5GV7A

Structure of nadh-cytochrome b5 reductase refined with the multipolar atomic model at 0.80 a
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
272
structure length
272
Chain Sequence
STPAITLENPDIKYPLRLIDKEVVNHDTRRFRFALPSPEHILGLPVGQHIYLSARIDGNLVIRPYTPVSSDDDKGFVDLVIKVYFKDTHPKFPAGGKMSQYLESMKIGDTIEFRGPNGLLVYQGKGKFAIRPDKKSSPVIKTVKSVGMIAGGTGITPMLQVIRAIMKDPDDHTVCHLLFANQTEKDILLRPELEELRNEHSARFKLWYTVDRAPEAWDYSQGFVNEEMIRDHLPPPEEEPLVLMCGPPPMIQYACLPNLERVGHPKERCFAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Distribution of valence electrons of the flavin cofactor in NADH-cytochrome b5 reductase.
pubmed doi rcsb
source organism Sus scrofa
molecule tags Oxidoreductase
molecule keywords NADH-cytochrome b5 reductase 3
total genus 75
structure length 272
sequence length 272
ec nomenclature ec 1.6.2.2: Cytochrome-b5 reductase.
pdb deposition date 2016-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
A PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 5gv7A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 5gv7A02
2PIAA 1BX1A 2C78A 4TMWA 1CNEA 3AVWA 4Y9RA 4PC1A 1D2EA 1NDHA 3VNVA 1W2BB 2EFGA 5JBQA 3E20A 3U6KA 2R6HA 1H85A 3CW2A 1K9MD 1S0UA 4AF7A 2HCJB 1VQOB 3CCLB 3OZWA 4IW3B 1G7TA 1YHQB 2BMWA 4N3GA 4B43A 4AC9A 1YI2B 1EP2B 1H42A 2ZITA 1VQ5B 1QGZA 1VQ9B 4P3YA 4YAFA 1EFCA 1QFJA 2BF4A 5GV7A 3WNDA 1IB0A 4LC0A 1EP3B 2QN6A 2DEUA 4Y9UA 1QG0A 1QGYA 2XNCA 3QFCA 1S72B 4C0SA 4G5GA 1JNYA 3ES9A 3ZZ0A 1TUIA 1KRHA 1KJZA 1M90D 2VNJA 2VZLA 1CNFA 1GO2A 2D74A 4M0LA 3FJOA 2EIXA 3JQRA 3CC2B 2QA4B 2VNIA 3OW2B 2VNKA 4DQLA 1DG1G 3B78A 3QFTA 1ZM9A 1K73D 1EFTA 1JB9A 2VNHA 1F20A 4PGOA 1ZM2A 4B48A 2GPJA 1BJKA 3U2QA 3LO8A 3VO1A 1QX4A 5KSWB 1YJNB 3OZUA 3MHPA 4ZCMA 4RD4A 3CCVB 1BQEA 2OTJB 3QSYA 3CRZA 4RCZA 4NCNA 3V76A 1FNMA 3E1YE 3CCMB 1YJ9B 1KK0A 1TLLA 3U6BA 1VQ7B 1G7CA 3P27A 3AVTA 3AVYA 3WYAA 1OB2A 3AGQA 4TMXA 3WNCA 1YJWB 4PC6A 4G1VA 4RD0A 1AIPA 2B5OA 2OK7A 3G6EB 2C77A 1KC8D 2BVNA 5TY0A 2OK8A 4M1KA 3LRXA 5TR9A 1Q81D 4ZV4A 4M53A 2QMUA 1FNDA 4UAJA 3AGPA 3W5VA 4NBSA 1QH0A 3G4SB 3LYUA 2BM0A 4C43A 1E63A 3JQPA 1DDGA 2BSAA 3JQQA 2XEXA 3LVBA 4FN5A 1XB2A 5AN9A 2RC5A 4YHBA 1G7SA 3W5HA 1DARA 4ZGNB 2DETA 2DY1A 2PMDA 3I1FA 1NJID 1M1KD 1KTVA 3QFRA 1VQNB 4RD3A 3CCUB 4RD2A 4RCYA 1VQ4B 1QUFA 3AVUA 4ACAA 4DQKA 1GAWA 4TMZA 4B3XA 4HE5A 1QFYA 4LBZA 4MYUA 5DSZA 4B4DA 4EH1A 2QEXB 3ZZTA 1Q82D 5EMNA 4M2LA 3CXCB 3W2IA 4QHYA 4Q7JB 1R5BA 3W2EA 2B7CA 3J81k 1TTTA 2BN4A 2BV3A 1IJEA 1FRQA 1FNBA 1JJ2B 4ZGQB 4F7DA 1KK2A 1HA3A 2YWFA 1UMKA 1Q86D 1BX0A 1JA0A 4RJLA 1KK3A 3ZZUA 1GVHA 2DERA 4LBYA 4WQMA 3B82A 3ZBTA 2FX3A 1FDRA 5THXA 2BM1A 2HDNB 4AF6A 4J0QA 3SJZA 4ZCIA 4YAWA 1QGAA 1ZM4A 1QUEA 2QDXA 3QFSA 3CPWB 1N0UA 4FWTA 1G7RA 1N0VC 1GAQA 2YWGA 3QE2A 3CMEB 1EP1B 1QVFB 3WBJA 1YITB 1VQLB 2B7BA 3CCJB 3B8HA 4FK8A 2GQFA 5FA6A 1KK1A 2XNJA 4B44A 3I55B 1VQKB 1VQ6B 1D1NA 1AMOA 3CCRB 1A8PA 3CMAB 1QVGB 2PLFA 1JA1A 4PC3A 2BGJA 3OZVA 3CD6B 2HMAA 3VMFA 1I7PA 3MCAA 4LBVA 4ZCLA 2E1RA 3CCQB 1FNCA 1E64A 2X3UA 2DCUA 4TMTA 1EFUA 3CCSB 1XE1A 2AHOA 4PC7A 1KD1D 1OGIA 1E62A 2CNDA 4M4SA 3FPKA 4PC2A 4TMVA 2YWHA 1J9ZA 1K8AD 4TN1A 3WNBA 2CRVA 4YAUA 1R5OA 2BGIA 2RC6A 3ZC3A 4B47A 1R5NA 1KQSB 2OTLB 3P26A 1VQPB 5HXBA 1OB5A 5H59A 4LBWA 4HE6A 2VYQA 3WXMA 1Q7YD 2J7KA 4N3NA 4BPRA 1FRNA 1F60A 1QFZA 1WDTA 3W2FA 2BPOA 4YAOA 3AVXA 1B2RA 4YALA 3VNUA 4MYTA 5H5JA 1B23P 4U9UA 3W5UA 1GR1A 5GV8A 1TVCA 1VQ8B 3W2HA 3CCEB 4H9GA 2QTZA 3CB4A 4G1BA 3G71B 4ACBA 1YIJB 1CQXA 4QFMA 3CC4B 4P6VF 3WBKA 3VO2A 1ZUNB 1W34A 1DDIA 1VQMB 3I56B 1EWYA 4RD1A 1N8RD 3AVVA 4K1XA 2QTLA 2YWEA 3PENA 4Y7CA 3CC7B 1ELOA 3W2GA 1IJFA 1U2RA 5TV2A 3MMPA 1SM4A 1OGJA 3A1FA 2NPFA 1D8TA 1SKQA 4RD6A 1ZM3A 1EXMA 1W35A 4R71A 1GJRA 1W87A 3OJWA 3OJXA 3WY9A 3ZBUA
chains in the Genus database with same CATH superfamily
4J4TA 3OMXA 2MJLA 1U7PA 2JJ2A 1TQ8A 2VP3A 1AGPA 5I5GA 2YV1A 4KPUA 4AP5A 4CL0A 1JT2A 4NBUA 4BVBA 4A9AA 1M8KA 4EENA 4OA8A 5IYRA 5B3JC 2NMVA 3IJEB 5SY9A 4ZK6A 2FW0A 5CBPB 4LVUA 4IHJB 2Q6TA 3GIDA 4C6TA 4H1TA 3ET5A 1GKUB 4QVGA 1AV7A 3KQPA 3OI7A 4Q3LA 4YFYA 5EJ2A 4B4WA 5J2UF 5BSFA 4EX7A 2H5EA 1JTFA 3ZDXB 3L82B 1ST2A 2ZYAA 3CCCA 3BB3A 4F60A 2W6JA 5HF9A 4G4SO 1CZHA 3UAWA 4JHXA 1ZIDA 3OCJA 3QUCA 3I01A 4PZYA 1D7OA 2HIMA 3REGA 2OFFA 3JPYA 4XQ0A 3AY6A 4UCQA 2Z1NA 3JAMA 5EYPA 4OPVA 1G5HA 2PUVA 1O96B 1TFUA 2FYTA 4DJAA 4F4HA 2O8DA 3TQTA 2OV8A 1NVDA 5F4JA 1U7OA 1V11B 5CA1B 1NNEA 3N53A 3LA8A 1G2OA 3TTVA 1DIHA 4EGAA 1X7WA 3S2YA 1DBQA 3EGXB 4N7JA 5C51B 4H7JA 4MNTA 3BWCA 4E51A 1U1CA 4Z0PA 1YHQB 1CLUA 1JHAA 2FPIB 1PG0A 2JATA 2W6ZA 3M82A 4I8DA 5KVCA 3AF1A 3P9KA 1MRZA 1XQVA 1NWCA 3BIFA 3KS9A 4CFSA 5FL7A 1MAUA 4I66A 1Z38A 2AE1A 3I2KA 1UAYA 3OEYA 4R31A 3V80A 4A92A 1NMYA 2QW8A 3GVPA 4DLKA 2GPYA 3KOMA 4NF2A 3W5SA 4ZZ1A 2RCYA 1TYEB 3V4RA 4OLFA 1XQXA 3HYTA 2VDVE 1RMQA 4NI5A 4PHFA 1XX6A 1XMSA 5A05A 1FFWA 4R1TA 2ZZEA 1BXRB 3BH0A 3LCVB 4G0ZA 1YHYA 3EAQA 1W9MA 4RQBA 5CM2Z 1U8EA 2IZ1A 5EUBA 4ZHQB 3EXHC 2VTBB 2X7JA 2IZ7A 5D2CA 1L7RA 2F3PA 1DOAA 2JFYA 1YZLA 3LD9A 3QFCA 4LJSA 4CUKA 1Y3HA 4DIBA 1MA3A 3E18A 3Q9SA 4DDMA 4C0SA 4H35A 5CHYA 1GXSA 4JI5B 2HSZA 2GRJA 2YJTD 4LJ7A 3C5HA 2OCIA 4JJAA 2ZSDA 3JQGB 3CP8A 1IY2A 3UK0A 1EDBA 2B6NA 2OBBA 2OV6A 3GFVA 1YACA 1UJCA 1WF3A 2A5LA 2QROA 2ZSAA 3A8TA 1HLGA 1I6WA 3GZTB 4OEHA 2ZBRA 5ALXA 1G20E 3D7RA 3PQ2A 4H4EA 5HFJA 1XL0A 2GYYA 1Z8FA 1EJ0A 2D74A 3G05A 1FXWF 4JBIA 5BSVA 1E2FA 2PL9A 3U3ZA 3KZCA 3AT1A 5KWEA 1JHPA 3B51X 2C82A 2AGVA 1N3LA 5AVSA 5ILGA 2QE7D 1AO3A 2A1UB 2EIXA 3HRHA 3LPCA 4M0MA 3RKSA 4BNVA 2PX2A 2W2QA 4MS1A 4B32A 3EOAI 2PL3A 1KAMA 5IAEA 2CD9A 4TTVA 4RSRA 3G7NA 3H84A 3LDGA 4MP3A 5H83A 3R76A 1IL0A 1KVTA 5E9WA 2FTKE 3O4RA 4MINA 4D6XA 4CGYA 5KYYB 4KE8A 4NK4A 1HKHA 1RWMA 1FX0A 2Q4OA 2X0IA 2YR0A 4IUCS 5TJHA 3SNHA 2OKGA 4TM8A 3MT9A 1IIRA 4WXYB 1MGOA 5AK6A 3SY8A 1WTHD 1C3JA 3UB3A 5I7AA 3O3MB 4D26A 4OXKA 2QLBA 4EHIA 3NHPA 3WMRA 2FEKA 4BNXA 1RLMA 1L8OA 2I3ZA 4DNQA 2FUNB 2PLAA 2AJLI 2P9YA 3FVVA 3VZRA 5JXIA 2ROQA 4EARA 1VKHA 2WIFA 1OHHA 3CVJA 4HNQA 4Z51A 3U5ZB 4ENUA 1RYFA 5TX7A 4N54A 4BWVA 1QE3A 3UK1A 4RNCA 4YP0A 3MBIA 1YBVA 3AEXA 5D1NA 2BFFA 3AHIA 4NDZA 3VKHA 5KTYA 1KO5A 2XDWA 3E58A 4LJ8A 4NU0A 3CR3C 3H9BA 3BHJA 2PT7A 2QV0A 4GLFA 1U0FA 4BLWA 1E6LA 1GTL1 1V95A 5EI5A 4TKOB 4JK3A 2J5RA 4RD4A 2JDID 3C3XA 3K9LA 4C7MA 3HDTA 4N8DA 3BMNA 3I04M 3HI6A 1PG5A 3N0TA 2BP7B 2VKQA 3PHBE 1QV6A 1JXAA 1NDUA 1P0CA 1D04A 2P27A 2IW3A 2I34A 2X40A 1F1JA 3WLOA 1LLCA 3DDSA 3EK2A 5EFOA 3NGLA 3SXPA 1SPBS 3CX8A 4E0BA 5JY1A 2WYRA 2DX7A 1OWLA 1TLLA 3I0ZA 4ZEOA 3S27A 3SC2A 1C8LA 1E79D 1P5RA 2M1XA 2GAJA 3KDPA 4H2DA 4IMRA 4BHTA 5KNCH 4MVWA 4AKEA 1J2RA 1TKCA 1SCDA 1C9DB 1ESZA 4ARBA 1UBCA 4Y8VA 1YJWB 4BQNA 4C76A 4EJMA 1KS9A 1Z16A 3OX4A 4JJZA 3AVQA 5LUAA 4FU0A 3OU7A 1S3IA 2PUBA 3ECAA 4NWIA 2XZLA 2D3TA 1P4SA 4OSOA 3T3EA 1CUIA 1Q81D 4J1SA 4RZQA 1P7CA 3MVEA 1HI9A 5JRZA 5JCZA 4L2IB 2I7VA 3EVCA 3H4MA 5CBPA 1IZ8A 3IESA 4OUDB 1KGDA 1G41A 1XP8A 2HJVA 4XNFA 4RORA 5P21A 3HBLA 1OI3A 4JGIA 3U7QA 3UGTA 3QKIA 1FVHA 4B3FX 4L4ZA 2YUIA 4H1HA 4D4LA 2D6FA 5D87A 3INGA 4TQAA 2NZUG 3GFPA 3D4PA 3LQYA 3AW8A 4MKGA 3KK0A 3LYUA 3P52A 5DKFA 5KYWB 2O8CA 1E63A 1YV9A 3LWNA 3NP7A 3QE4A 4E94A 1OKKD 1XTQA 3I0MA 1V35A 3JQQA 5I7SA 1YUMA 3DDHA 3IUQA 3ITKA 1HYGA 2BELA 2R97A 3T51B 3QVUA 3N70A 4KSYA 4HK4A 1O94C 1VHJA 3IHLA 1YJXA 2WB4A 3A6DA 1V6CA 4B6OA 1PUJA 4E2XA 4MQ5A 4TSFD 4YCBA 1GHTA 3MUEA 4EELA 4TV8A 1NJ8A 1NY6A 2XGGA 5KJFA 1LNQA 1O08A 3X1MA 4Z4QA 1T29A 2BFAA 4M7WA 4QATA 4Q4LA 4RIIA 3UOWA 2KBEA 4HZGA 4BNHA 3DKPA 5BWLA 2ZRKA 5KQPA 3RSOA 3CUVA 3J7TA 1GDHA 2GJ4A 3KB1A 4UU8A 4TLCA 3NWOA 2A4KA 1Z12A 3GEMA 4TMZA 1U8YA 4W9NC 1N4AA 4OQZA 5SICE 3KQHA 1QFYA 5TPWA 1LQUA 3FGNA 4L8VA 4OP3A 4ZOLF 3RODA 3VR0A 3T38A 5KDOA 3PNVA 3TZQA 3ZZTA 3L8MA 1RSZA 2AJCA 3D4OA 3MWLA 1PJLA 1U7DA 4MVYA 3VVMA 1XCGB 2G1AA 3JVVA 2GEDA 3ONFA 4C3UA 1X7ZA 1PI3A 3FPFA 3N2NA 4KXNA 4QXAA 4ALMA 4QM6A 2I7DA 2ZIVB 2AL7A 1RRPA 1DJNA 3H9UA 3L4BC 4ROSA 2I71A 3A6HA 5CJ2A 3KR1A 1PSDA 1FFHA 4WY8A 4Q1AA 1ANKA 2D00A 5BN5A 3ZHZA 4C30A 3A1UA 3TXYA 3VPAA 2FWNA 2OFOA 3OE7D 4AL4A 2POQX 2HMSA 2GPBA 3M5WA 3RIHA 4F8YA 4ZGQB 4DV5B 1P1JA 1Z39A 4RXUA 1GADO 5JAHA 3GUCA 1J20A 1UXOA 3SYLA 1M34E 3IXQA 1DKPA 2AXEA 1Y9ZA 2O19A 3N8IA 1SXJD 1VLZA 4L6AA 3UF0A 3O1HB 4J9UE 3Q9NA 4ZVPA 3FMFA 1KH2A 4R0VA 4IQ8A 4JUDX 3SEFA 2YJ3A 2DAPA 2HJ9A 3QK7A 4UAVA 2F2TA 2PX8A 3WRXA 1P7ZA 4GSKA 1NW4A 1FDSA 3IR6A 4CRWB 3HV2A 1OWPA 1JTEA 1NRXA 4GP9A 5CW1A 3V42A 1Y3CE 2BOVA 1UBJS 1O95A 3B82A 2AW3A 3KZ1E 3E5MA 1N8KA 1X7WB 3NCTA 2QUZA 4G36A 4OLHA 4PCAA 1E1KA 4NK5A 1W88B 1RAEA 2L2QA 1J70A 1XP5A 2I9PA 3D8UA 4J0CA 1BMTA 1YMVA 5HVNA 2ZYGA 3BMCB 2EBUA 4LNHA 4MPPA 5AVWA 3RG8A 4UTZA 2VP0A 4LHVA 4X3PA 3SQDA 3SJZA 1R9NA 2C99A 3RSHA 5K51A 1BX3A 2QMHA 3C6XA 3M3PA 4LHXA 1Z37A 1UBSB 1V37A 2HO5A 3NG1A 3INRA 4IUYA 3W9YA 3WBFA 1M9NA 3IQDB 5FKJA 3K96A 5CVEA 1QCCA 1XKXA 3ZWPA 2H1RA 2RJNA 3UK7A 1JAHA 3CMEB 1KZ9A 4EKDA 3PUYA 1WSAA 1E3QA 3WBJA 3CZMA 4WKBA 5E2AA 2XQFA 2YN4A 3OG9A 1FFXB 1CUZA 5DBOA 3KD3A 4RLSA 3CSUA 4RKWA 3CCJB 3G89A 4FB4A 3H5WA 3AL3A 1ZGJA 1JJ7A 3HYLA 3EPHA 5FTWA 3VGPA 5FUQA 1GXSB 1A98A 4PLTA 1GUDA 2A9PA 3CWCA 2DSTA 3PFBA 3WGLA 5BVGB 2ZANA 5FP0A 1VQ6B 2B7LA 4BFYA 2ZSUA 4PHGA 2I0FA 3TKYA 1VHEA 1TVMA 1QIEA 4OIMA 5CLJA 3NATA 1KIAA 1DIAA 1NQWA 1ZUWA 1PZMA 4PPNA 5JROA 2Z5FA 3OO1A 2YXPX 2QOEA 3BUSA 1WUJS 5L53A 2RFLA 2FMUA 1WDKA 4IEFB 4RIFA 1GUZA 2DG2A 2R65A 3LC7O 1ORTA 4PZDA 4RADA 5EUMA 4MIYA 3TCXB 3TW4A 1JEYB 4R81A 5IZCA 3OPXA 1E1LA 2WV7A 4X8HA 1SQFA 2QP3A 3EOZA 4RHFA 2WJIA 4UMVA 4WFQA 5JHGB 2GXQA 1FPMA 2HL6A 5KSOA 4JASB 1ZH8A 3CZ4A 4C6HA 3R7AA 1RXEA 5KYNA 2QUAA 1BDBA 5SZHB 2PVSA 1T6BY 1VPDA 1R9MA 2VBSA 4FFNA 4GICA 4L9AA 4RU1A 3SE7A 3DWIA 4KIGA 1VL2A 3FPKA 1RYNA 3CUUA 2QPOA 4PC2A 4IIHA 1XRLA 2NACA 3IIJA 3B12A 3OQIA 4UAUA 4U7WA 5TGZA 4CLEA 4UMFA 5AVUA 2AG8A 1SGWA 5FNZA 3BGDA 5FR1A 4AJNA 1K63A 3MS4A 4L57A 5ABPA 1JILA 5KQMA 1QRSA 2FPIA 1NJGA 2CRVA 1PHPA 2YHAA 3R23A 3KYIB 1CZUA 1W4AA 1IEWA 4MGEA 2J0QA 2AOUA 2VXCA 3RJ5A 3DXXA 3UFXB 3EUWA 2G36A 1WMBA 3IP3A 1DCKA 3EQ9A 3DL2A 4C0WA 1GNVA 3PD1A 1IK4A 4XWTA 3EVDA 1AC5A 1Q5PA 2BR3A 4GYYA 4MQ4A 1V25A 2WD8A 3PWZA 2Q3LA 1H2RS 3FD8A 5E6RB 2VYQA 1XYVA 4TTPA 5D3MA 3WZ2A 3ROEA 3R5JA 4DXDA 4K6CA 3HEBA 5ERYA 1BCSA 4GXNA 3PYLA 2DR2A 1KEPA 1QHXA 1WUTA 5CDUA 1K8QA 2R8PA 5EXXA 5K8IA 1WQ4A 2IYUA 3RIMA 4AVYA 3BWEA 4C7BA 3PFHA 1SG9A 2P8SA 2WABA 2WFZA 4I1RA 4MW4A 3U1BA 2X5NA 3L41A 2GSDA 1EAYA 1ZGCA 2XNHA 3REOA 4BMPB 4U8GA 2WTXA 221PA 3NDIA 1VTKA 4TLDA 2I65A 1Q9SA 4P3IA 1MIOA 2QZPA 4WXHA 2RKOA 3QTTA 1Z75A 4ZALA 4EX6A 1Y8AA 2PT6A 3BRCA 5K3CA 1E0JA 2HREA 1EMDA 2E37A 2XZDA 4LOIA 4RQUA 2VBUA 1NZJA 2CUKA 3AEQA 3MXOA 4RV9A 5CLHA 1VGQA 3C1AA 5FTMA 4MQEA 4ZYVA 1LC0A 1DC4A 4LFAB 1QB8A 2O7NA 2P3SA 4HLNA 3G71B 4ACBA 2NUPB 1CQXA 3B1YA 3I5AA 4WEQA 4MZXA 5DHTA 3RYHB 1N36B 2DUMA 2A9VA 4K8RB 5KAMA 1H3FA 2HK7A 4D9BA 4EJSC 3E7WA 4Y0AA 1ZD2P 2VTVA 3S55A 3SICE 3OCXA 5GAJA 2WHRA 4IDOA 2JLBA 1VL1A 3IP1A 3PCXA 3QA9A 4QBFA 1YIDA 3G17A 1U9CA 4IS3A 4O8ZA 4FINA 3ZTWA 4Y2TA 1G8SA 2R5WA 4MA5A 5AXDA 2P90A 2WWVD 2WR8A 1FFEA 1JMYA 2AXNA 1O6ZA 2FZCA 2BMDA 3MRSA 3DAOA 5J63A 1A96A 1L1QA 2EWVA 3EEQA 4FT4A 4XQ9A 4F5YA 6NULA 5EIOA 1N8TA 1Q22A 3FYUC 1JIJA 1LK0A 4MUMA 4O2AF 4H7KA 4TLLB 3WE7A 5MGNA 1TNDA 4LF8B 4FR2A 3USCS 1O9GA 4MVJP 1GL3A 3RFUA 2J41A 2IX9A 4CT4B 5J2TA 2JS7A 2QTMA 3I2JA 3TD6A 3LHSA 2MSWA 2GCEA 3DLAA 2VDUE 3MMPA 4PZLA 5GMOA 1JKIA 1RP7A 1Z6TA 3UGJA 4QEDA 3LPMA 4H6XA 1HSZA 3EHDA 3G23A 1L1FA 1JFFB 2PGNA 1RQXA 3UFXA 3RVLA 2QN2A 3NC1C 1W35A 3MWFA 5L4SA 3THWB 3HWSA 2O59A 3JYPA 4GYKA 3R7SA 4OXNA 5EXPA 2G4VA 2P6PA 3WWOA 2YYAA 6LDHA 2ZYSA 2Z2IA 3ENWA 3HJGA 3N8DA 3OZXA 4ISBA 3WK4A 4EHJA 2ACKA 3FWHA 3WY9A 5E7JA 3FG9A 3FPSA 1USWA 2GTIA 2D3NA 2KB0A 3C6MA 1ETHA 2VCYA 3Q7IA 3MCVA 4G09A 4NJMB 5F1OA 3WB2A 4QQNA 2IE8A 1IBMB 1F4LA 1DKQA 2LRHA 1MNQA 3GT3A 3HKBB 5TVGA 3LHKA 3RK1A 4FYXA 4Y9RA 3KL4A 3KKZA 1OFVA 4OQPA 5A3VA 3LBAA 4LZAA 3HKEB 3S1AA 3UAXA 4FS8A 1V0EA 3DVAB 1H93A 5HE9A 2CV0A 1YQQA 3V1KA 1R6AA 3HCFA 1OLOA 2ZROA 2BIFA 5ELXA 4KO1S 1U63A 2BDTA 2FDXA 2P3QA 1XQBA 4NZPA 5AMXA 1D03A 4DVJA 2QD3A 1ZK1A 3JSXA 4QDZA 5BY2A 2HOQA 3HCPA 3AEQB 1ENOA 4ND6A 5JD3A 4URZR 1OR8A 4QDXA 5JSKA 3RU7A 2RH4A 1GL7A 3WR5A 3U6KA 2HXYA 1XZNA 2YDYA 1U9IC 1ICIA 1ADYA 1MA0A 2GTPA 4C20A 4CIDA 3LY9A 2WYHA 3B3QA 4L5IA 3D6UA 1LCIA 1QPBA 2Q3JA 4ZQFA 3ZHXA 1YZKA 3ANXA 3WMGA 2A67A 1DU4A 1JV2B 1XMVA 1XU9A 2ZR0A 4RDHA 3SPXA 3S2ZA 3QE9Y 5CFZA 1QHIA 1UBNA 2K4MA 2FHSA 4BRWA 3LECA 3ROZA 4EVRA 1ILEA 2Y27A 5F2EA 1BYUA 1T0HB 3AFMA 5FJJA 2PKCA 3RR2A 3L7KA 5EJ4A 2DQZA 3KYJB 3OM0A 4MS4A 5JZBA 2OMEA 4TTRA 4TUYB 3WAJA 4FHZA 2X6RA 3NTXA 4W1SA 3WOHA 4JIGA 3TLKA 2JI9A 2D59A 4MVJH 3LLMA 3JZAA 2G70A 4YGXB 4CLRB 3KTOA 4CEJA 3S6JA 1FFYA 1PW5A 1LD3A 1DIOB 4LGVA 1C5KA 5U4QA 4TVKA 1VLVA 3JW8A 3A2KA 3VH1A 2E4AA 2JHGA 3EVTA 1SC3A 1PFGA 1JHXA 3D26A 2QN6A 4LMRA 1C8VB 4KRXA 3SF8A 4WE3A 3HA7A 1LF5A 1MN6A 1YO6A 3TDMA 3D7SA 1RJEA 3PUIA 4XPZA 4F2DA 2QRGA 4E88A 3G85A 1JR2A 3E5NA 4BASA 5HRAA 2PMFA 3CRRA 3L7JA 2W4MA 2QVCA 1WY7A 2VL7A 3KEFA 5AOAA 3TW8A 2V7TA 4NX2A 4XQCA 2PV0A 4AIIA 1KRHA 1N92A 5EEGA 1ADBA 1WTAA 3WLFA 3T1TA 4IVRA 3KQNA 1E2JA 3T5GA 1HQYE 2GRUA 1XPJA 3IOYA 3L6BA 3GQVA 3IPXA 1MOQA 5JD6A 5JSUA 1EIWA 4NCXA 1Y8QB 3JPWA 2Y4NA 3P96A 4MVJE 5L3RA 4ZYLA 1AE1A 2CN1A 2PV7A 1PWYE 1SU7A 1FFGA 3UN1A 2YV4A 2JFUA 3REQB 5HJ7A 3L0YA 4LRQA 3WGKA 4GQIA 1RCFA 3QELB 1WW2A 3T9CA 1SHUX 3L0OA 3HPRA 4EEZA 2TMYA 2DJ5A 3O83A 1KAEA 3ITDA 4R1SA 2PKXA 2G28A 5K20A 1G20A 2X86A 1OIWA 1UK6A 1FDUA 3QKRB 1EK1A 2W48A 2PFGA 1V5EA 2F1HA 4R7ZA 3B6IA 3S5JA 2V9ZA 2K7FA 4C6SA 1FW6A 4P7GA 3L43A 2O5CA 3QG5A 4C3OB 3FVQA 3ADKA 3MGBA 4GE3A 1RZRA 3NYIA 4F9TA 1W30A 3C7AA 2DPYA 4AJ9A 2IPNA 2XXBA 3M6FA 5K7SA 2XB2A 3B2NA 2NQ8A 2C92A 3QY9A 3WGNA 5EHGA 2GJPA 2VHUA 4MCJA 1X1EA 1XDZA 2X23A 1QO0D 2OD7A 4UU1A 2F9LA 4LPSA 5HKKA 1KVUA 1MX1A 1ZZGA 2LR0A 1D7AA 3NHJA 2AG6A 5F21A 2C9BA 1ZK4A 2H0QA 2NO7A 2NSLA 1PJTA 3DE3X 4RDKA 2I7CA 4HN4B 5A4DA 1KERA 3PNSA 1K7SN 4IILA 4YYZA 5KPDA 5EINA 4W99A 4L76A 3ZUPA 3SYTA 3F96A 4D6PA 2FP4A 2ACVA 2OTJB 1QDLB 3GCWA 4G1MB 3WYGA 4BBJA 1KI4A 2EF0A 4EVIA 3I9LA 1WXEA 3DFUA 3LUBA 4CDRA 2WAXA 3CLKA 4KWCA 2JH8A 1P6QA 4GBMA 2W6ID 4KV7A 3UA4A 2OR3A 1PHRA 3R0XA 4HX2A 5EPEA 2V3VA 3FFAA 1XU4A 5FWXB 2OUKA 3K5IA 2AOTB 1TJ4A 3SSAA 1EFPB 4IICA 3K35A 3LK6A 2PMKA 1NVEA 2EX0A 4QRHA 3JR3A 3HJFA 3QMPA 5K0ZA 3FTCA 2V03A 3NEPX 3T9AA 2VQSA 3HJBA 1CUFA 1U0OC 1VP9A 2PUWA 3B2QA 4GMFA 1F12A 2HMYB 4I1UA 1Z0ZA 1ZITA 1MOSA 2EJWA 1P2VA 3MN1A 5KYYA 5FWXA 2QZ9A 2OSBA 1NQAO 2GGSA 3OTHA 3GH1A 1B73A 2Q6OA 1RDFA 1PFQA 2Z83A 3JYQA 1YCDA 1BXKA 1QHHB 2RARA 3DNPA 3EZXA 4D99A 4DJJA 2NXNA 5KNBH 4OX9B 4LRWA 3K9WA 2HEIA 2HQBA 3RK0A 3I05A 2XUDA 1OI7A 1WOSA 3O8QB 5BXYA 4P1VA 4NKRA 1LY1A 1DZ3A 2FV8A 3MWEA 3R3HA 3FB4A 4IHQA 4IOMA 1WULS 3VR4A 4Z1MA 2XCQA 4WX2B 2QBYA 1XCOA 3II6X 1P2TA 1YB6A 3AUTA 4L6IA 2H2AA 2GCIA 1DX4A 1NBMD 4L5AA 1KHHA 1SUWA 4Y6OA 3RVRA 1HFEL 1KNQA 3DPIA 2EAUA 3JQ9A 4M60A 2IS6A 2UYGA 1UJ6A 2FR0A 3NBYC 4RAOA 3AJRA 4FFLA 2OG1A 3RNOA 2TSYB 2NP7A 2QVYX 3B36A 1SKYB 5HZAA 1I13A 1OU0A 4AJ1A 2ZYTX 3BMNB 4C5CA 4CODB 2IH4A 1G7SA 4TZTA 2YDXA 4R8LA 4ZAXA 2WE7A 1CY0A 3E35A 3FFBA 3F9RA 2PMDA 1PUXA 1W46A 1ENZA 3D8SA 2NGRA 3OOSA 3EQ6A 4EB8A 3H05A 5B2EA 3A2LA 3UQYS 2BFDB 5LQKA 2QD4A 3CJQA 2AWNA 4KODA 4IH9A 5CPFA 5DNVA 1IE3A 3E6AA 1ZO8A 1QH1B 3O91A 5FJIA 2Q0HA 2QP9X 5DHFA 3TLYA 4YRKA 2PHZA 3N0XA 3ZDDA 3TOVA 3GFRA 4Y67A 3OEHD 5IBRA 4C0JA 2XGMA 3ROMA 2PPLA 4EATA 4LDNA 1HFKA 1QIIA 4LYEA 5KNDA 4I2NA 4BGVA 1PGJA 1SXJB 3CE6A 4Y9TA 2P9HA 3BGIA 3H42B 3FOWA 2F1RA 2PBLA 2EIHA 4ZT2A 2FP4B 3K09A 4EB3A 1MIOB 5ITWA 1Z7BA 4QOGA 4EHLA 1UPAA 2BGLA 4BX0A 1ZG3A 2QIOA 1EKXA 2VJMB 1MNAA 4IDBA 4JLJA 2X5JO 4PG8A 3RVQA 1PJRA 2OORA 1D2HA 1VRCA 3GJTA 3N2LA 1WCXA 4F1WA 2XMDA 3A3YA 2L17A 4MQEB 4X41A 5AM5A 4JEHA 2VJQA 3HB7A 4OFWA 4AUMA 3G82C 3MA0A 4K9OA 4XFKA 4YTEA 1WKVA 4BCDA 1DTSA 2B1RA 4ZVOA 3FOZA 1ZU4A 4JJIA 1G42A 2AX4A 4UU7A 1TZKA 4G5YA 3ZXSA 1AQYA 4X85A 4JCOA 3PX2A 5CVJA 5GONB 1EXNA 3UMJA 5DNUA 1QPZA 4RPGA 3BXEA 4I50F 4CG1A 1C7RA 1QORA 1VLOA 2ABWA 1Z5OA 2CXSA 2FPGA 2PWZA 3O90A 5T57A 1GR0A 3TNYA 3TSOA 1Z26A 4E7OA 3ASUA 2Z2KA 4RVFA 2R7LA 2P1DA 3WQBA 3G1TA 3WKAA 1RRKA 3EXIA 3P5BA 4CCSA 4FGJA 3NJ8A 4GW3A 3EEBA 4M6WB 3ZZNA 1GOTA 2AFIB 4DQUA 1EFRD 4JC4A 9LDTA 1XDDA 2R5FA 3IUPA 2FSPA 3F7TA 4FTWA 1RE0A 4RNDB 4FSDA 2NUAB 5IFLA 1BN6A 1HL7A 2VZ0A 1F2TB 1YS2X 3NONA 4A10A 4DK0A 5EHZA 1GFSA 2CYCA 5IJ9B 2VXBA 1ZVQA 3K9GA 3HCWA 5K8JB 1ULHA 2DT8A 4FDAA 3N5KA 1EESA 1GUBA 4Z0NA 5AIAA 2ZOSA 1G18A 5HGJA 5EZYF 1RPTA 3U3XA 3PXDA 4M22A 4G67A 3IP7A 4BEWA 4ECAA 4HVTA 2MSNA 1VE9A 1QLJA 4EPTA 5K3OA 2BSQA 1S9DA 3C1UA 5MFZA 5GGXA 1P73A 3PHCA 1W5BA 3W6NA 3PGJA 2ONCA 3B9PA 4U7JA 1PK7A 1RYMA 2YWGA 1REQA 3FM9A 1EP1B 3PBKA 3PHIA 4PZ0A 3T9BA 1XO1A 3F5QA 3IMGA 1NB9A 5ER6A 2GEVA 2GBCA 3I1IA 4GR9A 2O5VA 1O95C 3U9LA 5A02A 3GYBA 2ZM5A 2JAPA 3QX3A 2VH2A 4R9SA 3JYOA 1H1TA 3SHQA 1X7HA 3JRWA 2EARA 5TQJA 5FLXA 3OHSX 1AGRA 5BQXA 1V6AA 4IV0A 5CYGA 1N2ZA 2CSUA 2HUNA 4P9SA 2JGKA 2XB4A 2Y9PB 2YOHA 2CHUA 3L0IB 3PNYA 1YI1A 4MEJA 3OPMA 1EHYA 5TT0A 5B55A 4K9MA 3CMAB 1QVGB 2NVOA 3ULKA 2IT1A 3GL9A 4B0OA 4QDKA 4PC3A 4C6TB 4QG3A 1BFUA 3CVWA 4KFRA 1UFVA 3CD6B 2B0JA 2OTCA 2QXUA 3MNFA 4US0R 3VMFA 2B8JA 2JC3A 3F5MA 5HTOA 3CUYA 3MCAA 2X9NA 3DDZX 4MV3A 1B43A 3H9GA 3UXMA 3IB6A 1KARA 3DD1A 4DARA 3H8WA 1LTHR 4RHYA 4J7AA 5F76A 3FKSA 1IHDA 1WEHA 1P4HA 2QQEA 4NULA 2ZRJA 5F78A 3O7WA 4FYKA 1BE1A 1TADA 3BFVA 2VP2A 2X5XA 3EZNA 5C32A 1KD1D 1WCV1 4A5SA 3C3EA 3D3WA 3D1LA 4DL9A 4E4TA 4Y98A 1ORWA 2FB9A 2PXCA 1DWUA 1HUQA 3UJ7A 5HJEA 3PV0A 2YJ5A 1FEZA 3BQMB 4DAEA 3VR6A 1J22A 4DC9A 1J9ZA 1TO2E 4HEHA 3DOFA 2OGUA 1CUDA 3AIOA 4QUKA 1DX9A 3D8RA 1YR6A 5AKLA 1V96A 4RFLA 4EJFA 2CMKA 2J0SA 4ROXA 5CCDA 3UC9A 2JI4A 3UT5B 1XDGA 2NZ8A 3ASSA 1KZ4A 1TYDE 3OF5A 4IOJA 1NX9A 3OUZA 2W37A 5CB4F 2GKGA 1CR2A 3FXAA 3PIIA 3G2JA 4WESA 4CM1A 2OTLB 4REQB 3R8CA 4RHTA 3BSWA 1OB5A 4UM9B 5AVZA 3HDVA 2AN4A 2CJPA 3A05A 4NCBA 3H4VA 4LZZA 2X0FA 5T4HA 5FDFA 5IBCA 2O0LA 1SVIA 4X6LA 4C7OB 2AG5A 3BH4A 5H3LA 3TLCA 5KJ6A 4CDMA 2ZUEA 2C95A 3PVCA 2C4MA 4HGRA 3S8EA 2H7VA 4YMVA 3WWYA 2Y05A 4COOA 4F3CA 3LT1A 1OFUA 3BZUA 3TGPA 1U4NA 5JD4A 3BIOA 4YASA 3FSJX 3ZD9A 1NNUA 5BN3B 1AOXA 1XJWA 3KU1A 5FTNA 1QANA 1TK2A 4KIJA 4JA2A 3ZYZA 1LK7A 1E6EA 4YAOA 3HCRA 5ALGA 4C4XA 2I62A 1MB4A 3G2NA 4FDUA 2IA5A 1EQ2A 1N9GA 4WK2B 1CUYA 3SX4A 2WZPP 1K9VF 3FPCA 3AHCA 3C5VA 4PGHA 2Z04A 1Z15A 2Z9BA 1VPVA 4NCAA 1J0DA 3ANLA 3K72B 4NYMQ 2M6KA 3OLWA 3QXGA 3NHBA 4KAAA 4MO9A 3AX6A 4MWDA 4P12A 2J31A 2L69A 2PGLA 2H4YA 1YZQA 2WTUA 3BZWA 3GJXC 3CZPA 3T4XA 1QS0B 3HU2A 1HRDA 1RS0A 1RJ9A 2OQ2A 1ZLXA 4AMYA 2AF3C 1PGPA 2ERXA 3KXLA 4RMNA 5IAKA 5K9ZA 3VNQA 4P80A 1IN1A 1IOLA 2SBTA 5IEJA 1QLHA 1WMAA 2EW1A 2P9JA 3ASZA 1BMQA 4HWOA 1OBFO 5LB4A 2I2FA 4YCDA 3WJ1A 3MOIA 4RKYA 3FNBA 4C7OA 2F3RA 3N28A 2AC7A 4BATA 5A4JA 1Y6QA 4UVDA 2OPBA 3FWNA 4QREA 1JLKA 3GCGA 5ALMA 2O05A 4L95C 4OQQA 4XL9A 3FFXA 3NKVA 4L72A 1PT9A 2I9KA 2QUKA 4K87A 3A4VA 1BN7A 5CYOA 1VSVA 3G7UA 4X94A 4MJLA 1XTUA 1G1AA 1HMPA 2EGUA 1L4LA 1Z4IA 2YVKA 4B3SB 4JL5A 3ETCA 2Q2VA 1DQYA 2BD0A 4QECA 1RLJA 1EG7A 4L73A 2HZ7A 3I5MA 1O97C 3F46A 3LLVA 1N2HA 3I32A 3ICWA 4US2R 3HBAA 2FMTA 5DGXA 4M7RA 4HDKA 1DAOA 5HJ2A 3O3CA 2WD9A 1E1MA 1R0KA 3IGFA 3L5OA 5IT5A 3GDGA 5KC8A 2QP4A 4LYAA 5KU7A 4QGBA 1N77A 3H65A 2BZGA 4UXHA 3Q3CA 1VOTA 1RWWA 5IAAA 3FMIA 2Y67A 4AUEA 1TEXA 4I9NA 3KKLA 2Q45A 3T53B 3H11A 1M0TA 3QYAA 1P1BA 2ZS7A 4RESA 1FSPA 2VPYA 2NNLD 4IJ6A 4DRZA 1RP1A 4KKXB 2X4LA 2PIAA 5FOQA 2R9VA 5IJ0B 3ZWDA 4IX1A 1XNQB 3W1EA 2ZTGA 2AJ8A 3FUXA 5EVJA 1X1BA 1YVRA 2ZL6A 1R6UA 1TJNA 5AKKA 1BQ4A 1LU9A 1U5AA 3N76A 3VV2A 2D0PB 1G5IA 2UYYA 1C0PA 2EL7A 2JIRA 2XQIA 4EVQA 4UD2A 4PY2A 4KO3S 2J48A 1EUCA 4UDOA 1SRRA 4QOFA 4ZKDA 2BTOA 2HO4A 4DXAA 3CZQA 3MWEB 5JI3E 1NN1A 2W2KA 1XZQA 4QNNA 1E3MA 4LRYA 4JMPA 5JXGA 5L6LB 1M7BA 1HT1E 2D13A 3EDCA 3SIWA 2JLZA 2OO5A 2WWXA 3L6EA 5TMPA 3VSEA 3L9WA 1S2OA 4TQUS 3RLIA 1CHNA 1SFRA 5FFMA 1U1EA 2X77A 1EUDA 1XI2A 2OP0A 3Q1LA 4HFRA 4WAUA 4UXJA 4AWBA 2X15A 5TRDA 3PWKA 3PQ8A 4DQXA 2H07A 1EG2A 2W2LA 4UBLA 1N2EA 1DBVO 3BMXA 3CW2A 3EZFA 1CR0A 1WZEA 3LHIA 2I22A 3RIYA 4H31A 4NATA 3C39A 3S44A 5I9IA 5FV4A 4PLYA 3VA7A 1CQWA 1C0EA 1THGA 1VQOB 3O0DA 3FYHA 1TYBE 3CX3A 1DWPA 1E7YA 3KSMA 4JBXA 1L5LA 2YFKA 1JQEA 4CL8A 4GPD1 1QZUA 2ONKA 1KEEA 1EVYA 1U0RA 2GCGA 1N5IA 2MINB 2VBCA 1EIZA 3MUFA 3PS9A 4BGEA 2R4UA 4HGOA 3TQSA 3UJAA 2CFCA 3ZHTA 4KGDA 2HAEA 2VT7A 3G0GA 4CR6A 2Q1SA 4BQFA 1KF0A 1TW2A 4TRRA 1XZBA 3U3KA 1QVAA 3PG5A 4PGMA 1K0FA 4QLAA 5JVDA 1VQ5B 2ZQZA 2OO3A 2B9EA 2NXCA 3WO0A 1REQB 2C1ZA 4GX1A 1H0SA 1V5WA 1X1SA 4JFAA 1SBYA 2DPLA 2X4DA 3F4KA 1RPAA 1I5OA 1BS2A 3KB8A 2HNKA 1QKKA 1WNTA 3QXSA 3CPXA 1PAUA 1EP3B 1GNRA 1QZTA 2M1ZA 2YCLA 3CH5A 2A3RA 2D0OB 3OJFA 1XQ1A 3H2IA 4MAAA 5KCMA 1S72B 3RTDA 1NE2A 1Z5VA 2C1XA 2PRJA 3ASPA 2D4HA 1NJ6A 1KQNA 3ES9A 2ZT7A 3IAXA 2O7VA 1QQ6A 2N1BA 3COSA 3OH8A 1SWWA 5AVTA 2CXOA 3F98A 4U6SA 3EXHA 4UZEA 5IT4A 2VJLA 5DI3A 4UFOA 3ZR4B 4HVCA 2W0MA 4PXSA 1GO2A 3TFOA 4EG4A 3FFWA 1EWKA 2Y77A 4Q9HA 3QWFA 3U7HB 4P36A 5FXMA 4MQ6A 3AUKA 1PKEA 2DCMA 3KOZA 3W5DA 5E6TA 4CPDA 3FDJA 3P2KA 1RAFA 4HNTA 4OHFA 3U4HA 4WK6A 3AWIA 2WJJA 5HHTA 1WSBA 2OYNA 1IAQA 3N0WA 3T99A 1JSLA 3NYQA 1CP2A 1U8TA 3K70C 1CV2A 3KPUA 4KRGA 1GPDG 3OJLA 2X2OA 4AJ2A 2H7XA 4YV1A 1ZM9A 4NICA 3PJDA 1S01A 5EL0A 3CKMA 1N6KA 4ITVA 4U7DA 1DXOA 1TO6A 2CNKA 3UAVA 3Q2IA 4KN5A 3UW3A 4XIYA 5AW1A 1JLRA 2W5UA 3WB1A 4OOSA 2ZL5A 4KX3A 2I3DA 1C7JA 1TTHA 3EGWA 3P4UA 5CBKA 4IFIA 1KFKB 3BCRA 1TDJA 5LJIA 1H9AA 4KN6A 4KRFA 5CDGA 3ETLA 4IMPA 2BRUA 4CQMB 2QLMA 1QX4A 2C29D 1LJLA 2VLIA 2ZJ0A 1S02A 3H18A 1W0CA 4BN4A 4AP9A 1B3BA 5BNIA 2QRQA 2O2EA 3LT0A 5GWXA 1MVLA 5HZKA 1VE5A 1XJCA 2QT9A 4FN4A 3ZNPA 3ZU5A 2J5XA 1A71A 2YHBA 1KBQA 1PEYA 1VC2A 5I9BA 3O21A 3V6LA 1F2VA 2WE8A 4FHCA 4BKMA 2D8MA 3MUNA 5IVIA 3F0TA 3M83A 4Y2RA 1M8JA 4XYEA 4NCNA 3PKZA 4IGFA 1IQUA 1YC5A 3HVJA 3O93A 2HA3A 1UM8A 2J4FA 1CJSA 2Q3DA 4XWGA 4Z99A 5DSTA 3PT9A 2VK8A 1SELA 2FN7A 3R3XA 3TUZC 4CTKA 3AM4A 2PH5A 1AN9A 1CRLA 3KVYA 3PJEA 4QXQA 5HDBB 2ZRGA 2P2YA 1E98A 3NETA 5SV2A 4CKEA 4CEIB 3BD6A 3QXJA 5CA0A 2EYQA 4J6FA 1HRKA 1Y7HA 3C24A 3Q9LA 4CCYA 4NENB 1W1WA 2SICE 1TMKA 4PSKA 1N9GB 3KJNA 2O0MA 4B79A 2NLOA 3R3JA 4GZ5A 4R69A 5MF6A 4X7EA 1U80A 1Q0ZA 1Q1EA 5IJ0A 3A4YA 1YZHA 1Z82A 5BSWA 1XJ0A 4X8IA 3AB8A 1KYZA 4UFPA 2ZYUX 1G66A 1X9IA 3AOGA 1TYAE 3KSDO 4MWEA 4K0KB 4BFZA 2YVAA 2FI1A 4RW0A 2V7QD 2IYPA 4UPVA 2CWWA 1YJCA 4YI3A 2Q9BA 3DUWA 4MVXA 4UOZA 4JUFA 1ZH0A 1GQ2A 3KT8A 2NW6A 3AEYA 1S1MA 1UKCA 1ZJJA 1AZSC 1NMEA 1RM0A 1UEXC 2J5BA 2KJQA 3COYA 3F7NA 5C34B 4PGGA 3PX7A 3ZUGA 3CF0A 4P58A 4QDTA 1KKLA 4ZMBA 5EIXA 3IAS1 4I1IA 4FQ8A 1YS4A 2I5PO 3E9YA 1VRVA 5BNZA 2J3QA 2DOGA 2KSQA 1GSOA 5K8VA 2DQ4A 1U9IA 5JXWA 2H63A 2FN9A 4XTRA 3NE5B 2ZTHA 3FOEC 3OEEA 2Y93A 2EU8A 1CQPA 3A2MA 2OOSA 1KH3A 3GMSA 2HU2A 3PFWO 2WTBA 3UT5A 4WBNF 3M4ZA 4V1CA 2BH2A 3E3MA 1B16A 2M98A 1RLUA 3N6RA 3O31A 3OFKA 4JLKA 5K0JA 2AEJA 1P2FA 3HS3A 1VQNB 2B6HA 2CGEA 5C8YA 4F6RA 2IOYA 4LC1A 4YXWD 1JALA 1E2GA 4FGSA 3RRXA 4RZ3A 4CL2A 4XD7A 2RGEA 4IGKA 3QMVA 3E81A 3GGDA 1GPUA 1L4EA 1QMPA 3JS5A 3PUXA 4JT4A 3BE4A 2AX3A 4GPEA 3WSTA 2O8EA 1P72A 1V43A 3KU4A 1SUBA 2E21A 3A3NA 4GPZA 1VF7A 3TNJA 4MYUA 3UQZA 5LP6F 4EH1A 1CIPA 1LJUA 2Q2OA 4EGQA 5THQA 1JW9B 3L49A 4I19A 2DSNA 1HBJA 3BGVA 1ES9A 1JIQA 4RM2A 1RHRA 5K6TA 3PPVA 1PZFA 3FUUA 1DIGA 1Q6YA 2L18A 3C1TA 4O4IB 5JZVA 2DWQA 2H8GA 3GELA 3FCOA 2C2YA 2V0NA 3VJLA 4BUZA 3V2IA 4GEGA 3IEVA 4GMHA 4Q4DA 2JFGA 3CN7A 4KV9A 2VUHB 2HIAA 1NF2A 4AP6A 4PQFA 5ICGA 5K4HA 4PNEA 5JOQA 4PYQA 4GGMX 3JQAB 3P0FA 2B7CA 2YZMA 2MCFA 2XJ4A 2QAGC 2M6SA 5LZ4A 5ISMA 1MHPA 3OCVA 1FRQA 3DZDA 4LXXA 1PN3A 3C87A 3P9IA 3FPLA 4UHHA 1YS6A 4HMOA 4DIMA 1G6KA 2XNDD 1EXVA 2IU4A 5KJ1A 2J6CA 2DBYA 2WT9A 4EPRA 3IRUA 5J3OA 1AHHA 3I8SA 2H4FA 3KBOA 3JTMA 3PNBA 3OW7A 1ZJWA 2WF6A 3OWHA 2ATIA 4AUKA 4KZKA 5B3KA 3MW8A 3Q2OA 2O2DA 1K4KA 2AK2A 3OP4A 3PYMA 4E5DA 4G9BA 1KQGA 4J4HA 1QSGA 1FDIA 1I14A 1L2TA 1AGYA 1GG2A 3O95A 3SZUA 2MSKA 1SK9A 2BM9A 2D5BA 4C7XA 1U2EA 2P68A 4C78A 2GF2A 4DEVA 3B20A 2NG1A 3GLRA 4F7WA 4AZVA 3NWJA 4WLFA 1RIFA 4HAWA 4EHBA 5THXA 2Q49A 5IBPA 2HDNB 1EGHA 2QN7A 4YJFB 1DT5A 4MCHA 3TTSA 2XBLA 3IVRA 3WKDA 4JQYA 5CXXA 3C14C 2DLDA 4GKAA 4OGKA 4WEOA 5FL7D 3RT1A 3V2GA 1P4RA 2W2MA 3D6VA 4U3JA 1FIUA 1BDMA 2OXTA 1FRZA 3SIXA 3UGKA 4IG4A 1JB1A 2BCGY 1ZUIA 1TYCA 3C4VA 4FUTA 4KK3A 2I91A 3K9HA 2C9YA 2JNWA 1H6DA 1XJ5A 4Q3EA 5EMKA 2NTNA 5GADl 5CDFE 1GAQA 3SSMA 4YJ2B 1E9SA 1QVFB 1Z5ZA 3JYLA 3JZMA 2OV3A 1Z17A 4GDFA 2O54A 3EDRA 3UEOA 1YITB 1OLUB 3H0CA 5JWOA 3U4QB 3I9OA 3R5XA 5AQEA 4I55B 3ABZA 5EUQB 5AWFC 2UVPB 4HGZA 5DW3A 4YJDA 1OH7A 4AZ3A 3AB7A 4IFTA 2FVGA 4DDTA 4YMUA 1PWZA 3CLSD 5LZ5A 2GXSA 3FMPB 5F1YA 2IYZA 2CJWB 3LY8A 1VPLA 2A6PA 2XTNA 2YIDA 2G71A 3C3BA 4M1YA 5ICFA 1W6RA 4NFSA 3N1UA 2WSIA 1AMOA 1YOVA 3R09A 1D0VA 2O8CB 3FDFA 1USUA 4NDAA 3OIDA 4CCYB 3ZWWA 2HGZA 1JA1A 3PC8A 3SG0A 5JXJA 4JYBA 4E0FA 1K9SA 3DV0A 4Y9DA 4BVGA 3VNAA 3U4IA 5CVTA 2QRHA 3SKVA 2Z57A 2HRQA 4FCTA 3RFTA 4ZCLA 4UEWA 2P11A 3DOHA 3GD7A 2WUWE 3LVQE 1XA4A 1M1YB 2C31A 2GFQA 3O4JA 4I4NA 5LMCA 2MMCA 5FWNA 1KP9A 2ZSKA 3B13B 2JGLA 1EFUA 1T3GA 4HZIA 5FLEX 1Y9DA 2UU9B 3SF0A 5ENDA 3WLRA 3TQFA 3CGWA 1OLSB 3DDCA 1T15A 2CL6X 5LDHA 3L7LA 1Q0TA 4C0BA 2AVDA 2GEJA 1FSGA 1FX0B 2UZ0A 3AJ8A 3D7MA 2ZW9A 3LBYA 5FPYA 2Z6QA 3P0RA 4HQNA 4HDNB 2YWHA 3EWIA 2QPTA 3KELA 5CITA 3SLRA 5LJLA 3KWLA 4FZ5A 3A4LA 4GPBA 1Y3AA 3ENQA 3OPYI 4TN1A 3BYZA 2GXUA 4F3KA 2YWXA 5AP9A 5AH0A 4JLWA 1HETA 4PSDA 4M0EA 4ZANA 3GQBB 1TA4A 3OZAA 2WWFA 3D7LA 1LDBA 1QH8B 2BGIA 1DOZA 1BXGA 2XY4A 4LQCA 2CNOA 1SXGA 2Q1TA 1AGXA 2Z8XA 4KVAA 4W82A 3M8KA 1XWFA 4QLOA 1M2GA 1P9RA 4XEHA 4A6XA 1RBMA 2MTBA 5H02A 1IBRA 1XQ6A 3RKUA 1ZS9A 2C54A 5C4MA 3WXMA 2PO5A 2XR1A 5DBFA 3BJMA 4IDHA 3DR5A 4A2WA 4Y2XA 2FHPA 4DCGA 2QTGA 1Y5MA 1JIXA 4XLFA 2FPPB 3A35A 2QNRA 1P17A 2WZCA 1WUIS 3D4IA 3I73A 3LUAA 4R9VA 4U3JB 4M1WA 1R8JA 1UMBB 1YKGA 2A94A 2LIPA 1UK9A 2YIJA 3QVWA 1LKZA 2JAUA 3KLNA 3ZWMA 4N3NA 2O06A 2BFBB 2VHEA 3CNOA 1K6MA 4TVOA 1E79A 4QICA 1ULTA 1J90A 3EMDA 1OE0A 4FI3C 2IOHA 3I37X 4EB6B 1H8ED 4LHZA 4QT4A 2ACEA 1BMDA 2O3TA 4DA4A 2QD5A 2WYUA 4NMLA 3WYBA 5HEKA 5DN9A 2H1SA 5CURA 2IH5A 5C3UA 4OJYA 1T3HA 3VU3A 3CU5A 5I3ZA 1HQKA 4XIIA 5CDHA 1KWKA 2B36A 4INJA 2QEQA 3CY6A 1XZGA 2AMFA 1WORA 3H6KA 3VR4H 2XTMA 3TZKA 4AJEA 1TVCA 4MS1B 2RBKA 3WJ7A 1QOQB 2PWYA 1JYEA 3OQPA 4H9GA 2HD4A 2C61A 3A3PA 4KNVA 4HUTA 4KXMA 4URVR 4R9UC 3M9XA 3G79A 2V58A 4ENRA 5E9QA 4PAQA 2O2CA 1IUKA 3WK8A 1MAVA 1M2NA 4NU8X 1H8EA 2I03A 5BQ5A 3RVKA 1O5TA 1KSFX 3EWNA 2VUUA 1JT9A 3H3FA 3IE2A 3UYKA 1L4HA 4WLUA 1ZBQA 4JB0A 3K8ZA 4Q01A 3ZI0A 2EKQA 3EY9A 1K7CA 3D3NA 2XOKA 1SXPA 4WWVA 1A4IA 2C3UA 2ON6A 1RXIA 3I9V1 4M89A 3KSUA 4A2QA 3Q3GE 4PVDA 4KOEC 3I39X 1GDTA 2H1OA 5E1DA 5K3EA 1T9GR 1GL9B 1N75A 1TA0A 3EQ7A 3V1MA 1DC6A 5EKTA 1QR2A 1UXKA 4IJVA 4Q1EA 3LLUA 1JXMA 3W90A 4W4TA 4MDEA 2RGAA 3PRHA 3AM5A 2ADOA 1CUWA 3EUEA 5BVGA 1ZSVA 5G1OA 2G9NA 1XZHA 1CUAA 4ZRMA 3ICQB 2ZVQX 5FBWB 3ZV7A 1D4OA 2BR4A 3DZIA 3OIUA 4MJ7A 4MEBA 4P33A 1BHJA 3OX2A 1M1YE 1RWPA 2JFWA 3ISVA 2R6R1 1N3YA 4K9DA 4MWTA 3GG2A 5B7GA 5EJMA 3GRPA 4WOKA 5E2IA 5TQ0A 1IFXA 2FOLA 1HVXA 3LC1O 4KQJA 4BY9E 4W5RA 5EIWA 3P2JA 4GKVA 1GJRA 4M49A 3IKLA 1OCEA 2ZIZA 3C8UA 3RUPA 5T7BA 1UBMS 1MU0A 3E5RA 3L7OA 4JP3A 5LP6C 3OJWA 1NT2A 1TQ4A 3RAFC 3TFQA 2CJFA 1HDEA 1V16A 2IELA 3HSYA 4KJXA 4YDRA 3ZKWB 5FV7A 4BXOA 1S0UA 1P33A 3DONA 3EULA 3R9KA 4ZMSA 1CEXA 3OF2A 3V7UA 1MAHA 1POWA 3G9QA 2UAGA 4KFSA 4AWAA 1JECA 4F5DA 3NVKI 2NO9A 1SB9A 3S2IA 1QHHA 1DWQA 1YOVB 2PNJA 1XTJA 4TM7A 3H94A 4P5PA 5E7MA 2EJVA 3RTBA 1G8HA 3DD5A 3V4SA 4X65B 2F43B 2QD1A 2EP5A 1W25A 4A0RA 4HDRA 4PPFA 3UUWA 4OFZA 4ZFNA 3TGLA 1PQ4A 1IYZA 4RLQA 5EA2A 3O9VA 4HEA1 4C01A 3FCAA 2A0FA 2AOVA 4FYYA 1KMMA 1KIFA 4R40A 4RFSA 1AU9A 1CFZA 3WYFA 4F9EA 3BJZA 1ADGA 1GIAA 1LPSA 2HDOA 2ZU0C 4GRAA 5DX8A 4UOEA 3EBOA 2JW5A 1QVVA 2JH3A 2C0CA 4HGQA 4D81A 5CB0A 4MR8B 4BWFB 1FTGA 2BFCA 5HDQA 4BNGA 2YYYA 3CHYA 3DCJA 4AZ0A 2AYZA 4EI8A 3UJBA 5C8YF 1GSHA 3WLMA 1NSFA 4YT2A 5LKAA 1U1DA 1U0JA 4A36A 4MQFB 1Y9AA 4XX1A 4ZRNA 3TI7A 3WJ2A 4NY1A 1IHPA 2WOJA 5LC1A 3VKGA 4AY6A 2VWQA 4I4TB 1QZ3A 3OZBA 1CB7A 1L3BA 1N1MA 1DV2A 2EQAA 1O94D 2HV8A 3N2YA 2V5VA 1G7TA 1SG6A 2Q29A 1DHTA 3PEFA 5CK4A 4GMXA 1O54A 3CLTC 3M4XA 5EKXA 1TVKA 4YPVA 4PSVA 3QMMA 2YRWA 4WCFC 1U2ZA 4N3GA 2WF8A 2Y0DA 3GVIA 4Q24A 1YFZA 2IXFA 4URFA 3JVEA 3W4KA 2DMRA 4F45A 1G4HA 2HA0A 1DZIA 5JNSA 1T2EA 4UTOA 4V0NA 3JY6A 1ZNQO 1N9ZA 4RF3A 1HLPA 2Q5IA 2XT9A 2V31A 2BKXA 5DASA 1R6TA 3PNKA 1DBWA 2FF5A 1ODJA 3BCUA 4Z1OA 3DAHA 2VJBA 3Q6QA 5BYBA 3JQGA 2CW5A 1OWOA 4YLGA 2OD2A 3EDYA 2JZNA 2QKYA 4XMYA 4Q5IA 4CMGA 1NI3A 3WDSA 5LU8A 2OCBA 1YVPA 1M6YA 3RFFA 2KX7A 4KPEC 2PR2A 4UHKA 1XOIA 2FE4A 3DE6X 1JJAA 2QRNA 3PEVA 4Q93A 2VIIA 3VHRA 1NUAA 4E4YA 3KIPA 3I53A 1NB0A 1UBUS 1QOPB 2HWWA 3MINA 4E31A 3BBPA 1MOPA 2OV4A 1P0IA 4ZT3A 3QG1A 4DV0B 2VDMB 3QPCA 2VTEA 3EIQA 3TAXA 4D3XA 4RTLA 1KFBB 2OUIA 4GHWA 1NX6A 1BPLA 2IHJA 1N7HA 4RF4A 5B36A 1E0AA 2DRIA 5EIBC 3V3KA 4YUZA 1NR5A 4DNFA 1GTG1 3U7GA 2JGJA 4AY5A 1U4SA 4HQLA 4RJJA 5KYWA 2HT1A 1Q2XA 2E0IA 5FYQA 4BJ5A 2QN8A 4MV7A 4TTSA 2X22A 2XE7A 5DYNA 2VNIA 3I2FA 1RXVA 1XNRB 1X3LA 3O0TA 4UPDA 4YUYA 3X0DA 4F71A 1PNQA 4LIPD 2ZREA 3R20A 4E12A 5HCNA 3PQ6A 4WZLA 3EIHA 2P6RA 1R10A 2IZOA 3ZXUB 1NN3A 1FP1D 4O4HF 1KZ1A 3TE6A 3VAZA 3ZEAA 4E07A 5ALPA 3FWZA 3CNQS 4RMHA 4L5BA 3ASTA 3LKVA 4OK3A 7REQB 4GSYA 2BEKA 1XROA 4ZDJA 5IRCD 1MTZA 3I23A 4GXTA 4QGAA 4K81B 3T7IA 4IG9A 3V4ZA 5PGMA 1XPUA 2NV2B 1R88A 2CNNA 4LVOA 2PXHA 4K7JA 2VAPA 3V3TA 4BO5A 1QHYA 1HOXA 2FMHA 2X3YA 1NYTA 1Q11A 5ECGC 2P1ZA 4JI4B 2WNHA 1TK3A 1A9YA 1SHLA 4RK6A 2PSEA 1FYEA 3DUFB 5A1TA 1AKRA 2WAAA 1BDJA 5G0TA 2V7XA 3UOGA 3GLVA 4YWHA 4ABTA 3DEHA 5DXAA 5PNTA 1R6BX 1RD4A 3HNPA 1WM1A 4NNPA 4Y2YA 5CVCA 4I55F 1IAVA 2CV1A 2D62A 1DGQA 3KKMA 1PT7A 1H94A 3FHJA 4ZI7F 2XA2A 4LYGA 5TPZD 1VE7A 2IZZA 2CXNA 3ESDA 5K2MA 2PK3A 4OV6B 1GPYA 4DQDA 3KYCB 3MJ4A 1V7CA 3AUFA 5TQ2B 3F1KA 3NH6A 3DTNA 2X9VA 5J40A 1L7OA 2Q1YA 4DNOA 4V0ME 3DE7X 1UBLS 3HXKA 3C3MA 3LDHA 4QYSA 2IEYA 4D96A 1BCRB 4JR1A 3ILVA 5K0FA 1H05A 3QKTA 5DVZA 4Z0HO 1EGVB 3ZK8A 3OUTA 3CGGA 4C2BA 5J43A 4O59O 2PZAA 4PABA 1ZNXA 1J7KA 1GZ5A 2C7VA 4LWPA 4F1JA 4DV7B 2ISSD 1QJCA 2DZDA 5GJCA 5BNFA 4BO4A 2Q7DA 1ZP6A 1BVRA 3Q8MA 4LZNA 3COJA 5LQJA 1PDVA 1O5OA 4C4SA 1CZNA 2LGJA 3OFJA 1Y33E 1R0LA 4K9RA 4ZI7A 1FYFA 2QLLA 2GN0A 2Z4SA 3O3NB 1P9WA 2EFYA 1Z34A 1NJSA 3GZ4A 5HCUA 1K7XB 3VKVA 4ZV4A 4M53A 3L5KA 3USES 3ELBA 2H08A 2BR5A 2R60A 3L1UA 2IWRA 1CQJB 3JALB 3Q3VA 1H9BA 2VHQA 4Q02A 4FSXA 1R0SA 1H5QA 2J3HA 3ZQJA 1E5TA 2V1UA 2QRVB 4HBGA 3RS2A 1KETA 1UDBA 1VI2A 4NBSA 3QEMB 1N6PA 2C4WA 1I0LA 2SHKA 1R4NB 5AI6A 3IL2A 1RKUA 2ZT5A 2XECA 2C8LA 1W4CA 1JEQA 1K5DA 2CLIB 2JFPA 3EWSA 4P9NA 1C9YA 3OQOA 5GP1A 3T7RA 1XB2A 3ZI7A 3OZFA 4Y2UA 2WDZA 5T6BA 3V4VB 2LKDA 2E89A 4DKJA 4OXYA 1EX1A 4EBFA 4YONB 1K4MA 5B1DA 4CV1A 4G0PA 2Q1WA 1F4PA 4R16A 1NJID 4BO9A 4PG5A 5EOVA 4NQRA 2Q7XA 1CJVC 2BFMA 3VH3A 1E6WA 3AUXA 5CVDA 5BRAA 4IDCA 3AVUA 5ESRA 2KMLA 2WHEA 2ZU6A 3MT7A 1S4MA 1VCOA 3QV2A 4OH7A 4X00A 2W6CX 3SR0A 4C0AC 2V7UA 2IU6A 2XMQA 1EFLA 2FU5C 1C2TA 3TBKA 3FE2A 5F3RA 3R6DA 5IC5A 2WMNB 3W9BA 3O82A 3NVDA 5LA6A 2YCBA 1K88A 1NBAA 4G97A 4XD2A 3HEMA 1OYYA 3JD4A 5I4BA 4AJ4A 1OH6A 1VHQA 4HLUA 1JGTA 4MPTA 5GONF 1IHYA 1IJKA 4LXYA 4AKTA 3BDIA 5YASA 2IYFA 4N5MA 4E30A 5ED4A 4M2LA 3GLIE 3SI7A 1CDDA 4OCZA 4L15A 3R5HA 5KHAA 5IUNC 1NQUA 2H3EA 5D1HA 1DPFA 2GJ8A 1PEKE 1YRLA 3PF8A 4CLOA 4X62B 2OORC 4GH5A 1QP7A 1PR0A 3MJTA 4PZAA 1I36A 4B33A 4N48A 2QX6A 3P9XA 3WK6A 3WZLA 4J03A 1BHO1 3F4BA 2W42A 5A2GA 4BO0A 4ND3A 3E1KA 5ADUS 3AR2A 3WADA 4NXMB 3K09C 4JFRA 5EJ5A 4P92A 3ELDA 3ASRA 1C14A 3B9BA 1I1OA 2JIOA 3C3KA 3K1AA 4TXNA 1K7EB 2RGGA 2A0UA 4PN7A 3OQHA 4N12A 4OKSA 4RANA 1FVFA 3DE0X 3W8NA 4TRMA 1WETA 3L8ZA 2UZAA 1XRMA 1WU7A 2BJHA 2C2OA 3AY7A 4MVJG 4EG3A 5TJ9A 1QOZA 2OM6A 2R68A 2W11A 4ZN6A 4F93B 1AZTA 1JEAA 3GBVA 5JISA 4MR8A 3DW3X 1FDVA 2Y2VA 2V0CA 4N40A 5LQSA 1U7XA 3RS4A 5JFTA 4ZA2A 4RJLA 3IH5A 3SGLA 1UKEA 2R4TA 3KOUA 5LMNB 3C6BA 4B8YA 1I8DA 5D5PA 1EB9A 1OAOA 2QI9C 3PFGA 4X1KA 3VC7A 5DLYA 1O3YA 2FX3A 1E1DA 4YGYA 3TLXA 4URUR 4DMLA 1CU1A 5I9TA 1JDPA 3N6XA 5BT9A 5A3QA 4Q1VA 4MQLA 1OKKA 1KP3A 1W4LA 2XTJA 3WI7A 1JS1X 3R40A 4LKRA 5CFNA 3T3NA 3ICEA 1JEQB 3P9ZA 2ZETA 2JLUA 4NU5A 2RKWA 3K0SA 3CPEA 4BJ3A 2QL6A 4FZRA 3NBMA 3P2MA 1BU5A 4NOMA 2HLHA 4RPHA 5DP1A 2VQEB 1S3GA 2A78A 4DUZB 1MQ8B 1T24A 4ZQHA 4DB2A 3HTXA 2R96A 1ZJ4A 3FPAA 1KY4A 4DA8A 2LBPA 3MUOA 1FXUA 1NYQA 3UT0A 2EEZA 2AYXA 1UBGA 1DP4A 1F38A 4Z8XA 5ESDA 5A3JA 5BVHB 3DULA 3QIAA 1VQLB 1P31A 2IS2A 4N0PA 9LDBA 2XVZA 4X66B 3AQ4A 3B8HA 2IY9A 2VWPA 3A26A 4I6JA 5TQ2A 4U7FA 1U94A 2ZZQA 1IVSA 1H9CA 2XNKA 3ZK7A 2VSQA 3IFSA 3VPHA 5DN6A 3WDMA 1Q74A 1B7GO 3HVUA 3K31A 4GPAA 3STVA 4QWMA 4YRBA 3QEAZ 1SCUB 1YZGA 4UXIA 1D1NA 5CK5A 1HXHA 3S2SA 3TQOA 4BFCA 4ZK2A 2QLFA 4LY0A 2PL5A 1PR9A 3DEYX 1I6KA 4KUGA 3WAGA 3RYHA 4H0FA 5EXTA 4RDXA 1YR3A 1JPUA 3IQZA 1FL9A 3UJDA 2OXCA 4WZAB 2PUGA 5HIKA 4FS3A 3U4MA 2HMAA 1DRWA 1DWOA 3OECA 4QHSA 5SY6A 4LRUA 4DNPA 3LDAA 4HXYA 2PMCA 4UNSA 3AK4A 3OTOB 4KAJA 1AM4D 2ZJFA 4NS4A 4C06A 1QCYA 5CIYA 1XFAA 2X0JA 1JQKA 4BAUA 3C7DB 3HB1A 5CFQA 3MD9A 1RHQA 3EVEA 1EGQA 5FBKA 4LRSB 1VMEA 3BH6A 4C9BA 4PLVA 1NZFA 2Q8PA 2ZK7A 5DI9A 1ADJA 1ZA1A 3EBPA 2RONA 4KKSA 3RIGA 1L5HB 5JDIA 4ZO4A 4ES6A 2QRVA 1IEVA 1I6LA 1CYDA 1VJDA 1I4TD 4O0LA 3AEKB 4Q3CA 2LP4Y 2Z1MA 1DKOA 1OYVA 2JFBA 1P4JA 1C7IA 2WV9A 2P9FA 2Z1DA 1C1YA 2RH5A 3KQWA 3M6IA 4RKRA 5IW8A 3ZU2A 1TCUA 2RIPA 4AYXA 1BH2A 1ZEJA 1B0PA 5ILOA 4QYIB 4X7FA 1NVXQ 2BT4A 1NBMA 1SBZA 1BGXT 1LQTA 3SKBA 2J3IA 4YXFA 2C9OA 2O8BA 4MW5A 3L18A 4N1AA 1R4MA 1YVEI 2NYRA 1VE1A 4Q19A 4HWSA 2RHHA 3FZQA 3WMWA 3VUEA 5LMUB 1X92A 1CEQA 1TQ2A 5SYNA 3IEKA 4MQMA 4FCWA 1RABA 2A9JA 2DBQA 3AJEA 1FSFA 3PJFA 4QBHA 4NFYA 1N6RA 1MC4A 1POXA 2CDBA 3PXBA 2X7HA 4LBWA 4PLWA 3PFNA 3HN7A 4LZJA 2I1QA 1GNLA 2IDKA 4N0DA 1HFJA 4O4JF 4RTQA 1UC5B 3PEEA 3EDQA 1MRNA 3L8YA 3V8VA 1X7DA 3HE3A 4LW8A 1ZOPA 3WYEA 1X13A 2X8KA 2GH1A 3V1LA 4D46A 1AT1A 2JIQA 2FN8A 2WLSA 3EZ9A 2ZI6A 3OC0A 5K8CA 3FRHA 4BPRA 1MB9A 1RXSA 5JW6A 1DELA 5J4KA 1EFDN 4XOUA 4DCNA 2A86A 1CK4A 4V0LA 5FOXA 2IYQA 2JIDA 4JKOA 2OWEA 1BE8A 1TVEA 3WKEA 4S1VA 2CFTA 5A6SB 4BCCA 4INOA 1PD1A 4ER3A 5DHUA 3NNSA 4P4UA 4B7AA 5BR8B 4I9FA 2PRIA 2JHCA 3AHGA 4R8KA 2VVTA 4OQFA 3HFGA 4BN0A 5L46A 1IG0A 3AFNA 4RIGA 1CVRA 2I2DA 4MV1A 1E9CA 1K92A 3IB3A 3WIVA 3BXOA 2H4XA 3WL5A 3E22A 5EJFA 3LFTA 4WKCA 1A04A 1YIJB 2V59A 4MLZA 3SX0A 1W5SA 2JKYA 1E7WA 2QN9A 4M1TA 2CB9A 3AERB 3V8MA 4NMXB 4EKIA 4FDLA 4ZICA 1A7KA 1XAJA 3B5IA 3UWDA 4EMSA 3TIIA 1D09A 1T0BA 3LPDA 4HD8A 1EB8A 2OLKA 1Y5NA 1ABFA 4KBGA 4RVHA 1H2BA 2BRUC 1MZVA 1TAHA 2HI0A 3EPRA 4LZWA 4QUEA 3WYNA 4FMCF 4OAQA 3CRW1 2CK3D 5ALVA 1R1DA 4PW0A 2ADFA 4ZI5A 2VBTA 2JJ8A 3LWBA 1QBGA 1GYQA 1NW7A 3QTBA 4MHSA 1XXHE 4EA6A 5K0NA 5KCZA 4KR3A 4ZC1A 4ALJA 3NRJA 2MSCB 1GLVA 2REBA 3H86A 4N5IX 3ZHRA 1T5SA 3QVTA 3QPBA 2B82A 1ZNWA 2C2ZA 1FFCA 3TLEA 3DXFA 3U0BA 4TKMA 1K4YA 4F9FA 5D6OA 3IE1A 4TV8F 2EP7A 3NHYA 3U09A 4JGBA 1BXRA 2C7BA 5LXTB 1K66A 2JZOA 3GX1A 3L02A 4PBSA 5EVCA 3SR4A 4CM8A 1N2SA 4DY6A 5BSHA 3AESB 2QSYA 5IHPA 1JI3A 5JMOA 1NBOA 4B4OA 2PKRA 3GVXA 1GFIA 2A58A 2VUSA 4CMBA 6ABPA 3FPJA 3B70A 4R6XA 4E5YA 2WF5A 3HUUA 4RV4A 1KEKA 1EDEA 2R48A 3GH3A 3OFND 1YBHA 1K8ZB 4AKHA 4B81A 4CDNA 3PC6A 1JIVA 1S7GA 2C4NA 2ID7A 5EKDA 3FOBA 2IU3A 3C15C 4CM8B 1W85A 1LVGA 3E1GA 3WLNA 2PYZA 5J4HA 4ZOAA 2CVFA 3N74A 2QRJA 3R0ZA 3HCOA 4GD3Q 4PM4A 1KAOA 5GOTA 1KYWA 2AQKA 2YVLA 3NIWA 1PFUA 4G01B 4NENA 4RZ2A 5EJ9A 1D2NA 2OG2A 5CB6A 4XDYA 1WO8A 3VR6D 2X8JB 3GFOA 2R6DA 3HXLA 3IRVA 4ZT7A 5T4FA 3GZNA 4V0QA 1TAGA 4Z2AA 5BV2P 1MABA 4IDDA 3N9IA 2XQVA 3BHMA 1GA6A 1R0XA 4YRAA 5B58C 2BBTA 5CDSA 2CXHA 1PJ8A 4QDOA 3AFHA 1BE6A 3UV6A 1PS9A 3N0VA 1PWHA 2GZ2A 1RBZA 2ET6A 3HBMA 4O33A 3U39A 2VJPA 3RHFA 2C4KA 4M8IA 5FNVB 1RQNA 3BQNB 4BMVA 1GSAA 4QVJA 1V3VA 5REQB 3WTBA 1UJNA 3T5BA 3VHLB 4B7CA 3GJ8A 4HQ0A 4PEVA 3DDUA 3L0CA 1I2BA 4P2BA 4E5PA 1RHMA 4LS3A 3W77A 4MAMA 2JBHA 3DJYA 1T9CA 4IIXA 5KTKA 3K9CA 3SJBA 4CLDA 1AV6A 1SXJC 1MXHA 4V3CA 1FTSA 3PF9A 1X87A 3GGPA 1V3TA 4DUGA 2FVYA 2H00A 2VTBA 2AZDA 4QOEA 1MJ5A 1XT6A 2J6BA 2Z56A 4FNAA 4GBED 1E2LA 4M6WA 5B64A 3UHOA 4JI8B 1NASA 1U2DA 1DJOA 3IVCA 5JC1A 1IHXA 3F9IA 2H65A 2QI9F 1U8XX 2CK3A 4HYQA 4IW3B 2VF7A 3LX6A 4IDQA 4ZKEA 2XCLA 5MN4A 1QQ5A 2KQUA 3HLTA 4QQFA 3ZIAD 3QHAA 1IIBA 5COAA 3RV3A 1SKAA 1TCCA 2GASA 2JPDA 1LDYA 3VZCA 2O8BB 4X20A 2ZJ3A 3ROFA 4WT7A 1EP2B 1H42A 4LSWA 3P4XA 4U02A 2ZITA 4ZXPA 2ZKLA 3HDGA 4Q7MB 5E4TA 5AI0A 2V45A 2H2IA 4TWBA 4XCQA 3GLGA 1A3CA 1AK1A 3E0QA 3IUSA 4XR9A 2HJRA 1C9NA 2PJUA 3DSRA 3FNHA 1IB0A 1YZVA 4RK1A 5E6RA 4PV7A 3DBRA 1UZMA 4ZYZA 3DBLB 4BIIA 2YZ7A 5C9ZA 1WE2A 2Q7OE 1ZZEA 2PQ6A 1KKMA 1RPNA 1NXWA 5K8UA 4RPBA 1KZLA 1OFUX 2WM3A 4DRYA 2PM8A 4ALKA 1XVIA 2D5AA 3OY2A 4TL9A 1XHFA 2EW8A 1PR2A 4EMTA 2FSIA 4JJ8A 1X1CA 1W36B 4P5DA 1OQAA 3O4VA 1GU1A 3PI7A 1Z8NA 3WMEA 2O5EA 2AFRA 1EEXB 2AD5A 4C0KA 1HDZA 3HZZA 2ECPA 3NHFA 1BOOA 1CDEA 1G5PA 1XD2A 4O1MA 5EG5A 2X1HA 5FWAA 5JCOA 3GCZA 5G1PA 1EAMA 2ZAMA 4WNAA 2FZLA 3OSUA 3BFJA 4PLGA 3AG6A 3B1XA 1Y89A 2W2PA 5EXDA 3UKDA 3Q8WA 3A3KA 4PYNA 4QE3A 1W2HA 4R7TA 1H22A 2FQYA 3MEQA 3O7MA 4YUVA 3UAGA 1IXYA 1Z0KA 2CYBA 4MVJI 2BEUA 3GJSA 5AJVB 3T7SA 1TUEA 4IY1A 1NSTA 5JNVA 3M2TA 5EE0A 1TMOA 1MB0A 2O48X 1A77A 4CTJA 1K3TA 1UT8A 1E4EA 1N1DA 2A1IA 1E0SA 2V4UA 1UAGA 2X4IA 2FGKA 1GFZA 3IUEA 4KQ6A 1YLOA 1K73D 4D82A 1T1SA 2I29A 3DXZA 5EPOA 4BFTA 1U2DC 2ZJAA 2HBQA 3EXG1 3H16A 1KE2A 2GZ1A 1XFOA 1Y7IA 2P0YA 9ABPA 3PNQA 3BXGA 4LJ9A 2H17A 3G2IA 4DIDA 4D79A 3NX4A 2CY0A 3M2PA 1RZUA 1CUUA 4ARVA 1R4MB 4BQRA 2GEUA 3MXTA 2FW8A 4F3RA 4NL4H 1RRMA 1C7QA 1HZZC 1C1HA 3BRSA 4EF4A 2Q5JA 3CV3A 1L8XA 1OXTA 1Y7PA 4ILEA 4M0PA 1KDYA 1ZCAA 2TECE 3H2GA 1EK0A 1ZW1A 4RDLA 1ZD5A 3EIFA 3KJGA 4UQLA 1E2BA 1OLUA 3BJRA 1Q83A 3BMQA 4IUDS 3ESYA 4JBWA 1BS9A 3Q11A 5EZYA 2JK1A 4CMHA 3ZIAA 2YMQA 3A4IA 4DIFA 2QVBA 1YJ9B 1UMBA 2VHWA 1WY5A 1TYZA 1RVDA 2EKPA 3AP1A 3KZOA 3OE1A 1QRAA 4I4TF 5BN5B 2BEVB 2JAWA 2P9TA 3GU3A 4G2TA 4IKPA 4GIBA 4BVAA 5JMWA 3TVTA 5JJKA 1I51A 4OAPA 4MV4A 2J32A 4OU4A 5AUNB 3E61A 2I2CA 4AY3A 2LCFA 1QK4A 2E6UX 1YE3A 2I54A 3TIGA 3U3DA 4AXXA 2R0QC 3WNCA 4H1VA 5M2QA 1LJ8A 1SCIA 4PC6A 3ZV6A 3ER8A 2IOFK 4RD0A 3O8OB 3N75A 3SLDA 5HIIA 4F6RB 4LDRA 4XVCA 1G63A 2WZNA 1V7ZA 1E1QA 5I5EA 1VG8A 1FVOA 1XDBA 2EFCB 4HNGA 1J24A 1ORVA 1X8XA 3ACBA 4ON9A 4LA4A 4IJMA 4M9XA 2UVQA 3L6DA 1G3IA 1PU2A 4WKNA 2G4LA 3OHPA 4DIUA 1K86A 5J47A 3AF0A 4TLMB 3FDXA 2V6GA 4F11A 4HN2A 2JLYA 3BKWA 1U7ZA 1VKOA 2DPMA 3KSZO 5FUBA 1J0AA 4AI6A 2OKCA 2C07A 1SD1A 4YIKA 3H9QA 2KM1A 3OOEA 3TD9A 3UTDA 5IP5A 4D9GA 4JUAA 5GVSA 4AJOA 1UD3A 4R98A 2ONZA 3GRVA 2QW1A 3INYA 2ECKA 3ZDQA 2GZHA 5BSKA 1GPWB 2X2FA 1P5FA 3W5HA 4OQEA 3CZRA 3CF4G 4WZBA 2CSXA 2A7QA 1NU8A 3VPBA 3VTAA 4JEIA 1P7PA 3HHEA 4BP1A 3LGSA 2IUFA 2E48A 5EP3A 1VFPA 2H1LA 3JQFA 1QUFA 1I5RA 1L4BA 2ZXIA 4G56A 1IWPB 3UVEA 3VVBA 4DBLE 4JLSA 1YOBA 3FJYA 1NOJA 2C57A 3F74A 4GPIB 4RWZA 4INPA 4X20B 4Q39A 5F1KA 4OFBA 2CBZA 2RHGB 4RHUA 5IUJC 1T25A 4DR7B 3A1WA 1IOZA 2FW9A 3R3UA 1V1MB 4MIOA 3USZA 1W96A 2ZAYA 1V3UA 2MYNA 3FBWA 4PS1A 3V2HA 2Q5QA 3JU4A 1T3ZA 3EXEA 1RYHA 3ASYA 1M3SA 1QC5B 1UJ5A 3AXTA 3ONVA 3TLMA 1BWRA 1QG4A 2GHQA 1TI7A 1ZGGA 3JRNA 4WTOA 3UHJA 4BQEA 2X19A 1SVSA 2B1GA 2Q07A 4II7A 4B6EA 4Y0NA 3AVOA 1E94E 1MABB 2HU7A 4X7MA 4I4CA 4J0DA 4WK4B 4LF6B 2VCHA 3GFBA 2UZIR 5DNCA 2C2GA 2Q4DA 3G5TA 4Q1FA 1PWXA 3D54D 4L8LA 1IJEA 4C1BA 1HTTA 1R4NA 3KVNA 3VZDA 1FNBA 1OTHA 3O73A 4IHJA 1HEYA 3ISJA 1E2PA 2I7TA 1Z5UA 1S4QA 1KMQA 1L6IA 5BUQA 3A6GA 3OZDA 3TRKA 1U2GA 4Y1EA 4D7AA 3A6KA 1Z7WA 3DZCA 3CR8A 2NSDA 4GVXA 4P4SA 2O4UX 4ICIA 4RE6A 4WCDA 2ZJ2A 1WXDA 5CP8A 1VYTA 3SD7A 3WVNA 5KTSA 3EYAA 3D2AA 2JJ1A 4GX2A 2QJFA 3EHEA 2HNAA 2WC1A 5H3HA 4IIFA 4ZREA 1T8TA 3VI3B 2UUOA 4ZI2A 1HE4A 1GVHA 2DERA 4N0QA 3PWTA 2CE7A 4PZEA 5IN5A 4BZXA 3GLGE 1IM2A 1GUYA 1ZI9A 4KQEA 4XYMA 4E15A 2DXIA 1N78A 1H2EA 3U7FB 1Y6JA 2H29A 4HCJA 1JIIA 1C1XB 2A84A 2DP4E 1XD9A 2EDAA 3U3RA 4KYVA 4EA9A 4EPXA 3ADDA 2Q9CA 5K4GA 1XMXA 1YL5A 2F59A 1P3DA 2PXXA 4KWTA 2GUWA 4M9QA 5L3QA 1Q95A 5I7EA 4JXKA 3FKQA 5B3LA 3R2JA 1RC1A 2JHAA 1JX6A 2R6AA 4GU5A 5BMOA 1M67A 1L7MA 2J87A 2GCNA 3F7MA 4IOKA 1UOPA 1E1YA 4AN0A 2A88A 2OBTA 1YIAA 2P9BA 1PUIA 3DUFA 3G1UA 4N5DA 1J2TA 1UPXA 2CUNA 4J75A 3T1OA 1EVJA 1EPUA 2QA5A 3TRIA 1YVDA 1PWEA 3UAOA 2JFZA 3DBRB 1FP4B 2ZUDA 1HDXA 1JQJC 2IKSA 5A0FA 2C7PA 3X1KA 5K2OA 4HIZA 1DX6A 2G80A 2B7BA 4AVZA 5JSZA 5C4IA 3QKRA 3DEKA 2GYUA 1L7PA 3S1SA 5AXBA 2QT1A 4OLBA 4IV8A 1XPRA 3RSQA 2BHLA 3EZ2A 3VHXA 1YQUA 2BFOA 3RD5A 2OGWA 2F4VB 2O3SA 1KYTA 4HRVA 4UCFA 5AUPB 1ZR2A 5IT0A 2BGJA 1QC5A 3DZGA 2XT6A 1B6TA 5T3UA 3UC5A 2ZCVA 4PLPA 1WCIB 3V7NA 2GR9A 3I2YX 1U90A 4I1SA 2OP1A 5EQJB 1LA2A 1UKYA 5F4ZA 3TPFA 3C3DA 3M6XA 4QPDA 3ZX4A 4DCVA 3KQOA 2WD7A 1MLDA 4Y2SA 3CFYA 1L4KA 1MCZA 3MJVA 2PN1A 1ISJA 3RVJA 1HG1A 2QGNA 1JE1A 1WHTA 3FSGA 3QSGA 1U8AA 5TF4A 1NVWQ 1UC8A 3TS1A 3U7EB 4YPOA 1ZHFA 4IDAA 2EJTA 4OIFA 2CL0X 2WIAA 4GGPA 1Z0DA 1O6FA 2C94A 4LGMA 4TKVA 3ZHOA 4GZLA 3GAZA 4CCAA 4S04A 2HA7A 2HA4A 3KAQA 2Y0BA 3CG4A 1KI2A 2W98A 4JBLA 5JSHA 4X84A 3NWPA 2CXQA 4ZYXA 4ZVNA 1U0SY 4RK7A 4CBVA 3L7YA 2ZVDA 4LISA