5GTIZ

Native xfel structure of photosystem ii (two flash dataset)
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
62
structure length
62
Chain Sequence
MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLNFFVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem II D1 protein
publication title Light-induced structural changes and the site of O=O bond formation in PSII caught by XFEL.
pubmed doi rcsb
molecule tags Photosynthesis
total genus 23
structure length 62
sequence length 62
chains with identical sequence z
ec nomenclature
pdb deposition date 2016-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01737 Ycf9 YCF9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.740 Mainly Alpha Orthogonal Bundle Helix Hairpins Photosystem II PsbZ, reaction centre 5gtiZ00
5B5EZ 5B66Z 4UB6Z 2AXTZ 5GTHZ 1S5LZ 5GTIZ 4IL6Z 3KZIZ 5KAIZ 3WU2Z 5E79Z 5TISZ 4UB8Z 3A0HZ 3JCUZ 5H2FZ 4PJ0Z 5KAFZ 3A0BZ
chains in the Genus database with same CATH superfamily
2WSSG 1SKVA 4RQEA 4O4HA 2FB5A 2UXDB 1VARA 3R66A 4YY3O 4B3MB 2P22C 5LHGA 5J2UB 4X88A 3W7SA 3SPHA 2O57A 2WLJA 3BCCH 3NXSA 5J2TA 3CJHA 3QNEA 4O4JB 4WCEV 2X7RB 5KAFZ 3JAMN 1JFFB 3OEEG 3W7UA 2YI9A 1IURA 3QF7A 4MS2A 5AG2A 3N27A 2ADPA 3TJTA 1SESA 3KKYA 2FYUH 1N36O 3H1IH 2ZQMA 4WBNA 4FM2A 3PJSK 2P7TC 1EN4A 5J9PC 4F6RB 2WWWA 2HVKC 3G6EV 3UM7A 1F7YA 2A06H 3JASB 2LFSA 3BRCA 4PDLA 2Y0IA 1K4DC 5CB4A 1MSDA 3H1LH 5JH7A 4FZ1A 2Q6AA 3KG2A 4O4JA 1GH6A 2PYJA 2ETNA 1QLEC 1OHHG 1YTFB 3MDSA 1BS3A 5LXTB 3B8MA 3T1CA 4JAAA 2BSKB 2VWKA 3ABKB 3HB3B 4BIUA 3MD0A 1BL8A 1K92A 2DYSC 4X64B 4YHHB 4O4LA 2KSDA 2Z3YA 3T4ZA 4JI6B 1KKDA 4BW5A 5LBQA 2JRIA 3LSSA 4CC5A 2EIKB 1VQ5V 3JASA 2P90A 5JWPA 2X6AA 3ZMTA 3THOA 2AHZA 5IDJA 1FFXB 1OCRB 4DR4O 1D2DA 5LYJA 1QBZA 2DQ0A 3BA8A 1XOUA 4KHPB 4BW9A 5CBFA 1SQFA 5LXTA 3SPJA 3HKCA 3K08A 3WG7C 1FXKC 1NH2D 2ZIOA 1VF6A 4DR3O 1KQSU 1XNRB 5JQGB 1XREA 2XAHA 1EZJA 1Y76B 2A7WA 4B3SO 1KP2A 2LJ2A 1IX9A 2QKSA 3T1HO 2WA3A 3DXRB 4DV1B 4DR6B 4OPAA 5L3GA 1SZTA 3AG1B 5L3BA 4I0XA 2HR3A 4UVBA 2VRZA 5CMUA 2F66C 5JCOC 2HVJC 4JI2B 4OGQB 3W7WA 1VQNV 2AW9A 4LF7B 1P84F 1SQVH 4DV4O 1L1FA 5KHIA 4K35A 3RT3C 2LW7A 1JX9A 1VQ4V 5A9GA 2WLLA 1KYOF 5D5QA 3ABUA 2YI8A 3BPZA 5JQGA 1YIJV 4B7KA 3CCUV 4MVUA 4TV8A 4PDVA 5KLVH 2GUZA 3SYAA 3IGAC 4KP4A 4JYYA 1I08A 1KP3A 3X2QB 4LNUB 4B7EA 2UUAO 1JJOA 2E74B 4JV5B 5EYPB 2WLKA 2EIMB 4NXNO 3UQ8A 4TT3G 1I94B 1SRYA 1TAEA 4H33A 4U7OA 2UXCO 1H2MA 2ZM6B 3ABKC 4DK1A 1R6NA 5LMUB 2P6JA 1IDSA 2RN9A 1AVMA 5BMVB 4FIPC 5C93A 4MT8A 4XDJA 4FLWA 1LR1A 1SC5B 1HWYA 1I5YA 1Q43A 1GO3F 2YXYA 4B3RO 1OCRC 1QU7A 1HP8A 2HP8A 5EIBD 2OCCB 4J7KA 4R7CA 4MVSA 3M99B 2R72A 2Q0AA 3B09A 4YJ3A 2IU3A 5EC1C 3OMAB 5CA1A 3F5WC 1XDCA 1Y66A 4ABMA 5IYCO 1WP7A 4TUYB 1VQMV 1AI7A 4FJCC 3LUTB 1VQ6V 5B1BB 3CRCA 4HNAA 2WLHA 1JOYA 3ZX6A 2Q7GA 4DRXB 1IBKB 4AHCA 2DN9A 3ZHQA 1QR8A 3AG1C 2ZIMA 5IYBO 1BHAA 2V4DA 3ZMSA 4LC1A 3SPGA 4GCZA 2Q9LA 5BY1A 1TGOA 4DV2B 4NTXA 3PN1A 3JATA 4UVCA 4FLVA 4YXWG 2IH3C 3RFRA 3CC4V 2BTOA 2Y0PA 1W59A 2B1GA 4TUYA 4LFBO 2HLDG 2K1EA 4AILC 2AZ2A 2DYRB 4ZKIA 4LFAB 1DK1A 4JZ2A 4CC6A 1QVFU 1WP8A 1KD1W 3CCEV 4LF5B 5IY5B 2JGDB 4KFMA 3SJBC 4JI5O 2FMLA 1HR0O 4ZOLA 3X2QC 2EINB 1Z2GA 4H44B 3FFQA 1HNWO 3F7YC 2CGNA 2EIMC 3FD9A 4JAUA 4X1YB 5EZYB 1MZEA 2JEUA 2PYLA 1VF7A 1OCOC 2G38A 3ASNB 2LP7A 3JSLA 4K8XA 3SYPA 3C90A 4X62B 1OCCC 4R8CA 5B3SC 4DW0A 3CEIA 1XMQB 3QVNA 1JCHA 1Q86W 3CCQV 3OTOB 3H1JH 1NQTA 4KL1A 4DUZB 2YC0A 3HKDB 1RSOB 5IJ0A 5BR8B 1JJ2U 4J42A 4FM0A 4PA9A 2YUAA 3HKBA 2IJJA 3ASOB 1Y74A 5LMNO 3K5OA 2ZR2A 4I4TB 1Q8IA 3WB0A 3IC7A 3K5LA 3SYQA 2Q69A 5KA6A 2OCCC 1SQPH 2YIDA 5KHKA 4JI7O 2VQFO 5GONA 4X1YA 2P67A 2RMKB 2UXXA 3DSQA 4HBNA 3RYHB 3I55V 4O2BA 3ZMZA 2QJ1A 4JI8O 4JZGA 1KC8W 2N05A 1K34A 2Y4UA 4XDLA 4UB6Z 2LQTA 3CP1A 4Q20A 4EEQA 3CX5F 4DV7B 3CS5A 2KKWA 4LWSA 3D3IA 3OUFA 1PNMA 2IJHA 3SJAC 4I55B 3SYCA 5CA3A 1YJNV 2Q0OC 3ZHTA 3H01A 1K33A 4I50B 4QIWF 3RVYA 1VQKV 1GN4A 4DXWA 3K5NA 1GM7A 1ZAUA 2XAGA 3S3XA 3K5MA 2CAZC 1ROPA 2DYRC 2EX3A 4GX2A 3VBBA 1MG1A 1VIBA 2R9AA 1R3IC 2RDCA 4X1KA 5IY5C 1H2LA 4J9ZB 3RYIB 4OX9O 3UT5A 3RGBA 3SPIA 4DYLA 1YJ9V 4JI8B 4JAVA 3ZHSA 2EINC 5IJ9A 2JK5C 3U11A 5D5PA 2F43G 2QTSA 4X65O 4UCSA 1N32O 2OTLV 1QHTA 4L87A 4BWAA 3JAWA 5F2VO 1NTZH 1BZKA 3AG2B 3BFRA 2JVDA 3F5TA 2OIEA 2JS3A 1R3LC 2D2CB 5EC2C 2DMXA 2HEPA 3P30A 2P06A 5IT9N 1K3EA 3OGIB 3OR7C 3U0ZA 1MMMA 2BCCH 3BEHA 1Q82W 3SYOA 3OD4A 4X9QA 5EK0A 3P3NA 3ASOC 2R70A 4UUJC 1JVMA 2EJ7A 1AP5A 4L8JA 4PA4A 4ZI7B 2UXDO 3ZRWA 1LUVA 1BGYH 1ENVA 3ZN1A 4B3MO 1JPXA 2IW5A 2E75B 1US6A 5JJNB 3D36C 5KHHA 1K7DA 4GLXA 2ARHA 5DECA 2L35A 1RM1B 4RUFA 5CBGA 3QO7A 5KHJA 2XHBA 1GN2A 5H6QA 3EHBB 2VS0A 3AK2A 5CA0B 4PV1B 5LP6C 3TETA 4K8ZA 4OXSA 1AR5A 4UVAA 2NN4A 2IJIA 3CJHB 5J2TB 1SQBH 3FB5C 1U97A 4GZRB 1NJIW 1H2KA 2EILB 5LOVA 1R1BA 3LDDA 5B1NA 2XTAA 1G4YB 1EZVH 3OEHG 1KU9A 1DTOA 1PPJH 3CMEV 1I5XA 2ZXWC 3DC5A 4J7ZA 1OJHA 1SQXH 2DE0X 3BHPA 2F4VB 1XL6A 4WBNB 1SQQH 2QEXV 4OPHA 2QM7A 1BQ0A 5CA0A 3UKMA 2QWRB 4TQFA 3LSUA 5CB4B 4RUEA 5CBHA 1BCCH 2OIGA 3SDLA 3SJQC 5JH7B 3E22A 4X64O 4YHHO 4LFCB 4JI6O 3J7AU 2XASA 1GTOA 4EKWA 2BE3A 3CCJV 1OV9A 3CYOA 4CH6A 4ZIBA 4FMTA 1G6UA 3DC6A 4RAIA 4WFEA 4O4LB 4X66B 2HG5C 4BIOA 4TWKA 1YZBA 4KHPO 1IBMB 2PY5A 3AEIA 1JA8A 4U3JA 4DV5B 1ZL8B 4G2KA 4KXRA 1X4TA 4DV6B 1Q6HA 5LYJB 1JQ0A 3K57A 3J81N 1GMGA 1NU1H 1KBHA 2GDSA 4GKJO 3ZJZA 2Q5ZA 4MTGA 1XNRO 2JJ1G 3F7VC 4Z1MG 3CHXA 1NKDA 3B4SA 1HDJA 3HKCB 2ZDIA 4DV1O 4DR6O 2ZT9B 1BSMA 1WB8A 1RM1C 4GKKB 3HR0A 2E5LB 2Y69B 3CCVV 2B1IA 4JI2O 3BY6A 2X6BA 2CUGA 4LF7O 3E8HA 2XNDG 3FYIB 4LF9B 3M8AA 4W4KA 4FLTA 1ZL8A 3OT7A 4LP8A 4D6TH 4NYKA 4CBCA 4I0XB 1XNQB 5FL7G 4IT5A 1KMIZ 2PI5A 4LCUC 1SETA 3ABMB 5L3DA 1GK9A 3SJCC 4GX0A 4U3FH 2ZCEA 4JV5O 1XBLA 2WLLB 3B2EE 3T2MA 3HPLC 5H5NA 2P4KA 5IWAB 1K8AW 4GKJB 4J41A 1VMGA 1I94O 4TV8B 2GUZB 2Q4PA 4AQYB 1PL0A 2X0LA 1GM9A 2LGWA 2ZM6O 1J95A 4RWUA 3ZBHA 5LMUO 1M1KW 3APQA 5DM6V 3K0DA 4FFKA 1IVSA 1VQ8V 2EZOA 1PV0A 3OM3B 3ZMVA 4DUYB 5IYDO 4DR5B 1THZA 4JTCB 4LBEC 3K0GA 4R6ZA 2YXLA 4DR1B 1XMOB 1D5AA 1P49A 4MVMA 4GT1A 2AHYA 2FKXA 4HZ3A 3B8NA 1U96A 4P9PA 1E1QG 1NS1A 2DW4A 1Q81W 2ZE5A 3IC9A 4D7TA 1AJQA 2HFEC 4YIOA 4FLUA 3E86A 3HKEA 4CH4A 1GKFA 4X20A 1N4CA 4O4IA 4JTDB 4NXMB 2K9PA 1B06A 2JJ2G 1FXVA 2CGOA 4YJ3B 4EB6A 3VQXA 3ML0A 3N2KA 5CA1B 4LF4B 1T5EA 5FLXN 1EN6A 1IBKO 3OAAG 4RQFA 1QNMA 1K5SA 2PGGA 4NTWA 1VF6C 2Q7HA 1ZWIC 3LDCA 2EJRA 4IL6Z 1NT2B 3ETDA 2Y69C 4DV2O 3E35A 3OR6C 4HNAB 2CTPA 3U10A 4DR7B 3OMNB 1SZXA 1WAZA 2EIKC 3ZRVA 3B77A 4IYIA 1IBLB 2E3CA 2GTSA 4LFAO 1RPOA 3RBZA 1ORQC 3EVKA 3KZIZ 4LF5O 4J9YB 3JATB 1Y67A 3SPCA 3CCMV 2R9RB 3ABMC 4TV9A 5E1AC 4WFBV 1FXHA 3RYFA 1WLEA 3H1KH 3UCSC 2QWNB 2YIAA 2HJDA 1N33B 3NR7A 1LUWA 2YEVB 2YXHA 3CC7V 3BABA 2QWPB 1WNSA 3CCLV 2QM8A 3K59A 2QR4A 4ZOLB 2A79B 3JALA 4MTOA 4H0LB 4X62O 1XMQO 1Q90D 1MZFA 2PF4E 1YSCA 3OTOO 1SA0A 4DUZO 2QWQB 5B1AB 1TUEB 5BR8O 4U7NA 4TSFG 3JD0A 1YITV 4CH3A 3JAKA 1NVPB 2EULA 2YSUB 4Q6GA 3TK1A 1HNZO 4JYCA 3SR2C 1NR7A 1YJWV 3A2FA 3JD4A 4CS2A 2UUCB 5IJ0B 2YEVA 3CCRV 1EM1A 1NZ6A 1Y6XA 3E83A 3HKBB 5JVDB 4J10A 1Y74B 3DGEA 1VQ7V 2KG7A 2ITDC 5ITZA 3CMAV 4X1IA 3OTFA 3N2GA 3L70H 4J7JA 5GONB 4QPKA 4IGGA 1GAXA 1AR4A 4DV7O 3E8GA 4O2BB 4FLZA 2JGUA 5LA6A 3CD6V 4PI0A 4EFEA 4RO2A 5GTHZ 2ADQB 4N23A 3ZRSA 3ZHVA 2UUBB 1AJNA 1W0JG 2CDYA 2PTMA 5JVDA 4NR1A 2VQEB 4ASUG 4LWSB 1HNZB 3T4DA 1M90W 3CB2A 1WJZA 3ZHUA 3K9SA 2F95B 1B3QA 1UPGA 1H8HG 2P4VA 1VQLV 1VQPV 3E2EA 5KHGA 3WB2A 3OUSA 1VQ9V 1VF5B 1AI4A 4PI2A 3UO2A 2M7WA 2QKAA 2EIJB 3L9DA 4MTXA 1L0LH 3TGUH 5KA5A 5A2QN 1HNXB 1TUBA 2IU0A 3JYCA 5B1BC 3FYEB 2WPDG 3VQYA 4X1KB 4I9WA 2XAJA 3VQVA 3UT5B 1R6KA 2XOKG 2BOBC 3ETGA 5IJ9B 3WU2Z 5FNVA 1BT8A 2UU9B 1MABG 5H6RA 4ICGA 5BXZA 2EZPA 5B1AC 4P30A 1ZSPA 3JAWB 4X8AA 3IFXA 3CC2V 1O9HA 2B5UA 2H8PC 1FFTB 3CSXA 4QE9A 5GTIZ 3IJ4A 3K03A 2QM4A 3J80N 3EFFK 2HHHB 3G80A 4QNHB 4PELA 4O2AA 3AG3B 1H8EG 3D36A 1WA8A 2W6JG 5H2FZ 1YHQV 4UFZA 2CK3G 4F6EA 4BR6A 1JR9A 1QLNA 2UXBB 1M56B 1YCIA 3KCXA 1DGSA 1N34O 2YS8A 3AK3A 1EFRG 3LDEA 3ZRWB 3L75H 2IH1C 2W6IG 2OWOA 4YJ2A 2BTQA 2JIZG 1AR1B 1XEQA 4LF8O 1H2SB 4PA6A 5KAIZ 3JARA 5LP6A 4JI1B 3ASNC 2WLNA 1BE3H 1XQ8A 2KQXA 3STZC 4EFBA 1AB3A 2IJKA 3FAVA 1TVKA 1G1XB 2HKOA 5CN0A 4DR2B 2QSAA 4NVPA 1R3KC 3ICXA 1VEWA 1IZ3A 4UCTA 2F4VO 4K0KO 4DV3B 4MVRA 5H9CA 5K1XA 3OMIB 4DV0B 1YI2V 2ZE6A 3JCZA 3R65A 5L3CA 5LOVB 4UCRA 3L74H 5KUKA 1URFA 4TOIA 1BMFG 1DF4A 1PNKA 4K3AA 1WB7A 2HJFC 4H13B 1KECA 4QE7A 1N34B 4UV8A 4JYAB 2ODMA 1QLEB 1J5EB 4LFCO 1AI6A 2EIJC 1Q6IA 3JCUZ 2AZ0A 2FL4A 3FB8C 4G27B 4LF8B 3OW2U 2F23A 4JGSA 4IHJB 5C8YA 5LGNA 3E22B 2R9IA 4LF6B 2WLIA 4LH7A 3I56V 4X66O 4PA3A 3K3WA 2CH7B 2ZD9A 1CXZB 4E4EA 3T1YO 3FB6C 3TXSA 2OYQA 3ABLB 1IBMO 1K97A 1LNQA 3FKSG 4DV5O 2QDOA 4BAYA 4DV6O 4B3TB 1FJGB 4K0KB 2RCVA 4IIJA 2GV9A 3Q4HA 1XI1A 3RYCA 1FD9A 2Y48A 1ZLZA 1RFYA 4H37A 2OT5A 1GN6A 5DN6G 4U3JB 1I7FA 2DQ3A 2XUMA 4KUMA 4DO2A 4I7ZB 4IHJA 4UV9A 1FXKB 3GVMA 1V9PA 3CWBH 3LNMB 1M56C 1ZTEA 4GKKO 2E5LO 3QO5A 2CH7A 1NH2B 4JI4B 1KB9F 4PD4F 3P32A 2NR5A 2CE4A 1QCEA 2QE7G 4LF9O 3A0RA 2PI4A 4PHZA 3ZS8C 3DTUB 3AG2C 4JI0B 5JJJB 1OZ0A 1XNQO 1W0KG 1W2BU 2ZNIA 1M93A 3E8BA 3E8FA 5KMGA 3T1YB 3GWOA 2MK3A 1PD3A 2WAMA 1F4MA 1QVGU 1VQOV 2CTWA 1S72V 3W7XA 1RP3B 1FXKA 3D8CA 5L3EA 1JMKC 1YXBA 5IWAO 1A32A 5GW7A 5IYZB 1N0NA 1GN3A 4AQYO 5J2UA 3TCUA 2QWOB 4P2ZA 1MOFA 3RVZA 3ZIAG 5KUMA 3K79A 5JCOA 4FK5C 3WB1A 1S5JA 4YY3B 2L6LA 1JFFA 1N8RW 4UB8Z 3ZCCA 3CXCU 4DUYO 4DR5O 4B08A 2IM9A 2CTRA 4Z2WA 1YDXA 1WN7A 4DR1O 1XMOO 4FZ0A 4QPJA 2MW2B 4PDMA 2EILC 1S5HC 1SERA 2RQ6A 5IYZA 5JJEB 4IYHA 4WFGA 4F6RA 3ABLC 2ITCC 3L72H 5EBWC 1L8DA 4FPPA 4GUNA 1GRJA 3OE7G 2Y4TA 4YIPA 3GWKC 1N36B 3ETEA 1NI8A 2BOCC 1FAFA 4NXMO 3ZHRA 1H2NA 2OCHA 2F1MA 2PZSA 1AILA 3S3WA 3O9OA 1P7GA 4GYCB 4LF4O 4MVOA 3IAYA 2BSKA 1R6TA 2GBOA 3HKEB 1L0NH 1K9MW 1B04A 2W0XA 4X20B 3ABTA 4O4IB 3D3QA 4CH5A 1ZX3A 4PJ0Z 1F51A 4CS3A 3O65A 1YEWA 4EB6B 3N2KB 2LFRA 4DR7O 2WLMA 1I0HA 3H1HH 4GX1A 5LHHA 2ZDIC 4TQDA 2V7QG 1IBLO 3KCYA 2NLJC 4A5UB 4HAMA 4HYOA 3CCSV 1FFXA 3K04A 5KX5B 4BIZA 3AG7A 1NBMG 4J80A 2ATKC 3CRRA 3OFNG 1S5LZ 2X6CA 1M9NA 3E89A 4J11A 1YTFD 2H94A 4DR4B 1N33O 1X59A 4NB5A 1Y76A 3RN4A 1WPBA 4TV9B 4E2LA 4AI8A 4C7UA 2ZE8A 3RYFB 2N04A 2A3QA 2DWDC 3DXRA 1UFIA 2JDIG 1K73W 4DR3B 1FPOA 2NNUA 5KX5A 3LSQA 1FS0G 1OCOB 3CRAA 4FFBB 2IBZH 3C3SA 1EBOA 4B3SB 4WFAV 3G4SV 2ZINA 3JALB 1H2GA 3T1HB 1OCCB 5B3SB 4G28B 1N0JA 5B66Z 1V54B 2XT9A 1VP7A 3QG5A 1Q5OA 1SA0B 3CRMA 2GSMB 2UUCO 3AG4B 3B40A 4MW3A 1PKXA 3QTCA 3JAKB 3H9VA 1ZUQA 1CPYA 4DV4B 2ZKOA 4WFHA 3I5DA 4WFFA 1AI5A 1V55B 4LNUA 3W7TA 5EYPA 3CXHF 1AJPA 1Q7YW 4FFBA 4NTYA 3OGCC 5EIBC 2F93B 1BHBA 2KG7B 1S76D 2UUAB 3A8TA 5ITZB 2Q73A 1UJWB 1OCZB 4X1IB 3N2GB 4CS4A 1P4RA 1KUQA 2GHYA 4NXNB 3JD3A 5BMVA 1G8MA 3LNNA 4FVMA 2UUBO 5FPRA 3STLC 1E79G 3K58A 2VQEO 1SQGA 2UXCB 5LA6B 3M7MX 4MVQA 1EN5A 2JEXA 1PNLA 5LL6Y 1DLBA 1M57B 5LGTA 2EBOA 2Q68A 3CRQA 2PUSA 2ZR3A 3A0BZ 1R3JC 3GB7C 3SGIA 1FKAO 1M4UA 1NTKH 1BQZA 1WPXA 2DWEC 1HNXO 3C3TA 2VWJA 4B3RB 1SS3A 2XAQA 1MNGA 2GTAA 2QTOA 1O9GA 2RNBA 1XUQA 4FM1A 1XL4A 4MSWC 4MTFA 5BZBA 3VQWA 1QQCA 2AXTZ 4DRXA 5DEDA 4DW1A 2UU9O 1TUBB 4I9QA 2V1DA 4QJFB 2A0LA 1Q3EA 1AP6A 4ZHQB 5LGUA 3A0HZ 5L3FA 5K1PA 2Q8VA 4UCOA 4ZBMA 1GM8A 5FNVB 3BVOA 4JASA 1V54C 2LO1A 2HHHO 4JYBA 4NKGB 2Q7EA 1NTMH 4CZZA 3AG4C 2H3OA 5EBLC 2JGDA 1AROP 2KB1A 2UXBO 2Q67A 3BAAA 1V55C 1Z5WA 3MHHC 5LHIA 4LFBB 1Y4MA 3K9AA 1F23A 2YICA 1KKCA 2D3OW 1CEZA 4QGPA 3L73H 4O2AB 2JS5A 4FLXA 5EZYA 1WA8B 3EXAA 4JI1O 3L71H 4ZHQA 2DOSA 3ZMUA 4JI5B 1HR0B 4W4LA 5HFLA 1M5IA 4R50A 4YJ2B 1IXBA 1HNWB 1OCZC 2BTQB 3AK1A 1NVPD 4DR2O 3JARB 5LP6B 4UCVA 2YIBA 3HKDA 1RSOA 4LH6A 2OTJV 3MAQA 1CP9A 1S77D 3FB7C 4DV3O 4I4TA 4DV0O 2LGQA 3FAVB 1TVKB 1COWG 1IXMA 2CTQA 4WF9V 1SF9A 1M57C 1MA1A 2ILMA 1K5QA 1PL4A 4PDRA 2ZXWB 5LMNB 3RYHA 4JF3A 3K06A 5HFMA 3P3PA 4JTAB 4JYAO 1K4CC 1FYJA 1J5EO 4GX5A 2AGAA 1P7BA 1TA8A 4Z1VA 4JI7B 1Z5VA 2VQFB 2ZE7A 1NR1A 1XHXA 2P5OA 3FX7A 1DF5A 3QO8A 4JPRA 2E76B 4LF6O 2YIBD 1YVWA 3JSNA 1R73A 3VOUA 3ETQA 1RPRA 4I55A 1E1RG 3TXQA 3APOA 4DK0A 4X89A 4I50A 3WFVA 4XBFA 5C8YB 4I5SA 4JI3O 2M6YA 1PP9H 3G67A 4B3TO 5TISZ 1FJGO 2WLIB 3JD2A 4N21A 1HW7A 2Z0AA 3ZEDA 4LR3A 4F4LA 1MSWD 1F4NA 5IE9A 1QR9A 1D5NA 2LW1A 4PA7A 3G71V 3ZRXA 2UXNA 2B9ZA 2C2AA 3RYIA 3BA9A 4IIJB 2A9HA 3MHSC 1XHZA 3Q4HB 1YF2A 2DJVA 2FTKA 4UXNA 3RYCB 1H38A 4JI4O 3G6BA 5EBMC 4D7SA 2W0FC 4JI0O 5B1OA 2QGNA 2QKCA 1S0VA 4OX9B 2DYSB 2YDEA 3CE2A 1Q6UA 2XAFA 4O4HB 2N74A 2QA4V 4UCUA 2ZNJA 5E79Z 4X65B 1N32B 2WA4A 2Z5UA 4XDKA 4JI3B 5B5EZ 1B6QA 4MVZA 3RWRD 3RW0A 3ZN0A 4MW8A 4ZI7A 4FLYA 5KMGB 3UO3A 3JD1A 3CPWU 3AG3C 1PM9A 3WG7B 5FPOA 1S3JA 2RJZA 1XILA 4P9OA
chains in the Genus database with same CATH topology
5B5EZ 5B66Z 4UB6Z 2AXTZ 5GTHZ 1S5LZ 5GTIZ 4IL6Z 3KZIZ 5KAIZ 3WU2Z 5E79Z 5TISZ 4UB8Z 3A0HZ 3JCUZ 5H2FZ 4PJ0Z 5KAFZ 3A0BZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B5E Z;  5B66 Z;  4UB6 Z;  2AXT Z;  5GTH Z;  1S5L Z;  5GTI Z;  4IL6 Z;  3KZI Z;  5KAI Z;  3WU2 Z;  5E79 Z;  5TIS Z;  4UB8 Z;  3A0H Z;  3JCU Z;  5H2F Z;  4PJ0 Z;  5KAF Z;  3A0B Z; 
#chains in the Genus database with same CATH topology
 2WSS G;  1SKV A;  4RQE A;  4O4H A;  2FB5 A;  2UXD B;  1VAR A;  3R66 A;  4YY3 O;  4B3M B;  2P22 C;  5LHG A;  5J2U B;  4X88 A;  3W7S A;  3SPH A;  2O57 A;  2WLJ A;  3BCC H;  3NXS A;  5J2T A;  3CJH A;  3QNE A;  4O4J B;  4WCE V;  2X7R B;  5KAF Z;  3JAM N;  1JFF B;  3OEE G;  3W7U A;  2YI9 A;  1IUR A;  3QF7 A;  4MS2 A;  5AG2 A;  3N27 A;  2ADP A;  3TJT A;  1SES A;  3KKY A;  2FYU H;  1N36 O;  3H1I H;  2ZQM A;  4WBN A;  4FM2 A;  3PJS K;  2P7T C;  1EN4 A;  5J9P C;  4F6R B;  2WWW A;  2HVK C;  3G6E V;  3UM7 A;  1F7Y A;  2A06 H;  3JAS B;  2LFS A;  3BRC A;  4PDL A;  2Y0I A;  1K4D C;  5CB4 A;  1MSD A;  3H1L H;  5JH7 A;  4FZ1 A;  2Q6A A;  3KG2 A;  4O4J A;  1GH6 A;  2PYJ A;  2ETN A;  1QLE C;  1OHH G;  1YTF B;  3MDS A;  1BS3 A;  5LXT B;  3B8M A;  3T1C A;  4JAA A;  2BSK B;  2VWK A;  3ABK B;  3HB3 B;  4BIU A;  3MD0 A;  1BL8 A;  1K92 A;  2DYS C;  4X64 B;  4YHH B;  4O4L A;  2KSD A;  2Z3Y A;  3T4Z A;  4JI6 B;  1KKD A;  4BW5 A;  5LBQ A;  2JRI A;  3LSS A;  4CC5 A;  2EIK B;  1VQ5 V;  3JAS A;  2P90 A;  5JWP A;  2X6A A;  3ZMT A;  3THO A;  2AHZ A;  5IDJ A;  1FFX B;  1OCR B;  4DR4 O;  1D2D A;  5LYJ A;  1QBZ A;  2DQ0 A;  3BA8 A;  1XOU A;  4KHP B;  4BW9 A;  5CBF A;  1SQF A;  5LXT A;  3SPJ A;  3HKC A;  3K08 A;  3WG7 C;  1FXK C;  1NH2 D;  2ZIO A;  1VF6 A;  4DR3 O;  1KQS U;  1XNR B;  5JQG B;  1XRE A;  2XAH A;  1EZJ A;  1Y76 B;  2A7W A;  4B3S O;  1KP2 A;  2LJ2 A;  1IX9 A;  2QKS A;  3T1H O;  2WA3 A;  3DXR B;  4DV1 B;  4DR6 B;  4OPA A;  5L3G A;  1SZT A;  3AG1 B;  5L3B A;  4I0X A;  2HR3 A;  4UVB A;  2VRZ A;  5CMU A;  2F66 C;  5JCO C;  2HVJ C;  4JI2 B;  4OGQ B;  3W7W A;  1VQN V;  2AW9 A;  4LF7 B;  1P84 F;  1SQV H;  4DV4 O;  1L1F A;  5KHI A;  4K35 A;  3RT3 C;  2LW7 A;  1JX9 A;  1VQ4 V;  5A9G A;  2WLL A;  1KYO F;  5D5Q A;  3ABU A;  2YI8 A;  3BPZ A;  5JQG A;  1YIJ V;  4B7K A;  3CCU V;  4MVU A;  4TV8 A;  4PDV A;  5KLV H;  2GUZ A;  3SYA A;  3IGA C;  4KP4 A;  4JYY A;  1I08 A;  1KP3 A;  3X2Q B;  4LNU B;  4B7E A;  2UUA O;  1JJO A;  2E74 B;  4JV5 B;  5EYP B;  2WLK A;  2EIM B;  4NXN O;  3UQ8 A;  4TT3 G;  1I94 B;  1SRY A;  1TAE A;  4H33 A;  4U7O A;  2UXC O;  1H2M A;  2ZM6 B;  3ABK C;  4DK1 A;  1R6N A;  5LMU B;  2P6J A;  1IDS A;  2RN9 A;  1AVM A;  5BMV B;  4FIP C;  5C93 A;  4MT8 A;  4XDJ A;  4FLW A;  1LR1 A;  1SC5 B;  1HWY A;  1I5Y A;  1Q43 A;  1GO3 F;  2YXY A;  4B3R O;  1OCR C;  1QU7 A;  1HP8 A;  2HP8 A;  5EIB D;  2OCC B;  4J7K A;  4R7C A;  4MVS A;  3M99 B;  2R72 A;  2Q0A A;  3B09 A;  4YJ3 A;  2IU3 A;  5EC1 C;  3OMA B;  5CA1 A;  3F5W C;  1XDC A;  1Y66 A;  4ABM A;  5IYC O;  1WP7 A;  4TUY B;  1VQM V;  1AI7 A;  4FJC C;  3LUT B;  1VQ6 V;  5B1B B;  3CRC A;  4HNA A;  2WLH A;  1JOY A;  3ZX6 A;  2Q7G A;  4DRX B;  1IBK B;  4AHC A;  2DN9 A;  3ZHQ A;  1QR8 A;  3AG1 C;  2ZIM A;  5IYB O;  1BHA A;  2V4D A;  3ZMS A;  4LC1 A;  3SPG A;  4GCZ A;  2Q9L A;  5BY1 A;  1TGO A;  4DV2 B;  4NTX A;  3PN1 A;  3JAT A;  4UVC A;  4FLV A;  4YXW G;  2IH3 C;  3RFR A;  3CC4 V;  2BTO A;  2Y0P A;  1W59 A;  2B1G A;  4TUY A;  4LFB O;  2HLD G;  2K1E A;  4AIL C;  2AZ2 A;  2DYR B;  4ZKI A;  4LFA B;  1DK1 A;  4JZ2 A;  4CC6 A;  1QVF U;  1WP8 A;  1KD1 W;  3CCE V;  4LF5 B;  5IY5 B;  2JGD B;  4KFM A;  3SJB C;  4JI5 O;  2FML A;  1HR0 O;  4ZOL A;  3X2Q C;  2EIN B;  1Z2G A;  4H44 B;  3FFQ A;  1HNW O;  3F7Y C;  2CGN A;  2EIM C;  3FD9 A;  4JAU A;  4X1Y B;  5EZY B;  1MZE A;  2JEU A;  2PYL A;  1VF7 A;  1OCO C;  2G38 A;  3ASN B;  2LP7 A;  3JSL A;  4K8X A;  3SYP A;  3C90 A;  4X62 B;  1OCC C;  4R8C A;  5B3S C;  4DW0 A;  3CEI A;  1XMQ B;  3QVN A;  1JCH A;  1Q86 W;  3CCQ V;  3OTO B;  3H1J H;  1NQT A;  4KL1 A;  4DUZ B;  2YC0 A;  3HKD B;  1RSO B;  5IJ0 A;  5BR8 B;  1JJ2 U;  4J42 A;  4FM0 A;  4PA9 A;  2YUA A;  3HKB A;  2IJJ A;  3ASO B;  1Y74 A;  5LMN O;  3K5O A;  2ZR2 A;  4I4T B;  1Q8I A;  3WB0 A;  3IC7 A;  3K5L A;  3SYQ A;  2Q69 A;  5KA6 A;  2OCC C;  1SQP H;  2YID A;  5KHK A;  4JI7 O;  2VQF O;  5GON A;  4X1Y A;  2P67 A;  2RMK B;  2UXX A;  3DSQ A;  4HBN A;  3RYH B;  3I55 V;  4O2B A;  3ZMZ A;  2QJ1 A;  4JI8 O;  4JZG A;  1KC8 W;  2N05 A;  1K34 A;  2Y4U A;  4XDL A;  4UB6 Z;  2LQT A;  3CP1 A;  4Q20 A;  4EEQ A;  3CX5 F;  4DV7 B;  3CS5 A;  2KKW A;  4LWS A;  3D3I A;  3OUF A;  1PNM A;  2IJH A;  3SJA C;  4I55 B;  3SYC A;  5CA3 A;  1YJN V;  2Q0O C;  3ZHT A;  3H01 A;  1K33 A;  4I50 B;  4QIW F;  3RVY A;  1VQK V;  1GN4 A;  4DXW A;  3K5N A;  1GM7 A;  1ZAU A;  2XAG A;  3S3X A;  3K5M A;  2CAZ C;  1ROP A;  2DYR C;  2EX3 A;  4GX2 A;  3VBB A;  1MG1 A;  1VIB A;  2R9A A;  1R3I C;  2RDC A;  4X1K A;  5IY5 C;  1H2L A;  4J9Z B;  3RYI B;  4OX9 O;  3UT5 A;  3RGB A;  3SPI A;  4DYL A;  1YJ9 V;  4JI8 B;  4JAV A;  3ZHS A;  2EIN C;  5IJ9 A;  2JK5 C;  3U11 A;  5D5P A;  2F43 G;  2QTS A;  4X65 O;  4UCS A;  1N32 O;  2OTL V;  1QHT A;  4L87 A;  4BWA A;  3JAW A;  5F2V O;  1NTZ H;  1BZK A;  3AG2 B;  3BFR A;  2JVD A;  3F5T A;  2OIE A;  2JS3 A;  1R3L C;  2D2C B;  5EC2 C;  2DMX A;  2HEP A;  3P30 A;  2P06 A;  5IT9 N;  1K3E A;  3OGI B;  3OR7 C;  3U0Z A;  1MMM A;  2BCC H;  3BEH A;  1Q82 W;  3SYO A;  3OD4 A;  4X9Q A;  5EK0 A;  3P3N A;  3ASO C;  2R70 A;  4UUJ C;  1JVM A;  2EJ7 A;  1AP5 A;  4L8J A;  4PA4 A;  4ZI7 B;  2UXD O;  3ZRW A;  1LUV A;  1BGY H;  1ENV A;  3ZN1 A;  4B3M O;  1JPX A;  2IW5 A;  2E75 B;  1US6 A;  5JJN B;  3D36 C;  5KHH A;  1K7D A;  4GLX A;  2ARH A;  5DEC A;  2L35 A;  1RM1 B;  4RUF A;  5CBG A;  3QO7 A;  5KHJ A;  2XHB A;  1GN2 A;  5H6Q A;  3EHB B;  2VS0 A;  3AK2 A;  5CA0 B;  4PV1 B;  5LP6 C;  3TET A;  4K8Z A;  4OXS A;  1AR5 A;  4UVA A;  2NN4 A;  2IJI A;  3CJH B;  5J2T B;  1SQB H;  3FB5 C;  1U97 A;  4GZR B;  1NJI W;  1H2K A;  2EIL B;  5LOV A;  1R1B A;  3LDD A;  5B1N A;  2XTA A;  1G4Y B;  1EZV H;  3OEH G;  1KU9 A;  1DTO A;  1PPJ H;  3CME V;  1I5X A;  2ZXW C;  3DC5 A;  4J7Z A;  1OJH A;  1SQX H;  2DE0 X;  3BHP A;  2F4V B;  1XL6 A;  4WBN B;  1SQQ H;  2QEX V;  4OPH A;  2QM7 A;  1BQ0 A;  5CA0 A;  3UKM A;  2QWR B;  4TQF A;  3LSU A;  5CB4 B;  4RUE A;  5CBH A;  1BCC H;  2OIG A;  3SDL A;  3SJQ C;  5JH7 B;  3E22 A;  4X64 O;  4YHH O;  4LFC B;  4JI6 O;  3J7A U;  2XAS A;  1GTO A;  4EKW A;  2BE3 A;  3CCJ V;  1OV9 A;  3CYO A;  4CH6 A;  4ZIB A;  4FMT A;  1G6U A;  3DC6 A;  4RAI A;  4WFE A;  4O4L B;  4X66 B;  2HG5 C;  4BIO A;  4TWK A;  1YZB A;  4KHP O;  1IBM B;  2PY5 A;  3AEI A;  1JA8 A;  4U3J A;  4DV5 B;  1ZL8 B;  4G2K A;  4KXR A;  1X4T A;  4DV6 B;  1Q6H A;  5LYJ B;  1JQ0 A;  3K57 A;  3J81 N;  1GMG A;  1NU1 H;  1KBH A;  2GDS A;  4GKJ O;  3ZJZ A;  2Q5Z A;  4MTG A;  1XNR O;  2JJ1 G;  3F7V C;  4Z1M G;  3CHX A;  1NKD A;  3B4S A;  1HDJ A;  3HKC B;  2ZDI A;  4DV1 O;  4DR6 O;  2ZT9 B;  1BSM A;  1WB8 A;  1RM1 C;  4GKK B;  3HR0 A;  2E5L B;  2Y69 B;  3CCV V;  2B1I A;  4JI2 O;  3BY6 A;  2X6B A;  2CUG A;  4LF7 O;  3E8H A;  2XND G;  3FYI B;  4LF9 B;  3M8A A;  4W4K A;  4FLT A;  1ZL8 A;  3OT7 A;  4LP8 A;  4D6T H;  4NYK A;  4CBC A;  4I0X B;  1XNQ B;  5FL7 G;  4IT5 A;  1KMI Z;  2PI5 A;  4LCU C;  1SET A;  3ABM B;  5L3D A;  1GK9 A;  3SJC C;  4GX0 A;  4U3F H;  2ZCE A;  4JV5 O;  1XBL A;  2WLL B;  3B2E E;  3T2M A;  3HPL C;  5H5N A;  2P4K A;  5IWA B;  1K8A W;  4GKJ B;  4J41 A;  1VMG A;  1I94 O;  4TV8 B;  2GUZ B;  2Q4P A;  4AQY B;  1PL0 A;  2X0L A;  1GM9 A;  2LGW A;  2ZM6 O;  1J95 A;  4RWU A;  3ZBH A;  5LMU O;  1M1K W;  3APQ A;  5DM6 V;  3K0D A;  4FFK A;  1IVS A;  1VQ8 V;  2EZO A;  1PV0 A;  3OM3 B;  3ZMV A;  4DUY B;  5IYD O;  4DR5 B;  1THZ A;  4JTC B;  4LBE C;  3K0G A;  4R6Z A;  2YXL A;  4DR1 B;  1XMO B;  1D5A A;  1P49 A;  4MVM A;  4GT1 A;  2AHY A;  2FKX A;  4HZ3 A;  3B8N A;  1U96 A;  4P9P A;  1E1Q G;  1NS1 A;  2DW4 A;  1Q81 W;  2ZE5 A;  3IC9 A;  4D7T A;  1AJQ A;  2HFE C;  4YIO A;  4FLU A;  3E86 A;  3HKE A;  4CH4 A;  1GKF A;  4X20 A;  1N4C A;  4O4I A;  4JTD B;  4NXM B;  2K9P A;  1B06 A;  2JJ2 G;  1FXV A;  2CGO A;  4YJ3 B;  4EB6 A;  3VQX A;  3ML0 A;  3N2K A;  5CA1 B;  4LF4 B;  1T5E A;  5FLX N;  1EN6 A;  1IBK O;  3OAA G;  4RQF A;  1QNM A;  1K5S A;  2PGG A;  4NTW A;  1VF6 C;  2Q7H A;  1ZWI C;  3LDC A;  2EJR A;  4IL6 Z;  1NT2 B;  3ETD A;  2Y69 C;  4DV2 O;  3E35 A;  3OR6 C;  4HNA B;  2CTP A;  3U10 A;  4DR7 B;  3OMN B;  1SZX A;  1WAZ A;  2EIK C;  3ZRV A;  3B77 A;  4IYI A;  1IBL B;  2E3C A;  2GTS A;  4LFA O;  1RPO A;  3RBZ A;  1ORQ C;  3EVK A;  3KZI Z;  4LF5 O;  4J9Y B;  3JAT B;  1Y67 A;  3SPC A;  3CCM V;  2R9R B;  3ABM C;  4TV9 A;  5E1A C;  4WFB V;  1FXH A;  3RYF A;  1WLE A;  3H1K H;  3UCS C;  2QWN B;  2YIA A;  2HJD A;  1N33 B;  3NR7 A;  1LUW A;  2YEV B;  2YXH A;  3CC7 V;  3BAB A;  2QWP B;  1WNS A;  3CCL V;  2QM8 A;  3K59 A;  2QR4 A;  4ZOL B;  2A79 B;  3JAL A;  4MTO A;  4H0L B;  4X62 O;  1XMQ O;  1Q90 D;  1MZF A;  2PF4 E;  1YSC A;  3OTO O;  1SA0 A;  4DUZ O;  2QWQ B;  5B1A B;  1TUE B;  5BR8 O;  4U7N A;  4TSF G;  3JD0 A;  1YIT V;  4CH3 A;  3JAK A;  1NVP B;  2EUL A;  2YSU B;  4Q6G A;  3TK1 A;  1HNZ O;  4JYC A;  3SR2 C;  1NR7 A;  1YJW V;  3A2F A;  3JD4 A;  4CS2 A;  2UUC B;  5IJ0 B;  2YEV A;  3CCR V;  1EM1 A;  1NZ6 A;  1Y6X A;  3E83 A;  3HKB B;  5JVD B;  4J10 A;  1Y74 B;  3DGE A;  1VQ7 V;  2KG7 A;  2ITD C;  5ITZ A;  3CMA V;  4X1I A;  3OTF A;  3N2G A;  3L70 H;  4J7J A;  5GON B;  4QPK A;  4IGG A;  1GAX A;  1AR4 A;  4DV7 O;  3E8G A;  4O2B B;  4FLZ A;  2JGU A;  5LA6 A;  3CD6 V;  4PI0 A;  4EFE A;  4RO2 A;  5GTH Z;  2ADQ B;  4N23 A;  3ZRS A;  3ZHV A;  2UUB B;  1AJN A;  1W0J G;  2CDY A;  2PTM A;  5JVD A;  4NR1 A;  2VQE B;  4ASU G;  4LWS B;  1HNZ B;  3T4D A;  1M90 W;  3CB2 A;  1WJZ A;  3ZHU A;  3K9S A;  2F95 B;  1B3Q A;  1UPG A;  1H8H G;  2P4V A;  1VQL V;  1VQP V;  3E2E A;  5KHG A;  3WB2 A;  3OUS A;  1VQ9 V;  1VF5 B;  1AI4 A;  4PI2 A;  3UO2 A;  2M7W A;  2QKA A;  2EIJ B;  3L9D A;  4MTX A;  1L0L H;  3TGU H;  5KA5 A;  5A2Q N;  1HNX B;  1TUB A;  2IU0 A;  3JYC A;  5B1B C;  3FYE B;  2WPD G;  3VQY A;  4X1K B;  4I9W A;  2XAJ A;  3VQV A;  3UT5 B;  1R6K A;  2XOK G;  2BOB C;  3ETG A;  5IJ9 B;  3WU2 Z;  5FNV A;  1BT8 A;  2UU9 B;  1MAB G;  5H6R A;  4ICG A;  5BXZ A;  2EZP A;  5B1A C;  4P30 A;  1ZSP A;  3JAW B;  4X8A A;  3IFX A;  3CC2 V;  1O9H A;  2B5U A;  2H8P C;  1FFT B;  3CSX A;  4QE9 A;  5GTI Z;  3IJ4 A;  3K03 A;  2QM4 A;  3J80 N;  3EFF K;  2HHH B;  3G80 A;  4QNH B;  4PEL A;  4O2A A;  3AG3 B;  1H8E G;  3D36 A;  1WA8 A;  2W6J G;  5H2F Z;  1YHQ V;  4UFZ A;  2CK3 G;  4F6E A;  4BR6 A;  1JR9 A;  1QLN A;  2UXB B;  1M56 B;  1YCI A;  3KCX A;  1DGS A;  1N34 O;  2YS8 A;  3AK3 A;  1EFR G;  3LDE A;  3ZRW B;  3L75 H;  2IH1 C;  2W6I G;  2OWO A;  4YJ2 A;  2BTQ A;  2JIZ G;  1AR1 B;  1XEQ A;  4LF8 O;  1H2S B;  4PA6 A;  5KAI Z;  3JAR A;  5LP6 A;  4JI1 B;  3ASN C;  2WLN A;  1BE3 H;  1XQ8 A;  2KQX A;  3STZ C;  4EFB A;  1AB3 A;  2IJK A;  3FAV A;  1TVK A;  1G1X B;  2HKO A;  5CN0 A;  4DR2 B;  2QSA A;  4NVP A;  1R3K C;  3ICX A;  1VEW A;  1IZ3 A;  4UCT A;  2F4V O;  4K0K O;  4DV3 B;  4MVR A;  5H9C A;  5K1X A;  3OMI B;  4DV0 B;  1YI2 V;  2ZE6 A;  3JCZ A;  3R65 A;  5L3C A;  5LOV B;  4UCR A;  3L74 H;  5KUK A;  1URF A;  4TOI A;  1BMF G;  1DF4 A;  1PNK A;  4K3A A;  1WB7 A;  2HJF C;  4H13 B;  1KEC A;  4QE7 A;  1N34 B;  4UV8 A;  4JYA B;  2ODM A;  1QLE B;  1J5E B;  4LFC O;  1AI6 A;  2EIJ C;  1Q6I A;  3JCU Z;  2AZ0 A;  2FL4 A;  3FB8 C;  4G27 B;  4LF8 B;  3OW2 U;  2F23 A;  4JGS A;  4IHJ B;  5C8Y A;  5LGN A;  3E22 B;  2R9I A;  4LF6 B;  2WLI A;  4LH7 A;  3I56 V;  4X66 O;  4PA3 A;  3K3W A;  2CH7 B;  2ZD9 A;  1CXZ B;  4E4E A;  3T1Y O;  3FB6 C;  3TXS A;  2OYQ A;  3ABL B;  1IBM O;  1K97 A;  1LNQ A;  3FKS G;  4DV5 O;  2QDO A;  4BAY A;  4DV6 O;  4B3T B;  1FJG B;  4K0K B;  2RCV A;  4IIJ A;  2GV9 A;  3Q4H A;  1XI1 A;  3RYC A;  1FD9 A;  2Y48 A;  1ZLZ A;  1RFY A;  4H37 A;  2OT5 A;  1GN6 A;  5DN6 G;  4U3J B;  1I7F A;  2DQ3 A;  2XUM A;  4KUM A;  4DO2 A;  4I7Z B;  4IHJ A;  4UV9 A;  1FXK B;  3GVM A;  1V9P A;  3CWB H;  3LNM B;  1M56 C;  1ZTE A;  4GKK O;  2E5L O;  3QO5 A;  2CH7 A;  1NH2 B;  4JI4 B;  1KB9 F;  4PD4 F;  3P32 A;  2NR5 A;  2CE4 A;  1QCE A;  2QE7 G;  4LF9 O;  3A0R A;  2PI4 A;  4PHZ A;  3ZS8 C;  3DTU B;  3AG2 C;  4JI0 B;  5JJJ B;  1OZ0 A;  1XNQ O;  1W0K G;  1W2B U;  2ZNI A;  1M93 A;  3E8B A;  3E8F A;  5KMG A;  3T1Y B;  3GWO A;  2MK3 A;  1PD3 A;  2WAM A;  1F4M A;  1QVG U;  1VQO V;  2CTW A;  1S72 V;  3W7X A;  1RP3 B;  1FXK A;  3D8C A;  5L3E A;  1JMK C;  1YXB A;  5IWA O;  1A32 A;  5GW7 A;  5IYZ B;  1N0N A;  1GN3 A;  4AQY O;  5J2U A;  3TCU A;  2QWO B;  4P2Z A;  1MOF A;  3RVZ A;  3ZIA G;  5KUM A;  3K79 A;  5JCO A;  4FK5 C;  3WB1 A;  1S5J A;  4YY3 B;  2L6L A;  1JFF A;  1N8R W;  4UB8 Z;  3ZCC A;  3CXC U;  4DUY O;  4DR5 O;  4B08 A;  2IM9 A;  2CTR A;  4Z2W A;  1YDX A;  1WN7 A;  4DR1 O;  1XMO O;  4FZ0 A;  4QPJ A;  2MW2 B;  4PDM A;  2EIL C;  1S5H C;  1SER A;  2RQ6 A;  5IYZ A;  5JJE B;  4IYH A;  4WFG A;  4F6R A;  3ABL C;  2ITC C;  3L72 H;  5EBW C;  1L8D A;  4FPP A;  4GUN A;  1GRJ A;  3OE7 G;  2Y4T A;  4YIP A;  3GWK C;  1N36 B;  3ETE A;  1NI8 A;  2BOC C;  1FAF A;  4NXM O;  3ZHR A;  1H2N A;  2OCH A;  2F1M A;  2PZS A;  1AIL A;  3S3W A;  3O9O A;  1P7G A;  4GYC B;  4LF4 O;  4MVO A;  3IAY A;  2BSK A;  1R6T A;  2GBO A;  3HKE B;  1L0N H;  1K9M W;  1B04 A;  2W0X A;  4X20 B;  3ABT A;  4O4I B;  3D3Q A;  4CH5 A;  1ZX3 A;  4PJ0 Z;  1F51 A;  4CS3 A;  3O65 A;  1YEW A;  4EB6 B;  3N2K B;  2LFR A;  4DR7 O;  2WLM A;  1I0H A;  3H1H H;  4GX1 A;  5LHH A;  2ZDI C;  4TQD A;  2V7Q G;  1IBL O;  3KCY A;  2NLJ C;  4A5U B;  4HAM A;  4HYO A;  3CCS V;  1FFX A;  3K04 A;  5KX5 B;  4BIZ A;  3AG7 A;  1NBM G;  4J80 A;  2ATK C;  3CRR A;  3OFN G;  1S5L Z;  2X6C A;  1M9N A;  3E89 A;  4J11 A;  1YTF D;  2H94 A;  4DR4 B;  1N33 O;  1X59 A;  4NB5 A;  1Y76 A;  3RN4 A;  1WPB A;  4TV9 B;  4E2L A;  4AI8 A;  4C7U A;  2ZE8 A;  3RYF B;  2N04 A;  2A3Q A;  2DWD C;  3DXR A;  1UFI A;  2JDI G;  1K73 W;  4DR3 B;  1FPO A;  2NNU A;  5KX5 A;  3LSQ A;  1FS0 G;  1OCO B;  3CRA A;  4FFB B;  2IBZ H;  3C3S A;  1EBO A;  4B3S B;  4WFA V;  3G4S V;  2ZIN A;  3JAL B;  1H2G A;  3T1H B;  1OCC B;  5B3S B;  4G28 B;  1N0J A;  5B66 Z;  1V54 B;  2XT9 A;  1VP7 A;  3QG5 A;  1Q5O A;  1SA0 B;  3CRM A;  2GSM B;  2UUC O;  3AG4 B;  3B40 A;  4MW3 A;  1PKX A;  3QTC A;  3JAK B;  3H9V A;  1ZUQ A;  1CPY A;  4DV4 B;  2ZKO A;  4WFH A;  3I5D A;  4WFF A;  1AI5 A;  1V55 B;  4LNU A;  3W7T A;  5EYP A;  3CXH F;  1AJP A;  1Q7Y W;  4FFB A;  4NTY A;  3OGC C;  5EIB C;  2F93 B;  1BHB A;  2KG7 B;  1S76 D;  2UUA B;  3A8T A;  5ITZ B;  2Q73 A;  1UJW B;  1OCZ B;  4X1I B;  3N2G B;  4CS4 A;  1P4R A;  1KUQ A;  2GHY A;  4NXN B;  3JD3 A;  5BMV A;  1G8M A;  3LNN A;  4FVM A;  2UUB O;  5FPR A;  3STL C;  1E79 G;  3K58 A;  2VQE O;  1SQG A;  2UXC B;  5LA6 B;  3M7M X;  4MVQ A;  1EN5 A;  2JEX A;  1PNL A;  5LL6 Y;  1DLB A;  1M57 B;  5LGT A;  2EBO A;  2Q68 A;  3CRQ A;  2PUS A;  2ZR3 A;  3A0B Z;  1R3J C;  3GB7 C;  3SGI A;  1FKA O;  1M4U A;  1NTK H;  1BQZ A;  1WPX A;  2DWE C;  1HNX O;  3C3T A;  2VWJ A;  4B3R B;  1SS3 A;  2XAQ A;  1MNG A;  2GTA A;  2QTO A;  1O9G A;  2RNB A;  1XUQ A;  4FM1 A;  1XL4 A;  4MSW C;  4MTF A;  5BZB A;  3VQW A;  1QQC A;  2AXT Z;  4DRX A;  5DED A;  4DW1 A;  2UU9 O;  1TUB B;  4I9Q A;  2V1D A;  4QJF B;  2A0L A;  1Q3E A;  1AP6 A;  4ZHQ B;  5LGU A;  3A0H Z;  5L3F A;  5K1P A;  2Q8V A;  4UCO A;  4ZBM A;  1GM8 A;  5FNV B;  3BVO A;  4JAS A;  1V54 C;  2LO1 A;  2HHH O;  4JYB A;  4NKG B;  2Q7E A;  1NTM H;  4CZZ A;  3AG4 C;  2H3O A;  5EBL C;  2JGD A;  1ARO P;  2KB1 A;  2UXB O;  2Q67 A;  3BAA A;  1V55 C;  1Z5W A;  3MHH C;  5LHI A;  4LFB B;  1Y4M A;  3K9A A;  1F23 A;  2YIC A;  1KKC A;  2D3O W;  1CEZ A;  4QGP A;  3L73 H;  4O2A B;  2JS5 A;  4FLX A;  5EZY A;  1WA8 B;  3EXA A;  4JI1 O;  3L71 H;  4ZHQ A;  2DOS A;  3ZMU A;  4JI5 B;  1HR0 B;  4W4L A;  5HFL A;  1M5I A;  4R50 A;  4YJ2 B;  1IXB A;  1HNW B;  1OCZ C;  2BTQ B;  3AK1 A;  1NVP D;  4DR2 O;  3JAR B;  5LP6 B;  4UCV A;  2YIB A;  3HKD A;  1RSO A;  4LH6 A;  2OTJ V;  3MAQ A;  1CP9 A;  1S77 D;  3FB7 C;  4DV3 O;  4I4T A;  4DV0 O;  2LGQ A;  3FAV B;  1TVK B;  1COW G;  1IXM A;  2CTQ A;  4WF9 V;  1SF9 A;  1M57 C;  1MA1 A;  2ILM A;  1K5Q A;  1PL4 A;  4PDR A;  2ZXW B;  5LMN B;  3RYH A;  4JF3 A;  3K06 A;  5HFM A;  3P3P A;  4JTA B;  4JYA O;  1K4C C;  1FYJ A;  1J5E O;  4GX5 A;  2AGA A;  1P7B A;  1TA8 A;  4Z1V A;  4JI7 B;  1Z5V A;  2VQF B;  2ZE7 A;  1NR1 A;  1XHX A;  2P5O A;  3FX7 A;  1DF5 A;  3QO8 A;  4JPR A;  2E76 B;  4LF6 O;  2YIB D;  1YVW A;  3JSN A;  1R73 A;  3VOU A;  3ETQ A;  1RPR A;  4I55 A;  1E1R G;  3TXQ A;  3APO A;  4DK0 A;  4X89 A;  4I50 A;  3WFV A;  4XBF A;  5C8Y B;  4I5S A;  4JI3 O;  2M6Y A;  1PP9 H;  3G67 A;  4B3T O;  5TIS Z;  1FJG O;  2WLI B;  3JD2 A;  4N21 A;  1HW7 A;  2Z0A A;  3ZED A;  4LR3 A;  4F4L A;  1MSW D;  1F4N A;  5IE9 A;  1QR9 A;  1D5N A;  2LW1 A;  4PA7 A;  3G71 V;  3ZRX A;  2UXN A;  2B9Z A;  2C2A A;  3RYI A;  3BA9 A;  4IIJ B;  2A9H A;  3MHS C;  1XHZ A;  3Q4H B;  1YF2 A;  2DJV A;  2FTK A;  4UXN A;  3RYC B;  1H38 A;  4JI4 O;  3G6B A;  5EBM C;  4D7S A;  2W0F C;  4JI0 O;  5B1O A;  2QGN A;  2QKC A;  1S0V A;  4OX9 B;  2DYS B;  2YDE A;  3CE2 A;  1Q6U A;  2XAF A;  4O4H B;  2N74 A;  2QA4 V;  4UCU A;  2ZNJ A;  5E79 Z;  4X65 B;  1N32 B;  2WA4 A;  2Z5U A;  4XDK A;  4JI3 B;  5B5E Z;  1B6Q A;  4MVZ A;  3RWR D;  3RW0 A;  3ZN0 A;  4MW8 A;  4ZI7 A;  4FLY A;  5KMG B;  3UO3 A;  3JD1 A;  3CPW U;  3AG3 C;  1PM9 A;  3WG7 B;  5FPO A;  1S3J A;  2RJZ A;  1XIL A;  4P9O A; 
#chains in the Genus database with same CATH homology
 5B5E Z;  5B66 Z;  4UB6 Z;  2AXT Z;  5GTH Z;  1S5L Z;  5GTI Z;  4IL6 Z;  3KZI Z;  5KAI Z;  3WU2 Z;  5E79 Z;  5TIS Z;  4UB8 Z;  3A0H Z;  3JCU Z;  5H2F Z;  4PJ0 Z;  5KAF Z;  3A0B Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...