5GT3A

Crystal structure of nucleosome particle in the presence of human testis-specific histone variant, hth2b
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
98
structure length
98
Chain Sequence
b'PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Structural analyses of the nucleosome complexes with human testis-specific histone variants, hTh2a and hTh2b
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 32
structure length 98
sequence length 98
chains with identical sequence E
ec nomenclature
pdb deposition date 2016-08-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5gt3A00
2BYKA 3B6GB 5CP6B 1P3FC 3VH6T 5CPKC 3AZEC 1P3MA 5B1LB 5CP6A 3AYWC 4CSRB 5AV8C 3LELC 5CPJC 5B2IB 2CV5B 4R8PB 1BFMA 3AZLA 3WAAD 4H9QB 1M19A 2CV5A 1P3LB 1P3GB 4R8PA 4H9QA 4ZUXB 3B6GC 1P3GA 5CP6C 5KDMB 1N1JB 2HIOB 4YS3A 1F66D 3C1BC 5B1LC 5B2IC 2CV5C 2PYOB 4Z5TB 4R8PC 4Z66A 5JA4A 3W97A 3A6ND 5GSUB 4XUJB 1BH9B 1P3LC 4Z5TA 1P3GC 3O62D 1ID3A 4ZUXC 5GSUA 4XUJA 3MGRB 1BH9A 5CPIB 3REKD 5DNNA 2HIOC 5B32B 5CPIA 4WU9B 2PYOC 4Z5TC 4WU8D 5FUGA 5B32A 1P34D 1AOIB 5GSUC 4XUJC 3AZHB 3LJAB 3KUYA 4WU9A 1H3OB 1AOIA 3MGRC 3AZHA 5AV5B 3W99B 5CPIC 3WTPB 1M18D 2L5AA 3TU4D 3W99A 5B32C 3WTPA 5AVCD 4WU9C 1AOIC 3UT9D 4J8XD 3AZHC 3MGSA 3LJAC 2F8ND 5B0YD 1ZLAB 2AROB 5AV5C 4E44A 3W99C 4H9NB 3UTBB 2YFWA 5B0ZD 3WTPC 2AROA 4H9SA 4H9NA 3UTBA 1P3KB 4NE6A 5BNVB 3AZJB 3X1VD 3C1CA 4J8VB 1P3PB 5E5AB 1P3KA 5B1MB 3AZJA 3AZGB 5B2JB 5F99D 1P3OB 4J8VA 4HGAB 5E5AA 3AZID 5B1MA 1P3BD 1ZLAC 2AROC 2YFVB 5B2JA 3AZNA 3UTBC 3UTAD 3WA9A 2YFVA 4X23B 1P3KC 5G49B 3AZJC 4H9PB 3B0DB 4J8VC 3REJB 3AZED 5E5AC 5CPKD 1P3PC 5B1MC 3AYWD 3AZGC 5B2JC 5AV9A 3LELD 5CPJD 1P3OC 4HGAC 3KXBB 3KSYA 4E45A 2NZDA 3AV2B 3LZ0B 4J8UB 5B40A 3VH5A 1P3AA 3R45A 5GT3B 4X23C 1TAFA 3KXBA 5JRGB 3AZKA 3AV2A 4J8UA 3B6GD 5B33B 5CP6D 5GT3A 3B0DC 3REJC 5B1LD 4DRBA 5B33A 4JJNB 3AZLD 1KX5A 2CV5D 4R8PD 3X1VB 1EQZB 4JJNA 3KXBC 3AV2C 3LZ0C 4J8UC 1P3GD 1P3LD 2F8NH 1KU5A 5BT1C 5GT3C 4ZUXD 3AFAB 3AZIB 5JRGC 1TZYB 5B33C 3NQJA 4QLCA 3X1SA 3MGQB 3AFAA 2HIOD 4JJNC 1S32B 3MGQA 4CAYB 4NE3A 5CHLB 2PYOD 4Z5TD 4EO5B 3X1VC 3AZMB 1EQZC 2NQBA 5GSUD 4XUJD 5B31A 3AZMA 3AFAC 5BO0A 3AZIC 1TZYC 2BYKB 5CPID 3MGQC 3W96A 1S32C 5B32D 3MNNA 1JFIB 1P3MB 4WU9D 3WTPE 3AV1B 4EO5C 3AZMC 1AOID 3AZHD 1JFIA 3AZLB 3LJAD 1M19B 3AV1A 4XZQB 1R4VA 5GT0A 2BYMB 5AV5D 4YM6A 3W99D 4XZQA 5GXQA 3WTPD 5C3IB 1P3IB 2BYMA 1Q9CA 2IO5B 4YS3B 1P3MC 3AV1C 1P3IA 1M1AB 4Z66B 5JA4B 3AZLC 3W97B 1M19C 4XZQC 5BS7A 1M1AA 1ZLAD 2AROD 3REHB 3X1UA 1ID3B 5B24A 3VH5T 5B32G 3UTBD 3LZ1A 5C3IC 3REHA 5DNNB 1P3IC 3RELA 4G92B 2IO5C 1P3KD 4YS3C 1U35B 3AZJD 4J8VD 1P3PD 5E5AD 5AY8B 5B1MD 1U35A 1M1AC 3AZGD 5FUGB 5B2JD 4Z66C 1P3OD 3W97C 5BNXB 5AY8A 3KUYB 3WA9D 4KGCA 3REHC 1ID3C 5BNXA 3V9RA 3KWQB 4X23D 5DNNC 3W98B 4G92C 3B0CT 1U35C 3KWQA 3REJD 3W98A 5AY8C 3AN2B 1KX3B 3MGSB 5B40D 3KUYC 3AN2A 3KXBD 1KX3A 5DNMA 3AV2D 3LZ0D 4J8UD 2FJ7A 3KWQC 2RVQC 5BT1D 5GT3D 3W98C 2YFWB 5JRGD 5B33D 4JJND 3C1CB 3AN2C 1KX3C 3MGSC 1EQZD 3WAAA 3AZNB 1HTAA 3AFAD 1TZYD 3X1TB 3WA9B 4H9SC 3MGQD 3VH6W 3X1TA 3C1CC 1S32D 1F66A 1HQ3A 5AV9B 3AZMD 2F8NG 2NZDB 3A6NA 4J8WA 3AZNC 5B40B 3X1TC 1B67A 1P3AB 3R45B 3WA9C 3AZKB 1TAFB 1KX4A 1P3MD 3AV1D 3REIA 5AV9C 1WWIA 1KX5B 1M19D 2NZDC 4XZQD 4WNNA 5AVBB 5B40C 1P3AC 3AZKC 5AVBA 3NQJB 4QLCB 1P3ID 3X1SB 1WWSA 1M18A 4YS3D 1KX5C 3NQUA 1M1AD 4Z66D 2NQBB 3W97D 3UT9A 5B31B 5AVBC 3REHD 1ID3D 5BO0B 4QLCC 5DNND 3X1SC 4UUZB 3W96B 1U35D 3MNNB 4NE5A 4UUZA 5AY8D 3MGPB 2NQBC 5B31C 3KUYD 5F99A 3MGPA 1P3BA 5GT0B 4YM6B 3KWQD 2RVQD 5GXQB 3W98D 3W96C 3MVDB 3MNNC 4ZBJB 1P3FA 3MVDA 3AN2D 1KX3D 3MGPC 1BH8B 3B6FB 3AYWA 3MGSD 5AV8A 3LELA 4Z2MG 4H9RB 1BH8A 3B6FA 3X1UB 5GT0C 5B24B 4H9RA 4YM6C 5GXQC 3LZ1B 3MVDC 3RELB 3B6GA 3C1BB 1B6WA 4ZBJC 3C1CD 3C1BA 3B6FC 5B1LA 4CSRA 5B2IA 4KUDB 5BS7C 4KGCB 3X1UC 3AZND 5B24C 1P3LA 4KUDA 3V9RB 1A7WA 3X1TD 3WKJB 3LZ1C 4ZUXA 3RELC 1HQ3D 5KDMA 4Z2MH 3WKJA 1N1JA 2HIOA 2F8NK 5AV9D 4J8WD 5AV6B 2PYOA 4KUDC 4KGCC 2NZDD 5DNMB 5AV6A 1KX4D 2FJ7B 1P3AD 3WKJC 3AZKD 3MGRA 3AZFB 4LD9B 3REID 4WV4B 3AZFA 4LD9A 1KX5D 5AV6C 2JSSA 5DNMC 3LJAA 3WAAB 5AVBD 2FJ7C 1H3OA 3AZFC 5AV5A 4QLCD 4G91B 4LD9C 3X1SD 1F66B 1HQ3B 2LY8A 2NQBD 5B31D 3WAAC 3A6NB 4J8WB 4WZSB 1ZLAA 3O62B 4G91C 1KX4B 3O62A 3W96D 3REKB 3MNND 3VH6A 5BNVA 1F66C 1HQ3C 4DRAA 3REIB 3REKA 3MGPD 1P3PA 4WU8B 3AZFD 3AZGA 4AWLB 1P34B 1P3OA 3A6NC 4J8WC 4WNNB 4WU8A 3O62C 3VH5W 4YM6D 5GT0D 1P34A 5GXQD 1KX4C 4M6BA 1P3FD 3MVDD 4X23A 3REKC 1M18B 4KHAB 5G49A 5B31G 3TU4B 5AV8D 4H9PA 3REIC 3NQUB 3REJA 5AVCB 3B6FD 4WU8C 2HUEB 4KHAA 3TU4A 4AWLC 1P34C 3UT9B 3B0BA 5AVCA 4J8XB 2F8NB 4H9OB 5B0YB 3X1UD 5B24D 3LZ0A 4J8XA 2F8NA 4H9OA 3LZ1D 5B0YA 3B0CW 3RELD 5B0ZB 5JRGA 1M18C 3C1BD 3TU4C 5B2ID 5B0ZA 5AVCC 2HUEC 3UT9C 4KUDD 2CWEA 4J8XC 3X1VA 1EQZA 5F99B 4KGCD 5B0YC 1P3BB 1ULYA 3WKJD 3AZIA 5B0ZC 1TZYA 3UTAB 1F1EA 3UTAA 1P3FB 1S32A 5CPKB 3AZEB 4CAYA 5AV6D 3AYWB 5AV8B 3LELB 5F99C 5CPJB 5CPKA 4NFTA 3MGRD 3AZEA 5DNMD 1P3BC 2FJ7D 5CPJA 3UTAC 4LD9D
chains in the Genus database with same CATH superfamily
2BYKA 3B6GB 5CP6B 1P3FC 3VH6T 5CPKC 3AZEC 1P3MA 5B1LB 5CP6A 3AYWC 4CSRB 5AV8C 3LELC 5CPJC 5B2IB 2CV5B 4R8PB 1BFMA 3AZLA 3WAAD 4H9QB 1M19A 2ZY2A 2CV5A 1P3LB 1P3GB 4R8PA 4H9QA 4ZUXB 3B6GC 1P3GA 3EG5B 5CP6C 5KDMB 1N1JB 3EPLA 2HIOB 4YS3A 1F66D 3C1BC 5B1LC 2Y2HA 5B2IC 2CV5C 2PYOB 4Z5TB 3A1KA 4R8PC 4Z66A 5JA4A 3W97A 3A6ND 5GSUB 4XUJB 1BH9B 1P3LC 4Z5TA 1P3GC 3O62D 1ID3A 4ZUXC 5GSUA 4XUJA 3MGRB 1BH9A 5CPIB 3REKD 5DNNA 2Y2KA 2HIOC 5B32B 5CPIA 4WU9B 2PYOC 4Z5TC 2Y2MA 4WU8D 3H0LC 5FUGA 5B32A 1P34D 1AOIB 5GSUC 4XUJC 3AZHB 3LJAB 3KUYA 4WU9A 1H3OB 1AOIA 3P5JB 3MGRC 3AZHA 2JE5A 5AV5B 3W99B 5CPIC 3WTPB 1M18D 2L5AA 3TU4D 3W99A 5B32C 3WTPA 5AVCD 4WU9C 1AOIC 3UT9D 4J8XD 3AZHC 3MGSA 3LJAC 2F8ND 3AL0C 5B0YD 1ZLAB 2AROB 5AV5C 4E44A 3W99C 4H9NB 3UTBB 2YFWA 5B0ZD 3WTPC 2AROA 4H9SA 4H9NA 3UTBA 1P3KB 4NE6A 5BNVB 3AZJB 3X1VD 3C1CA 4J8VB 1P3PB 5E5AB 1P3KA 5B1MB 3AZJA 3AZGB 5B2JB 5F99D 1P3OB 4J8VA 4HGAB 5E5AA 3AZID 5B1MA 1P3BD 1ZLAC 2AROC 2YFVB 5B2JA 3AZNA 3UTBC 2XD5A 3UTAD 3WA9A 2YFVA 4X23B 1P3KC 5G49B 3AZJC 4H9PB 3B0DB 4J8VC 3REJB 3AZED 5E5AC 5CPKD 1P3PC 5B1MC 3AYWD 3AZGC 5B2JC 5AV9A 3LELD 5CPJD 1P3OC 4HGAC 2XD1A 3KXBB 3KSYA 4E45A 2NZDA 3AV2B 3LZ0B 4J8UB 5B40A 3VH5A 1P3AA 3R45A 5GT3B 4X23C 1TAFA 3KXBA 5JRGB 3AZKA 3AV2A 4J8UA 3B6GD 5B33B 5CP6D 5GT3A 3B0DC 3REJC 2Y2GA 5B1LD 4DRBA 5B33A 4JJNB 3AZLD 1KX5A 2CV5D 4R8PD 3X1VB 2JCHA 4JJNA 1EQZB 3KXBC 3AV2C 3LZ0C 4J8UC 1P3GD 1P3LD 2F8NH 1KU5A 5BT1C 5GT3C 4ZUXD 3AFAB 3AZIB 5JRGC 1TZYB 5B33C 3NQJA 4QLCA 3X1SA 3MGQB 3AFAA 2HIOD 4JJNC 1S32B 3MGQA 4CAYB 4NE3A 5CHLB 2PYOD 4Z5TD 4EO5B 3X1VC 3AZMB 1EQZC 2NQBA 5GSUD 4XUJD 5B31A 3H0MC 2BG1A 3AZMA 3IP4C 3AFAC 5BO0A 3AZIC 1TZYC 2BYKB 5CPID 3MGQC 3W96A 1S32C 5B32D 3MNNA 1JFIB 1P3MB 4WU9D 3WTPE 3AV1B 4EO5C 3AZMC 2W8SA 1AOID 3AZHD 1JFIA 2ZY3A 3LJAD 3AZLB 1M19B 3AV1A 4XZQB 1R4VA 5GT0A 2BYMB 5AV5D 4YM6A 3W99D 4XZQA 5GXQA 3WTPD 3H0RC 5C3IB 1P3IB 2BYMA 1Q9CA 2IO5B 4YS3B 1P3MC 3AV1C 1P3IA 1M1AB 4Z66B 5JA4B 3AZLC 3W97B 1M19C 2ZM5A 4XZQC 5BS7A 1M1AA 1ZLAD 2AROD 3REHB 3X1UA 1ID3B 5B24A 3VH5T 5B32G 3UTBD 3LZ1A 5C3IC 3REHA 5DNNB 1P3IC 3RELA 4G92B 2IO5C 1P3KD 4YS3C 1U35B 3AZJD 4J8VD 1P3PD 5E5AD 5AY8B 5B1MD 1U35A 1M1AC 3AZGD 5FUGB 5B2JD 4Z66C 1P3OD 3W97C 5BNXB 5AY8A 3KUYB 3WA9D 4KGCA 3REHC 1ID3C 5BNXA 3V9RA 3KWQB 3EPHA 4X23D 5DNNC 3W98B 4G92C 3B0CT 1U35C 3KWQA 3REJD 3W98A 5AY8C 2Y2NA 3AN2B 1KX3B 3MGSB 5B40D 3KUYC 3AN2A 3KXBD 1KX3A 5DNMA 3AV2D 3LZ0D 4J8UD 2FJ7A 3KWQC 2RVQC 5BT1D 5GT3D 3W98C 2YFWB 5JRGD 5B33D 2ZY5A 4JJND 3C1CB 3AN2C 1KX3C 1W2EA 3MGSC 1EQZD 3WAAA 3AZNB 1HTAA 3AFAD 1TZYD 3X1TB 3WA9B 4H9SC 3MGQD 2G5HC 3VH6W 3X1TA 3C1CC 1S32D 1F66A 1HQ3A 5AV9B 3AZMD 2F8NG 2NZDB 3A6NA 4J8WA 3AZNC 5B40B 3X1TC 1B67A 1P3AB 3R45B 3WA9C 3AZKB 1TAFB 1KX4A 2F2AC 1P3MD 2Y2QA 3AV1D 3REIA 5AV9C 1WWIA 2ZY4A 1KX5B 1M19D 2NZDC 4XZQD 4WNNA 5AVBB 5B40C 1P3AC 3AZKC 5AVBA 3NQJB 4QLCB 1P3ID 3X1SB 1WWSA 1M18A 2Y2IA 4YS3D 1KX5C 3NQUA 1M1AD 4Z66D 2NQBB 3W97D 3UT9A 5B31B 5AVBC 3REHD 1ID3D 5BO0B 4QLCC 5DNND 3X1SC 4UUZB 3W96B 1U35D 3MNNB 4NE5A 4UUZA 5AY8D 3MGPB 2NQBC 5B31C 3KUYD 5F99A 3MGPA 2J8PA 1P3BA 5GT0B 4YM6B 3KWQD 3EPJA 2RVQD 5GXQB 3W98D 3W96C 3MVDB 3A1IA 3MNNC 2DQNC 4ZBJB 1P3FA 3MVDA 3AN2D 2G5IC 3MGPC 1KX3D 1BH8B 3B6FB 3AYWA 3MGSD 5AV8A 3LELA 4Z2MG 4H9RB 1BH8A 2VQRA 3B6FA 5GT0C 4YM6C 5B24B 4H9RA 3X1UB 5GXQC 3LZ1B 3MVDC 3RELB 3B6GA 3C1BB 1B6WA 4ZBJC 3C1CD 3C1BA 3B6FC 5B1LA 4CSRA 5B2IA 4KUDB 5BS7C 4KGCB 3X1UC 3AZND 5B24C 1P3LA 4KUDA 3V9RB 1A7WA 3X1TD 3WKJB 3LZ1C 2Y2OA 4ZUXA 3RELC 1HQ3D 5KDMA 4Z2MH 3WKJA 1N1JA 2HIOA 3FDDA 2F8NK 5AV9D 4J8WD 5AV6B 2PYOA 4KUDC 2DF4C 4KGCC 2NZDD 5DNMB 5AV6A 1KX4D 2FJ7B 1P3AD 3WKJC 3AZKD 3MGRA 3AZFB 4LD9B 3F6TA 3REID 4DQYB 4WV4B 3AZFA 4LD9A 2Y2JA 1KX5D 5AV6C 2JSSA 1Z2CB 5DNMC 3KFUG 3LJAA 3WAAB 5AVBD 2FJ7C 1H3OA 3AZFC 5AV5A 4QLCD 4G91B 4LD9C 3X1SD 1T3UA 1F66B 1HQ3B 2LY8A 2NQBD 5B31D 3WAAC 2UWXA 3A6NB 4J8WB 4WZSB 1ZLAA 3O62B 4G91C 1KX4B 3O62A 3W96D 3REKB 2FFFB 3MNND 3VH6A 5BNVA 1F66C 1HQ3C 4DRAA 3REIB 3REKA 3MGPD 1P3PA 4WU8B 4UPKA 3AZFD 3AZGA 2Y2PA 4AWLB 1P34B 1P3OA 3A6NC 4J8WC 4WNNB 4WU8A 3O62C 3VH5W 4YM6D 5GT0D 1P34A 5GXQD 1KX4C 4M6BA 1P3FD 4WJ3C 3MVDD 4X23A 3REKC 1M18B 4KHAB 5G49A 5B31G 3TU4B 5AV8D 4H9PA 3REIC 3NQUB 3REJA 5AVCB 3B6FD 4WU8C 2HUEB 4KHAA 3TU4A 4AWLC 1P34C 3UT9B 3B0BA 5AVCA 4J8XB 2F8NB 3EPKA 4H9OB 5B0YB 3X1UD 5B24D 3LZ0A 4J8XA 2F8NA 4H9OA 2Y2LA 5B0YA 3LZ1D 3B0CW 3RELD 5B0ZB 5JRGA 1M18C 3C1BD 3TU4C 5B2ID 5B0ZA 5AVCC 2HUEC 3UT9C 4KUDD 2CWEA 4J8XC 3X1VA 1EQZA 5F99B 4KGCD 5B0YC 1P3BB 1ULYA 3WKJD 3AZIA 5B0ZC 1TZYA 3UTAB 1PZRA 1F1EA 2RIQA 3UTAA 1P3FB 1S32A 5CPKB 3AZEB 4CAYA 5AV6D 3AYWB 5AV8B 3LELB 5F99C 5CPJB 5CPKA 4NFTA 3MGRD 3AZEA 5DNMD 1P3BC 2FJ7D 5CPJA 3UTAC 4LD9D
chains in the Genus database with same CATH topology
2BYKA 3B6GB 5CP6B 1P3FC 3VH6T 5CPKC 3AZEC 1P3MA 5B1LB 5CP6A 3AYWC 4CSRB 5AV8C 3LELC 5CPJC 5B2IB 2CV5B 4R8PB 1BFMA 3AZLA 3WAAD 4H9QB 1M19A 2ZY2A 2CV5A 1P3LB 1P3GB 4R8PA 4H9QA 4ZUXB 3B6GC 1P3GA 3EG5B 5CP6C 5KDMB 1N1JB 3EPLA 2HIOB 4YS3A 1F66D 3C1BC 5B1LC 2Y2HA 5B2IC 2CV5C 2PYOB 4Z5TB 3A1KA 4R8PC 4Z66A 5JA4A 3W97A 3A6ND 5GSUB 4XUJB 1BH9B 1P3LC 4Z5TA 1P3GC 3O62D 1ID3A 4ZUXC 5GSUA 4XUJA 3MGRB 1BH9A 5CPIB 3REKD 5DNNA 2Y2KA 2HIOC 5B32B 5CPIA 4WU9B 2PYOC 4Z5TC 2Y2MA 4WU8D 3H0LC 5FUGA 5B32A 1P34D 1AOIB 5GSUC 4XUJC 3AZHB 3LJAB 3KUYA 4WU9A 1H3OB 1AOIA 3P5JB 3MGRC 3AZHA 2JE5A 5AV5B 3W99B 5CPIC 3WTPB 1M18D 2L5AA 3TU4D 3W99A 5B32C 3WTPA 5AVCD 4WU9C 1AOIC 3UT9D 4J8XD 3AZHC 3MGSA 3LJAC 2F8ND 3AL0C 5B0YD 1ZLAB 2AROB 5AV5C 4E44A 3W99C 4H9NB 3UTBB 2YFWA 5B0ZD 3WTPC 2AROA 4H9SA 4H9NA 3UTBA 1P3KB 4NE6A 5BNVB 3AZJB 3X1VD 3C1CA 4J8VB 1P3PB 5E5AB 1P3KA 5B1MB 3AZJA 3AZGB 5B2JB 5F99D 1P3OB 4J8VA 4HGAB 5E5AA 3AZID 5B1MA 1P3BD 1ZLAC 2AROC 2YFVB 5B2JA 3AZNA 3UTBC 2XD5A 3UTAD 3WA9A 2YFVA 4X23B 1P3KC 5G49B 3AZJC 4H9PB 3B0DB 4J8VC 3REJB 3AZED 5E5AC 5CPKD 1P3PC 5B1MC 3AYWD 3AZGC 5B2JC 5AV9A 3LELD 5CPJD 1P3OC 4HGAC 2XD1A 3KXBB 3KSYA 4E45A 2NZDA 3AV2B 3LZ0B 4J8UB 5B40A 3VH5A 1P3AA 3R45A 5GT3B 4X23C 1TAFA 3KXBA 5JRGB 3AZKA 3AV2A 4J8UA 3B6GD 5B33B 5CP6D 5GT3A 3B0DC 3REJC 2Y2GA 5B1LD 4DRBA 5B33A 4JJNB 3AZLD 1KX5A 2CV5D 4R8PD 3X1VB 2JCHA 4JJNA 1EQZB 3KXBC 3AV2C 3LZ0C 4J8UC 1P3GD 1P3LD 2F8NH 1KU5A 5BT1C 5GT3C 4ZUXD 3AFAB 3AZIB 5JRGC 1TZYB 5B33C 3NQJA 4QLCA 3X1SA 3MGQB 3AFAA 2HIOD 4JJNC 1S32B 3MGQA 4CAYB 4NE3A 5CHLB 2PYOD 4Z5TD 4EO5B 3X1VC 3AZMB 1EQZC 2NQBA 5GSUD 4XUJD 5B31A 3H0MC 2BG1A 3AZMA 3IP4C 3AFAC 5BO0A 3AZIC 1TZYC 2BYKB 5CPID 3MGQC 3W96A 1S32C 5B32D 3MNNA 1JFIB 1P3MB 4WU9D 3WTPE 3AV1B 4EO5C 3AZMC 2W8SA 1AOID 3AZHD 1JFIA 2ZY3A 3LJAD 3AZLB 1M19B 3AV1A 4XZQB 1R4VA 5GT0A 2BYMB 5AV5D 4YM6A 3W99D 4XZQA 5GXQA 3WTPD 3H0RC 5C3IB 1P3IB 2BYMA 1Q9CA 2IO5B 4YS3B 1P3MC 3AV1C 1P3IA 1M1AB 4Z66B 5JA4B 3AZLC 3W97B 1M19C 2ZM5A 4XZQC 5BS7A 1M1AA 1ZLAD 2AROD 3REHB 3X1UA 1ID3B 5B24A 3VH5T 5B32G 3UTBD 3LZ1A 5C3IC 3REHA 5DNNB 1P3IC 3RELA 4G92B 2IO5C 1P3KD 4YS3C 1U35B 3AZJD 4J8VD 1P3PD 5E5AD 5AY8B 5B1MD 1U35A 1M1AC 3AZGD 5FUGB 5B2JD 4Z66C 1P3OD 3W97C 5BNXB 5AY8A 3KUYB 3WA9D 4KGCA 3REHC 1ID3C 5BNXA 3V9RA 3KWQB 3EPHA 4X23D 5DNNC 3W98B 4G92C 3B0CT 1U35C 3KWQA 3REJD 3W98A 5AY8C 2Y2NA 3AN2B 1KX3B 3MGSB 5B40D 3KUYC 3AN2A 3KXBD 1KX3A 5DNMA 3AV2D 3LZ0D 4J8UD 2FJ7A 3KWQC 2RVQC 5BT1D 5GT3D 3W98C 2YFWB 5JRGD 5B33D 2ZY5A 4JJND 3C1CB 3AN2C 1KX3C 1W2EA 3MGSC 1EQZD 3WAAA 3AZNB 1HTAA 3AFAD 1TZYD 3X1TB 3WA9B 4H9SC 3MGQD 2G5HC 3VH6W 3X1TA 3C1CC 1S32D 1F66A 1HQ3A 5AV9B 3AZMD 2F8NG 2NZDB 3A6NA 4J8WA 3AZNC 5B40B 3X1TC 1B67A 1P3AB 3R45B 3WA9C 3AZKB 1TAFB 1KX4A 2F2AC 1P3MD 2Y2QA 3AV1D 3REIA 5AV9C 1WWIA 2ZY4A 1KX5B 1M19D 2NZDC 4XZQD 4WNNA 5AVBB 5B40C 1P3AC 3AZKC 5AVBA 3NQJB 4QLCB 1P3ID 3X1SB 1WWSA 1M18A 2Y2IA 4YS3D 1KX5C 3NQUA 1M1AD 4Z66D 2NQBB 3W97D 3UT9A 5B31B 5AVBC 3REHD 1ID3D 5BO0B 4QLCC 5DNND 3X1SC 4UUZB 3W96B 1U35D 3MNNB 4NE5A 4UUZA 5AY8D 3MGPB 2NQBC 5B31C 3KUYD 5F99A 3MGPA 2J8PA 1P3BA 5GT0B 4YM6B 3KWQD 3EPJA 2RVQD 5GXQB 3W98D 3W96C 3MVDB 3A1IA 3MNNC 2DQNC 4ZBJB 1P3FA 3MVDA 3AN2D 2G5IC 3MGPC 1KX3D 1BH8B 3B6FB 3AYWA 3MGSD 5AV8A 3LELA 4Z2MG 4H9RB 1BH8A 2VQRA 3B6FA 5GT0C 4YM6C 5B24B 4H9RA 3X1UB 5GXQC 3LZ1B 3MVDC 3RELB 3B6GA 3C1BB 1B6WA 4ZBJC 3C1CD 3C1BA 3B6FC 5B1LA 4CSRA 5B2IA 4KUDB 5BS7C 4KGCB 3X1UC 3AZND 5B24C 1P3LA 4KUDA 3V9RB 1A7WA 3X1TD 3WKJB 3LZ1C 2Y2OA 4ZUXA 3RELC 1HQ3D 5KDMA 4Z2MH 3WKJA 1N1JA 2HIOA 3FDDA 2F8NK 5AV9D 4J8WD 5AV6B 2PYOA 4KUDC 2DF4C 4KGCC 2NZDD 5DNMB 5AV6A 1KX4D 2FJ7B 1P3AD 3WKJC 3AZKD 3MGRA 3AZFB 4LD9B 3F6TA 3REID 4DQYB 4WV4B 3AZFA 4LD9A 2Y2JA 1KX5D 5AV6C 2JSSA 1Z2CB 5DNMC 3KFUG 3LJAA 3WAAB 5AVBD 2FJ7C 1H3OA 3AZFC 5AV5A 4QLCD 4G91B 4LD9C 3X1SD 1T3UA 1F66B 1HQ3B 2LY8A 2NQBD 5B31D 3WAAC 2UWXA 3A6NB 4J8WB 4WZSB 1ZLAA 3O62B 4G91C 1KX4B 3O62A 3W96D 3REKB 2FFFB 3MNND 3VH6A 5BNVA 1F66C 1HQ3C 4DRAA 3REIB 3REKA 3MGPD 1P3PA 4WU8B 4UPKA 3AZFD 3AZGA 2Y2PA 4AWLB 1P34B 1P3OA 3A6NC 4J8WC 4WNNB 4WU8A 3O62C 3VH5W 4YM6D 5GT0D 1P34A 5GXQD 1KX4C 4M6BA 1P3FD 4WJ3C 3MVDD 4X23A 3REKC 1M18B 4KHAB 5G49A 5B31G 3TU4B 5AV8D 4H9PA 3REIC 3NQUB 3REJA 5AVCB 3B6FD 4WU8C 2HUEB 4KHAA 3TU4A 4AWLC 1P34C 3UT9B 3B0BA 5AVCA 4J8XB 2F8NB 3EPKA 4H9OB 5B0YB 3X1UD 5B24D 3LZ0A 4J8XA 2F8NA 4H9OA 2Y2LA 5B0YA 3LZ1D 3B0CW 3RELD 5B0ZB 5JRGA 1M18C 3C1BD 3TU4C 5B2ID 5B0ZA 5AVCC 2HUEC 3UT9C 4KUDD 2CWEA 4J8XC 3X1VA 1EQZA 5F99B 4KGCD 5B0YC 1P3BB 1ULYA 3WKJD 3AZIA 5B0ZC 1TZYA 3UTAB 1PZRA 1F1EA 2RIQA 3UTAA 1P3FB 1S32A 5CPKB 3AZEB 4CAYA 5AV6D 3AYWB 5AV8B 3LELB 5F99C 5CPJB 5CPKA 4NFTA 3MGRD 3AZEA 5DNMD 1P3BC 2FJ7D 5CPJA 3UTAC 4LD9D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BYK A;  3B6G B;  5CP6 B;  1P3F C;  3VH6 T;  5CPK C;  3AZE C;  1P3M A;  5B1L B;  5CP6 A;  3AYW C;  4CSR B;  5AV8 C;  3LEL C;  5CPJ C;  5B2I B;  2CV5 B;  4R8P B;  1BFM A;  3AZL A;  3WAA D;  4H9Q B;  1M19 A;  2CV5 A;  1P3L B;  1P3G B;  4R8P A;  4H9Q A;  4ZUX B;  3B6G C;  1P3G A;  5CP6 C;  5KDM B;  1N1J B;  2HIO B;  4YS3 A;  1F66 D;  3C1B C;  5B1L C;  5B2I C;  2CV5 C;  2PYO B;  4Z5T B;  4R8P C;  4Z66 A;  5JA4 A;  3W97 A;  3A6N D;  5GSU B;  4XUJ B;  1BH9 B;  1P3L C;  4Z5T A;  1P3G C;  3O62 D;  1ID3 A;  4ZUX C;  5GSU A;  4XUJ A;  3MGR B;  1BH9 A;  5CPI B;  3REK D;  5DNN A;  2HIO C;  5B32 B;  5CPI A;  4WU9 B;  2PYO C;  4Z5T C;  4WU8 D;  5FUG A;  5B32 A;  1P34 D;  1AOI B;  5GSU C;  4XUJ C;  3AZH B;  3LJA B;  3KUY A;  4WU9 A;  1H3O B;  1AOI A;  3MGR C;  3AZH A;  5AV5 B;  3W99 B;  5CPI C;  3WTP B;  1M18 D;  2L5A A;  3TU4 D;  3W99 A;  5B32 C;  3WTP A;  5AVC D;  4WU9 C;  1AOI C;  3UT9 D;  4J8X D;  3AZH C;  3MGS A;  3LJA C;  2F8N D;  5B0Y D;  1ZLA B;  2ARO B;  5AV5 C;  4E44 A;  3W99 C;  4H9N B;  3UTB B;  2YFW A;  5B0Z D;  3WTP C;  2ARO A;  4H9S A;  4H9N A;  3UTB A;  1P3K B;  4NE6 A;  5BNV B;  3AZJ B;  3X1V D;  3C1C A;  4J8V B;  1P3P B;  5E5A B;  1P3K A;  5B1M B;  3AZJ A;  3AZG B;  5B2J B;  5F99 D;  1P3O B;  4J8V A;  4HGA B;  5E5A A;  3AZI D;  5B1M A;  1P3B D;  1ZLA C;  2ARO C;  2YFV B;  5B2J A;  3AZN A;  3UTB C;  3UTA D;  3WA9 A;  2YFV A;  4X23 B;  1P3K C;  5G49 B;  3AZJ C;  4H9P B;  3B0D B;  4J8V C;  3REJ B;  3AZE D;  5E5A C;  5CPK D;  1P3P C;  5B1M C;  3AYW D;  3AZG C;  5B2J C;  5AV9 A;  3LEL D;  5CPJ D;  1P3O C;  4HGA C;  3KXB B;  3KSY A;  4E45 A;  2NZD A;  3AV2 B;  3LZ0 B;  4J8U B;  5B40 A;  3VH5 A;  1P3A A;  3R45 A;  5GT3 B;  4X23 C;  1TAF A;  3KXB A;  5JRG B;  3AZK A;  3AV2 A;  4J8U A;  3B6G D;  5B33 B;  5CP6 D;  5GT3 A;  3B0D C;  3REJ C;  5B1L D;  4DRB A;  5B33 A;  4JJN B;  3AZL D;  1KX5 A;  2CV5 D;  4R8P D;  3X1V B;  1EQZ B;  4JJN A;  3KXB C;  3AV2 C;  3LZ0 C;  4J8U C;  1P3G D;  1P3L D;  2F8N H;  1KU5 A;  5BT1 C;  5GT3 C;  4ZUX D;  3AFA B;  3AZI B;  5JRG C;  1TZY B;  5B33 C;  3NQJ A;  4QLC A;  3X1S A;  3MGQ B;  3AFA A;  2HIO D;  4JJN C;  1S32 B;  3MGQ A;  4CAY B;  4NE3 A;  5CHL B;  2PYO D;  4Z5T D;  4EO5 B;  3X1V C;  3AZM B;  1EQZ C;  2NQB A;  5GSU D;  4XUJ D;  5B31 A;  3AZM A;  3AFA C;  5BO0 A;  3AZI C;  1TZY C;  2BYK B;  5CPI D;  3MGQ C;  3W96 A;  1S32 C;  5B32 D;  3MNN A;  1JFI B;  1P3M B;  4WU9 D;  3WTP E;  3AV1 B;  4EO5 C;  3AZM C;  1AOI D;  3AZH D;  1JFI A;  3AZL B;  3LJA D;  1M19 B;  3AV1 A;  4XZQ B;  1R4V A;  5GT0 A;  2BYM B;  5AV5 D;  4YM6 A;  3W99 D;  4XZQ A;  5GXQ A;  3WTP D;  5C3I B;  1P3I B;  2BYM A;  1Q9C A;  2IO5 B;  4YS3 B;  1P3M C;  3AV1 C;  1P3I A;  1M1A B;  4Z66 B;  5JA4 B;  3AZL C;  3W97 B;  1M19 C;  4XZQ C;  5BS7 A;  1M1A A;  1ZLA D;  2ARO D;  3REH B;  3X1U A;  1ID3 B;  5B24 A;  3VH5 T;  5B32 G;  3UTB D;  3LZ1 A;  5C3I C;  3REH A;  5DNN B;  1P3I C;  3REL A;  4G92 B;  2IO5 C;  1P3K D;  4YS3 C;  1U35 B;  3AZJ D;  4J8V D;  1P3P D;  5E5A D;  5AY8 B;  5B1M D;  1U35 A;  1M1A C;  3AZG D;  5FUG B;  5B2J D;  4Z66 C;  1P3O D;  3W97 C;  5BNX B;  5AY8 A;  3KUY B;  3WA9 D;  4KGC A;  3REH C;  1ID3 C;  5BNX A;  3V9R A;  3KWQ B;  4X23 D;  5DNN C;  3W98 B;  4G92 C;  3B0C T;  1U35 C;  3KWQ A;  3REJ D;  3W98 A;  5AY8 C;  3AN2 B;  1KX3 B;  3MGS B;  5B40 D;  3KUY C;  3AN2 A;  3KXB D;  1KX3 A;  5DNM A;  3AV2 D;  3LZ0 D;  4J8U D;  2FJ7 A;  3KWQ C;  2RVQ C;  5BT1 D;  5GT3 D;  3W98 C;  2YFW B;  5JRG D;  5B33 D;  4JJN D;  3C1C B;  3AN2 C;  1KX3 C;  3MGS C;  1EQZ D;  3WAA A;  3AZN B;  1HTA A;  3AFA D;  1TZY D;  3X1T B;  3WA9 B;  4H9S C;  3MGQ D;  3VH6 W;  3X1T A;  3C1C C;  1S32 D;  1F66 A;  1HQ3 A;  5AV9 B;  3AZM D;  2F8N G;  2NZD B;  3A6N A;  4J8W A;  3AZN C;  5B40 B;  3X1T C;  1B67 A;  1P3A B;  3R45 B;  3WA9 C;  3AZK B;  1TAF B;  1KX4 A;  1P3M D;  3AV1 D;  3REI A;  5AV9 C;  1WWI A;  1KX5 B;  1M19 D;  2NZD C;  4XZQ D;  4WNN A;  5AVB B;  5B40 C;  1P3A C;  3AZK C;  5AVB A;  3NQJ B;  4QLC B;  1P3I D;  3X1S B;  1WWS A;  1M18 A;  4YS3 D;  1KX5 C;  3NQU A;  1M1A D;  4Z66 D;  2NQB B;  3W97 D;  3UT9 A;  5B31 B;  5AVB C;  3REH D;  1ID3 D;  5BO0 B;  4QLC C;  5DNN D;  3X1S C;  4UUZ B;  3W96 B;  1U35 D;  3MNN B;  4NE5 A;  4UUZ A;  5AY8 D;  3MGP B;  2NQB C;  5B31 C;  3KUY D;  5F99 A;  3MGP A;  1P3B A;  5GT0 B;  4YM6 B;  3KWQ D;  2RVQ D;  5GXQ B;  3W98 D;  3W96 C;  3MVD B;  3MNN C;  4ZBJ B;  1P3F A;  3MVD A;  3AN2 D;  1KX3 D;  3MGP C;  1BH8 B;  3B6F B;  3AYW A;  3MGS D;  5AV8 A;  3LEL A;  4Z2M G;  4H9R B;  1BH8 A;  3B6F A;  3X1U B;  5GT0 C;  5B24 B;  4H9R A;  4YM6 C;  5GXQ C;  3LZ1 B;  3MVD C;  3REL B;  3B6G A;  3C1B B;  1B6W A;  4ZBJ C;  3C1C D;  3C1B A;  3B6F C;  5B1L A;  4CSR A;  5B2I A;  4KUD B;  5BS7 C;  4KGC B;  3X1U C;  3AZN D;  5B24 C;  1P3L A;  4KUD A;  3V9R B;  1A7W A;  3X1T D;  3WKJ B;  3LZ1 C;  4ZUX A;  3REL C;  1HQ3 D;  5KDM A;  4Z2M H;  3WKJ A;  1N1J A;  2HIO A;  2F8N K;  5AV9 D;  4J8W D;  5AV6 B;  2PYO A;  4KUD C;  4KGC C;  2NZD D;  5DNM B;  5AV6 A;  1KX4 D;  2FJ7 B;  1P3A D;  3WKJ C;  3AZK D;  3MGR A;  3AZF B;  4LD9 B;  3REI D;  4WV4 B;  3AZF A;  4LD9 A;  1KX5 D;  5AV6 C;  2JSS A;  5DNM C;  3LJA A;  3WAA B;  5AVB D;  2FJ7 C;  1H3O A;  3AZF C;  5AV5 A;  4QLC D;  4G91 B;  4LD9 C;  3X1S D;  1F66 B;  1HQ3 B;  2LY8 A;  2NQB D;  5B31 D;  3WAA C;  3A6N B;  4J8W B;  4WZS B;  1ZLA A;  3O62 B;  4G91 C;  1KX4 B;  3O62 A;  3W96 D;  3REK B;  3MNN D;  3VH6 A;  5BNV A;  1F66 C;  1HQ3 C;  4DRA A;  3REI B;  3REK A;  3MGP D;  1P3P A;  4WU8 B;  3AZF D;  3AZG A;  4AWL B;  1P34 B;  1P3O A;  3A6N C;  4J8W C;  4WNN B;  4WU8 A;  3O62 C;  3VH5 W;  4YM6 D;  5GT0 D;  1P34 A;  5GXQ D;  1KX4 C;  4M6B A;  1P3F D;  3MVD D;  4X23 A;  3REK C;  1M18 B;  4KHA B;  5G49 A;  5B31 G;  3TU4 B;  5AV8 D;  4H9P A;  3REI C;  3NQU B;  3REJ A;  5AVC B;  3B6F D;  4WU8 C;  2HUE B;  4KHA A;  3TU4 A;  4AWL C;  1P34 C;  3UT9 B;  3B0B A;  5AVC A;  4J8X B;  2F8N B;  4H9O B;  5B0Y B;  3X1U D;  5B24 D;  3LZ0 A;  4J8X A;  2F8N A;  4H9O A;  3LZ1 D;  5B0Y A;  3B0C W;  3REL D;  5B0Z B;  5JRG A;  1M18 C;  3C1B D;  3TU4 C;  5B2I D;  5B0Z A;  5AVC C;  2HUE C;  3UT9 C;  4KUD D;  2CWE A;  4J8X C;  3X1V A;  1EQZ A;  5F99 B;  4KGC D;  5B0Y C;  1P3B B;  1ULY A;  3WKJ D;  3AZI A;  5B0Z C;  1TZY A;  3UTA B;  1F1E A;  3UTA A;  1P3F B;  1S32 A;  5CPK B;  3AZE B;  4CAY A;  5AV6 D;  3AYW B;  5AV8 B;  3LEL B;  5F99 C;  5CPJ B;  5CPK A;  4NFT A;  3MGR D;  3AZE A;  5DNM D;  1P3B C;  2FJ7 D;  5CPJ A;  3UTA C;  4LD9 D; 
#chains in the Genus database with same CATH topology
 2BYK A;  3B6G B;  5CP6 B;  1P3F C;  3VH6 T;  5CPK C;  3AZE C;  1P3M A;  5B1L B;  5CP6 A;  3AYW C;  4CSR B;  5AV8 C;  3LEL C;  5CPJ C;  5B2I B;  2CV5 B;  4R8P B;  1BFM A;  3AZL A;  3WAA D;  4H9Q B;  1M19 A;  2ZY2 A;  2CV5 A;  1P3L B;  1P3G B;  4R8P A;  4H9Q A;  4ZUX B;  3B6G C;  1P3G A;  3EG5 B;  5CP6 C;  5KDM B;  1N1J B;  3EPL A;  2HIO B;  4YS3 A;  1F66 D;  3C1B C;  5B1L C;  2Y2H A;  5B2I C;  2CV5 C;  2PYO B;  4Z5T B;  3A1K A;  4R8P C;  4Z66 A;  5JA4 A;  3W97 A;  3A6N D;  5GSU B;  4XUJ B;  1BH9 B;  1P3L C;  4Z5T A;  1P3G C;  3O62 D;  1ID3 A;  4ZUX C;  5GSU A;  4XUJ A;  3MGR B;  1BH9 A;  5CPI B;  3REK D;  5DNN A;  2Y2K A;  2HIO C;  5B32 B;  5CPI A;  4WU9 B;  2PYO C;  4Z5T C;  2Y2M A;  4WU8 D;  3H0L C;  5FUG A;  5B32 A;  1P34 D;  1AOI B;  5GSU C;  4XUJ C;  3AZH B;  3LJA B;  3KUY A;  4WU9 A;  1H3O B;  1AOI A;  3P5J B;  3MGR C;  3AZH A;  2JE5 A;  5AV5 B;  3W99 B;  5CPI C;  3WTP B;  1M18 D;  2L5A A;  3TU4 D;  3W99 A;  5B32 C;  3WTP A;  5AVC D;  4WU9 C;  1AOI C;  3UT9 D;  4J8X D;  3AZH C;  3MGS A;  3LJA C;  2F8N D;  3AL0 C;  5B0Y D;  1ZLA B;  2ARO B;  5AV5 C;  4E44 A;  3W99 C;  4H9N B;  3UTB B;  2YFW A;  5B0Z D;  3WTP C;  2ARO A;  4H9S A;  4H9N A;  3UTB A;  1P3K B;  4NE6 A;  5BNV B;  3AZJ B;  3X1V D;  3C1C A;  4J8V B;  1P3P B;  5E5A B;  1P3K A;  5B1M B;  3AZJ A;  3AZG B;  5B2J B;  5F99 D;  1P3O B;  4J8V A;  4HGA B;  5E5A A;  3AZI D;  5B1M A;  1P3B D;  1ZLA C;  2ARO C;  2YFV B;  5B2J A;  3AZN A;  3UTB C;  2XD5 A;  3UTA D;  3WA9 A;  2YFV A;  4X23 B;  1P3K C;  5G49 B;  3AZJ C;  4H9P B;  3B0D B;  4J8V C;  3REJ B;  3AZE D;  5E5A C;  5CPK D;  1P3P C;  5B1M C;  3AYW D;  3AZG C;  5B2J C;  5AV9 A;  3LEL D;  5CPJ D;  1P3O C;  4HGA C;  2XD1 A;  3KXB B;  3KSY A;  4E45 A;  2NZD A;  3AV2 B;  3LZ0 B;  4J8U B;  5B40 A;  3VH5 A;  1P3A A;  3R45 A;  5GT3 B;  4X23 C;  1TAF A;  3KXB A;  5JRG B;  3AZK A;  3AV2 A;  4J8U A;  3B6G D;  5B33 B;  5CP6 D;  5GT3 A;  3B0D C;  3REJ C;  2Y2G A;  5B1L D;  4DRB A;  5B33 A;  4JJN B;  3AZL D;  1KX5 A;  2CV5 D;  4R8P D;  3X1V B;  2JCH A;  4JJN A;  1EQZ B;  3KXB C;  3AV2 C;  3LZ0 C;  4J8U C;  1P3G D;  1P3L D;  2F8N H;  1KU5 A;  5BT1 C;  5GT3 C;  4ZUX D;  3AFA B;  3AZI B;  5JRG C;  1TZY B;  5B33 C;  3NQJ A;  4QLC A;  3X1S A;  3MGQ B;  3AFA A;  2HIO D;  4JJN C;  1S32 B;  3MGQ A;  4CAY B;  4NE3 A;  5CHL B;  2PYO D;  4Z5T D;  4EO5 B;  3X1V C;  3AZM B;  1EQZ C;  2NQB A;  5GSU D;  4XUJ D;  5B31 A;  3H0M C;  2BG1 A;  3AZM A;  3IP4 C;  3AFA C;  5BO0 A;  3AZI C;  1TZY C;  2BYK B;  5CPI D;  3MGQ C;  3W96 A;  1S32 C;  5B32 D;  3MNN A;  1JFI B;  1P3M B;  4WU9 D;  3WTP E;  3AV1 B;  4EO5 C;  3AZM C;  2W8S A;  1AOI D;  3AZH D;  1JFI A;  2ZY3 A;  3LJA D;  3AZL B;  1M19 B;  3AV1 A;  4XZQ B;  1R4V A;  5GT0 A;  2BYM B;  5AV5 D;  4YM6 A;  3W99 D;  4XZQ A;  5GXQ A;  3WTP D;  3H0R C;  5C3I B;  1P3I B;  2BYM A;  1Q9C A;  2IO5 B;  4YS3 B;  1P3M C;  3AV1 C;  1P3I A;  1M1A B;  4Z66 B;  5JA4 B;  3AZL C;  3W97 B;  1M19 C;  2ZM5 A;  4XZQ C;  5BS7 A;  1M1A A;  1ZLA D;  2ARO D;  3REH B;  3X1U A;  1ID3 B;  5B24 A;  3VH5 T;  5B32 G;  3UTB D;  3LZ1 A;  5C3I C;  3REH A;  5DNN B;  1P3I C;  3REL A;  4G92 B;  2IO5 C;  1P3K D;  4YS3 C;  1U35 B;  3AZJ D;  4J8V D;  1P3P D;  5E5A D;  5AY8 B;  5B1M D;  1U35 A;  1M1A C;  3AZG D;  5FUG B;  5B2J D;  4Z66 C;  1P3O D;  3W97 C;  5BNX B;  5AY8 A;  3KUY B;  3WA9 D;  4KGC A;  3REH C;  1ID3 C;  5BNX A;  3V9R A;  3KWQ B;  3EPH A;  4X23 D;  5DNN C;  3W98 B;  4G92 C;  3B0C T;  1U35 C;  3KWQ A;  3REJ D;  3W98 A;  5AY8 C;  2Y2N A;  3AN2 B;  1KX3 B;  3MGS B;  5B40 D;  3KUY C;  3AN2 A;  3KXB D;  1KX3 A;  5DNM A;  3AV2 D;  3LZ0 D;  4J8U D;  2FJ7 A;  3KWQ C;  2RVQ C;  5BT1 D;  5GT3 D;  3W98 C;  2YFW B;  5JRG D;  5B33 D;  2ZY5 A;  4JJN D;  3C1C B;  3AN2 C;  1KX3 C;  1W2E A;  3MGS C;  1EQZ D;  3WAA A;  3AZN B;  1HTA A;  3AFA D;  1TZY D;  3X1T B;  3WA9 B;  4H9S C;  3MGQ D;  2G5H C;  3VH6 W;  3X1T A;  3C1C C;  1S32 D;  1F66 A;  1HQ3 A;  5AV9 B;  3AZM D;  2F8N G;  2NZD B;  3A6N A;  4J8W A;  3AZN C;  5B40 B;  3X1T C;  1B67 A;  1P3A B;  3R45 B;  3WA9 C;  3AZK B;  1TAF B;  1KX4 A;  2F2A C;  1P3M D;  2Y2Q A;  3AV1 D;  3REI A;  5AV9 C;  1WWI A;  2ZY4 A;  1KX5 B;  1M19 D;  2NZD C;  4XZQ D;  4WNN A;  5AVB B;  5B40 C;  1P3A C;  3AZK C;  5AVB A;  3NQJ B;  4QLC B;  1P3I D;  3X1S B;  1WWS A;  1M18 A;  2Y2I A;  4YS3 D;  1KX5 C;  3NQU A;  1M1A D;  4Z66 D;  2NQB B;  3W97 D;  3UT9 A;  5B31 B;  5AVB C;  3REH D;  1ID3 D;  5BO0 B;  4QLC C;  5DNN D;  3X1S C;  4UUZ B;  3W96 B;  1U35 D;  3MNN B;  4NE5 A;  4UUZ A;  5AY8 D;  3MGP B;  2NQB C;  5B31 C;  3KUY D;  5F99 A;  3MGP A;  2J8P A;  1P3B A;  5GT0 B;  4YM6 B;  3KWQ D;  3EPJ A;  2RVQ D;  5GXQ B;  3W98 D;  3W96 C;  3MVD B;  3A1I A;  3MNN C;  2DQN C;  4ZBJ B;  1P3F A;  3MVD A;  3AN2 D;  2G5I C;  3MGP C;  1KX3 D;  1BH8 B;  3B6F B;  3AYW A;  3MGS D;  5AV8 A;  3LEL A;  4Z2M G;  4H9R B;  1BH8 A;  2VQR A;  3B6F A;  5GT0 C;  4YM6 C;  5B24 B;  4H9R A;  3X1U B;  5GXQ C;  3LZ1 B;  3MVD C;  3REL B;  3B6G A;  3C1B B;  1B6W A;  4ZBJ C;  3C1C D;  3C1B A;  3B6F C;  5B1L A;  4CSR A;  5B2I A;  4KUD B;  5BS7 C;  4KGC B;  3X1U C;  3AZN D;  5B24 C;  1P3L A;  4KUD A;  3V9R B;  1A7W A;  3X1T D;  3WKJ B;  3LZ1 C;  2Y2O A;  4ZUX A;  3REL C;  1HQ3 D;  5KDM A;  4Z2M H;  3WKJ A;  1N1J A;  2HIO A;  3FDD A;  2F8N K;  5AV9 D;  4J8W D;  5AV6 B;  2PYO A;  4KUD C;  2DF4 C;  4KGC C;  2NZD D;  5DNM B;  5AV6 A;  1KX4 D;  2FJ7 B;  1P3A D;  3WKJ C;  3AZK D;  3MGR A;  3AZF B;  4LD9 B;  3F6T A;  3REI D;  4DQY B;  4WV4 B;  3AZF A;  4LD9 A;  2Y2J A;  1KX5 D;  5AV6 C;  2JSS A;  1Z2C B;  5DNM C;  3KFU G;  3LJA A;  3WAA B;  5AVB D;  2FJ7 C;  1H3O A;  3AZF C;  5AV5 A;  4QLC D;  4G91 B;  4LD9 C;  3X1S D;  1T3U A;  1F66 B;  1HQ3 B;  2LY8 A;  2NQB D;  5B31 D;  3WAA C;  2UWX A;  3A6N B;  4J8W B;  4WZS B;  1ZLA A;  3O62 B;  4G91 C;  1KX4 B;  3O62 A;  3W96 D;  3REK B;  2FFF B;  3MNN D;  3VH6 A;  5BNV A;  1F66 C;  1HQ3 C;  4DRA A;  3REI B;  3REK A;  3MGP D;  1P3P A;  4WU8 B;  4UPK A;  3AZF D;  3AZG A;  2Y2P A;  4AWL B;  1P34 B;  1P3O A;  3A6N C;  4J8W C;  4WNN B;  4WU8 A;  3O62 C;  3VH5 W;  4YM6 D;  5GT0 D;  1P34 A;  5GXQ D;  1KX4 C;  4M6B A;  1P3F D;  4WJ3 C;  3MVD D;  4X23 A;  3REK C;  1M18 B;  4KHA B;  5G49 A;  5B31 G;  3TU4 B;  5AV8 D;  4H9P A;  3REI C;  3NQU B;  3REJ A;  5AVC B;  3B6F D;  4WU8 C;  2HUE B;  4KHA A;  3TU4 A;  4AWL C;  1P34 C;  3UT9 B;  3B0B A;  5AVC A;  4J8X B;  2F8N B;  3EPK A;  4H9O B;  5B0Y B;  3X1U D;  5B24 D;  3LZ0 A;  4J8X A;  2F8N A;  4H9O A;  2Y2L A;  5B0Y A;  3LZ1 D;  3B0C W;  3REL D;  5B0Z B;  5JRG A;  1M18 C;  3C1B D;  3TU4 C;  5B2I D;  5B0Z A;  5AVC C;  2HUE C;  3UT9 C;  4KUD D;  2CWE A;  4J8X C;  3X1V A;  1EQZ A;  5F99 B;  4KGC D;  5B0Y C;  1P3B B;  1ULY A;  3WKJ D;  3AZI A;  5B0Z C;  1TZY A;  3UTA B;  1PZR A;  1F1E A;  2RIQ A;  3UTA A;  1P3F B;  1S32 A;  5CPK B;  3AZE B;  4CAY A;  5AV6 D;  3AYW B;  5AV8 B;  3LEL B;  5F99 C;  5CPJ B;  5CPK A;  4NFT A;  3MGR D;  3AZE A;  5DNM D;  1P3B C;  2FJ7 D;  5CPJ A;  3UTA C;  4LD9 D; 
#chains in the Genus database with same CATH homology
 2BYK A;  3B6G B;  5CP6 B;  1P3F C;  3VH6 T;  5CPK C;  3AZE C;  1P3M A;  5B1L B;  5CP6 A;  3AYW C;  4CSR B;  5AV8 C;  3LEL C;  5CPJ C;  5B2I B;  2CV5 B;  4R8P B;  1BFM A;  3AZL A;  3WAA D;  4H9Q B;  1M19 A;  2ZY2 A;  2CV5 A;  1P3L B;  1P3G B;  4R8P A;  4H9Q A;  4ZUX B;  3B6G C;  1P3G A;  3EG5 B;  5CP6 C;  5KDM B;  1N1J B;  3EPL A;  2HIO B;  4YS3 A;  1F66 D;  3C1B C;  5B1L C;  2Y2H A;  5B2I C;  2CV5 C;  2PYO B;  4Z5T B;  3A1K A;  4R8P C;  4Z66 A;  5JA4 A;  3W97 A;  3A6N D;  5GSU B;  4XUJ B;  1BH9 B;  1P3L C;  4Z5T A;  1P3G C;  3O62 D;  1ID3 A;  4ZUX C;  5GSU A;  4XUJ A;  3MGR B;  1BH9 A;  5CPI B;  3REK D;  5DNN A;  2Y2K A;  2HIO C;  5B32 B;  5CPI A;  4WU9 B;  2PYO C;  4Z5T C;  2Y2M A;  4WU8 D;  3H0L C;  5FUG A;  5B32 A;  1P34 D;  1AOI B;  5GSU C;  4XUJ C;  3AZH B;  3LJA B;  3KUY A;  4WU9 A;  1H3O B;  1AOI A;  3P5J B;  3MGR C;  3AZH A;  2JE5 A;  5AV5 B;  3W99 B;  5CPI C;  3WTP B;  1M18 D;  2L5A A;  3TU4 D;  3W99 A;  5B32 C;  3WTP A;  5AVC D;  4WU9 C;  1AOI C;  3UT9 D;  4J8X D;  3AZH C;  3MGS A;  3LJA C;  2F8N D;  3AL0 C;  5B0Y D;  1ZLA B;  2ARO B;  5AV5 C;  4E44 A;  3W99 C;  4H9N B;  3UTB B;  2YFW A;  5B0Z D;  3WTP C;  2ARO A;  4H9S A;  4H9N A;  3UTB A;  1P3K B;  4NE6 A;  5BNV B;  3AZJ B;  3X1V D;  3C1C A;  4J8V B;  1P3P B;  5E5A B;  1P3K A;  5B1M B;  3AZJ A;  3AZG B;  5B2J B;  5F99 D;  1P3O B;  4J8V A;  4HGA B;  5E5A A;  3AZI D;  5B1M A;  1P3B D;  1ZLA C;  2ARO C;  2YFV B;  5B2J A;  3AZN A;  3UTB C;  2XD5 A;  3UTA D;  3WA9 A;  2YFV A;  4X23 B;  1P3K C;  5G49 B;  3AZJ C;  4H9P B;  3B0D B;  4J8V C;  3REJ B;  3AZE D;  5E5A C;  5CPK D;  1P3P C;  5B1M C;  3AYW D;  3AZG C;  5B2J C;  5AV9 A;  3LEL D;  5CPJ D;  1P3O C;  4HGA C;  2XD1 A;  3KXB B;  3KSY A;  4E45 A;  2NZD A;  3AV2 B;  3LZ0 B;  4J8U B;  5B40 A;  3VH5 A;  1P3A A;  3R45 A;  5GT3 B;  4X23 C;  1TAF A;  3KXB A;  5JRG B;  3AZK A;  3AV2 A;  4J8U A;  3B6G D;  5B33 B;  5CP6 D;  5GT3 A;  3B0D C;  3REJ C;  2Y2G A;  5B1L D;  4DRB A;  5B33 A;  4JJN B;  3AZL D;  1KX5 A;  2CV5 D;  4R8P D;  3X1V B;  2JCH A;  4JJN A;  1EQZ B;  3KXB C;  3AV2 C;  3LZ0 C;  4J8U C;  1P3G D;  1P3L D;  2F8N H;  1KU5 A;  5BT1 C;  5GT3 C;  4ZUX D;  3AFA B;  3AZI B;  5JRG C;  1TZY B;  5B33 C;  3NQJ A;  4QLC A;  3X1S A;  3MGQ B;  3AFA A;  2HIO D;  4JJN C;  1S32 B;  3MGQ A;  4CAY B;  4NE3 A;  5CHL B;  2PYO D;  4Z5T D;  4EO5 B;  3X1V C;  3AZM B;  1EQZ C;  2NQB A;  5GSU D;  4XUJ D;  5B31 A;  3H0M C;  2BG1 A;  3AZM A;  3IP4 C;  3AFA C;  5BO0 A;  3AZI C;  1TZY C;  2BYK B;  5CPI D;  3MGQ C;  3W96 A;  1S32 C;  5B32 D;  3MNN A;  1JFI B;  1P3M B;  4WU9 D;  3WTP E;  3AV1 B;  4EO5 C;  3AZM C;  2W8S A;  1AOI D;  3AZH D;  1JFI A;  2ZY3 A;  3LJA D;  3AZL B;  1M19 B;  3AV1 A;  4XZQ B;  1R4V A;  5GT0 A;  2BYM B;  5AV5 D;  4YM6 A;  3W99 D;  4XZQ A;  5GXQ A;  3WTP D;  3H0R C;  5C3I B;  1P3I B;  2BYM A;  1Q9C A;  2IO5 B;  4YS3 B;  1P3M C;  3AV1 C;  1P3I A;  1M1A B;  4Z66 B;  5JA4 B;  3AZL C;  3W97 B;  1M19 C;  2ZM5 A;  4XZQ C;  5BS7 A;  1M1A A;  1ZLA D;  2ARO D;  3REH B;  3X1U A;  1ID3 B;  5B24 A;  3VH5 T;  5B32 G;  3UTB D;  3LZ1 A;  5C3I C;  3REH A;  5DNN B;  1P3I C;  3REL A;  4G92 B;  2IO5 C;  1P3K D;  4YS3 C;  1U35 B;  3AZJ D;  4J8V D;  1P3P D;  5E5A D;  5AY8 B;  5B1M D;  1U35 A;  1M1A C;  3AZG D;  5FUG B;  5B2J D;  4Z66 C;  1P3O D;  3W97 C;  5BNX B;  5AY8 A;  3KUY B;  3WA9 D;  4KGC A;  3REH C;  1ID3 C;  5BNX A;  3V9R A;  3KWQ B;  3EPH A;  4X23 D;  5DNN C;  3W98 B;  4G92 C;  3B0C T;  1U35 C;  3KWQ A;  3REJ D;  3W98 A;  5AY8 C;  2Y2N A;  3AN2 B;  1KX3 B;  3MGS B;  5B40 D;  3KUY C;  3AN2 A;  3KXB D;  1KX3 A;  5DNM A;  3AV2 D;  3LZ0 D;  4J8U D;  2FJ7 A;  3KWQ C;  2RVQ C;  5BT1 D;  5GT3 D;  3W98 C;  2YFW B;  5JRG D;  5B33 D;  2ZY5 A;  4JJN D;  3C1C B;  3AN2 C;  1KX3 C;  1W2E A;  3MGS C;  1EQZ D;  3WAA A;  3AZN B;  1HTA A;  3AFA D;  1TZY D;  3X1T B;  3WA9 B;  4H9S C;  3MGQ D;  2G5H C;  3VH6 W;  3X1T A;  3C1C C;  1S32 D;  1F66 A;  1HQ3 A;  5AV9 B;  3AZM D;  2F8N G;  2NZD B;  3A6N A;  4J8W A;  3AZN C;  5B40 B;  3X1T C;  1B67 A;  1P3A B;  3R45 B;  3WA9 C;  3AZK B;  1TAF B;  1KX4 A;  2F2A C;  1P3M D;  2Y2Q A;  3AV1 D;  3REI A;  5AV9 C;  1WWI A;  2ZY4 A;  1KX5 B;  1M19 D;  2NZD C;  4XZQ D;  4WNN A;  5AVB B;  5B40 C;  1P3A C;  3AZK C;  5AVB A;  3NQJ B;  4QLC B;  1P3I D;  3X1S B;  1WWS A;  1M18 A;  2Y2I A;  4YS3 D;  1KX5 C;  3NQU A;  1M1A D;  4Z66 D;  2NQB B;  3W97 D;  3UT9 A;  5B31 B;  5AVB C;  3REH D;  1ID3 D;  5BO0 B;  4QLC C;  5DNN D;  3X1S C;  4UUZ B;  3W96 B;  1U35 D;  3MNN B;  4NE5 A;  4UUZ A;  5AY8 D;  3MGP B;  2NQB C;  5B31 C;  3KUY D;  5F99 A;  3MGP A;  2J8P A;  1P3B A;  5GT0 B;  4YM6 B;  3KWQ D;  3EPJ A;  2RVQ D;  5GXQ B;  3W98 D;  3W96 C;  3MVD B;  3A1I A;  3MNN C;  2DQN C;  4ZBJ B;  1P3F A;  3MVD A;  3AN2 D;  2G5I C;  3MGP C;  1KX3 D;  1BH8 B;  3B6F B;  3AYW A;  3MGS D;  5AV8 A;  3LEL A;  4Z2M G;  4H9R B;  1BH8 A;  2VQR A;  3B6F A;  5GT0 C;  4YM6 C;  5B24 B;  4H9R A;  3X1U B;  5GXQ C;  3LZ1 B;  3MVD C;  3REL B;  3B6G A;  3C1B B;  1B6W A;  4ZBJ C;  3C1C D;  3C1B A;  3B6F C;  5B1L A;  4CSR A;  5B2I A;  4KUD B;  5BS7 C;  4KGC B;  3X1U C;  3AZN D;  5B24 C;  1P3L A;  4KUD A;  3V9R B;  1A7W A;  3X1T D;  3WKJ B;  3LZ1 C;  2Y2O A;  4ZUX A;  3REL C;  1HQ3 D;  5KDM A;  4Z2M H;  3WKJ A;  1N1J A;  2HIO A;  3FDD A;  2F8N K;  5AV9 D;  4J8W D;  5AV6 B;  2PYO A;  4KUD C;  2DF4 C;  4KGC C;  2NZD D;  5DNM B;  5AV6 A;  1KX4 D;  2FJ7 B;  1P3A D;  3WKJ C;  3AZK D;  3MGR A;  3AZF B;  4LD9 B;  3F6T A;  3REI D;  4DQY B;  4WV4 B;  3AZF A;  4LD9 A;  2Y2J A;  1KX5 D;  5AV6 C;  2JSS A;  1Z2C B;  5DNM C;  3KFU G;  3LJA A;  3WAA B;  5AVB D;  2FJ7 C;  1H3O A;  3AZF C;  5AV5 A;  4QLC D;  4G91 B;  4LD9 C;  3X1S D;  1T3U A;  1F66 B;  1HQ3 B;  2LY8 A;  2NQB D;  5B31 D;  3WAA C;  2UWX A;  3A6N B;  4J8W B;  4WZS B;  1ZLA A;  3O62 B;  4G91 C;  1KX4 B;  3O62 A;  3W96 D;  3REK B;  2FFF B;  3MNN D;  3VH6 A;  5BNV A;  1F66 C;  1HQ3 C;  4DRA A;  3REI B;  3REK A;  3MGP D;  1P3P A;  4WU8 B;  4UPK A;  3AZF D;  3AZG A;  2Y2P A;  4AWL B;  1P34 B;  1P3O A;  3A6N C;  4J8W C;  4WNN B;  4WU8 A;  3O62 C;  3VH5 W;  4YM6 D;  5GT0 D;  1P34 A;  5GXQ D;  1KX4 C;  4M6B A;  1P3F D;  4WJ3 C;  3MVD D;  4X23 A;  3REK C;  1M18 B;  4KHA B;  5G49 A;  5B31 G;  3TU4 B;  5AV8 D;  4H9P A;  3REI C;  3NQU B;  3REJ A;  5AVC B;  3B6F D;  4WU8 C;  2HUE B;  4KHA A;  3TU4 A;  4AWL C;  1P34 C;  3UT9 B;  3B0B A;  5AVC A;  4J8X B;  2F8N B;  3EPK A;  4H9O B;  5B0Y B;  3X1U D;  5B24 D;  3LZ0 A;  4J8X A;  2F8N A;  4H9O A;  2Y2L A;  5B0Y A;  3LZ1 D;  3B0C W;  3REL D;  5B0Z B;  5JRG A;  1M18 C;  3C1B D;  3TU4 C;  5B2I D;  5B0Z A;  5AVC C;  2HUE C;  3UT9 C;  4KUD D;  2CWE A;  4J8X C;  3X1V A;  1EQZ A;  5F99 B;  4KGC D;  5B0Y C;  1P3B B;  1ULY A;  3WKJ D;  3AZI A;  5B0Z C;  1TZY A;  3UTA B;  1PZR A;  1F1E A;  2RIQ A;  3UTA A;  1P3F B;  1S32 A;  5CPK B;  3AZE B;  4CAY A;  5AV6 D;  3AYW B;  5AV8 B;  3LEL B;  5F99 C;  5CPJ B;  5CPK A;  4NFT A;  3MGR D;  3AZE A;  5DNM D;  1P3B C;  2FJ7 D;  5CPJ A;  3UTA C;  4LD9 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...