5GV7A

Structure of nadh-cytochrome b5 reductase refined with the multipolar atomic model at 0.80 a
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
272
structure length
272
Chain Sequence
b'STPAITLENPDIKYPLRLIDKEVVNHDTRRFRFALPSPEHILGLPVGQHIYLSARIDGNLVIRPYTPVSSDDDKGFVDLVIKVYFKDTHPKFPAGGKMSQYLESMKIGDTIEFRGPNGLLVYQGKGKFAIRPDKKSSPVIKTVKSVGMIAGGTGITPMLQVIRAIMKDPDDHTVCHLLFANQTEKDILLRPELEELRNEHSARFKLWYTVDRAPEAWDYSQGFVNEEMIRDHLPPPEEEPLVLMCGPPPMIQYACLPNLERVGHPKERCFAF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NADH-cytochrome b5 reductase 3
publication title Distribution of valence electrons of the flavin cofactor in NADH-cytochrome b5 reductase.
pubmed doi rcsb
source organism Sus scrofa
molecule tags Oxidoreductase
total genus 75
structure length 272
sequence length 272
ec nomenclature ec 1.6.2.2: Cytochrome-b5 reductase.
pdb deposition date 2016-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
A PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 5gv7A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 5gv7A02
2BM1A 3WNCA 2BM0A 2X3UA 1HA3A 3MCAA 3QE2A 1B2RA 1OGIA 1TLLA 2NPFA 2OK7A 1UMKA 2BSAA 2CNDA 3LVBA 3OW2B 1DARA 2DETA 1KD1D 5THXA 1VQ8B 3VNUA 4UAJA 1N0VC 2C77A 1KK2A 1YJWB 3AVWA 1VQMB 1H42A 1K9MD 3WNDA 1U2RA 4ZCLA 1EWYA 3U2QA 1YI2B 5H5JA 4ZGNB 3OZWA 3ZZTA 4QHYA 3SJZA 3P27A 5HXBA 3ZC3A 1EFTA 1E62A 2R6HA 2QTLA 2VNIA 1VQ9B 1DG1G 2EFGA 3U6BA 3JQRA 3ZZ0A 1J9ZA 4LC0A 4U9UA 3ZZUA 1YIJB 1GO2A 3CW2A 1TUIA 4LBYA 3CD6B 2VNKA 4YAOA 1W87A 2B5OA 3CB4A 3E20A 4B44A 4MYTA 2RC5A 4Y7CA 3I55B 1TTTA 1WDTA 2YWFA 5GV8A 4YALA 1NDHA 4Q7JB 2QN6A 4AC9A 1GVHA 1Q81D 4G1VA 1DDGA 2DEUA 5EMNA 3QFSA 1SM4A 1N0UA 2PLFA 2VNHA 4AF7A 2AHOA 1JJ2B 1VQOB 1DDIA 3PENA 2ZITA 3W2FA 5TV2A 4TN1A 2HDNB 1OB2A 1CNEA 4TMWA 1K73D 3CMEB 1VQ4B 3CC4B 1EP1B 3CCJB 1EP2B 1GAWA 1YHQB 1VQLB 1VQKB 2VYQA 3W5HA 4P6VF 1FRQA 3VO2A 4B48A 2DERA 3QSYA 3B82A 3CCVB 4PC7A 1I7PA 2HMAA 1Q86D 3CC7B 4NCNA 1W34A 1QVGB 3WBJA 1JA1A 4B4DA 1IJEA 1M1KD 1JB9A 1G7TA 3VO1A 4WQMA 3OJXA 4ZV4A 3WXMA 3AVYA 4P3YA 4RCZA 3E1YE 3OJWA 3CPWB 2OTLB 1G7RA 1B23P 1KK0A 3W2GA 5JBQA 1E64A 5KSWB 4LBWA 1VQ7B 1KRHA 3I56B 4TMVA 1JA0A 4ACBA 4DQLA 1D2EA 3CCEB 1TVCA 3WBKA 3ZBTA 1OGJA 2BGIA 1KTVA 4Y9RA 2QTZA 1R5BA 1FNBA 3FPKA 3JQPA 4R71A 1K8AD 2OK8A 4N3GA 2YWGA 1SKQA 1H85A 2PIAA 4M0LA 3FJOA 4ACAA 1VQNB 3AGPA 1YJNB 4PC3A 1QFJA 1EFCA 4BPRA 4ZCMA 2BF4A 2DY1A 1F60A 5TY0A 5TR9A 4C0SA 2OTJB 1Q82D 1QFZA 2C78A 1EXMA 1QFYA 1QGZA 4J0QA 3W2IA 5FA6A 4F7DA 4YAFA 2XNCA 3CRZA 4DQKA 1W35A 4HE5A 3CCQB 3I1FA 5AN9A 1M90D 1JNYA 1R5NA 4YAUA 1XE1A 3W5VA 4B43A 4YHBA 2QMUA 3VMFA 3OZUA 1NJID 3J81k 1KJZA 1FRNA 1QGAA 4G5GA 3CCMB 3QFRA 4RD6A 4M53A 4ZCIA 4RD3A 1ELOA 4TMXA 4RD2A 3AVUA 1GR1A 2BPOA 1VQPB 1E63A 2VNJA 1D1NA 1BX0A 2VZLA 4M2LA 2EIXA 2QA4B 1VQ6B 1FNCA 4HE6A 1IJFA 1IB0A 1FNDA 1R5OA 3CCRB 4TMZA 1S0UA 3QFTA 3CXCB 4ZGQB 4N3NA 2DCUA 4B3XA 1YITB 4PC6A 1QGYA 3B8HA 2YWHA 2E1RA 1GJRA 4Y9UA 2BMWA 3WY9A 3G4SB 4RJLA 1AIPA 3P26A 3WNBA 3G71B 4LBZA 4M4SA 1BX1A 3AGQA 4TMTA 1N8RD 4QFMA 1FNMA 4H9GA 3LYUA 2BGJA 2CRVA 3AVVA 1QUFA 3CMAB 3VNVA 2XEXA 2B7CA 3W2HA 3W2EA 3OZVA 2GPJA 3ES9A 4IW3B 3CCUB 4FWTA 3W5UA 1QG0A 3WYAA 1CQXA 1QH0A 2BV3A 2QEXB 3AVXA 2FX3A 3CCSB 1AMOA 2HCJB 2BVNA 3V76A 5GV7A 5DSZA 4G1BA 1EFUA 1KC8D 3LRXA 2XNJA 1CNFA 4M1KA 3ZBUA 4LBVA 2J7KA 4RD4A 1Q7YD 1G7SA 1ZM3A 3MMPA 1QVFB 3MHPA 4B47A 2QDXA 1ZM2A 1G7CA 1D8TA 3G6EB 2B7BA 4PGOA 1F20A 3AVTA 1ZM4A 1ZM9A 4RD0A 4RCYA 5H59A 3JQQA 2BN4A 3U6KA 4EH1A 4NBSA 1GAQA 1ZUNB 4PC2A 1BQEA 1BJKA 1S72B 4K1XA 4YAWA 3LO8A 2D74A 3B78A 3CC2B 1W2BB 1A8PA 4RD1A 1XB2A 3A1FA 2PMDA 3CCLB 1QUEA 1OB5A 4C43A 1YJ9B 3QFCA 1EP3B 1KK1A 4PC1A 4MYUA 2RC6A 1FDRA 2YWEA 1VQ5B 4FN5A 1QX4A 1KK3A 1KQSB 2GQFA 4FK8A 4AF6A
chains in the Genus database with same CATH superfamily
1DUSA 4XWTA 1DBRA 2Q1YA 2POCA 4CTKA 1DWPA 4RQTA 1S8AA 2J9GA 2ZYVX 4L8GA 3OECA 3AEUB 4RVUA 2O0LA 2QSUA 2HA0A 3T34A 1YACA 3TGPA 2FPXA 3LIIA 1FX0A 1CB7A 3PPXA 4ZVMA 3WXBA 2I6UA 1B42A 2OZKA 2ZWOA 3QE2A 3GJ8A 1L5MA 5LLSA 3CCFA 2OQVA 3V1MA 5HJ7A 5KYUB 4IEEA 1TLLA 4HDSB 4AN1A 3OF2A 1MH1A 5JVDF 3MT8A 4ON9A 4P4UA 2CNDA 2VCEA 4ZAYA 2R5NA 5CUQA 2XT0A 2C29D 3TLBA 3IAS6 4G97A 2R86A 1XHLA 1BEUB 3MHTA 1NKTA 2ADOA 3Q38A 1L7MA 1LI4A 3PR3A 5F4ZA 3MTEA 2DETA 1JG4A 5J5AA 4ER5A 5CURA 3TQOA 2A1UB 3C14C 4JUDX 5M04A 1IEXA 2M1XA 3OZSA 3RSQA 1IEVA 1U3TA 4XWGA 1R4ZA 2FWJA 4ZAVA 5HNKA 3VGPA 3HWRA 4LZLA 1P72A 1W581 2ZT8A 3E7XA 2PQMA 5DI3B 1L1EA 1KDRA 1R12A 1Z6TA 2YV1A 2PS9A 3BOSA 3RADC 1VGVA 1K9MD 3JZDA 2FEAA 4FMBB 1XJ5A 1U9IC 3CYFA 3PE3A 3HJTA 1A71A 1E0KA 3GZJA 2ZYRA 4HT3B 2ERCA 2XQGA 2FF7A 3OQIA 4L4UA 4XEHA 5AYVA 3ZWXA 1D2HA 3K6SB 1XTRA 2DX7A 1W8IA 2AUTA 4YMGA 3F71A 2YW2A 5K20A 3ANMA 3IHWA 4F0JA 2YFHA 3G88A 2YX1A 4LYDA 2ON6A 1R9GA 1BJRE 1HE2A 1HKHA 3RE1A 5ADUS 5ESDA 5A9SB 1NWHA 3H2GA 3WV4A 3LL4A 5HILA 4X05A 2GD0A 4JJ7A 3BYZA 3ROTA 1KR2A 2A35A 2IP4A 1TUEA 5ALUA 2QB5A 3QE4A 2NP6A 1Z6AA 2PSEA 5AK5A 1P6UA 2VJIA 1N32B 4ALIA 5KYVA 1I3NA 4FOTA 2SKCA 5CYOA 1DG1G 4ND5A 3IA2A 2ZJZA 5GAJA 4PE5B 3RVOA 3L8EA 3L7IA 4D9GA 3GEBA 4LC0A 2RAPA 2H4FA 4ARUA 1C4WA 3A4MA 3B12A 4C4ZA 1FMFA 1ECJA 5JSZB 1QGOA 1GLNA 4AIIA 4FXUA 1AGNA 1Z18A 5EUQB 1PTKA 1BHQ1 3QLVC 1MAAA 5G4LA 4JNCA 2C9YA 3MUFA 1U0FA 3AB3A 2ZS9A 1ZGGA 2FPRA 3GLUA 3S2YA 4DJEC 1Q17A 2DTDA 2FMUA 2Q21A 2VBIA 3E8MA 3FCAA 2HPAA 1O5OA 3QP9A 4W9RA 5C2JB 3OQOA 3CUKA 1XQWA 1PG0A 1TIPA 2WF8A 5C4IA 4M9UA 4YYZA 5CM2Z 1W36B 5DBOA 3IBFA 2A3NA 3BH0A 4KACA 3HR4A 2IV2X 5AXDA 1G98A 4UTVA 4JY7A 4MYTA 1UJCA 3LBFA 3OZDA 5J47A 5ADHA 2JFFA 3F97A 4EHBA 2ZUUA 1HURA 3GZTB 2YQZA 1HYGA 5FHQA 5GM2A 2LCQA 4X45A 5HKLA 6PFKA 5EINA 2BFFB 5A4AA 2Q1TA 3K0BA 1N3BA 3V32A 2I80A 4D74A 1GTRA 2I3AA 2YHIA 3A6EA 3FYUA 4N6NA 4W5OA 4V0RA 1RPNA 1P61B 1UP7A 1T4MA 3ZUPA 1V0FA 6YASA 4MLPA 3ZHTA 2HO4A 4QNMA 3UOWA 4O5OA 2C4WA 3IT1A 3TR0A 1OJ7A 2NQTA 4QE3A 1B1AA 1Q91A 3DZIA 2XKBA 3MQ4A 4PQFA 4U7HA 2O2XA 2HIGA 3LLSA 3U4QB 3B6KA 2YL2A 2VRBA 3EEOA 3LV8A 4A2WA 3FZQA 4HGNA 3FPFA 3L6EA 3MB8A 3MGKA 4YWHA 1NW8A 2AC2A 4V2UA 4B83A 1I0IA 2HREA 2VJMA 3NU1A 3Q9LA 3QXGA 2XUPA 2DHCA 2GERA 4GF5A 4A91A 1N0WA 1RHJA 5KAPA 3KUDA 3W4KA 2XD9A 2FEXA 3K0AA 2CNBA 5FPTA 2HK7A 1U7HA 4DWVA 1M6YA 4CL0A 4K2HA 3KVVA 3ZE7A 4LXGA 3HP4A 1OBOA 1GFWA 3BG5A 1E1LA 4G56A 5HQ3B 2Q4RA 3WOHA 5L45A 4WY8A 3BILA 4PEVA 1HOTA 5TV2A 1TU0A 4MW1A 4PXAA 1QKIA 4KOAA 3DUFB 5LB2A 2PRJA 5LOVA 2HWXA 2HF7A 2XY4A 5JD4A 4D5EA 4TTQA 2DQKA 1NUUA 4TMWA 6ADHA 1SBQA 2H31A 4M1QA 1CJUC 3CC4B 1DNPA 1NF3A 4XLFA 3WBBA 4UOZA 2H8GA 4KITB 2IYVA 5ES4B 5ITZA 1PL6A 3LBNA 4BRWA 1MQ8B 4ISBA 1JBKA 3MUOA 4U3JB 3ORFA 4LK2A 1GAEO 3RR2A 2QVCA 3DWEX 5DI9A 5KDOA 3TL3A 4DA8A 4UXIA 2G04A 4QBGB 3T7EA 2EW2A 3TTSA 1PJBA 5FO1A 2R11A 5BNWA 2ZBUA 1AQJA 1OX4A 1N1MA 4E0BA 4KR7A 3AKYA 1JVSA 3GJZA 4RK6A 2XYQA 5CVVA 1RQGA 5K1ZA 5ICSA 2VTDA 4N12A 1GKYA 5K3SA 1YS6A 3TZKA 3A1TA 3UXYA 4MSUA 4UHDA 2CC2A 1JS1X 4DJJA 1J23A 1D6NA 2D1RA 4W6ZA 3R9WA 4DM3A 2CXQA 1N33B 2FAXA 3FKJA 4WGFA 1JPVA 2FPKA 2I3ZA 2VZEA 4PGGA 1NXXA 2O5VA 3WGUA 4ZV4A 1IY9A 2XYRA 3BXFA 2Q5JA 3LU1A 3JW8A 3PP8A 2PO5A 4P3YA 4YRAA 5T3YA 3I34X 3IALA 4RPKA 5KEIA 2AW3A 2DHRA 2J31A 4GGMX 1HTBA 2ZTNA 3DAPA 4HTFB 5F21A 4A1OA 3BS4A 4BCDA 2G77B 3P0RA 5M29A 2RK4A 4I9UA 2HA5A 3FR7A 1OTXA 3VH1A 2ZRHA 4WK6A 5FL3A 3Q6QA 2DZDA 3PLNA 4YUAA 3OQNA 2H48A 1M2EA 2V4DA 3B3JA 4KKXB 4AZWA 1XQVA 4PX2A 3VPDA 4LFBB 4KKUA 2PN1A 2NV6A 1J07A 2GZRA 4HPXB 1E3WB 1C4OA 1VB5A 4X7EA 3ED1A 1MUUA 3QYFA 4PX5A 4JVSB 2VTEA 2A57A 3K0CA 1TPYA 3CO0S 4LJ4A 1FNSA 5CJ2A 4KKSA 1OXUA 4G01B 5ALQA 5EKSA 5I51A 2LKCA 5AK0A 3CS3A 2YDYA 4QL3A 2GA8A 4BNNA 3PFCA 2OXIA 4DCCA 1PV1A 1KFKB 3K73O 1EQAA 2HNAA 2RI0A 3ESZA 2R1ZA 2R96A 3G5MA 4UHBA 4LF6B 1X8XA 4YAJA 1LZKA 5EXXA 2Y0EA 3PWKA 3WIOA 4LX8A 1XCMA 3PWSA 4NJEB 4ESHA 4HYEA 1SY7A 4X64B 3G9TA 1XFDA 3JYQA 2XTNA 4KXYA 1YMUA 1XUOA 4Z8XA 1NLMA 1N5DA 2H1WA 2HWUA 4CF7A 4PABA 1KWGA 3I9V6 4YGXB 4CIAA 2CBXA 4B35A 2QNRA 1YJNB 3CP8A 1CUWA 1VRWA 4RFSB 3UMVA 1NIJA 2N3ZA 4Q7LA 2ZTHA 2X4GA 5BURA 2OC4A 3JS5A 4Y6RA 1WTCA 4MQEA 1GNRA 2IYSA 4D0RA 5JD5A 3NCHA 4BJHB 4F9GA 2I2XB 3IQHX 5FBZA 2JJ2A 1U90A 1MTOA 3LVQE 1GEEA 2YRXA 3QLUA 4FMDF 3TVYA 1KZ4A 5TR9A 2RKWA 4LC9A 4K6GA 2V96A 5DN6A 4IJQA 4ZO7A 3VR5H 4FX2A 4GX1A 1CK4A 5TIIA 1V3VA 1L5YA 2Z3ZA 4D3ZA 4DDWA 2K2QB 3OCCA 2FQWA 4H18A 3O1LA 3F73A 2W11A 2CHUA 2CL7X 2IOFA 1U6IA 2NU8B 4L08A 3C7TA 1X87A 3CRZA 4HATA 1F8GA 3O8LA 2PSSA 2G8LA 2VRWA 5DXFA 4MS3B 3OZTA 4ESVA 5DHSA 1ISMA 4U00A 4TYNA 3C3KA 2P8JA 1LUAA 3JASA 4JENA 5CXQA 1QQTA 1JHQA 2YWCA 5HCNA 3R5KA 4FYMA 4OBWA 3PXDA 2P27A 1B6GA 2UUPA 3LFTA 3W6ZA 1VPVA 4B85A 4C1BA 3WG9A 1TKRA 1V9SA 2CMKA 1DJQA 3SKYA 1PLLA 2C54A 2NT3A 3TX2A 3KKPA 1QV7A 3EUWA 2WWYA 1GPYA 2JLAA 1X1TA 4PZ0A 1YBMA 3LG2A 2X2PA 4D98A 3O9VA 4MIOA 3L7JA 3K8QA 1N2XA 1TW3A 1NJID 2D2VA 2OFXA 3PJFA 4IIEA 4J1QA 4C06A 3ABSB 5A62A 1KFJB 3LLUA 4QOFA 3UYLA 2G06A 1ODTC 3CT6A 3FB1A 4ML3A 4QA9A 1PW5A 4RNDB 1FDSA 1AGRA 3AJ9A 3GNTA 3MWLA 2O8DB 1E79D 3ZJUA 3AJAA 1WDWB 4KFCA 3OTIA 4K3VA 1D9ZA 3A9VA 3SEAA 4P83A 5ECWA 3UMSA 1UBNA 4J75A 4YV7A 2O3SA 3H9JA 4X8MA 3VSBA 2FDRA 3FCSB 5BYAA 1A9XA 1FOEB 2QQEA 1HT3A 1XTJA 3WMFA 3UMYA 1NQAO 2A92A 2H1HA 4Z7QB 1ETHA 3HE3A 4I4NA 4BCBA 1SUEA 4RHCA 1TCCA 1JZQA 1SUBA 2CEKA 2QU7A 4MX8A 5CVUA 1YR9A 5EKDA 5LZ4A 3OEEA 3ITEA 4R0MA 4RLSA 3IKVA 2ZAGA 4W63A 1BS9A 1IB0A 5IYPA 4GRDA 2VDVE 2AHRA 4TV8A 4RDKA 2PBRA 1IUOA 2DBRA 1XDGA 2HSWA 2KPOA 1JMVA 2Z2XA 3FAKA 3DPSA 3UJAA 2ZULA 4CQMA 2Q2QA 1TF2A 3ESBA 4IZOA 3HDJA 1U8FO 4BTEA 3C7DB 3F5DA 3HV2A 3B1FA 2ZRPA 4HRXA 2NZ8A 5CX1B 3H84A 3UC5A 3CZ5A 1AB6A 2KWIA 2XHZA 1YIDA 1KYXA 2I9PA 2Y93A 3WGKA 2Z5LA 3KSAC 2VQ3A 5TPWA 5EPOA 5I9SA 1E2GA 5A6SA 1D0VA 4AN4A 4CHTA 4QNNA 2OB2A 4IICA 2O59A 4QRDA 4XPZA 4LHYA 1U0TA 2XR1A 5EC8A 3OAAA 3MJTA 2WKRA 4AX4A 3FYDA 2HL6A 4FB5A 5EYPA 1WUKS 1VLVA 1DXQA 2ZJ2A 2ZYUX 3GRUA 3IBTA 3L77A 3PWZA 4L2IA 5ESWA 4JI1B 4YP9A 1RJ9B 5D8DA 3LYUA 2P9JA 4M9QA 3B6JA 2JGAA 5LP6B 2X4IA 2GHRA 4UHJA 3IPRA 4QT4A 2CFRA 3QBEA 4NAHA 1TF5A 1AS2A 4E88A 1ML4A 1IN7A 2QUZA 3AUJB 4IIXA 4LY3A 4XRRA 1ZESA 4AO7A 1JKIA 5C8DA 3H4MA 5CVTA 2BYTA 5IYRA 2R66A 2QF7A 2FP4A 3G49A 2QYSA 3BMNB 5CFMA 5AW2A 3P4YA 2RHJA 4FLEA 2G1AA 3RANA 5BNZA 4JLAA 1RRPA 1NJ5A 1M8GA 2JLSA 1WTHD 1BROA 5KOJA 1O0CA 3KQSA 2OEPA 3UJ9A 4HF7A 2WA2A 3O1HB 1KEKA 1MRSA 2P62A 4RMJA 5F52A 3V34A 2HO5A 1Y1PA 3DT6A 1XK7A 2BFNA 4JKOA 1IHUA 1RQPA 3LKZA 2F3RA 2SICE 1E3MA 4UDNA 1QGED 3FCEA 5FFFA 3V76A 2AEMA 4V0SA 1I6LA 2WNHA 1LC0A 2WC1A 2GMWA 2JCVA 1DX4A 4ZYZA 1KC8D 1D6JA 1NBME 2XDYA 3F5FA 3VPFA 1VSUA 4GUDA 4BAGA 3EG9A 4F71A 1OH7A 4LYYA 1U0BB 3CSSA 3E4DA 3I6YA 4ZDKA 5I7VA 3HB9A 4DLZA 3QF4B 1QP4A 1DUIA 2B0CA 2R8YA 4BL5A 4DZRA 2WWTA 2GPSA 1DJNA 3WLAA 1OE0A 3IERA 5IKXA 2VAMA 1I8DA 3MXOA 1XCBA 4QATA 4XDHA 3GPCA 2HRCA 221PA 2AV6A 4RY0A 4UNRA 2X5XA 4LE1A 2H4WA 1JFRA 2UUAB 2FR1A 1X7XA 4X7CA 2JJ1A 3D6HA 4HAOA 2WIJA 1O08A 1SFRA 1V8ZA 2C31A 1XTQA 2H08A 4RQBA 4XGKA 3ZGOA 1M0EA 2Q99A 3ABZA 3KOWA 4LOHA 3ANLA 4OFXA 3VGJA 1ODFA 4EKNB 5IJ0B 2Z95A 4PU0A 3C1AA 4D42A 5A3QA 1ZCBA 1XXLA 3A3OA 3U6KA 3COJA 1HEUA 3EW9A 4LHXA 3I61A 4EJ6A 4JLMA 1JQLB 3UWSA 3EGXB 4D96A 1DBSA 2AJ8A 1UEIA 1XNGA 5J4YA 3GQBA 3DM9B 1U3VA 3C7AA 3OFVA 3ASVA 3BBPA 3OLYA 2MSEB 4GMGA 1Y7TA 3LH5A 4JL6A 4JX8A 3QZUA 1FCJA 1RHUA 1Z5ZA 4LOJA 1NJSA 3INNA 3TK1A 4OK6A 3FUCA 2WNIA 3LO8A 2YYYA 3JYNA 3L7BA 3JATB 3AHCA 2JEYA 1ULZA 3DQZA 2QTAA 4J3JA 4CR6A 2Y0DA 3TLKA 4EO4A 3RU3A 2Z8YA 1CC1S 1YE3A 3N87A 4A0GA 1MHTA 3UT5A 2CB9A 3NJRA 1IMOA 1DFHA 3TL6A 2Q2WA 3TSCA 4BO5A 2Q8NA 4YRNA 5IJ9B 4TL8A 3CEMA 1BOFA 4JUBA 3WZMA 4CM1A 4TKVB 5AVUA 1ZKMA 1A88A 1U3CA 1U0EA 2BI7A 1VHEA 1HYEA 3MCUA 3H5VA 2PKXA 3UK2A 4D9EA 4DT1A 1XXHB 2FE4A 1ZUIA 1U3WA 5JZMA 2J3DA 4NP6A 1NOIA 3GT3A 1PFGA 2NU7B 1J0XO 1TYBE 2PA3A 4ZAFA 1YGPA 2IBTA 1NC3A 4MK4A 5BW5A 3EVTA 1JEDA 2CVFA 1L4GA 1EX9A 2IUFA 4KG7A 3K0SA 2WZBA 1PQUA 5B6PA 4OXXA 3TXAA 1D9XA 3TE6A 1Y63A 3OUTA 3WQHA 3LPDA 4EUEA 4MPPA 1XU9A 3ZNQA 2JATA 4KZPA 2I2WA 3CWCA 2IELA 2QMQA 1D4AA 3UMFA 5I8WA 3UMMA 1CRZA 3N0WA 1Q57A 3FWPA 3NP7A 5F4JA 1P4MA 1DI0A 3TQIA 4LF9B 1WVMA 5F5NA 2HAEA 5A5EA 2WV7A 3EVNA 3Q0IA 3HUDA 1IBSA 3G5TA 5AVTA 1WLYA 1DEHA 5CIQA 5JZOA 1K4YA 1H0HA 3GO4A 4QG7A 1V96A 2YVUA 2EKBA 1HDCA 1YBHA 5DHPA 5IKPA 5K6RA 3LBHA 3NWJA 4GKVA 5ICEA 4G0MA 3DNMA 2DQZA 3KLBA 1EGVB 3GVKA 1Y4DE 4RU1A 1Y1QA 3FLBA 3KEOA 1YL5A 4H7PA 4HDKA 4O4IF 1RDFA 3K1YA 1M0WA 1R6DA 4GQBA 1RRVA 2NWQA 1YZVA 4L8LA 4LZPA 1W0JA 4DQDA 5BW8A 1VB3A 1CJBA 1FFEA 1OLUB 2ZBRA 4YJ3F 2YYAA 4UE2A 2IEYA 3VZQA 1IE3A 2GS9A 1QYWA 1E2JA 1US8B 3M89A 2DECA 2QJFA 2YJ5A 4HNVA 4TYYA 3Q7SA 2VS1A 1FQKA 4ZCLA 1R0WA 5B1IA 3NHSA 3UK1A 4FNGA 4QUBA 3DCNA 4I55B 4OOSA 3MTAA 1T1RA 4W4TA 5H5JA 3WLKX 3JWEA 3F7MA 3ACCA 4K0RA 3GLIB 3OZWA 1A4RA 1CY2A 2PLWA 3A6ZA 1TM7E 3LT5A 3OE7D 3EGWA 3TGLA 1U0GA 2A0WA 1QE3A 5D6OA 2NPOA 1PRYA 3JQ9A 3H3JA 4TRJA 4NFYA 1EFTA 3SK0A 4BFUA 2W4MA 1X1AA 2FPPB 2Y27A 4U6SA 5H3LA 5HIJA 4IJ5A 4ZVVA 3SR0A 2IYWA 4DLVA 5BQXA 4KR3A 4WTOA 3TLYA 4YV2A 1QRSA 3OPYI 4AMUA 1IPFA 1DRUA 1EK1A 5GGYA 3ULKA 1IBLB 2B8EA 1JEAA 2Q5EA 3QXHA 2ESRA 4REMA 3J80A 3BXXA 4P38A 3QLVA 5JIBA 1PKVA 1NRKA 4KDFA 2VL7A 3AUSA 3EF1A 4W5RA 7ABPA 3F4LA 2DFDA 4MLCA 3T8YA 1NUTA 4MGIR 2X13A 2ZCJA 1P18A 1PQ4A 3TM4A 5IEJA 3F3KA 2G70A 3DE4X 1JX6A 4KYTA 1KEPA 3MJFA 3HHPA 4XCQA 4YBZA 1NJ6A 2F55A 2MSKA 3HGTA 2QGNA 1E2NA 3NGMA 4MV6A 1IC6A 3I62A 1TZ2A 1W5EA 2R6FA 5IEBA 1QLWA 1B8VA 3I45A 3K70B 4ZJPA 2YUTA 3HO1A 1YFKA 4OB7A 5DP2A 5J2TB 3ZWVA 5HTKA 4RIEA 3IOYA 5KOHA 4I1IA 4FT2A 4GI1A 4Q00A 4DCGA 1K97A 2O4CA 4FOSA 1CERA 2YWFA 1OFUX 1Y0RA 4WFIA 3SC6A 2PAAA 4P9SA 3FNHA 1HFEL 1LS6A 1YASA 1XEXA 1Q7GA 4EY8A 4RJIA 5GJVC 2F3SA 3K3PA 4WJLA 3KJFA 1VJDA 2VKTA 3GNSA 1GVHA 3ZHVA 4ND6A 5G4KA 1DELA 1R6TA 3BFKA 1KSGA 4XUCA 1W9HA 3LHFA 1FDOA 4I9GA 1DDGA 1PT8A 1IVSA 4ZOBA 3UW3A 2DEUA 3EZFA 2PIDA 1ABFA 2VXCA 3FLAA 1H0KA 1BAPA 3P9IA 4IIGA 2FDXA 4G5OA 4R5HA 4A0RA 5K8VA 4C2UA 4CGYA 1OY1A 4PLYA 1N07A 3PIRA 5AI0A 2JK1A 3E5MA 1BFKA 3TX6A 5C8YF 3CN9A 5KU7A 4BMSA 3DBRB 1HC7A 5BSGA 3B1YA 3CNOA 2IE8A 3L0ZA 3OSZA 1D2MA 4P35A 2WWFA 3T5TA 2OCKA 1VQOB 2C04A 1IK6A 2AFRA 2PVPA 3I2FA 4O33A 1H2EA 3PENA 1R37A 4Z3KA 1ORHA 1R15A 3U3DA 3EAFA 2A0UA 2QVZX 4PYQA 3NBKA 3OZAA 3OH8A 2FFQA 2POQX 4UNNA 3T95A 2AMFA 5CB8A 3D3EA 1OYOA 4HNSA 4BXOB 3UJPA 1BMTA 3KS9A 3CVUA 3ICVA 2DRIA 5HQTA 1WA5A 2CLHB 3BQNB 3PQFA 4XOUA 4BDTA 2X3FA 1Q11A 2JFXA 3C3CA 4OI1A 5AW0A 2QDKA 4MP6A 3H9NA 2VRCA 4YJDA 5F1OA 5JC1A 2P2LA 5BSYA 4QOEA 1UD6A 3L05A 1A7JA 4DV4B 1L5ZA 2Q9UA 4EVRA 2RJNA 4DCVA 2E37A 2CXUA 1X2BA 3H1FA 2JGKA 4PCAA 3CCVB 1EWKA 2RKBA 5HMLA 3H75A 1FPMA 1WZIA 1JZSA 5JYBA 1NASA 2Q8QA 3BWYA 4IFTA 1OREA 1NJGA 3IEUA 4YXWD 4Z7JA 4P5EA 4AS1A 3JY6A 1T9BA 5C7OO 2PSDA 1P39A 4QAQA 3INRA 3SI7A 1VA5A 3ZCPA 1UBMS 5B6JA 2GO7A 2YFYA 1CUYA 1EUDB 3INTA 4ZEWA 2BEUB 4C5AA 3PKIA 1EBFA 1JA1A 2DJIA 1U9CA 1VBFA 3ETGA 5DIFA 4XUDA 2AKEA 4B4DA 2E49A 4O4LA 3H8WA 3HP7A 3FHTA 2QSJA 1M1KD 2NT4A 2O8NA 1G7TA 4ZOQI 5IM5A 1U7TA 1ZVMA 2C98A 4Q19A 1R2QA 4U2KA 3D6JA 2JZNA 5LZ8A 4MMYB 1SPXA 5J35A 2DU8A 4CKZA 5BXQC 2DYIA 4OGLA 4J4HA 4C4SA 2HT6A 4X85A 4AZVA 2B1RA 3LYLA 2DR3A 1FDVA 4KIGA 5JAZA 2IUYA 1W46A 1P1KA 4H1VA 4CMEC 4NMXB 5AVVA 2OV4A 1WCIB 1IG3A 5AK3A 5DKFA 1MB9A 3DAFA 5B4VA 2REXB 1ZMBA 1RBZA 2MDTA 3Q2IA 2XT9A 1VQ7B 5D3KA 2J5BA 3K2QA 1T4CB 3RIYA 1F7UA 5L3VA 3KOZA 1PFQA 4NBVA 3FUVA 1Q2XA 1D2EA 2VJNA 1GNTA 2GBCA 5HKAA 3UUGA 1XLWA 1TJ4A 4QUJA 1N9ZA 3HZHA 1KTVA 3K9CA 3T9FA 5ARBA 1UWVA 1V3QE 3EPKA 2FEWB 2FHSA 4X3PA 1TOAA 3CISA 1LX7A 3EEIA 3JPWA 1FVXA 4JC4A 2D0IA 3WR5A 1B6TA 3CMCO 3M49A 4S0ZA 5KPDA 1QO0A 3CZQA 4WIAA 5LQUA 4YJ2F 5KNCH 3CQ9A 2ECKA 3H0CA 3KTAA 3NRJA 3Q87B 2YHUA 3NEYA 3H7IA 1DXHA 4M6WB 4Y2VA 1P0IA 2WDZA 4C87A 4ESEA 5C46F 4XIFA 1E2KA 4GOOD 2FFBA 4MTCA 5FJIA 5IMBA 1EX6A 2HRRA 1IHOA 4OGFA 5AI5A 1TVMA 3RSLA 2N47A 2RCNA 4CM4B 3SWWA 4WZTA 2FUG6 4WLNA 5CFNA 2AOUA 4DKJA 4BFVA 4LS3A 1X77A 3CLSD 2ABWA 3HKDA 3H4TA 1OVGA 4RXMA 4BE4A 2QD4A 1JQKA 4IQ8A 1OLSB 5HXAA 2QI9C 2BF4A 1AKYA 2PWZA 4MWEA 5ALJA 3RFVA 3CEPB 2P9TA 2VUTA 3BRQA 3D0KA 1T8WA 5BN5B 1XMQB 5I9TA 4Z2YA 3KNZA 3QU2A 4RKYA 4DJAA 4R8RA 3GUVA 3PA1A 2I5PO 2RHDA 4QU5A 1XPRA 1W8DA 1SN7A 2CW5A 4MKXA 4F86A 1UEJA 3DXYA 3SLDA 3IAXA 3OE4A 4MW6A 4U6NA 2JI8A 4JAVC 5CHEA 4ZCTA 4ND3A 1PHPA 2WJ6A 5BRNA 3L7MA 3KT0A 1FJGB 1GZVA 2Y1LA 1U28A 3RTCA 1IWOA 4OMCA 5JMPA 3LC2O 3MLBA 4U9HS 2F67A 4ALMA 2ZZNA 3MT9A 4HV4A 1ZHFA 3QKRB 4M88A 2DUMA 2YIJA 4M21A 1Z35A 4UPEA 1PO7A 3VZRA 2R6ZA 1GNLA 2J07A 3BSFA 4G84A 1LRLA 3J81k 2EARA 3TLJA 1FRNA 2UUCB 2ZS7A 1K6IA 3MWEB 3O31A 4R05A 3S1AB 3FHCB 3WIBA 2YJZA 1HNZB 3A1CA 3SOPA 2Q5IA 1JT9A 1WE2A 1GD1O 2XV1A 1URPA 3IVRA 4WXHA 3TE7A 5JAIA 2ZRBA 4RENA 1IBRA 3DPIA 2G4VA 1QPBA 2RSLA 1VYVA 3M6AA 3O8QA 4Q1EA 4IDOA 4P25A 1GFIA 4WDRA 4FVTA 1I2MA 1A8IA 1R3UA 5J59A 2BPOA 3JARB 4X7DA 3GDOA 1KI6A 3PC8A 4HAIA 3IEVA 1E1MA 3N05A 3MOIA 3PXEA 1CY6A 2P5UA 1P4JA 5JSQA 3GN1A 1QRDA 1SKBA 1V4NA 3A1DA 4S0XA 3MINA 2D8MA 4KXWA 3NWPA 2VLIA 2X8KA 4HE6A 2ERYA 3K4PA 1YA6A 4GPIB 3E5HA 4WZEA 3D64A 4JV5B 3LECA 4RTMA 4CKWA 1TC1A 1I1HA 4GQAA 2B69A 5IASA 4FWIB 1M5RA 5ELXA 1PQPA 4LF7B 3CXCB 1ZIPA 3Q88A 4FKZA 2ZCVA 4ZI2A 1W29A 4OTZA 1JVNA 1SUCA 3ETNA 1FSFA 4PNZA 5EKXA 4AP5A 1QH8B 3B70A 3CBGA 3DG9A 3BSYA 4JLWA 2AI1A 4TRNA 1UMBA 3M4JA 5BSXA 1G18A 2JJQA 2AG1A 2B2XA 3U4CA 3RPEA 4EDFA 3U44A 3AXSA 2R00C 2KSQA 1XV5A 2CYAA 4PPGA 1VHJA 4GNKA 1Z5NA 2H29A 2ZATA 3AP3A 4BNVA 1HMPA 5K8JB 1VPEA 5BORA 1RRFA 3FHLA 1G4AE 721PA 5F4OA 3EDRA 1GG8A 1L7EA 3FMGA 1SMKA 5ESRA 1S3FA 2O07A 4YUYA 1FX1A 2F1JA 2J3LA 4TMTA 1QCCA 1N34B 4LCBA 4CM8A 2QTHA 4N9QA 4F60A 1H2XA 2G3YA 2X9GA 1P9LA 2BEVB 4RXTA 1TUBA 2Y68A 2AFIB 3P9XA 1H6BA 3EOBI 3HJCA 3NH6A 3TTWA 4EPWA 5CEEA 3WQSB 4MYDA 4DSZA 3M1IA 3ZLJA 2BCEA 1DTWA 2AMJA 2NXNA 3A8JA 1CIPA 1WOMA 2F1IA 2RI1A 3BTSA 3OE5A 5SICE 3Q4GA 2XXAB 5JNVA 4M1OA 1DAGA 4DUZB 3HXQA 3ZNNA 4FW9A 1JJFA 4E0FA 1TO1E 1L0BA 2KQUA 2XOKA 4ROTA 3C43A 3EF3A 1BU5A 3I0ZA 2OGUA 2D3LA 2O9JA 3EXHA 5CHYA 5P8WA 4CNQA 1Y7HA 5I7EA 4LMBA 1WXHA 2OWEA 2COUA 1U99A 5FF9A 5T57A 4BYMA 4Z4HA 5HS6A 4FWTA 1ONPA 2ZYTX 3NG1A 1YB1A 4IL5A 2IDKA 3IUNA 3KEQA 3CPXA 1UC8A 3BGVA 3D7LA 3I9NA 2VG8A 1NYQA 3EVEA 5E9AA 4GC9A 4I50F 1NUQA 2FX3A 1GQRA 3ZDFA 4DPKA 4Z1OA 4L8JA 3U56A 3BXOA 1KZ6A 4N3AA 4YHHB 3GP5A 5DSXA 4MZXA 3HWSA 4E3ZA 3K9WA 4CEJA 2YXPX 1UF9A 4G9GA 8OHMA 1DKPA 4DWWA 3AK4A 1EWTA 2CMGA 2FW8A 1VXRA 1JYSA 5FI0B 4QU8A 5DM70 4TKUA 2VP6A 3TG2A 1JDUA 3OESA 5CB0A 3RYTC 3C7CB 2FUEA 4RZ2A 3UJDA 4YRSA 1GT6A 2VCHA 3L0PA 4WOBA 1L4UA 4AMBA 1U4SA 2YDXA 2ZPAA 3KXDA 1JYFA 1MC5A 1QZTA 3P9YA 1XZ8A 4N82A 5LQJA 4KN5A 2QMEA 3KJIA 3G1TA 1WB6A 4BO0A 4DSUA 2VQEB 5EKTA 1O94D 1GPBA 5F1YA 4X8OA 1DTEA 1DWOA 4GQIA 3C6KA 3B3QA 2OXTA 3MHPA 2ZUBA 1T2EA 3QK7A 2HADA 5H02A 4BB9A 3CUSA 2LPMA 4Y3UA 2VPQA 2RGGA 4CMIB 4XLAA 2P3LA 4IZIA 3Q3VA 4P0PB 2Z08A 4X41A 2EBWA 4M7RA 4UVIA 1ZM9A 4MKGA 4BKQA 3JQQA 4G36A 3HEAA 3AR8A 4MICA 3T15A 4PHTA 4RWEA 4AJHA 2P69A 3CKYA 4IKOA 2BFPA 2QQGA 4NBUA 4OFZA 4JYBA 2QJWA 1H3FA 2XUGA 3CUEF 1QQ6A 1N7IA 3EXFA 4CM3A 1A7KA 4KN8A 1QVVA 4NZ9A 5CD1A 1I9GA 1A9ZA 3OOEA 5CB4A 2CXTA 1FP2A 1T5SA 2BFBA 3H11B 3DKRA 4MUNA 3VI4B 3EH1A 1FYWA 5CLJA 2V6MA 1VG9B 1W4RA 3QOYA 1UD5A 2HU8A 1AVTA 2IYLD 2QG4A 5DLYA 2Y92A 3T0GA 2YXLA 2VDWB 4CIDA 3IEKA 5J2UB 2NO4A 3G2HA 4IV8A 2H1OA 3AERB 4P7FA 4HAXA 2V59A 4R2WA 4F5ZA 1M34A 2W4IA 1F7VA 3B3FA 4WUTA 2AC7A 1V95A 2EZUA 4JXZA 3DDZX 4ZT5A 1O95D 4JVLA 4MYUA 1UXIA 2BZGA 1BKYA 1XVVA 2C9MA 2N1BA 4FN5A 1JHXA 3BJRA 2YZ7A 1EUCA 2R97A 1NXQA 4MWCA 3CVXA 3CZRA 1P91A 2QGZA 4OHVA 4X95A 4AWBA 3NC4A 2GYUA 1NQOA 1V43A 1BRMA 5JATA 3H2IA 3KEFA 2M6RA 3FA2A 4UD2A 4CEHB 2WOOA 1K66A 2A7QA 3L8CA 1MP0A 3O2JA 4RZIA 3RRXA 4E3WA 3MSCA 3LC1O 3RLIA 1ZGBA 5IVDA 1TO2E 1J70A 2V3WA 3AHJA 4M38A 4XEUA 2FB9A 2IOQA 1B2RA 1TNDA 3FF1A 3GLTA 1OGIA 3LDGA 4L0DA 4LMPA 5FR1A 2QZSA 3TNDA 1ZL2A 2FQYA 1H1LB 3NHMA 4QSMA 4C0QC 2I91A 1C29B 3U7EB 4KK3A 2FZ4A 3UJCA 3DWIA 3USCS 1Q74A 4INOA 3DL7A 3AZOA 5D85A 1O7JA 4QYIB 4CT4B 1Z0SA 2YH2A 1BS1A 3A1SA 2R2AA 1JAIA 4JT8A 3DDOA 3JYPA 4K81B 4LY6A 3WADA 5BN3B 1C14A 2BHLA 4YJFA 1FXWA 4EQ6A 3LTEA 4D8WA 3IGFA 2YV2A 1Q21A 2R60A 1GGHA 1W1WA 2HJHA 4LPSA 2QORA 2E1BA 5F4MA 1Q1BA 4NS1A 4BO3A 3A6DA 3KAJA 2PRKA 1GLGA 2EBHX 3MAGA 2E7ZA 4HNUA 1Z7EA 5ALWA 2UVPA 3CSUA 2VDKB 1PSZA 2IPOA 1S7CA 5ECDA 1KU0A 2NSHA 2R85A 2X9VA 3FETA 3HO6A 2A9QA 1U2EA 3RV4A 3BWMA 1ZJZA 2YV3A 4BNZA 4KFUA 4GLOA 4PANA 2H57A 4RV9A 4CTMA 1QG2A 1FYXA 2CNWD 3BL6A 1KZ9A 2OPBA 3W1EA 1GYQA 3N8DA 5DK4A 3BJEA 1NVXQ 1T91A 3WFZA 1E4OA 4G7XA 2EYQA 2WF7A 3DE7X 3NEJA 4Z9BA 3ZPNA 3H04A 3B1ZA 4DVJA 2WUVA 3WDLA 5HPYB 4XOPA 1H65A 1FS6A 3SIRA 2ZVDA 4JMPA 4CUJA 2AWOA 4QGFA 3PCXA 3I64A 4Y1GA 4IVQA 3LKDA 3IP6A 3JPYA 1K0UA 3Q3GE 1MBZA 3ZDRA 3GRCA 4MIEA 4DMFA 2ILVA 3U6BA 1WABA 3V5NA 3IC5A 1R0LA 2QZPA 5A06A 5A2GA 4QWWA 3OKFA 3RRJA 3WGLA 3LY5A 1W36D 3CW2A 1K5DA 3A6LA 4CWAA 4WBSA 1MJGA 3EGOA 4BC0A 4RTNA 4DC0A 4YAGA 2D13A 1U65A 1U81A 4X7FA 1Z4NA 1DRKA 4NIMA 2QTCA 4MAAA 1T2DA 3FWHA 1WTAA 4DV1B 4KO2S 1Q0SA 3X44A 2I4IA 4NABA 3A25A 3RVPA 1UFQA 1ZFNA 3GJXC 4E12A 3WMRA 2PXHA 1MO4A 4OHOA 3D4PA 4KC0A 5C80A 2RC5A 4Z4UA 2BTQA 4EF5A 1XZPA 1RC1A 4M76B 2WQ7A 2XAAA 3FD8A 3FYTA 1BE0A 1WXQA 3R0ZA 5GV8A 3V8VA 2NZJA 1SXPA 1BN7A 3SEQA 5FL7A 3O73A 2BSXA 2JZOA 1JZTA 2KM1A 4NAUA 2XDAA 2FRDC 1HX7A 2FUNB 1A76A 4QPPA 1NFRA 4L1KA 2CJYA 2HLDA 3AILA 4HGQA 1TVKB 1Q1QA 4Q1BA 4B80A 1GV1A 3LT1A 3DW1X 3MB5A 1L7NA 1ULUA 1DX6A 2CHGA 1D5WA 5EMNA 3W3ZB 3VYVA 3LUPA 3QXJA 5TC4A 2XW6A 4RF5A 3FMIA 1OILA 2F48A 1E3LA 4E7PA 1I33A 3IL2A 2W6MA 1RM5A 3KOXA 2X22A 1L3BA 4KDEA 1MDBA 1COWD 3TN7A 4J7XA 1YIAA 3E61A 1Z6PA 2KHZA 3FFBA 3IB6A 1KEEB 3ZD8A 3OLWA 4PBRA 1PL0A 3QX7A 4KV9A 3R3HA 4QEKA 4RK1A 5NLLA 1FW8A 1OBHA 4JI8B 1YJ8A 2QR2A 3KE9A 4QFDA 4WESA 4F46A 1K5GA 4Q16A 5U4XA 2WYHA 3VOSA 4GE3A 3IHLA 5HGXA 1NQWA 4Q4HA 3KJZA 2VFAA 5HIAA 3FWZA 4L5JA 3K0EA 3R8CA 2JLCA 3NW9A 4UFPA 2DQYA 1UFOA 3RYFA 4GICA 4M89A 4UQLA 4DNPA 3HABA 5C31A 1G4HA 4ECAA 1AZSC 1PKEA 2G09A 3BFVA 1PNQA 3ENZA 2ZB2A 4M1EA 4Q6BA 2ZYGA 4XD7D 4E1AA 4F4HA 4ZJUA 5CD9A 2XTAA 2P3SA 1Z45A 3N3BC 5AW9A 4AMGA 2KMLA 1YULA 3DBHA 3V8NA 1U1EA 2E5WA 3TIFA 4NARA 3FBGA 5K0GA 5IHXA 3G05A 3ORYA 2FFHA 4Q24A 1Z08A 2WHXA 2OV6A 1CQJB 2DIEA 2FWPA 1ISPA 3G2PA 3O3NB 3CFYA 4HDMA 4QRIA 4ER7A 1IHPA 1SCUA 4TVBA 4PINA 1JB1A 2C4HA 2H85A 4H0FA 2C2XA 4EVIA 3DLBA 4AZSA 1JAZA 4UMDA 4WQMA 2G5PA 3PFFA 2FZ5A 4FWBA 5C32A 3Q5DA 3LDHA 3WNVA 2ZJ5A 3I23A 1PLKA 3ZVNA 3OO1A 1QK4A 4DJFC 5DTEA 1GXSA 5KMGB 5LXTA 3OPYB 3TB6A 5FT9A 4B0OA 3P0FA 5HFAA 3LCMA 3TNFA 3G5LA 1UT6A 3VU1A 3INGA 3B52X 3GFVA 1NNUA 3N7UA 3MTDA 4JDUA 4JJIA 3A7EA 1BE6A 3B7WA 2VTKA 1ZH8A 2ODEA 3OD5A 3O75A 3PFIA 4LJLA 4NJOA 1G5PA 2AI2A 3NDIA 1A69A 1J7KA 5C8XA 3F6CA 3DM5A 2LR0A 3H0EA 4DQLA 1NVEA 1O87A 4I8DA 4BO4A 2FSVA 3PICA 1W4AA 4HGPA 4M0CA 2WSYB 1AV7A 1X70A 4AY4A 2I62A 5J23A 5FNZA 3T7DA 5I9LA 2XUQA 3MCTA 3R2JA 2Y1FA 2XE8A 2Q7XA 1JXOA 2WPNA 2F90A 3HZRA 3UM9A 5HUHA 1PR3A 3G13A 3V8PA 4G4JA 2DB3A 3DTVA 3G9UA 2AR9A 4PZZA 3TLGB 3WMXA 4Q1AA 4CKCB 5A0VA 2IX9A 1JHUA 2OXFA 2PZBA 4HAUA 3WI7A 1RXEA 1GL7A 2XOEA 1QVWA 3CWQA 1VQNB 4FFBA 2O2EA 3OT5A 4WACA 1PJTA 3ITKA 3A3NA 3MTGA 4FC7A 1Y1LA 4REQA 3M9WA 1CRQA 2PTGA 3BJMA 3IOEA 4HRYA 2N46A 3RHSA 3PDIA 2FOXA 1HLPA 1FX0B 3P2OA 1GTJ1 4JJFA 1ZUWA 1PL8A 3MRVA 1ACMA 1A97A 3A0RB 5IAKA 2IZ0A 2J9YB 1P2UA 1KKLA 2O06A 3WV5A 1F60A 1BA2A 2ZTUA 1QF9A 2VSQA 4RK5A 5D3QA 1N2CB 4MVJD 5KWEA 3EHEA 1C3XA 1BN6A 1R9MA 1YQTA 1RTKA 1I3MA 4YJHA 1C0IA 1E2EA 2FJ0A 3Q7QA 1KBOA 2WUDA 1ENOA 3EIQA 3P19A 4PHHA 5F2OA 4BNLA 3VO9A 1JWLA 2PFGA 3A7DA 3DTYA 4TN5A 4BRSA 2FN7A 2PMCA 3O1IC 1DHTA 4UBOA 2VUSA 3E1GA 1DBWA 4FKBA 3UMBA 4II7A 4OG2A 4GAEA 2PH1A 2QW0X 3VNAA 4BO9A 5A04A 1T5HX 3UENA 1QM5A 4GM1A 2NSLA 4AYWA 1R5NA 1T3SA 1FSZA 3IDSA 4OI2A 4NNPA 1B73A 4K5QA 3VKGA 2ZYAA 1MW9X 2GYVA 2ZIWB 3SLNA 3OFNA 4GR4A 1Y5NA 1E1DA 2FJPA 3H2JA 3IB3A 5EVCA 4J16A 1LPBB 1RP1A 4G8DA 2ZXEA 1NNEA 3RKRA 5BUSA 1L8LA 5KNBD 1UCFA 2XZPA 4EHJA 4BOYA 4Q05A 3BXEA 3L1KA 4V2IA 4BFCA 1SHZA 4FGKA 4QHTA 3ROZA 5F2KA 1QHHA 2HGZA 4Y2JA 3H19A 5JS7A 1YZNA 2OHGA 1ZGCA 3CRMA 4LVOA 4EJMA 3U81A 3I8XA 4DCSA 3LNNA 2GF0A 5CX4A 3G23A 4BP3A 1SOAA 3LY8A 1RAFA 1G19A 1ACLA 4NI5A 3U49A 4GZLA 2GJSA 2VNJA 4E5YA 3KQVA 3VUEA 1R00A 2WKQA 3FM9A 3MFQA 3N2YA 3PQEA 2WHYA 2I7VA 2P6MA 4X93A 5EIHA 3SZOA 5J4VA 4YAKA 5DGXA 4YDQA 4B0PA 4Y9TA 3HL0A 3WDKA 2P9EA 4XVCA 1NVTA 2YFQA 1A9YA 1G5TA 1HXHA 3E9RA 3M83A 3MMXA 2HU7A 3AIIA 2W2QA 3PUKA 2PZGA 1VHWA 2QAGA 4JBIA 4NJMA 1HDEA 1AUXA 2WF9A 1NT4A 3PEFA 4RA6A 5ICFA 3WLHA 4AJJA 1IVYA 1NA5A 1T2VA 1QPGA 2ZSIA 5J5VA 4A73A 1GNSA 3A11A 3E03A 4J0JA 4NVRA 5IARA 3UXMA 2EWVA 2V0GA 2DLNA 4Y2GA 4C0KA 5E0OA 4LQDA 2XMBA 1TIKA 4G0YA 4NULA 1LGYA 2CUKA 2VHJA 2XGSA 3CF4G 3CRQA 4C0BA 3UCEA 2YHIB 3PJGA 4K86A 4BJ5A 2C1ZA 5EJ6A 1PE0A 3URMA 1G5IA 1U8YA 4KP7A 3RVNA 3WY9A 1ZN7A 1E66A 4PNHA 3T4XA 2VLBA 1NNI1 1VFNA 1KMCA 1BDJA 3B38A 2WWGA 1FA9A 2C9OA 4IX9A 2HTFA 4Q3NA 4TV9F 4G24A 2AG8A 3I39X 4PZYA 1CRPA 2RKOA 4XH9B 2XCSB 3MJCA 5C5EA 4BB5A 1A7UA 1DEKA 3I5MA 3ADDA 4ARZB 4K9MA 2QROA 1YZFA 3OCYA 3O3OB 1P2FA 2GDJA 1HSZA 3NI2A 3D5TA 3OY7A 5IAEA 4V1CA 4URWR 1C7FA 3G2NA 1Z5WA 3MTJA 4KRYA 3Q6IA 4FP9A 4UCXA 1X14A 3A1PA 1UDBA 2J59A 4H15A 2GEBA 4U39A 2YZGA 3K0AB 4JKIA 3FAZA 3A6HA 2KX7A 3HB4X 1RNLA 4UC0A 3CLSC 2XEXA 1UFKA 1Z0JA 3UOGA 1NR5A 2HD4A 1Z8HA 4G8CA 4J0CA 5H7XA 2H07A 4FLMA 2A0FA 5E6UA 5BWMA 1KEUA 3AYXB 1ZMTA 3C24A 3A35A 2NZVG 1UD3A 3TM5A 3KYCB 3V1KA 1VKZA 1ZUHA 4ZC1A 1Z0KA 3VPBA 2QPOA 5AQEA 2Q2NA 3PX2A 4EGAA 5I5EA 4AUNA 1P77A 2QMYA 4IW3B 1N9KA 2Y1GA 4KIFA 5IDVA 1I2ZA 3JWHA 3W5UA 5DYYA 2QPLA 1MORA 4LC1A 5F7JA 1FP6A 1WG8A 2ODWA 2R7NA 4HWSA 2J6IA 2EFCB 4INAA 3SSAA 4IX1A 3AVXA 1VL0A 5E9QA 1SQ6A 4FD2A 1OH5A 1S9DA 3EZ9A 1QP7A 2FMFA 1JRLA 1TYDE 1JIIA 1U8EA 1DX9A 1OX4B 1XSEA 3EGDB 2AOTB 2FEPA 3CNBA 3I5UA 4V0LA 3IEMA 1AQLA 4N01A 4UM9B 4X61A 4K9DA 5KYGA 1A9QA 1Z22A 3MN1A 5EIEA 4W1RA 1G2PA 1KAEA 2XA9A 4AJPA 1F6WA 1UMDB 4DR4B 4YR7A 1LBQA 1GUAA 1V8PA 4L8WB 1CNFA 3EBLA 3L04A 3CW9A 1MB0A 1XKXA 3L0OA 1M33A 2NZWA 2VVTA 5CVCA 2G9UA 4TT8A 1ORTA 1ZRSA 2JAQA 3R20A 4LISA 4X54A 3V1TC 2AB0A 3ICQB 4H17A 2P91A 1OJLA 1VL6A 4O2AF 1VG1A 3RB8A 3TR5A 3UWKA 3Q8KA 3IV6A 3R0QA 4MROA 1J6UA 2AN9A 2XGMA 4YWJA 5LYJA 2J9ZB 3NYQA 3IHKA 1HPLA 5K3FA 4MNTA 2WFZA 4FDTA 1D8TA 2O3TA 1TEXA 4KQJA 4HQNA 4PQRA 3ER6A 4PN7A 4OOXA 3CZAA 3I09A 4CEIA 2Q45A 4EW6A 5KTNA 5AKHA 2IU0A 4NBSA 2GK3A 4FXOA 3I1JA 4TYMA 4F1KA 1M7BA 1PK9A 3H65A 1J8FA 1SC6A 5TPZA 4NOLA 4KRXA 5AHKA 3V4VB 2IHVA 3DEFA 4JP8A 4UZUA 1ZMRA 3EGCA 1Z0IA 1WEKA 2I6SA 4IQ4A 3ZY3A 4EW2A 1D7OA 1IHDA 4CETA 2MYTA 2C5HA 3I01M 4WZBE 4BV3A 2D74A 3B1VA 4UZSA 4H6WA 3ZY4A 2OO5C 4TKMA 4GKKB 2R1TB 5CH8A 2G1PA 1E1RD 4AJ9A 3GYGA 3ORRA 4OI4A 1KQFA 2CXXA 2CZGA 3RVJA 3A9TA 3TQRA 4NCAA 1Z8NA 4NV1A 3NTLA 2KB0A 2YVAA 1NP7A 2I4OA 3W3AD 2VBUA 2UKDA 3QKTA 1E20A 4MQEB 5M2QA 5K0LA 1H8HD 2X6WA 2IRWA 2QT1A 1T29A 3M5CA 2VPTA 3FRIA 4M0UA 3RWMB 3SN6A 2ZIFA 1YI0A 1J25A 2FMHA 3KSZO 5F33A 3RTBA 5JYEA 2D4AA 121PA 3I42A 3P0HA 2XECA 5ECYA 4DYVA 4HUTA 3ZD7A 4Z9AA 1C1XB 1AF4A 3UATA 2ZRCA 2P5SA 2FZWA 1RMYA 5IM4F 2NU9A 4MKIA 1W47A 3V4OA 4CIXA 4WZKA 1G42A 3Q12A 4HXFB 3ENQA 1K92A 2IU3A 1QIJA 2VJJA 1E0SA 2L17A 4RVSA 2ZBEA 3FGZA 5BVHA 2G1JA 3TLXA 2YN0A 4O4IB 3THXA 1SKAA 1XEFA 3AY6A 4B79A 4JA0A 5B7NA 3IXMA 3JASB 5E4YA 1BIFA 1XRPA 1G5QA 5KOIA 4JIMA 1X39A 2AE2A 2ZDQA 4YJ3B 4LF8B 1QS0A 2OL4A 4BGEA 2R7KA 3KVOA 2G9NA 3BCRA 3D1LA 5HFJA 3Q7IA 4QUEA 3CMMA 4QYMA 4PRZA 3DUWA 1S1CA 2M2IA 3QTLA 4G3XA 2Q5OA 1T5BA 5EEGA 4CQLA 3FOAA 5TX7A 1IWPB 1DRVA 2ZE5A 1YOVB 3DFKA 1TA4A 3K32A 1DWQA 3UO8B 3QNWA 5T3UA 4CBVA 3GB9A 4XOTA 3M4ZA 2HW8A 2JIPA 4XONA 3H2BA 1E2MA 1ULTA 3P2JA 2WU4A 3VR3A 1XDSA 3QTTA 1P6XA 2EL7A 1IH8A 4BJ6A 3HJHA 2Z6AA 3AKZA 4J7UA 1BX3A 4MCJA 1YZUA 2RCYA 4N6OA 4BE7B 2PVCA 1JG2A 4B6OA 3Q9SA 1DKOA 2BDTA 2X76A 3KL9A 5SYAA 1VECA 3U2QA 1Y8RA 2FQXA 2HK9A 2GBPA 2IYPA 1AOXA 2MYPA 2PLNA 2Q0SA 2ZPUA 1D1PA 4JQZA 4QARA 4DZZA 3LK7A 5CDUA 4W8HA 4Q4LA 3KSBC 4ZKEA 3DMRA 3P9CA 4FILA 2ZDHA 5FLEX 5CA0A 1J8DA 1HK7A 1LA2A 2X8AA 4K05A 5LSAA 3ADBA 2DPYA 3THWA 3HBFA 1JIVA 3OC0A 3SU8A 3IAM1 3MF4A 3BBLA 3ZJ5A 4KKTA 3IMCA 4TV8B 1KOLA 3KWFA 1EM8A 4U2FA 5B36A 3W5CA 4CQMB 1VQ9B 2R8ZA 2XMGA 3HNRA 4I4TA 4MYHA 4E5PA 4UTPA 3SHQA 1AKWA 4G23A 4FSHA 3SQMA 3RF6A 3NP9A 1W1UA 3H1AA 4NMWA 4MUBA 4IHKA 5BPHA 4U9UA 3ZZUA 1DAPA 1RYFA 4P7JA 4XD2A 4TS9A 1EFRA 4H4CA 1PNVA 3I9LA 5MN4A 3LFHA 2ZRQA 2PWBA 2QRPA 3NHRA 4R9UC 1ACJA 4Z3DA 1L5LA 2C07A 5A6SB 2M1ZA 4N3CA 3K1TA 2WMNB 1T4GA 2PKRA 3OCJA 3Q3EA 4YQYA 1RLMA 1VJ1A 2E3JA 3VRHA 5CM8B 2XCQA 1KA9H 2YKGA 1KR5A 2L18A 2PE3A 2O48X 3VR2A 5EYPB 3MGCA 5BNFA 2WAOA 4F5DA 5I4IA 2ZI6A 3HYRA 2AN1A 2DWUA 5E9WA 4B82A 3HLTA 3RU2A 5MGBA 5C8ZA 1UKAA 5HK9A 4DCJA 3AWIA 1WUJS 1JALA 3B9BA 16PKA 1I24A 2PLRA 3A6GA 3B53X 3KQPA 4DW8A 4Y7CA 1SHLA 2FRDA 2RIPA 1SCQA 2CYBA 3DVQX 4HUJA 3W1WA 1T26A 3FIJA 1BVYF 5DSTA 1E6CA 1UDWA 5C8YB 4JLSA 3EA5A 1TAUA 1S2NA 1KAMA 1TO6A 1IZ9A 3O4GA 1UDAA 1NDHA 5FUYA 1KJ9A 3A4IA 5BYJA 1Z0UA 3BWBA 3IULA 4PSAA 1MC8A 4XR4A 2DTXA 3QX9A 4RMHA 3VKHA 3O8CA 1E4YA 2IFTA 3SZGA 3WZLA 3ZKWB 3GPIA 3ZLVA 1PVVA 2FP4B 3VKVA 3QFSA 4WOPA 3A37A 4D5GA 3E27A 4IZ6A 4BNDA 2ES4A 2GZ2A 4ZO9A 4ZIRB 1N0UA 2PPVA 4J8PA 3STHA 3SX4A 2PLFA 1OFHA 5KOJB 2MSLA 1CZOA 4HX5A 3VVMA 1G20A 1JJ2B 2RHMA 1OXXK 3KLMX 1GQ2A 4Y2QA 1SBYA 1GNVA 1LY1A 2P7IA 5LUAA 3KEWA 3DBLB 2XNDD 4DGQA 4QICA 4EAAA 1KPHA 4Y2YA 5JH7F 1NE7A 1ZSYA 2W00A 3Q8WA 1QU2A 2O2CA 1XZEA 1Z8DA 2ZWAA 3CVWA 3CESA 1QIEA 4K26A 4D0GA 3GVCA 4BBAA 3ZJVA 3EG9B 2ZB8A 3BUSA 5A9RA 4DK1A 5JDIC 2DBYA 4RS3A 3S27A 1B16A 2I7CA 1F38A 2F17A 3DSRA 3AV3A 4OYRA 1YQEA 1Z5VA 3ZHZA 2VYQA 3GP8A 2G36A 4EJSB 1XZGA 2ZTMA 4R1PA 3HBNA 2JEZA 4B48A 1XD9A 3K0HA 2O52A 4M0KA 3TQCA 4CMBA 1V71A 1G8FA 1I7PA 2HY7A 3DZCA 1GZHB 3WE7A 2PZFA 4EPRA 1YV9A 1ZSNA 3N3AC 1TFUA 2WVAA 3BWVA 2AE1A 2Q9BA 3H05A 4R2IA 2J3HA 2Z43A 4JGGA 4D9IA 1VCOA 3A1NA 3MIIA 4LMAA 3T9DA 4WXMA 2BCGY 1CW2B 5BOSA 4DCOA 3HM2A 1C7ZA 1YS4A 2AKYA 4OQZA 5ALOA 4MHTA 4MEAA 2YMPA 3DOOA 4AUKA 3ZZNA 1Z36A 3WMWA 1QX3A 1UADA 4G2TA 4REOA 4YH1A 1RZRA 1Z6QA 1Z33A 5CBPB 1F2UB 2ZBFA 3NAZA 4TLCA 5AVXA 4D99A 1K2WA 3P0EA 3JALA 1J06A 1UKYA 2NUPA 3GQBB 3MMZA 5EWLA 2UXDB 1P5JA 3L9XA 4OI0A 4TWIA 1SULA 1NF2A 4GX0A 3OOCA 3C48A 3TUJC 1BMFD 4QT0A 5DEIA 4WLOA 2CLIB 3L0SA 1Z2AA 4C4TA 5LBIA 1Z06A 1I5EA 2JFGA 1YQXA 4W9NC 3W2GA 1GQQA 1YJQA 3DYVA 3HBMA 4P1ZA 4YJ2B 5EJIA 4B7UA 1TAHA 5DX1A 1S3SA 2FSPA 5LDDC 1J22A 1NYTA 3PVCA 4JUIA 3WYFA 1CUHA 1YSCA 1PD0A 2CNKA 2VBTA 2VXBA 2VYFA 4TOIA 3RVBA 3TSWA 3UT5B 4OQQA 2OXCA 5F73A 4X90A 4XARA 3I5XA 1TVCA 4MW5A 3SFTA 4BX3A 3QIVA 2BGIA 5E3JA 1QGUA 3ET4A 1Y3FE 3RS3A 3W5AA 2VEOA 1W5SA 2ISCA 3QPCA 2PRYA 1XG5A 2WHPA 2X77A 5LL6P 1UC5B 5J1TB 3ZOZA 1JLLA 2FR8C 1LNSA 4ZTUB 1QFSA 3I04M 4HOYA 4N0EA 5EIAA 4MXDA 3WKEA 2H3HA 1PR2A 1V16A 4FYXA 3V9PA 5BP7A 1VE1A 4RH1A 1F3OA 3Q6NA 2QP9X 4AB1A 2ORIA 2PIAA 4EO7A 2WWVD 3K0FA 3PXUA 2QN8A 1ZOSA 4LWQA 4C4PA 1QFJA 3QNUA 1MHPA 2B36A 1R6BX 1K8ZB 2H2GA 2FMKA 3MWDB 4R2MA 1SXGA 3SZMA 3LWBA 1M2HA 3A3BA 2B4QA 2O6LA 1G1MA 5DBHX 4G5FA 1KNXA 5JWRA 1N6HA 4EB6A 3FB4A 1NI5A 4ZCMA 3FKSD 4GKBA 5EP4A 1H6AA 1N8TA 2OD9A 2YZMA 1VLMA 3P0JA 1SOMA 3VOBA 4C0SA 1A9OA 4ZICA 3NETA 5GZ3A 2A1TR 1QAMA 1M54A 3VQTA 2D06A 4A9AA 1PWZA 2OG1A 5K4AA 4CG3A 1QGZA 3H9QA 1BLIA 2C8LA 2UDPA 3NTUA 3I9MA 4G89A 5B2FA 2PUVA 3F7TA 3WL4A 3L8MA 4N49A 1O2DA 2VYVD 2X9LA 1YDHA 4HWOA 4LRWA 2VK2A 1W35A 1B0AA 2DVMA 4E14A 5AICA 3AYZB 5JARA 2FRVA 1KZ7B 4NYMR 3GT7A 4HVTA 1X7GA 4ZOLF 5AN9A 1I3CA 4O1MA 4H08A 4WHMA 4MDHA 5EWJB 4P4SB 2O8VA 3ASZA 1VG8A 2HMUA 4D1YA 3DZGA 2ZUSA 3GLVA 4OM8A 1EB9A 1WXFA 3U0VA 3VZPA 4C14A 1MZPA 2XSZD 2ZSEA 4W1SA 5K5EA 4ARVA 3ZY5A 4CDGA 2INGX 2PRIA 1J2JA 2BFAA 2OQRA 1GFSA 5AOBA 3GRZA 4R1OA 1N2BA 2QMUA 1XDDA 1Y8CA 1BGXT 3WRXA 1JSRA 2YN2A 4NPHA 2QUBA 2IYTA 5HMMA 4DK0A 1YUBA 2C8KA 3MS7A 2ZM6B 4CT0A 4MGYR 4D9JA 1XEAA 3F6BX 3L1JA 4LXUA 4RZUA 4MV0A 5HZHA 4RABA 5DZSA 1E60A 1PVDA 1W93A 2P0YA 4M53A 2GHQA 1F1BA 3H6HA 2J3EA 1TJ5A 3NHFA 3NFYA 4IEFB 4DL9A 4EELA 2H0RA 5K3CA 4JJ8A 1V5EA 3NWBA 2VHTA 4PYIA 5EGNA 4TKOB 1QTQA 1XMJA 1WOYA 1SBZA 5DGIA 2ZJFA 3RNOA 2W98A 1JDTA 3IQZA 1M73E 1IQUA 2WTBA 1QGDA 1W85A 3C1UA 2FPWA 2LTAA 3QWAA 1QIKA 2GPYA 2UZ3A 3EDMA 3EQZA 3RT7A 1E5QA 2VOEA 3K6KA 1JI3A 4XJVA 1Z28A 2NVWA 3BE4A 3L7KA 3DV0A 2ATXA 1H2AS 1ZZGA 1JAHA 1R50A 1FNCA 3VV2A 1HTWA 1TU3A 3DE6X 3OKPA 2Q5LA 2DCMA 1WHSB 3KSUA 3NEAA 1OROA 1G8MA 5B6IA 2H1LA 3K92A 1XZNA 2WT4A 2NXCA 4JA2A 2XI4A 5F3DA 5LB4A 3IUJA 1NKSA 1QO9A 4IXWA 3BSSA 5LD2C 2CXRA 2IDZA 1A50B 1BO6A 3LC7O 1CG6A 1D0IA 3BE8A 1JJ7A 1NX9A 1TYCA 2IYQA 3LUDA 1BGWA 4KE6A 3ZDYB 3FI0A 1G20E 5AJUA 5ALFA 4J29A 1E7QA 1Y3AA 3OIVA 2IPAB 3FFXA 3SQOA 4ZA2A 1G21A 1GGNA 1XEXB 4RVHA 4ITUA 2HSJA 3G4SB 4MS4B 3A26A 5H83A 1HSOA 2JLBA 1NJ8A 4Q9NA 2HMWA 2CCJA 5G4KB 3USES 4LJSA 2DBZA 2VUHB 1NAIA 2G9VA 1A82A 1I7DA 2V7PA 1QYIA 3HY4A 1WW3A 4Q02A 4A92A 3PD1A 3EZNA 5AKZA 3GLGA 1FLDA 3M1LA 4R2KA 2C7QA 3ASSA 3GVJA 1NR7A 1VYHA 4IINA 1XROA 4R8MA 4BU1A 3J81A 4QBHA 1EK2A 2D1FA 2IYEA 2OP0A 1NT2A 2OV1A 3D3QA 1M3SA 3LYAA 4MYSA 1VBKA 3SZLA 4C4OA 5LQMA 2IS1A 4TT3A 2OCLA 3QITA 5DU2A 2FWIA 4DF3A 1QUFA 3CMAB 3H8JA 2C2GA 4G8BA 4DEXA 4HNRA 3ICEA 1RBYA 3PWTA 1PZHA 3GBVA 1MX5A 1QORA 1ZIXA 1B8UA 2BMFA 1ODCA 4RTLA 3VJKA 4EEZA 1WVIA 2OGTA 4UM5A 3L02A 4FFMA 4B6GA 3QVMA 1AZLA 4DOMA 1E2UA 1GRCA 1V3UA 5JPIA 3ZWYA 3NT2A 1YVPA 3DZJA 1GU0A 4EFDA 5HUJA 1FK8A 1Q0ZA 4QV2A 5G1NA 2C42A 1K4MA 3HCFA 3LPAA 3TTUA 4EGSA 2AF3C 4R1SA 4V02A 4WJKB 1N6KA 2IA5A 3Q8LA 3UFXB 4D8TA 3O4JA 1NVWQ 1XN4A 2VHUA 4KXXA 4IDEA 2ZUCA 1YI8A 2NVUB 3RS9A 4Z0NA 1RMTA 2COEA 1UP6A 2NYAA 4DSNA 4PX9A 1NRIA 4WK4B 1KEVA 3DZFA 4KU4A 1IXSB 5CH5A 3VDRA 3ROPA 5DNUA 1JG1A 3CLUC 3LCUA 3PDHA 2PSJA 3BGOS 3H5AA 3IAS1 4DUYB 1U2QA 3ODPA 4C1NA 1SELA 2J7PD 4QPNA 1NMEA 4ZO4A 5GJCA 3NQ41 1MAWA 3DEKA 1CKEA 1NLUA 1R4NA 1YDFA 4XQFA 1E1YA 1VP3A 3GJ7A 4RPIA 3X3HA 5JCJD 2BISA 3LZDA 4IVRA 2O0MA 4MUYA 1E5XA 4MV9A 3TEFA 1RYEA 5JY6A 1QF7A 3GCXA 4LBVA 1R4MB 4ZYVA 3N75A 3KQUA 3GEIA 4X6XA 3KT8A 4C0HA 5MFPA 3U7RA 5FCDA 4QBTA 4BN0A 4J2TA 2NYVA 2QMOA 4JLBA 1G7SA 2XQKA 3SJCA 3WAKA 3AM5A 1X7WB 3PPWA 4JOQA 4OKSA 4GYJA 2CV1A 1ABEA 2MTBA 3QPAA 1NXVA 1XGKA 4FQ5A 3W5IA 4EW1A 5U1PA 1UM9B 2HU2A 3U4GA 2CSUA 5L3SB 3U62A 3JQDA 3R6LA 4C89A 3I4LA 1PEYA 5AM4A 3LPCA 2BEWA 5JLJA 2Z6UA 2YIVX 3DLHA 5H59A 1LPPA 5UKDA 4HAWA 4DMHA 2PEZA 1I0ZA 2RH4A 1CZRA 4AXBA 2AGVA 4JLPA 1XALA 2J9RA 2R7MA 1RCFA 4EI8A 1BDMA 2X8LA 2DHQA 2DKFA 1KVQA 1AKMA 4M1WA 2EJWA 2V03A 3UTDA 3SDZA 1CUAA 1HOXA 4HDRB 5JJ5A 3IUBA 4KQMA 4XWAA 1S72B 2XITA 4GWLA 1AB5A 4L51A 3P94A 1RRGA 4OUDA 1TM1E 1GGVA 4MV1A 4EMUA 4ZCRA 3KTAB 7REQB 5FA5A 5I4KA 5KREA 3BK1A 3NM6B 4DV7B 1PWEA 2CBZA 4Q3CA 5AMXA 2WJ3A 4ASUD 4JWKA 4X91A 1EIZA 3AI3A 1LH0A 5JDCC 3T12A 1H66A 3QRWA 2Y2VA 2AOUB 3S2UA 1R66A 3LXMA 4ZMBA 2XYHA 1NJ2A 1UL1X 2CLOB 3LL7A 3Q3HA 1ARZA 1XZIA 3HKDB 3E23A 4OSEA 4QEZA 3SBEA 1CE8A 4R3WA 1U3GA 1U8CB 1ZMXA 2C59A 3HKBB 3IO3A 4L85A 5L3RA 4PC1A 3MWYW 4I4IA 2GESA 3JWPA 2QL9A 1QYRA 3PSAA 1Z16A 4QDUA 4AZ0B 5BN4A 1QX4A 2HJVA 1RKVA 2AFHA 4CI0B 1GSIA 3F46A 3ZHSA 5TLSA 1CQWA 2JLQA 5EMMA 2ZAIA 1CJCA 2XUKA 3FJYA 3KSMA 3O4IA 2BM1A 3H8VA 4N1AA 5ULLA 4CMKA 1AKVA 1D2NA 3LVFO 1FUKA 2JHCA 4ZVLA 3DFIA 4B3CA 4IIDA 3VO8A 3E3AA 1L7BA 2PRZA 5FPYA 2P40A 1WVGA 3KX2A 4KLAA 2BGNA 3I5AA 3DLCA 1IM5A 4D57A 4ND2A 1KMHA 1E6WA 1GPH1 4D43A 3MUEA 2BZSA 4IOJA 3EQ8A 5DCLA 1UMKA 1E3TA 1HLFA 4KH0A 3GXOA 3BDAA 3D1VA 4TVOA 3ZX4A 2F9FA 3FPJA 4TTPA 3ZIUA 3CG4A 1DBQA 3I8SA 1CUJA 4MUMA 2IS4A 3A04A 3U4DA 2R6R1 1USIA 1Q15A 5FWAA 3RKSA 3TGWA 4P2NA 1QTNA 2WYOA 1A4IA 4A2QA 4UHCA 1CV2A 4F2HA 3PA8A 4LHVA 3NORA 4WKOA 3UV7A 4DE5A 1N1DA 3DDCA 1D8AA 3FX2A 3W9YA 3COYA 2HJGA 3HH8A 3FTQA 2H00A 5SZJA 2WV9A 1T6NA 8ADHA 1EXVA 2H2AA 4PZPA 1N6RA 1VBNA 2GPBA 3PUIA 1IPHA 1W94A 3O8QB 4Q1CA 4O4JA 3PL5A 4PTLA 2GHTA 3PJDA 4B3GA 1KI6B 4OPVA 3T53B 1ZOLA 2J3MA 2PUTA 2VYNA 3UWPA 4XCXA 3WWOA 1THZA 1G21E 1WY5A 2FXVA 1YK1A 3O3CA 1L7RA 4NYMQ 4RVNA 4QVKA 1UOEA 2C88A 1XVUA 1CHDA 4QQKA 1M7HA 1JFSA 1ZWKA 1GYPA 1GZ7A 2LUOA 1X9GA 4GP6A 1DC3A 3FTPA 3HLKA 1VKOA 1MOPA 3JD3A 3P2YA 1PFKA 3W7BA 3KEMA 3UKOA 1NJ1A 5E1BA 4CJXA 1LKZA 1AG9A 4CIWA 5L40A 1EUYA 2ISSD 1FSSA 4LGCA 2HZBA 2CJWB 2C4VA 2G8NA 3VISA 1S9HA 2JI9A 3SR4A 3KL4A 5F7OA 5IC6A 2JHAA 3NZEA 3S1LA 5JXIA 3TMKA 2P0AA 4GIBA 4EKEA 2D7DA 1PGJA 1UK8A 3AF2A 3QX8A 5ITSA 1IEQA 1GWNA 5ITVA 2VYCA 1G59A 3FPHA 1U0NA 4DDMA 1T8SA 1J97A 1T5DX 3HC7A 3P1JA 5I7WA 3U44B 1UZMA 5IS2A 1VZ3A 3N86A 3COSA 2WFAA 3Q15C 4PAAA 4M8KA 2VBVA 5CG2A 1P2DA 4K2AA 5F1PA 4B44A 3CF4A 2I67A 3Q5EA 1NMSA 2Z1DA 5ALDA 3AINA 2AA3A 4G0NA 2GN0A 3FCYA 2ZI7A 4ED9A 3PUVA 1GOTA 2HBZA 1VGQA 1KQOA 2I2BA 3FYCA 5DGTA 2FK8A 3RC7A 1I6KA 3LI2A 1TTTA 4CKXA 2Q0QA 1JPUA 4NZMA 3E9DA 3HY6A 3U7JA 3V7NA 4HGYA 4QXOA 5B3JC 3KVYA 1Z3IX 4CFYA 1FTQA 4R16A 5LPNA 4MVXA 1R4AA 3A3YA 5EN4A 2GN6A 4CF4A 3C0KA 3K6JA 4HXYA 1W0KA 4F1JA 5EE3A 2EZ9A 3W9SA 1NOKA 4BZXA 2F3QA 3DDYA 2X0JA 3H5RA 4YEDA 4DUPA 3A9UA 2FTKE 2A2ZA 1DEOA 4G1VA 4QXQA 2XKKA 3DHYA 2QRZA 4EG4A 3KYDA 4OJQA 2IUTA 1OLOA 1VL8A 1NVVR 3I3SR 3UAZA 2OBRA 1C8BA 1EU1A 3A4YA 5EFZA 3ZQKA 4F3CA 1TIBA 4AKTA 3H4IA 4YR9A 4YDRA 3WB0A 1TZJA 5IDXA 1SHKA 3DVAA 2C3PA 3NIDB 2NMVA 2P68A 4YUVA 5FFNA 4ZTZB 4NICA 4DSAA 1AKUA 3CJTA 4L16A 4EK9A 3N0VA 4JLVA 2RHBA 4U7TB 4MV7A 1MPXA 3IT2A 2BKVA 2QLFA 4I9NA 1S96A 2IK8A 5K99A 3SHVA 3FNRA 1PR1A 1F48A 3W2FA 1HDIA 3BD8A 2NAFA 1EZ4A 2WWHA 2FSFA 2ZI4A 4B6QA 1W5TA 4MOWA 5F9MA 5C8VA 1H6CA 1Y98A 3AXTA 1WM1A 3CUWA 2PKYX 1U0SY 4HZUA 2AC4A 3NDPA 4DG9A 5CRIA 4HEJA 4HQRA 4FKMA 4E5UA 1E1CB 4TKUB 1PR0A 1YKSA 3CCJB 3ABIA 3RC1A 2P11A 2SECE 2DXIA 5FEMA 3I2JA 3KR1A 2OENG 2WP8J 4FE7A 4PV7A 2GAAA 3QFFA 5HDBB 4Y1EA 1RHMA 2EQAA 2A59A 5ILQA 1AGYA 2JS7A 5C5CA 4EOGA 3UUEA 3WMGA 4OP7A 3TBFA 1KS2A 1IY0A 2FG5A 2GPNA 5EE0A 1HQCA 4FOLA 5FUMA 1MO3A 3HJNA 4PFJA 1QNFA 4WV3A 1W73A 3F7OA 4H7JA 1NZDA 3BWCA 3LQ4A 1P6QA 3GWZA 1M6VA 4MRMA 3SFZA 4CLEA 4EY5A 6CHYA 2BMVA 3D4IA 3QVSA 1HNNA 4HN4B 4RM3A 5CPBA 1K8RA 2HIMA 1NF9A 1SR8A 3IQFA 4H7DA 5EJGA 3GEDA 1WMBA 4G63A 2G9QA 2QL6A 2QRHA 4YMTA 3EXG1 1Z63A 3RAPR 4P86A 3PFGA 4TXJA 1N8KA 1UZLA 3FCUB 4JZKA 2VWGA 3AVYA 2XWPA 1U2PA 4PZDA 4Z4ZA 3DQPA 3K35A 4W9NA 4O02B 4GOND 1RM3A 4R7GA 4J0EA 5EPUA 4EUSA 3D02A 2GVZC 4EP1A 2PBLA 2Y9PB 8ATCA 2ZW9A 1C2TA 1GG5A 3NYIA 2AFHE 5IAGA 3D3WB 1XEWY 1H05A 2CUTA 2DPMA 1WR8A 2PK3A 3FKQA 3IKJA 1AO3A 3BGSA 2HCBA 3LWDA 2CE7A 4D45A 2ZQYA 3DZDA 3NC0C 3AB7A 3NXKA 1BXGB 1U5AA 3TS1A 1J20A 4LBWA 2QUIA 4XKJA 2OCPA 3NPAA 5EZ5A 3ISJA 3KZKA 3ILXA 4TMVA 2W2PA 2C1XA 4R41A 1QB7A 1XX6A 2LCIA 1JEEA 1H2ZA 1P45A 1ZO8A 2PFSA 3MERA 4WY2A 4YP5A 4ZGBA 1FQWA 3BHJA 3T9BA 2ZIVB 1M6NA 4MZDA 2SCUA 2FR8A 4Q1FA 1GDHA 5JI2E 5LM3A 1IOZA 2FA9A 1M34B 3DLTA 1GN8A 3N53A 4CCSA 1U3UA 4LOAA 2HF2A 4N8EA 1BPLA 1NBIA 1O0BA 2ZTGA 2PZJA 1FNBA 4RVCA 4TXMA 4JL8A 1CUBA 4AJNA 3PNOA 5AJTA 1HYQA 3JQPA 2BH9A 4O8CA 4X1YA 3Q85A 1EEHA 4L76A 4R84A 4C4AA 3LOUA 5LBTA 1I7SB 5H3CA 1GCUA 4FOOA 1P33A 2O20A 1HTTA 2YNMA 2Z9DA 4LHZA 3CW8X 2I1QA 2RGRA 3AGPA 2EJBA 1PJ8A 4LRUA 3OCXA 3JTMA 4DC9A 1RPAA 5JW6A 3R3UA 1W5BA 2IEIA 3FBTA 5CW2A 2W6IA 5D01A 3SHWA 2H06A 4JOBA 3OQMA 3DXXA 3DKVA 3URKA 1HNWB 4U02A 1E3ZA 2AX4A 2QS9A 1MG0A 1P3DA 2YVKA 2VP2A 2X42A 3DDSA 3K5HA 2ETXA 3KUCA 4P22A 1M1NB 2A9PA 1O5TA 3FDXA 3OWOA 4HVLA 1CF4A 4YREA 4HDCA 3ZWWA 1Q82D 1C81A 2UZ1A 4PF1A 3RJ9A 1RE1A 3DT8A 3I2GA 3L0YA 3SDBA 4HGZA 2FLWA 2HV8A 1SB8A 3F0TA 3PTLA 3L7CA 2HHCA 3BC1A 4MR8A 5AKIA 4F7DA 2A58A 1JWAB 2ID7A 2NO7A 4I14A 4Q7KA 5AH0A 1UBCA 2CVQA 2YYSA 1H8EA 4DQKA 2Z2KA 5CTAA 1PW7A 2AUMA 1JHRA 5EG5A 4HE5A 1T8PA 3PFHA 2XE4A 4N48A 1YU6A 3BIXA 1ZU5A 2H1SA 2OM2A 2YHAA 3TQTA 5CG1A 1OHHA 3DEIA 1ECFA 1ICEA 4FINA 1DFIA 4EKIA 1P2SA 4P84A 3IUPA 5ALEA 4AVYA 3HFGA 1CY0A 2UVPB 2IWHA 3WA6A 1A1SA 5C3MA 2IY9A 1SURA 4S2UA 4C6TA 2H5LA 2VJYA 4C20A 3NHUA 1AUPA 2JDIA 1ZD5A 1E8NA 2R44A 4YACA 2HA6A 4JS0A 1XJCA 2XHEA 4HQ6A 3L1UA 1R8XA 2A30A 4W7HA 1LPSA 2Y6UA 4Z0HO 1QGAA 1WEHA 1XELA 1QV9A 3AUYA 3JQBA 1XFAA 5IF9A 3AVPA 3FVTA 3NRBA 3G7UA 3R5FA 2KW5A 1RJGA 3DCIA 3W9UA 1QHIA 1E2DA 1QFMA 1PR5A 1DCFA 1R6AA 1H6DA 2GVNA 3TTVA 3H2ZA 4IHJA 4HGRA 4RGBA 5C18A 5ISMA 1ELOA 1NPYA 1FFXA 1NL3A 4G07A 2F1OA 4U7GA 2GZ3A 2WD7A 5J43A 2XEDA 3D2CA 4MB2A 4S12A 4Y2PA 1U2SA 5IN5A 1GR1A 4MPJA 5TF0A 1JEOA 2R751 5J58A 4B3MB 1KMNA 2FQQA 4JQOA 4EX7A 4HLUC 1G55A 2FG7C 3LOQA 1AKRA 3JAKB 1TM2A 3R4VA 2HIHA 4YAEA 4DMLA 3DL4A 3EK2A 1IM8A 3HJGA 4RXUA 2JKVA 4CDNA 2GKSA 3WB9A 1T1JA 5DYIA 3M3HA 1VQ6B 2EAUA 4G0QA 3GRPA 2CLCX 3QVVA 4MRVA 1LDGA 4K9PA 4PBTA 3WLMA 1W48A 1OXBB 3D8HA 2LP4Y 3NLLA 4KYIB 5DX8A 3GLFB 4XDZA 2ODBA 3A06A 3NJ8A 4TV9B 5CFZA 5AHXA 2O0JA 1WQ3A 1OYWA 3BFJA 4IZHA 3S2FA 3QFTA 3H1BA 1ZJYA 1IAVA 2ZWIA 4N3NA 4YLGA 3VC7A 3V4RA 3FY4A 2XRMA 4F3TA 1FLNA 4YO7A 3DTNA 3WGOA 5FBHA 3ID6C 4KPUA 5E6SB 4AG6A 4B4UA 4GMKA 2OAQ1 3CY6A 3AF0A 4DJDC 4EL5A 4DDVA 5P21A 4XX1A 4XQ0A 3OG9A 1AIPA 4IM7A 4E6EA 3R7WA 3ZS9A 2GH1A 3T4UA 3U7GA 4Z2AA 3F96A 5KSZA 3GEEA 1BE8A 3AR5A 4PVDA 1YU9A 2BFOA 2HXYA 3AUFA 4NEGA 2IWRA 4BEVA 1JEYA 4GL4A 1H3NA 2BJVA 4Z53A 3FG9A 4OQPA 2AR7A 4P5PA 3NNSA 3STUA 3OLZA 7MHTA 2ZR8A 3N58A 4WWHA 3JU3A 2V7UA 3CLRC 2L19A 2AEEA 3KTDA 5DM60 1PNRA 3S0JA 2J09A 4N54A 4WI1A 4XL9A 3LUKA 5HVNA 3JR7A 2RBEA 4Z54A 3NAQA 3JWIA 2O7SA 1R9NA 1WMEA 5GP1A 5FTKA 2HXSA 3BXZA 1L5HA 2ZBVA 1C9YA 2O7NA 4LTDA 2RGUA 2WWXA 3TOSA 1AQIA