;  5G49 A;  3C1C D;  1R4V A;  3WKJ C;  4H9P A;  3WA9 C;  1TZY C;  5DNM A;  1P3L B;  2NQB C;  5BNX A;  3REH A;  5B40 A;  3MVD D;  5JA4 A;  1WWI A;  1P3G C;  5AVC B;  3R45 B;  4XUJ B;  4WV4 B;  4Z2M G;  4G92 B;  1P3P D;  4XZQ A;  5BO0 A;  3O62 D;  1TZY D;  3W99 C;  3KWQ C;  3AN2 D;  5B1M B;  2XD5 A;  5AV8 A;  4KUD C;  4J8W A;  3X1T A;  4KUD A;  5AVC A;  3UT9 A;  4WJ3 C;  1S32 B;  5CPI D;  2CV5 C;  4Z66 A;  1P3A D;  5B1L D;  3MGP D;  3AZI A;  3WTP B;  5G49 B;  1P3O D;  5KDM A;  4ZUX A;  3REJ C;  3WAA D;  1HTA A;  3REJ A;  1P3F C;  4LD9 D;  5GT0 C;  3TU4 D;  2ZY2 A;  4WU9 D;  3WTP E;  3W97 B;  3MGS D;  1KX4 D;  4HGA C;  3MGQ D;  2Y2O A;  4EO5 C;  5AV9 D;  1BFM A;  1H3O B;  3X1U D;  3AZK D;  4J8V C;  4YM6 A;  3AZK B;  3X1S D;  3EPJ A;  5B2J A;  1P34 D;  3MGS C;  1KX4 C;  3AYW D;  5AY8 B;  1U35 A;  4YS3 D;  3X1T D;  4J8W D;  1BH9 A;  1KX5 D;  3AZJ D;  4KHA B;  2ARO D;  3TU4 B;  3KFU G;  5B31 B;  4XUJ A;  5CPI A;  5DNN B;  3MGS B;  1M19 A;  1KX4 B;  5B33 C;  2XD1 A;  1M18 B;  3REK B;  4H9Q A;  3F6T A;  1M19 D;  3REI C;  1PZR A;  2YFW A;  3AZM D;  3REI A;  2ARO C;  3WTP A;  3AV2 C;  5CP6 D;  4LD9 A;  1HQ3 B;  2JSS A;  2FJ7 A;  4Z5T B;  3B6F A;  3X1V B;  1EQZ C;  1ULY A;  3MGP B;  3AL0 C;  4J8U C;  4J8U A;  3A6N D;  3AZK C;  3AZF D;  5B0Z C;  5B0Y B;  2PYO C;  4J8V D;  3KXB D;  5AV9 A;  3AN2 B;  1TZY B;  2Y2N A;  4NE5 A;  2F8N H;  5B24 A;  5B31 A;  5GXQ D;  3UT9 C;  3TU4 A;  1N1J B;  3REI B;  3KWQ D;  3AN2 C;  1AOI A;  3REK A;  3AZE C;  5B2J B;  5GT0 D;  3VH5 W;  4R8P B;  3C1C B;  3C1B D;  3X1V C;  5AVC D;  3MGR B;  4WNN B;  3A1I A;  4ZBJ C;  1HQ3 A;  4X23 C;  1U35 B;  4ZUX C;  2FJ7 B;  3C1C C;  2PYO B;  4XZQ D;  3O62 A;  3C1C A;  3WKJ A;  3AZI B;  4KGC D;  4JJN D;  3H0R C;  3B6F C;  3VH6 A;  1EQZ D;  3NQJ A;  4KUD D;  5CPK A;  1M1A A;  2F8N A;  5CPK C;  1M1A C;  5B32 C;  2Y2L A;  3WKJ B;  4DRB A;  2VQR A;  3AFA A;  2Y2P A;  4H9O B;  4XZQ C;  3AFA C;  3AV2 B;  1P3A A;  5B1M A;  5AV8 B;  3W99 D;  3REL D;  2Y2Q A;  5BT1 C;  3AZN C;  1P3I C;  1P3G B;  3LZ0 B;  2ZY4 A;  5CPJ D;  4J8U B;  2CWE A;  4R8P A;  1M18 C;  2BYK B;  3W98 B;  3LZ1 B;  1U35 C;  2CV5 A;  5B0Y D;  3AZE A;  3A6N B;  2Y2I A;  5JRG C;  5AV6 C;  5BNV B;  5JRG A;  3B6G C;  4AWL B;  3AZL B;  2W8S A;  2CV5 B;  2BG1 A;  4H9R B;  3EG5 B;  1T3U A;  5AV6 B;  1HQ3 D;  1M19 B;  5E5A D;  4Z2M H;  3W97 A;  4Z5T D;  3B6G D;  3REH C;  1EQZ A;  2ZY5 A;  3LZ1 A;  4UPK A;  2BYM A;  4CSR A;  5B2I A;  3UTA C;  3EPH A;  3AZK A;  3V9R B;  1KX5 A;  5DNM B;  1P3L A;  2Y2K A;  5JRG B;  5BNV A;  4Z5T C;  1P3B A;  1M18 D;  3W98 D;  5B31 C;  3AYW C;  3B0C W;  5GSU B;  3C1B A;  5B1L C;  3X1U B;  3X1S B;  5AV9 B;  3AN2 A;  1AOI C;  3FDD A;  4Z66 D;  3LZ0 C;  1KU5 A;  3AZG D;  5B24 D;  1P3F B;  3X1S C;  4LD9 B;  3W97 C;  4NE3 A;  3O62 C;  5DNM C;  2NQB A;  1P3M A;  1P3M C;  3AZH C;  5B33 B;  5CPJ C;  5C3I B;  3KWQ B;  3A1K A;  5B1M C;  4KGC A;  2CV5 D;  1P3A C;  3AYW A;  3MNN A;  1P3O B;  5FUG A;  5GT3 C;  2ZY3 A;  5B2J C;  5B0Z B;  4R8P C;  4J8W C;  3X1T C;  1M18 A;  5B31 G;  4H9Q B;  1P3P B;  5B1M D;  3AZJ A;  3AZF C;  3KXB B;  3AV1 D;  3UT9 B;  4QLC D;  3B0D C;  1P3B B;  1F66 C;  5AV8 D;  4QLC A;  3AV2 D;  1S32 C;  4H9S C;  3WKJ D;  5CP6 B;  5JA4 B;  5F99 A;  3AZH D;  5B40 B;  5CPK D;  5CPJ A;  1M1A D;  1P3L D;  1F66 D;  2F8N D;  3KSY A;  3AZI D;  4KGC B;  5GSU C;  2RVQ D;  2ARO B;  2PYO D;  4G92 C;  3AZG B;  3AZJ B;  2FJ7 D;  3B0C T;  5DNN D;  1P3K C;  4ZUX D;  3WAA A;  2G5I C;  5GT3 D;  3P5J B;  3AZN A;  1P3I A;  3LJA D;  2F8N K;  4Z5T A;  3B6F B;  5JRG D;  1P3L C;  2NQB B;  3AZG C;  3TU4 C;  1P34 B;  5AVB D;  3AZE D;  4J8X A;  4Z66 B;  3B0B A;  3IP4 C;  4XUJ C;  3MGQ C;  5AV5 A;  1ID3 A;  5BT1 D;  3REH D;  1P3M D;  3WA9 D;  2UWX A;  3VH6 W;  3X1S A;  1BH9 B;  1HQ3 C;  4X23 A;  3UTA D;  4DRA A;  3AV2 A;  2DQN C;  3A6N C;  3MVD A;  2Y2G A;  2NZD C;  2YFW B;  3AZH A;  5AV6 D;  3AZL D;  5B32 A;  3AZN B;  2J8P A;  2JCH A;  3WTP D;  5E5A B;  3REJ B;  1P3I B;  2PYO A;  3REH B;  5B1L B;  3X1U C;  4J8U D;  3W96 D;  1P3G D;  4H9P B;  4KHA A;  3C1B C;  5GT3 A;  4G91 C;  5AY8 C;  5B32 B;  3MNN C;  5AY8 A;  5AVC C;  5CPJ B;  4E44 A;  3LEL B;  2LY8 A;  4J8V A;  3REK C;  5AV5 C;  2L5A A;  2IO5 B;  4NFT A;  3MVD B;  4CAY B;  3MNN B;  4KUD B; 
#chains in the Genus database with same CATH homology
 5AVB B;  5GXQ A;  4ZBJ B;  5F99 D;  5B33 D;  1P34 A;  3W99 B;  1P34 C;  5BS7 C;  2NQB D;  4QLC C;  3LJA B;  5CPI C;  5E5A A;  3NQU B;  5E5A C;  3MGR D;  2NZD D;  4YS3 A;  1ZLA B;  4AWL C;  5F99 C;  3AZL C;  3LJA C;  5B2J D;  2JE5 A;  3B0D B;  1F66 B;  4XZQ B;  5BO0 B;  5B24 B;  5B40 D;  3REI D;  5F99 B;  1P3P C;  3VH5 A;  5GXQ B;  1U35 D;  3UTB B;  3MNN D;  4YM6 C;  4WU9 C;  3UT9 D;  5GT0 B;  1P3B D;  3W96 B;  5CPI B;  5B1L A;  1S32 D;  3W99 A;  4J8X C;  3AFA B;  5B32 D;  4WNN A;  3VH5 T;  5B0Z D;  3REJ D;  2HIO B;  3LEL D;  1F66 A;  3W96 A;  3KUY A;  1ID3 C;  4J8V B;  4J8X D;  5DNN A;  2HUE B;  5DNN C;  4WU8 D;  1KX3 D;  2YFV B;  2RIQ A;  2NZD A;  5B31 D;  2HUE C;  5CP6 C;  5GT0 A;  3AZM B;  4YM6 B;  2F2A C;  5B2I C;  3UTA A;  1P3K A;  1P3P A;  1F1E A;  3WAA C;  3REK D;  4YS3 B;  4UUZ B;  1KX5 C;  1P3F D;  1N1J A;  5CHL B;  3WA9 B;  2DF4 C;  3KUY D;  2Y2M A;  5B24 C;  3KXB C;  3LZ0 D;  1TAF A;  1KX5 B;  4UUZ A;  1ID3 B;  4WU9 B;  1BH8 B;  5GT3 B;  4DQY B;  1ID3 D;  3KUY C;  1P3O A;  4ZUX B;  4G91 B;  4Z66 C;  4JJN C;  3B6F D;  4JJN A;  1M19 C;  5AV6 A;  4CAY A;  3KUY B;  5CPK B;  2IO5 C;  3A6N A;  3MVD C;  3AZM A;  1M1A B;  2F8N B;  3AZH B;  2BYM B;  4CSR B;  5B2I B;  3UTB C;  4WZS B;  1P3K B;  2ZM5 A;  3REL C;  1WWS A;  3REL A;  1H3O A;  3B6G B;  5GSU A;  4QLC B;  3C1B B;  3EPK A;  2YFV A;  4LD9 C;  3AV1 B;  3X1U A;  4J8X B;  3V9R A;  5B40 C;  2BYK A;  3LZ1 C;  1ZLA C;  3LEL A;  4WU9 A;  3VH6 T;  3MGP C;  3NQJ B;  5AV9 C;  1AOI B;  4EO5 B;  3KWQ A;  5FUG B;  4H9O A;  1P3A B;  1JFI A;  1AOI D;  1A7W A;  2HIO D;  3LZ1 D;  2Y2H A;  4H9R A;  3W98 A;  3REL B;  3B6G A;  3MGR A;  1W2E A;  3X1V D;  3W98 C;  4XUJ D;  1S32 A;  3LZ0 A;  1TAF B;  3AZM C;  1BH8 A;  5B2I D;  4E45 A;  3O62 B;  3X1V A;  3UTB D;  2HIO C;  3AZL A;  2Y2J A;  5KDM B;  3AV1 C;  4JJN B;  3AV1 A;  3WTP C;  5C3I C;  5CP6 A;  3R45 A;  1TZY A;  4H9N A;  1ZLA D;  2NZD B;  3LEL C;  4J8W B;  3X1T B;  4R8P D;  1P3G A;  3AZG A;  5B0Z A;  3KXB A;  4KGC C;  1JFI B;  3H0L C;  5GSU D;  4M6B A;  3MGQ A;  5B0Y C;  5GXQ C;  3W97 D;  4YM6 D;  1P3O C;  5AV5 D;  3AZN D;  1P3I D;  5BS7 A;  5DNM D;  4NE6 A;  5AVB C;  5B33 A;  5B32 G;  3AZF B;  1Q9C A;  4YS3 C;  2F8N G;  3WAA B;  3UTB A;  2G5H C;  3UTA B;  1P3F A;  2ARO A;  4X23 D;  2RVQ C;  4WU8 B;  3NQU A;  1P3K D;  1KX3 B;  4X23 B;  2FJ7 C;  3WA9 A;  1ZLA A;  3EPL A;  3AZE B;  3MGP A;  5AV5 B;  4H9N B;  1P3M B;  3AFA D;  5B0Y A;  5AY8 D;  2FFF B;  3MGS A;  3AZJ C;  1P3B C;  3AZF A;  1KX4 A;  3H0M C;  5AV8 C;  4HGA B;  1Z2C B;  1B6W A;  1B67 A;  3AYW B;  3MGR C;  3W96 C;  4WU8 A;  1KX3 A;  4WU8 C;  1KX3 C;  5AVB A;  4H9S A;  3AZI C;  2HIO A;  1EQZ B;  5BNX B;  3MGQ B;  3LJA A;  5G49 A;  3C1C D;  1R4V A;  3WKJ C;  4H9P A;  3WA9 C;  1TZY C;  5DNM A;  1P3L B;  2NQB C;  5BNX A;  3REH A;  5B40 A;  3MVD D;  5JA4 A;  1WWI A;  1P3G C;  5AVC B;  3R45 B;  4XUJ B;  4WV4 B;  4Z2M G;  4G92 B;  1P3P D;  4XZQ A;  5BO0 A;  3O62 D;  1TZY D;  3W99 C;  3KWQ C;  3AN2 D;  5B1M B;  2XD5 A;  5AV8 A;  4KUD C;  4J8W A;  3X1T A;  4KUD A;  5AVC A;  3UT9 A;  4WJ3 C;  1S32 B;  5CPI D;  2CV5 C;  4Z66 A;  1P3A D;  5B1L D;  3MGP D;  3AZI A;  3WTP B;  5G49 B;  1P3O D;  5KDM A;  4ZUX A;  3REJ C;  3WAA D;  1HTA A;  3REJ A;  1P3F C;  4LD9 D;  5GT0 C;  3TU4 D;  2ZY2 A;  4WU9 D;  3WTP E;  3W97 B;  3MGS D;  1KX4 D;  4HGA C;  3MGQ D;  2Y2O A;  4EO5 C;  5AV9 D;  1BFM A;  1H3O B;  3X1U D;  3AZK D;  4J8V C;  4YM6 A;  3AZK B;  3X1S D;  3EPJ A;  5B2J A;  1P34 D;  3MGS C;  1KX4 C;  3AYW D;  5AY8 B;  1U35 A;  4YS3 D;  3X1T D;  4J8W D;  1BH9 A;  1KX5 D;  3AZJ D;  4KHA B;  2ARO D;  3TU4 B;  3KFU G;  5B31 B;  4XUJ A;  5CPI A;  5DNN B;  3MGS B;  1M19 A;  1KX4 B;  5B33 C;  2XD1 A;  1M18 B;  3REK B;  4H9Q A;  3F6T A;  1M19 D;  3REI C;  1PZR A;  2YFW A;  3AZM D;  3REI A;  2ARO C;  3WTP A;  3AV2 C;  5CP6 D;  4LD9 A;  1HQ3 B;  2JSS A;  2FJ7 A;  4Z5T B;  3B6F A;  3X1V B;  1EQZ C;  1ULY A;  3MGP B;  3AL0 C;  4J8U C;  4J8U A;  3A6N D;  3AZK C;  3AZF D;  5B0Z C;  5B0Y B;  2PYO C;  4J8V D;  3KXB D;  5AV9 A;  3AN2 B;  1TZY B;  2Y2N A;  4NE5 A;  2F8N H;  5B24 A;  5B31 A;  5GXQ D;  3UT9 C;  3TU4 A;  1N1J B;  3REI B;  3KWQ D;  3AN2 C;  1AOI A;  3REK A;  3AZE C;  5B2J B;  5GT0 D;  3VH5 W;  4R8P B;  3C1C B;  3C1B D;  3X1V C;  5AVC D;  3MGR B;  4WNN B;  3A1I A;  4ZBJ C;  1HQ3 A;  4X23 C;  1U35 B;  4ZUX C;  2FJ7 B;  3C1C C;  2PYO B;  4XZQ D;  3O62 A;  3C1C A;  3WKJ A;  3AZI B;  4KGC D;  4JJN D;  3H0R C;  3B6F C;  3VH6 A;  1EQZ D;  3NQJ A;  4KUD D;  5CPK A;  1M1A A;  2F8N A;  5CPK C;  1M1A C;  5B32 C;  2Y2L A;  3WKJ B;  4DRB A;  2VQR A;  3AFA A;  2Y2P A;  4H9O B;  4XZQ C;  3AFA C;  3AV2 B;  1P3A A;  5B1M A;  5AV8 B;  3W99 D;  3REL D;  2Y2Q A;  5BT1 C;  3AZN C;  1P3I C;  1P3G B;  3LZ0 B;  2ZY4 A;  5CPJ D;  4J8U B;  2CWE A;  4R8P A;  1M18 C;  2BYK B;  3W98 B;  3LZ1 B;  1U35 C;  2CV5 A;  5B0Y D;  3AZE A;  3A6N B;  2Y2I A;  5JRG C;  5AV6 C;  5BNV B;  5JRG A;  3B6G C;  4AWL B;  3AZL B;  2W8S A;  2CV5 B;  2BG1 A;  4H9R B;  3EG5 B;  1T3U A;  5AV6 B;  1HQ3 D;  1M19 B;  5E5A D;  4Z2M H;  3W97 A;  4Z5T D;  3B6G D;  3REH C;  1EQZ A;  2ZY5 A;  3LZ1 A;  4UPK A;  2BYM A;  4CSR A;  5B2I A;  3UTA C;  3EPH A;  3AZK A;  3V9R B;  1KX5 A;  5DNM B;  1P3L A;  2Y2K A;  5JRG B;  5BNV A;  4Z5T C;  1P3B A;  1M18 D;  3W98 D;  5B31 C;  3AYW C;  3B0C W;  5GSU B;  3C1B A;  5B1L C;  3X1U B;  3X1S B;  5AV9 B;  3AN2 A;  1AOI C;  3FDD A;  4Z66 D;  3LZ0 C;  1KU5 A;  3AZG D;  5B24 D;  1P3F B;  3X1S C;  4LD9 B;  3W97 C;  4NE3 A;  3O62 C;  5DNM C;  2NQB A;  1P3M A;  1P3M C;  3AZH C;  5B33 B;  5CPJ C;  5C3I B;  3KWQ B;  3A1K A;  5B1M C;  4KGC A;  2CV5 D;  1P3A C;  3AYW A;  3MNN A;  1P3O B;  5FUG A;  5GT3 C;  2ZY3 A;  5B2J C;  5B0Z B;  4R8P C;  4J8W C;  3X1T C;  1M18 A;  5B31 G;  4H9Q B;  1P3P B;  5B1M D;  3AZJ A;  3AZF C;  3KXB B;  3AV1 D;  3UT9 B;  4QLC D;  3B0D C;  1P3B B;  1F66 C;  5AV8 D;  4QLC A;  3AV2 D;  1S32 C;  4H9S C;  3WKJ D;  5CP6 B;  5JA4 B;  5F99 A;  3AZH D;  5B40 B;  5CPK D;  5CPJ A;  1M1A D;  1P3L D;  1F66 D;  2F8N D;  3KSY A;  3AZI D;  4KGC B;  5GSU C;  2RVQ D;  2ARO B;  2PYO D;  4G92 C;  3AZG B;  3AZJ B;  2FJ7 D;  3B0C T;  5DNN D;  1P3K C;  4ZUX D;  3WAA A;  2G5I C;  5GT3 D;  3P5J B;  3AZN A;  1P3I A;  3LJA D;  2F8N K;  4Z5T A;  3B6F B;  5JRG D;  1P3L C;  2NQB B;  3AZG C;  3TU4 C;  1P34 B;  5AVB D;  3AZE D;  4J8X A;  4Z66 B;  3B0B A;  3IP4 C;  4XUJ C;  3MGQ C;  5AV5 A;  1ID3 A;  5BT1 D;  3REH D;  1P3M D;  3WA9 D;  2UWX A;  3VH6 W;  3X1S A;  1BH9 B;  1HQ3 C;  4X23 A;  3UTA D;  4DRA A;  3AV2 A;  2DQN C;  3A6N C;  3MVD A;  2Y2G A;  2NZD C;  2YFW B;  3AZH A;  5AV6 D;  3AZL D;  5B32 A;  3AZN B;  2J8P A;  2JCH A;  3WTP D;  5E5A B;  3REJ B;  1P3I B;  2PYO A;  3REH B;  5B1L B;  3X1U C;  4J8U D;  3W96 D;  1P3G D;  4H9P B;  4KHA A;  3C1B C;  5GT3 A;  4G91 C;  5AY8 C;  5B32 B;  3MNN C;  5AY8 A;  5AVC C;  5CPJ B;  4E44 A;  3LEL B;  2LY8 A;  4J8V A;  3REK C;  5AV5 C;  2L5A A;  2IO5 B;  4NFT A;  3MVD B;  4CAY B;  3MNN B;  4KUD B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...