5GV7A

Structure of nadh-cytochrome b5 reductase refined with the multipolar atomic model at 0.80 a
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
272
structure length
272
Chain Sequence
STPAITLENPDIKYPLRLIDKEVVNHDTRRFRFALPSPEHILGLPVGQHIYLSARIDGNLVIRPYTPVSSDDDKGFVDLVIKVYFKDTHPKFPAGGKMSQYLESMKIGDTIEFRGPNGLLVYQGKGKFAIRPDKKSSPVIKTVKSVGMIAGGTGITPMLQVIRAIMKDPDDHTVCHLLFANQTEKDILLRPELEELRNEHSARFKLWYTVDRAPEAWDYSQGFVNEEMIRDHLPPPEEEPLVLMCGPPPMIQYACLPNLERVGHPKERCFAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NADH-cytochrome b5 reductase 3
publication title Distribution of valence electrons of the flavin cofactor in NADH-cytochrome b5 reductase.
pubmed doi rcsb
source organism Sus scrofa
molecule tags Oxidoreductase
total genus 75
structure length 272
sequence length 272
ec nomenclature ec 1.6.2.2: Cytochrome-b5 reductase.
pdb deposition date 2016-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
A PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 5gv7A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 5gv7A02
4RJLA 3MCAA 1QGZA 1FRQA 2OTJB 1F20A 4ZGQB 1B23P 1VQ9B 2RC6A 3ES9A 4N3GA 1BQEA 2XNCA 2QA4B 3VNVA 1Q86D 1HA3A 3LO8A 5AN9A 4RD3A 2QEXB 1YJNB 1XB2A 2YWGA 1AMOA 4HE6A 4TMTA 3LRXA 1QFZA 3VO2A 1ZUNB 3I56B 1VQLB 5TV2A 2HCJB 1D1NA 1EFUA 1FDRA 1JJ2B 3QFTA 2BPOA 4ACBA 2OK7A 4RD0A 2QTLA 1N0UA 1VQ4B 2DETA 1M90D 2BF4A 4M2LA 5EMNA 4J0QA 1I7PA 3OZUA 3W2IA 4C0SA 3I1FA 1VQMB 3QSYA 3VO1A 1KK3A 1H42A 2D74A 3AGQA 1B2RA 1YJ9B 3CB4A 3WBJA 4F7DA 2HDNB 1DARA 1JB9A 3ZBUA 4B44A 1VQ5B 1KJZA 2BV3A 2OK8A 5FA6A 2EIXA 2B7CA 2PMDA 3MHPA 5HXBA 3AGPA 1NJID 2HMAA 1YITB 4PC2A 3U6KA 4B48A 4Y9RA 1K9MD 1OB2A 4P6VF 1YJWB 4M1KA 4MYTA 1D8TA 1GO2A 3V76A 1KQSB 3OJXA 1IJEA 1G7RA 4ZV4A 4M53A 3W5UA 1Q81D 4DQLA 3AVTA 1KD1D 2XEXA 1SKQA 3AVUA 1EFCA 2RC5A 4TMXA 1VQOB 5KSWB 3E20A 2YWHA 1VQ8B 4EH1A 1K8AD 1TUIA 3CD6B 4FN5A 1OB5A 2C77A 5THXA 3QFRA 2OTLB 3CW2A 1CNFA 4QHYA 1TLLA 1IB0A 4YAUA 3B8HA 2VNKA 5DSZA 3ZZUA 2BGJA 4R71A 3ZBTA 1KK2A 1SM4A 4P3YA 1W87A 4Q7JB 4FWTA 3G71B 3ZZTA 4AC9A 3JQRA 1JA1A 4DQKA 2BM1A 3AVYA 3CCUB 1W34A 3CCQB 1R5OA 1DG1G 3G4SB 3JQPA 1R5NA 4YHBA 3G6EB 1J9ZA 4TMWA 3W2HA 1VQ7B 1EWYA 1ZM3A 4Y9UA 1EP2B 1KK0A 1W2BB 4K1XA 1DDIA 1U2RA 3CCVB 1QUFA 3JQQA 5H59A 1YHQB 1N8RD 2DEUA 2B7BA 1F60A 1QFJA 4M0LA 2E1RA 3LYUA 4H9GA 3CC4B 2VNIA 3CCLB 1TTTA 3U6BA 4N3NA 1S0UA 1FNMA 2EFGA 2BMWA 5H5JA 3W2FA 2PLFA 1VQKB 4U9UA 1QGYA 1FNBA 1ZM4A 2YWFA 2QTZA 3CRZA 3WNBA 1UMKA 4B47A 3WYAA 3QE2A 4ZCIA 2PIAA 1EFTA 3W5VA 1BX1A 3WXMA 4LBVA 1VQPB 4QFMA 1XE1A 4LBWA 3B82A 3FPKA 4PC6A 1KTVA 2C78A 1H85A 4PC7A 1GJRA 3ZC3A 3CXCB 3E1YE 1S72B 4PC1A 4NBSA 1CNEA 1E62A 4RCYA 1JNYA 1M1KD 4YAOA 3PENA 4IW3B 1QVGB 4WQMA 3WNCA 2BM0A 3P27A 2GPJA 3VNUA 3OW2B 1W35A 4PC3A 4C43A 1QFYA 3SJZA 1BX0A 1IJFA 2DY1A 2VNHA 3W2EA 2BGIA 2NPFA 4TMVA 1K73D 1JA0A 5TR9A 4ZGNB 5TY0A 1ELOA 4HE5A 4RCZA 5GV8A 1Q7YD 4TMZA 1QG0A 1GR1A 1Q82D 3CCMB 2VZLA 1NDHA 4RD4A 4M4SA 3CMEB 2R6HA 2J7KA 3VMFA 3A1FA 3LVBA 1QH0A 1KK1A 4ACAA 1QX4A 3CC7B 3FJOA 4YAWA 2CNDA 2YWEA 1KRHA 2GQFA 1GAQA 4BPRA 1G7TA 4PGOA 4YALA 1QVFB 1GAWA 3CPWB 3AVXA 2QDXA 4MYUA 1R5BA 1EXMA 2VNJA 3J81k 3WY9A 1D2EA 1A8PA 3CCEB 4G5GA 1G7CA 3OZVA 1QGAA 4G1VA 3AVWA 2DERA 2ZITA 3B78A 4RD1A 1QUEA 4B3XA 2XNJA 2DCUA 1BJKA 3QFCA 2AHOA 4ZCMA 4LBYA 2VYQA 1YI2B 4FK8A 1CQXA 3WBKA 2BVNA 2BN4A 1ZM9A 4UAJA 4AF7A 4RD2A 2B5OA 5GV7A 1E63A 3CMAB 3W2GA 3MMPA 3W5HA 1G7SA 2QMUA 3QFSA 4TN1A 1EP3B 1FNDA 1WDTA 1N0VC 3P26A 2QN6A 1YIJB 1FNCA 4B4DA 4AF6A 4LC0A 1KC8D 3CC2B 1E64A 2CRVA 1TVCA 3CCSB 4Y7CA 5JBQA 2FX3A 3OJWA 4YAFA 3WNDA 3CCJB 1GVHA 1ZM2A 3I55B 1VQNB 3ZZ0A 3AVVA 4LBZA 1OGIA 4NCNA 4RD6A 1DDGA 3OZWA 2X3UA 4B43A 1OGJA 1FRNA 3CCRB 4G1BA 1VQ6B 1EP1B 3U2QA 4ZCLA 2BSAA 1AIPA
chains in the Genus database with same CATH superfamily
2ZRNA 3NETA 4HSGA 3PK0A 4CUJA 4CMAA 2HADA 1EWVA 3K6SB 4M1YA 2AMVA 5CK4A 2FH5B 1DTWA 2XZDA 1I3CA 3FSGD 3ID6C 2XW6A 1CLUA 3MSXA 4RVDA 1CQJA 3ZJYA 1UBFA 3M6WA 1SXQA 2QTWB 4CVNA 2CK3A 4I2VA 1HNWB 2RC6A 2GXSA 1HBJA 1ZICA 1N1GA 4D74A 2FW7A 4GPTA 2WMDA 1CIVA 3HKEB 1BO6A 1RKUA 2VC2B 4JLAA 5L7TA 1EWQA 1BE8A 5EOVA 2WJHA 4C89A 2NU7B 1Z25A 4FMPA 1GPDG 2P30A 2B1RA 4J2HA 3PUXA 3GHYA 4NH4A 3FJ1A 2ZJ1A 3S1LA 5B36A 9LDBA 3ELBA 1RC1A 2PG3A 1XDDA 5EI5A 5H3LA 1A4RA 3RBVA 4ND2A 2XVMA 4P25A 3R3ZA 2VTEA 3F97A 2D9RA 3LC1O 2PL1A 2QLJA 4NX2A 3SC4A 5FUYA 3I56B 2C0QA 3DDOA 4Z9XA 2VCEA 3OLWA 1E3WB 2C8JA 1OVMA 1X9GA 3HUUA 3R3SA 4B31A 3M3DA 4KFUA 4DCVA 2P0AA 4N0PA 4RXUA 3QFTA 1LRJA 5C7IO 2BPOA 1FU4A 2Z4RA 2Z83A 3DMTA 2FE4A 4B7AA 1D7AA 2FJ0A 1G2OA 3F4LA 3SQOA 4CCAA 4JP2A 1SBCA 3VR4D 4M0EA 1R9MA 2W2NA 3DEHA 4FS3A 3RIHA 4OKSA 3TTYA 1R8XA 2ZS9A 3LLVA 1HKUA 3NASA 3OZUA 1IZ7A 3W2IA 1NLMA 1Z74A 2VK8A 2B61A 2W6CX 3PNPA 4FE3A 4XTCS 5EE5B 1HNZB 4TMKA 1Q7GA 3UYKA 3CVWA 1GZ6A 4WDRA 2ZJYA 3DFIA 3ETCA 4Z0TA 3SM9A 3U3OA 4PZZA 1A69A 2LDBA 3FA2A 2ZWVA 3C3WA 4N3CA 3UJNA 1H1DA 1E1QA 1Y8RA 3TZQA 2GM4A 2E49A 3GY0A 1WXIA 1XIVA 1TAUA 1Z6PA 1VLOA 4PR0A 4R84A 4ER5A 3PUNA 1YFJA 2YY6A 1MD9A 3A9RA 3DCNA 3K0SA 3EC1A 3L8CA 2BJWA 5FUQA 3ISTA 4XW2A 2JLBA 4A92A 4UDNA 4AYWA 2XBMA 1T9GS 2QJRA 3PPXA 2OO3A 3QTTA 1UM9A 2HRQA 4QYWA 3HVUA 4JY7A 2ZRAA 4MYCA 4O59O 2F00A 5EIXA 4P1ZA 3B2QA 3QVKA 5KB3A 3IP8A 4XN0A 1YJBA 2AG1A 3AGPA 3U4CA 3VDXA 4DIFA 3FYUB 2I9KA 5C7YA 1W76A 2C9CA 5JXIA 4PYQA 3E9QA 2X0FA 3LA6A 1S1MA 2B4TO 4OB7A 4H1UA 3OTIA 1KAQA 2I1WA 3EVGA 4EPVA 4ER3A 4RZSA 3JU3A 4GECA 3OE7D 3N28A 2HPVA 1CJUC 3BE4A 4MRRA 1DI0A 1I1HA 2BKXA 3HKCB 3IRUA 3AIMA 1GZ5A 1YSCA 2Z30A 5BNFA 3ROGA 3TSAA 5E6SA 5IAEA 5J2UB 1OI7A 3WYEA 4F5EA 1RHQA 1NE7A 1TF2A 2W6ZA 3B1WA 4K6HA 4NEQA 2ZJ7A 2XCRB 3LKZA 3IAEA 3KB8A 4C6RA 3OTHA 2ZXEA 3R6GA 5AVWA 2EX1A 3JQ7B 1MPTA 3DNMA 5EC8A 3UC5A 5ICEA 2GYYA 1KGDA 4P3IA 2H4JA 2E5FA 3JSAA 3QIVA 2CL6X 1QB8A 4MGHA 1P29A 4E6PA 3I5MA 5L51A 3GARA 2O2HA 4O1HA 4ETWA 4BXOB 4AKGA 3IQDB 2PO5A 1QF9A 2C29D 2R48A 1VJSA 1NX6A 1PGOA 4WH0A 2Y67A 5AJXA 3FTCA 1MH1A 3MFQA 4AJKA 2VPZA 5JCZA 3EF1A 3UCFA 2P5TB 2HBRA 1KYZA 1H2WA 5JS2A 2X5XA 3HCBA 4EUEA 4WNCA 2DOKA 3RKRA 3NHKA 3H13A 2W00A 1NKSA 1T25A 3NCTA 4X90A 4J7XA 3SOPA 1ST2A 1XDZA 4DC9A 4NICA 3MINA 1MHTA 2ZJBA 4RKQA 3QSGA 3R6TA 1HH4A 1PJTA 1EK0A 1WPCA 4GZLA 1II9A 1TEXA 1Z2PX 1KYYA 4NP6A 1U0GA 1MX1A 4LWPA 2LDXA 3CLSC 1AGRA 1YFLA 1E61A 2AJTA 2VHCA 3H9JA 3R1IA 1JDBC 1K7SN 3AJ9A 1N9GA 4BX8A 1HNNA 1GG2A 1US8A 3NCHA 4G5HA 3L7BA 4LGCA 3RYIB 3WISA 1KEKA 2HHHB 5H16A 5LDGA 5FFNA 4ZVKA 1QIDA 4CWAA 4KKVA 1BQ4A 2UUBB 1XHLA 5F7XA 3L1IA 1QQ5A 2PJRA 1IY1A 3AINA 4R1UA 4UUNA 1HL3A 2CLHB 2QXYA 1YL6A 3HV0A 3BJMA 1OH8A 1W87A 2GJ4A 4P3PA 4UUPA 3UH1A 4KAAA 3DE3X 3OLZA 2D1TA 1PWYE 1MXHA 2GUGA 4QYSA 1B4DA 1Z0KA 4OJKA 4UBOA 5DT9A 3AFGA 4WEQA 1N3BA 3R6JA 4CLEA 4JASB 4INPA 5IT5A 1XV5A 3B52X 2XVYA 2ACEA 3BRWD 2NSYA 3AF6A 3PD1A 1Z2CA 3C3CA 3LQ1A 4ALJA 1E7MA 1YAJA 5HPYB 1DLJA 1ONNA 1TJ3A 2EP7A 4QXOA 3RIXA 5KNLA 1J99A 4CHTA 3ZY4A 3CJRA 4J0EA 4XVUA 4XR4A 1D07A 1NR5A 1Z4LA 2AQKA 2IKSA 1W1WA 4KPGA 3DBRB 1L5HA 3V2GA 5EMHA 3VR5A 3U7GA 2AMYA 4JLJA 3H6HA 5HCIA 1SOVA 1YVUA 3BE8A 3X1DA 4D9FA 2E4UA 4JYAB 2R6R1 2F8LA 3THYB 4PIPA 4ZTUB 2GPTA 1W52X 5BN5B 3BAZA 1DDIA 1LS1A 1VFNA 3G2MA 1JXMA 1RACA 2CNWD 3CURA 4FD3A 2QP4A 4JEHA 4X41A 1T0HB 5F9MA 1F12A 2EHDA 3O4HA 1OZHA 3JQ6A 4ZJPA 4YAEA 1J23A 5DGTA 1V0JA 3TD2A 2ZPAA 1D9ZA 3EFHA 4K88A 3UT5A 3ZCRA 4EGJA 3OEEA 4K2HA 1KS9A 4WACA 4AYTA 1V5FA 4RZIA 2V1XA 3QKRB 3QXGA 5HQTA 3NG1A 3I2YX 1OASA 1T26A 1EZ1A 3DKPA 1E1LA 3ZWVA 1ZSNA 5FFMA 1QE3A 2AOVA 4IPTA 4ZU1X 5C7OO 3UMYA 1SELA 4W82A 2V3CC 2F3UA 3WLAA 3AHDA 4IUDS 3I9NA 2AX3A 1E3TA 4AUEA 4EG4A 4FHFA 4U9UA 3WSWA 1Y4AE 4Z9AA 4UNNA 3OWHA 5FR1A 2J3EA 3CEMA 3SEFA 1DL5A 1EE9A 4F72A 2D5LA 1BX3A 1GT91 1K9SA 4YROA 4ZVOA 3EMBA 3O74A 2QTZA 2OY0A 1ENPA 4HP8A 5JWHA 2G82A 3RT7A 4AWBA 2JDID 4CLOB 4KUHA 1HWYA 1X1DA 1XK7A 4O4IF 5AI6A 1JEDA 4LAFA 3TIXB 5F4JA 4Q4AA 1Y4DE 3AY6A 2F8TA 5JJLA 4L9RA 1RPTA 1T1SA 3DYBA 4R1QA 3MGAA 5LKRA 5FRDA 1Y7LA 5LPNA 3S8EA 1MFZA 3QE2A 4X64B 5KYUB 3X43A 5L4NA 1GOTA 1GQOA 2H2AA 3O2SB 3I9JA 2HMUA 3W4IA 1W4LA 1Y3DE 4E2YA 3RAFC 2JA1A 2QMZA 4N9QA 5EPUA 5F78A 1RYFA 3FX2A 4A3SA 1CNMA 3SEZA 4C08A 1JLSA 4LNUB 3FPKA 1Y89A 3EIWA 1EAMA 4PC6A 1OWPA 2WIAA 2V7GA 3UWMA 1ZO8A 4DSAA 4FD2A 1RM0A 3NT2A 4QGFA 1QGDA 3RU2A 4UU0A 2OV1A 4POOA 3EGXA 1YQGA 3PVDA 5CW1A 3REQB 1PK8A 4EJ0A 2A30A 1FLDA 1XU9A 1ZP6A 4KNVA 4ZPJA 1POWA 2YQ4A 1L4LA 1S72B 2R8XA 3WQBA 4PC1A 3FNRA 3PQEA 2KX7A 2PZ8A 2GBLA 2PQ2A 3IBCA 4U7FA 4EJ6A 4ZDIA 3RVPA 4M1EA 3DDHA 5JZ9A 3O38A 1DWQA 1NPYA 4GWLA 3PENA 4IW3B 1PGQA 2JHGA 3WRXC 5AK6A 4XOIA 3KHTA 4NG4A 4INJA 3H42B 5FPPA 4YH1A 2QAGB 3H94A 3VC2A 5DULA 1VIVA 3BFVA 1SC3A 1CJTC 3OT5A 3G89A 2V7QA 3EVDA 3ZV6A 3A1SA 2JGMA 3CX3A 3IFSA 2G5CA 1QWOA 1BVUA 4DKJA 3CNHA 1XJCA 4BVLA 2H9IA 3IEUA 4MUMA 1F7UA 3HCNA 3PGA1 5CLIA 3R4VA 5TRTA 3FVRA 2P9YA 4XSGA 2UUPA 4G23A 5HZMA 3OQ6A 1QZUA 3R0VA 3WLQA 4ZGNB 4FJ0A 4KPUB 3V7WA 4HWOA 1C3EA 1NM5C 5AOBA 3RWMB 4I9FA 1Z4MA 1JJBA 1GCGA 2D2VA 2GBFA 4NECA 4Q1VA 2OO7A 2LWIA 2YHSA 3LXUX 2R0QC 4O4IA 4RS4A 5AMXA 1WZ2A 3AFOA 2OQVA 1E2UA 2B4YA 5AWFC 1J8VA 5HF9A 4UUAA 1QVVA 2Z4SA 2D3WA 1BA2A 2YR0A 3IKVA 2VI5A 3SS7X 4DMLA 2YQZA 1QH0A 3BCDA 1Z22A 1LQ2A 3V7NA 1ZHOA 4HDNA 3NIDB 4UZFA 2NYAA 5AJVB 3G7SA 2IXFA 1IZ0A 2WF5A 3HKDA 4MUNA 4OP1A 1IEVA 5KTRA 2QX8A 5AKEA 2JVIA 4K0KB 4M7RA 4INAA 1UOPA 3GB9A 1KRHA 2IYUA 2GQFA 3LHKA 2FPLA 3IJEB 3GQBB 2GAAA 3D2BA 4EENA 3QLTA 4IEFB 4ARZB 2AI3A 1QVFB 2NNLD 2QLLA 4LXIA 5A03A 1OA1A 1XTVA 3ZJTA 3AR9A 2A0WA 2C82A 3U56A 4Z4IA 1IM5A 1MJNA 3H5TA 1KZ6A 4G1CA 2ZSHA 2H92A 5J35A 3LUPA 3T5TA 1CP3A 1HOTA 3GGDA 3KLPX 2YIJA 3N0WA 4ARIA 1LX6A 1VIMA 4R1MA 4ZOQI 4OXKA 3MWGA 4X20A 2GZRA 4B3SB 5TDHA 1GPWB 1E0SA 1LA2A 4HTAA 3V1MA 2P67A 5FL3A 1PQPA 2WMNB 3ZGVA 2PEZA 3D31A 2WINI 3EY9A 1GKLA 2PRIA 1DCKA 4EY4A 2XMZA 4J4BA 2IU4A 1O1YA 2WKRA 4ZMSA 4HR7A 3D5TA 2C54A 4D46A 4U00A 5JW6A 3N8IA 2WP0A 3BMCB 5LOVB 4MDEA 1CUSA 1EDBA 1G1MA 4N0QA 4YONB 3DTNA 5IBPA 1NOIA 2W6ID 3D8UA 2OHFA 5EESA 3LP5A 4V2UA 5E3JA 1M2VA 3BIOA 1N6HA 3PL1A 1LNSA 4EUKA 3NKLA 2IEAA 3VUFA 3OY2A 2AHOA 4JLKA 1FNNA 1RZ3A 2QM8A 1IZZA 1IHDA 3G1TA 4M49A 1UBCA 4XRGA 3HKBB 3QEAZ 1SNYA 1P3Y1 2JJMA 4GPZA 3WBKA 3ETLA 4MQ5A 4QRHA 3S3TA 1QE0A 3EIEA 4OPOA 3KR9A 1FSGA 3BUSA 5LXTF 4RK7A 3BGVA 4ETNA 1KH3A 1N5LA 2X9LA 2JIOA 5CP8A 1ZRMA 4X5OA 5LYYA 3WQRA 1N5MA 4ZAFA 1I13A 1PL7A 1ZD4A 3NIWA 1T5DX 1SVWA 2GASA 2IP1A 2Q3MA 1CYEA 3GSIA 1T5SA 2ALJA 4UEWA 3NDRA 4FHZA 2QHXA 1JAIA 2QMUA 1KQ3A 3RC2A 4TN1A 1KYVA 1NT2A 3GVPA 4U2DA 2FVXA 4BWGA 1SXPA 1W75A 2YHIB 4XIYA 4QG3A 5AT1A 2L69A 4P34A 2HA0A 2I6UA 4U2EA 1L1FA 5GM2A 1NN1A 4LTDA 1S96A 4MYHA 4B4DA 3EVZA 3VVMA 4MQ6A 4M1WA 1SZCA 5FWNA 5ALOA 4B8ZA 3BORA 3HK2A 4LQDA 4BZPA 2Z95A 4Z7QB 1TJ4A 4R51A 2ZVDA 2VPQA 3S81A 5EGSA 5I9LA 3QEJA 1P3JA 4S1TA 1VP9A 1I18A 1ZX1A 1Z82A 3WG9A 3F6YA 2ROQA 4X63A 5FV7A 4REOA 4MR9A 5JMOA 1YR7A 2XB8A 1L7RA 2CNNA 3FHLA 1DV2A 2IGBA 4JDUA 2FWNA 2XV1A 3RSOA 4D8WA 1PUIA 2GREA 4B2IA 1W5EA 4L8GA 2Y8EA 3CTPA 1W36D 4BKUA 1KC3A 4QASA 2CLLB 2I6GA 2GNOA 1ZN7A 5DGCA 2UZ3A 5T64A 4LBZA 1RYBA 1UFVA 1VOTA 1KBZA 4BFSA 1VG8A 3AY7A 1JG3A 1D4FA 3HFJA 4A91A 4DWJA 4OFBA 4BJ1A 5A4KA 3KO8A 1M33A 1ADFA 3BCHA 3USZA 3Q2IA 3WHLA 1U9IA 3TO5A 1DRWA 1E6EA 1Z17A 2OV6A 3Q8KA 1JPVA 2HWWA 1U80A 3FPAA 3DBVO 5ALNA 3L6RA 1C2TA 3FAKA 3LUBA 5DNUA 1Z5WA 1R4ZA 2R6DA 1YQXA 3C0KA 4UXJA 3D7KA 1NJ1A 1G3QA 1SOUA 3NBAA 3MTBA 3ZHVA 3JQ8A 5DNCA 4B6PA 3T1OA 1RKBA 4ARAA 2QTVB 4TTTS 1N36B 2C3PA 3OPVA 3D1JA 4H3KB 4L8WB 5L3QA 4Q1EA 3V4RA 2GN1A 1JIXA 4ZXFA 5LXTA 3TUZC 4K9QA 1N8SA 1E5TA 1KPHA 3P20A 5JAHA 1Z6XA 5G1NA 3UGQA 5ECYA 521PA 1AZLA 1TK3A 4RXTA 3CG0A 1QO0D 2PT9A 1XMIA 1OTYA 2Z8ZA 2GHQA 1MMFB 4JWTA 4RXMA 1Q50A 2YFQA 3MJEA 3ROPA 1XZMA 2XD4A 4D4LA 3K2QA 2GQ0A 1Z83A 4D9HA 2W71A 3C3AA 3DBHA 3TE6A 3AFHA 2Z5FA 3IE2A 4YRRA 5FI1B 1X0XA 2GEKA 3RU9A 3ESAA 5U1PA 3PEVA 3IR7A 4N3BA 1XMOB 3GMTA 4GYKA 5FTKA 1W9HA 4K40A 3X2FA 3AEXA 3FB4A 3IIIA 4P7FA 4DR4B 1XZEA 1TIKA 2A0XA 3F6RA 3QVVA 2JGRA 3AVQA 2F7SA 1I2ZA 4QUHA 4ILKA 4HCJA 1AH2A 2ZRCA 5TEVA 3SC3A 3ASUA 5AW2A 2FSFA 3EH1A 4BECA 1NNLA 1EFUA 4KL8S 2AGVA 1UD3A 2C1ZA 1QIIA 3RSGA 3RVNA 2OK7A 2Y1WA 1YBMA 2I3ZA 2JGLA 4W7HA 2YJ3A 3W8RA 4Q00A 1USKA 4KVZA 1GU1A 1JDBB 3AP2A 3FYTA 5EKSA 1VRCA 5EMNA 1ZQ1A 1POXA 1QC5B 2CFSA 3DGFC 5GP1A 5KOIA 1DKMA 3GN2A 1ADCA 4WOJA 3O4RA 1MRNA 3D4OA 1M6HA 2CDAA 1E3LA 2NYVA 3LWNA 3M4XA 3EE6A 4B3JA 5JBIA 2G9UA 2VG8A 3OCZA 2PE3A 2JEYA 5GVSA 3VO1A 1VHLA 5CB8A 5K4HA 4YCAA 3RRFA 3ZHQA 1SC9A 4XEUA 4F46A 3I1IA 3CKMA 3SYNA 3TX6A 4KIGA 1VCHA 3BXZA 2HNAA 4Q3CA 1ID8A 4TN5A 2I33A 4DTCA 1HDCA 1DOZA 1RWKA 3NTXA 2G1AA 3WGZA 4LQLA 4IIBA 3NWOA 1LSOA 4O25A 4KAFA 2BISA 1TT5B 3GLIB 1IRXA 1QRTA 1E3EA 3DMDA 1Y1KE 1P17A 2QG9A 4B44A 3WWPA 4E08A 2CYCA 2E5WA 1X7GA 5AM1A 2OK8A 5CT8A 4GC9A 5FYDA 3V1LA 2Q9UA 1H4QA 1FP7A 1CRLA 1U9JA 2ZCUA 3WGYA 1L5WA 1TVEA 4UMEA 4X06A 1H2XA 2BFFB 2GFQA 1Y0BA 4V0SA 1A04A 1GQQA 2WLSA 2HMAA 2WU0A 3BD7A 3FSGA 1E5QA 1Z29A 3BB4A 3H3XA 4L4YA 3MB8A 5AUPB 5BSWA 5EIBD 1GDTA 3UEOA 5IMBA 1P5RA 4XIIA 2QU8A 4DJEC 4HNGA 3H9BA 1OMOA 2YKGA 3PQ6A 3QUTA 1XKTA 4ZCRA 2Q3FA 3KUKA 4CM6A 1GA4A 1OBFO 4CM8B 1K2VN 2E7ZA 4P86A 2D0PB 4FT4A 2FEAA 4PG5A 2OCBA 3LBAA 1PDOA 3PQ3A 4TKUB 1E2BA 4QEDA 1RFGE 2QZPA 1W85A 3ACBA 3ICCA 1DEXA 3H65A 4NQZA 2ZYHA 1P7CA 4NYMQ 4RLSA 4BYMA 2VZ8A 3K2IA 5DMXA 4QAJA 2IEIA 4FU0A 1A82A 1HOXA 1UK8A 4GMFA 4D9NA 1B7GO 1UDRA 1KRWA 4OA8A 1EJBA 1YOVA 3D6MA 3SI7A 2D5BA 2SBTA 5LZ9A 3VTZA 1U2ZA 4R8LA 1JG4A 5A9SB 3GCZA 2IZOA 3R0XA 3OIGA 1I4OA 3DNFA 3ELYA 1YV9A 2ZT6A 1MB0A 3VR4A 3D43A 3X1YA 4MQUA 5F33A 4PFQA 5B12A 1EJ0A 1GA1A 1WSBA 4MQEB 5EPOA 4AM8A 4EI7A 2QTGA 2AXQA 4PGAA 1SHUX 4PNHA 5BN4B 5C8XA 1A50B 2PLWA 3KETA 2SNIE 2P2NA 4FFVA 3SXUA 4BGUA 1N07A 1CNFA 2VYCA 4DBLC 1TLLA 2Q3CA 4YCLA 1YRYE 3HV2A 4DT1B 1Y9ZA 2PAAA 3AESA 4E09A 3KQVA 4AAYA 4OF4A 1TADA 3C6KA 2CEKA 3F7TA 3AHJA 1X92A 4GOND 5EJFA 5CVEA 5B58T 4IQ0A 5CEEA 4PXYA 4RDLA 5HUQA 3WA7A 2NV0A 1B26A 5DX0A 3GGOA 5NULA 2VRBA 1QHYA 3VHXB 4PX5A 4YUWA 2WTMA 4ZI2A 3OM9A 4MS3B 1YDGA 5LM3A 2H57A 3SKBA 4AC9A 2Q2OA 3FVWA 4XGIA 1E59A 1L8XA 2VDWA 2Y3IA 1X39A 2JFGA 4NE9A 4OXIA 5DB4A 3AUJB 4N1AA 4GOLD 5L3RA 1FFXA 5KU1A 1GPAA 1TEVA 2ZI9A 1PQUA 1U1IA 1XZLA 4PCLA 4XH9B 2GOYA 4I8IA 1B76A 2QLBA 3AHEA 6PFKA 2WWHA 3OE7A 3N2LA 2NZVG 1R5OA 2XGOA 1H2FA 2VOJA 2GLTA 1BNCA 3FPEA 4FWIB 4GZ3A 4IDOA 4NFSA 4TYYA 2FN4A 2HOQA 2MU1A 3WAKA 2AD1A 2GF9A 2Q8QA 3JYNA 2CUNA 4UBJA 5AJHA 3I52A 1D6MA 1GXSB 4DILA 3ADPA 4EJSA 2HDWA 3BMQA 1NVMB 2OUKA 1VHQA 4MYRA 1H4SA 3VI3B 4TTJA 4TMWA 3FZQA 1KYXA 5F4OA 4RIGA 3L1VA 4HAWA 5C18A 4U3JA 2WSSA 1EWYA 2B99A 4FSDA 3C85A 4I4TB 4WNIA 3FOFC 2O2SA 2O8NA 2UDPA 3HYSA 1RMYA 3R24A 1Z6ZA 5K6AC 4NDAA 1LH0A 3X1ZA 1KXJA 2G5GX 2PLAA 4QQFA 2ZSKA 4H0CA 1PQWA 2IYFA 3A1CA 1E3QA 3S44A 1KA9H 5JS1A 1U2RA 2AFIE 2CLIB 4KFSA 5KSPA 4KXYA 4ZOLF 3S2FA 1EDOA 2H00A 3JQQA 2DP4E 4E88A 5C1IA 4MX8A 3VKVA 3HJUA 1USGA 2Y1CA 5LMUB 3R6KA 4G5FA 2Q07A 5HGXA 4OVKA 1LBQA 3H17A 1A97A 4NJOA 4EG8A 5GJVC 4PAQA 3EGDA 3W5DA 4R2WA 3O9VA 3MW8A 3M3PA 1WVGA 2Z6BD 3I72A 4Q39A 3TTSA 2NUAB 1M2GA 2J4FA 3EGVA 1GSAA 2GSWA 1Z06A 2ZWOA 3G0DA 4BQIA 1FNMA 4K8RB 3SBXA 1MP0A 3GV0A 2BMWA 3WJ7A 1YS2X 2QD4A 1N6LA 3EYAA 1CUEA 3L04A 3VA7A 1KNQA 1UPUA 4QSMA 5HM6A 3LTNC 2G67A 1KVSA 3RV4A 1HLFA 3QUQA 4HAIA 4L3WA 2FK8A 3FROA 4G89A 3AR5A 3QE0A 1KOJA 1OLUB 3KHSA 5DNWA 2XUJA 2DHDA 2GD0A 1Q7TA 3IQHX 3PBKA 2J7PD 1X86B 4OUDA 4OX9Y 3OLYA 4JJGA 3WYNA 1H2RS 1M73E 2YH2A 3LQ2A 4KQ6A 2O8CB 1YJ5A 1VBFA 1ZJZA 4U02A 3PR3A 2CHEA 5JADA 2WD9A 4QUDA 4X6UA 5DGIA 4JQCA 1RJ9A 1C14A 2CXQA 5J4LA 4Z1OA 5EZ5A 3UAYA 1FUEA 2C99A 3KG2A 3PQ5A 1ZM7A 5HXAA 2OT3B 1XROA 2QMEA 1KDVA 4DLWA 4HDMB 3JQCA 2RGYA 3BRWA 2JCBA 4I1UA 4NPCA 4AZSA 2BFCA 2FZ5A 5AM4A 3D7NA 2BM8A 1WHTB 1IDN1 3EIUA 4YT8A 4Y18A 2EJCA 3CNQS 2HNKA 1HY3A 4P9NA 4P4GA 4ZQFA 3I9OA 5I7UA 5BSXA 1Y8CA 3MS2A 4IDNA 4O4HF 1UJ4A 1WB6A 1E2HA 3TZKA 5AFSA 1OAKA 5JSZA 5JXJA 1TJNA 2JLZA 3W2TA 3WDMA 3TZHA 1C5KA 1RHJA 3BWMA 5G3YA 1WUKS 2YIMA 3GYBA 2P9CA 2WT4A 1VL1A 3BH7A 1CF9A 4B6FA 3SLDA 3I76A 2NO5A 3TX2A 2QTFA 3IRVA 3R9XB 5BRNA 4ZOLA 2REQA 3SY8A 4I19A 5GY7A 2G71A 3PQCA 2NNWB 4HK4A 5LFAA 1XMPA 2HBQA 4G5RA 1J5EB 2NMVA 2QI9C 3TW8B 3KZNA 1HL7A 3WNCA 1ULAA 2CE2X 2JCXA 3AEKB 4GGPA 3TPZA 3UENA 1WDKA 3ELDA 1OWOA 4Q19A 3MSCA 4TWRA 4WZAA 1PT9A 1N05A 3TSCA 4KQCA 5CB0A 3IPAA 3F1LA 2ILTA 2OLJA 2AZXA 2R84A 2RGAA 5CDFA 3SJZA 1VJ0A 4PS1A 5JVDF 1EGQA 1YDEA 2FX5A 4IXWA 4UTVA 5JLJA 5JH7A 1ODFA 4J6EA 5CM9C 1V41E 3S29A 3ZCSA 3EBPA 2Z08A 3GT0A 1H3FA 1P0MA 3OPOA 2NTVA 3HJHA 3K8YA 4JA0A 4WRRA 3KCNA 4GKAA 1GN9A 4GI7A 3JQAB 4IH1A 2EBFX 2JS7A 2BEVB 5E38A 1T5BA 4NV1A 1DS6A 1C7EA 3SHTA 3QU9A 3VMMA 2JDIA 4V03A 3HE3A 3PDIB 1WPXA 1ISGA 4Y2JA 5EWLB 3ZQKA 1SIUA 5K8UA 4KSBA 1KOGA 4MO2A 4IIVA 2FXIA 3AERA 2ACKA 1R18A 2I78A 1IOZA 3MMXA 4KX5A 3LVBA 4F56A 4LVUA 2IEZA 3FMVA 5A3SA 3CH5A 1A88A 4S0ZA 1F5NA 3EDMA 4UEOA 1MV8A 3WB9A 4TKVA 3JTMA 4DIDA 4RPGA 4JQZA 1L7BA 1BHSA 1OX5A 3JX9A 4HJRA 4K9MA 1PRYA 1HO3A 1FEZA 2JIMA 1AQ6A 4N49A 4M8SA 2IRWA 1M1YA 1Q2XA 3L6OO 2CNDA 5ECWA 4AQYB 3CE6A 4UHBA 2MSDB 3IEMA 2NQTA 3V1TC 3C7TA 1OTXA 1O77A 4XWOA 4BPRA 3JQGB 4O4HA 1ODJA 4ESEA 4QGSA 4QYXA 1UKZA 2GYVA 3GBPA 3V2UA 3TLYA 1O94D 3OD5A 4OHVA 3K94A 2D1YA 3GOQA 4A15A 1WOYA 1I0IA 2HO5A 1ZH8A 5CXQA 4L5AA 2NTJA 4OOFA 5JZOA 3CUWA 4JKIA 1XA0A 5JAPA 4BNZA 2X6YA 3SSMA 1GFIA 1XXHA 2LZ0A 3ORFA 1M54A 1I94B 4YRPA 3T53B 1T4BA 1YK1A 2AKYA 1U2GA 3ANYB 1Z0DA 4G1VA 2EFHB 4UZEA 2W7TA 1GV1A 1HSZA 1R3UA 3OAAD 4MQMA 5JAMA 3EQ8A 2RHTA 3MT8A 4NMXB 1WVMA 4F4HA 1RRMA 2HRBA 3RVSA 4I36A 4QTUB 4RA9B 3DAPA 4XWTA 5LB2A 1QUEA 2HCBA 5JVDA 1ZA1A 3IURA 2QPOA 3T41A 1RXSA 4GXTA 1RMTA 2E6UX 4LBYA 1IG3A 4P4UA 4UHEA 5JJ5A 2G7MC 1NONA 3O0TA 4HX5A 5AVKA 1SQFA 2RMKA 2V65A 1UINA 4RZQA 4ZO9A 4RKEA 2OGWA 4WT7A 5TJ9A 4NKRA 3HCAA 1W4RA 3OU7A 3HUEA 3MXTA 3RFUA 3QWFA 2JVJA 4C0XA 5ELMA 2JIQA 3U3DA 4XYEA 3BAFA 1KR2A 1X7WB 1M34A 4DC0A 3W2GA 3Q3IA 2FR1A 4HDAA 3TLJA 1IN4A 1D6SA 2RHJA 2ZQZA 3TLMA 5KCZA 4US0R 3V80A 4A2WA 4M83A 4CFZA 2VTBA 4KKSA 2CJWA 3D3WA 4AURA 4EATA 4R0VA 1NW4A 5KWVA 2IY7A 3I05A 4G7WA 3HB7A 4F1KA 1P4HA 2GVNA 4GC5A 3S2UA 3Q72A 7AT1A 1QKKA 1CPYA 1JHXA 2C98A 2EKBA 2EV9A 4LK2A 1V9LA 3W79A 3GFGA 1LLDA 2Z56A 3A6KA 1KNXA 3K73O 4LHZA 4TMYA 3UZUA 4HFNA 4CL2A 2O8BA 2WWIA 1E6WA 2QTNA 2VYFA 3D8TA 3GC6A 3I6IA 3LIIA 5HF6A 3WWCA 2J0UB 2IPMA 2YRFA 5B4UA 2HHAA 2D00A 4RKYA 1L5LA 4WVLA 5D3QA 1Y3HA 2HD4A 3PJFA 3MWEB 4L8JA 1K5HA 2VS1A 2X19A 4RKRA 3QGMA 3CUEF 3T6KA 2OMKA 3MJDA 4GNKA 2VK1A 4RKWA 5HQJA 1YACA 3DYVA 4BFVA 1CJVC 1H3NA 3K0KA 1IBKB 1HLPA 4ESOA 2FRDA 5JWOA 4QELA 2IIQA 1BTOA 4W7SA 1OAOC 2P3OA 2EQBA 2ZRKA 4CIBA 5FO0A 3UOWA 2L0XA 1YL5A 5KOJA 1XLTC 2VJJA 1KSFX 2PGIA 1VRWA 1DZIA 3JQ9C 2E18A 3CTMA 3CXUA 4OI4A 5AI0A 3TIVA 3WLTA 4ENRA 2J45A 2BBTA 3G8DA 2FSVA 4RD6A 5KCMA 4DL9A 5I5EA 2NZWA 3WQHA 1ZR4A 2O8FA 2B1JA 4P4NA 1T6YA 1HZJA 4TV9B 2F1IA 1OKKD 4TTSA 1GUAA 4D02A 4GBED 1MC5A 1O6FA 1YULA 2C9MA 4M98A 4Q05A 4ETIA 1VL0A 1R9NA 3H5VA 2Y77A 1IL0A 1JPUA 1PJ8A 5CD9A 1QWSA 1I3OA 4WLEA 2OFFA 4Q4HA 4LX0A 3RVBA 4POAA 2JLRA 1N2XA 2WJ3A 3MCAA 1O0SA 2CZGA 3E9MA 5NLLA 4OXYA 3HVKA 2OBMA 1NXXA 2JCYA 4WZBA 4OP3A 3OPNA 3LCJA 1ESZA 3G17A 3JALB 2OTJB 1PWZA 1F20A 4KQEA 1CU1A 4LJ9A 4QBTA 4CMEA 4YCSA 3GG2A 1W19A 1XAIA 1KZ9A 3GNLA 4QU9A 3H1FA 3ZQUA 1HYQA 4E5DA 5K8IA 1SCNE 1Z47A 4RMNA 4UNQA 4H7IA 4QHSA 1T9DA 2GI4A 5LD2B 2C83A 2OKCA 4C6TA 1PX2A 1YBAA 1SCKA 3RSFA 1WB4A 3OKCA 4Z5XA 1K7FB 1GY8A 2D1FA 2H17A 5EIAA 4P58A 3M1YA 1Y9EA 4XR9A 1DT3A 2HGSA 4II3A 3HP1A 2YICA 3U80A 4G0XA 2FW9A 3W6OA 5M3BA 1ISHA 4F6RA 3EPKA 2HC9A 1Q1GA 2JI8A 2I8LA 2BHRA 4LNAA 4EY7A 3HCCA 4BUCA 1HQCA 2PDAA 1NY6A 3P9KA 5F76A 1XMVA 5ENZA 2Q5LA 4RYLA 3COYA 4UXHA 1VQLB 4O3FA 1JAYA 5TV2A 1DUIA 2WFLA 2IYOA 2HCJB 2AEEA 3PNOA 4G5SA 4MPTA 4R9RA 1CVRA 2C4HA 1V3VA 1V6SA 2R60A 5EKTA 5JJCA 1QO7A 3HO6A 1PYOA 4IF4A 3TR0A 5SZIA 3WLPA 1KY2A 4CM7A 1UADA 2B94A 3H8SA 2K7ZA 4AKEA 2VDUE 4MJ3A 4EPRA 4FE4A 2Q4RA 1EEHA 3LGAA 3SYMA 2IJGX 5ES3A 3TSOA 2Z2YA 3G3EA 2I2WA 2G6BA 1OX6A 3V32A 4AP5A 4F5WA 4B3MB 1M1XB 4EX6A 1J70A 3TPFA 2HA2A 2WW8A 1SVUA 1KK3A 2M2IA 3H6GA 3W5CA 1J8FA 5FOQA 1K97A 4JL6A 1JHDA 2J3JA 4DR1B 3FGPA 4PLWA 3KKQA 3CB4A 2PKYX 3PXCX 5EMJA 1E1DA 3TPCA 3TZEA 3A26A 5L40A 3K8ZA 4LSGA 3R5SA 4ZU3A 3WYGA 2ZWIA 4PQFA 4F7DA 1WXQA 4NBUA 2ABWA 5FA8A 1KE1A 1Z5VA 3VC7A 2XMQA 1REQA 3DNPA 3LSTA 3Q1KA 2JGEA 2OBNA 3HABA 4RVFA 3O4IA 1N5DA 5K51A 4TQGA 5BURA 3LNNA 1W0CA 3LGSA 5A4IS 5IH7A 3ZN2A 1SMKA 1DIBA 4BNFA 1W5FA 4FFSA 3K6SA 3TXXA 3UWDA 4BPBA 1W96A 4LHWA 1EGAA 5EUQB 1NU8A 2LZJA 5HXBA 1L2TA 1M10A 2RSLA 4XL9A 5JXGA 2A94A 3PKIA 2CUTA 5GINE 4RTOA 1IHUA 1PLKA 3HKEA 1T5LA 3T0IA 1YZ3A 2QAIA 4XD7D 3A6GA 5AVZA 2XB2A 2ZIGA 2IDZA 1QO0A 4TWZA 3GEBA 5J2UF 2NU7A 2QZ9A 2OESA 1T9BA 4N9WA 3ZU3A 5CB4B 5AKLA 1T2NA 4DAOA 4D4MA 2GLUA 3C39A 2JLUA 4US1R 4KRGA 3TZCA 5CCEA 4AG3A 1FX0B 3EUAA 1B8UA 3ZLUA 3FUWA 4DEVA 2ZG6A 1AC5A 1U1FA 2A9KA 2ERXA 2PEYA 3SNHA 3S1SA 5C51B 3WQQA 3CEHA 3MQ2A 1L8OA 3GELA 1E3WA 5ES4B 3DL4A 3A25A 4GGMX 1FA9A 4OATA 4CR6A 1RZRA 4JAVC 4DQLA 1XR3A 3WOHA 3IAXA 4K81B 3NHRA 3VH2A 1WZUA 3I01M 1OFGA 3EMDA 2IWHA 1FU8A 3FUXA 5BPHA 5FHQA 4B4OA 2XQIA 4YWJA 4TMXA 1XAHA 1QDUA 1Z8NA 2FWPA 2NSJA 4P2GA 3F0TA 2A5FA 1B15A 2ZB8A 4YQEA 4E1VA 4TVOA 1A95A 4JV5B 3IP1A 2GPWA 1U28A 2Y1GA 1QV9A 2Y1EA 3G9XA 4PHCA 2I1VB 4D0RA 2EJWA 1V95A 4R7TA 4RANA 2H5IA 3OWOA 5KNCA 5DXAA 2DPGA 2FMUA 2BHLA 5HCUA 3VO8A 4NOKA 5HMMA 3F7OA 1YUBA 1IHMA 3L9WA 1G38A 3LT4A 4IM7A 3PHHA 1HE2A 4M76B 5K01A 3HLKA 3M83A 4GPIB 2YVKA 3L84A 3UWSA 5K0TA 2Z9CA 5GADl 3GH1A 5EJIA 3HB9A 2DF8A 2POQX 2OA0A 4CKWB 1E1YA 1LY1A 2OL4A 2VJAA 3QVTA 4JP8A 4OBXA 3ZIDA 2PR7A 3F7NA 4A82A 1X3SA 1YJCA 1EHIA 1UEXC 1I1QB 4QBGB 5HZGA 1COWD 3IP9A 2HMVA 5KYWA 2IXBA 3JWHA 4RDCA 3V00A 3FYUA 3GLSA 4UM9B 4Q9AA 4ZWNA 1E0KA 2P9BA 1C1XB 1XC7A 4KOEC 3AILA 1CFJA 3U19A 3M6XA 3RBAA 1EI9A 4LJLA 3W05A 3WGQA 2JH8A 2XUQA 2OVFA 2I71A 3HKCA 3QU2A 3K0FB 5G2OA 4B40A 5J2UA 2QRZA 5BSGA 1CZLA 3CP2A 1SQ6A 2JZOA 1PG5A 2NU9B 3I6QA 1SCUB 4OHRA 1Q1ZA 4UPDA 3O4GA 3SFTA 2JFNA 3IIJA 3KKLA 2XSZD 3JQ7A 4TLLB 4QPPA 3EC7A 1ITZA 1Y1RA 3WK7A 1EVLA 1GL9B 4HPJB 1R4AA 1AGNA 2CL7X 3NANA 5IDXA 2ZL5A 1UD4A 2G28A 2B2XA 2WNSA 3C97A 4GPAA 1N5RA 1FQOA 1SN7A 3A11A 4N7RA 4BXOA 1A1VA 2IH5A 4ILEA 1D03A 2W2VA 4ESHA 1FQKA 4P8RA 2EU8A 1YGYA 3S68A 2D8MA 2J5BA 1U0NA 1MJHA 2BZ0A 5D6OA 2R6GA 1VBNA 2ZYUX 4R1LA 4XDYA 2J09A 3RT9A 2ZTLA 2CLDX 4GMDA 1QIKA 3LL7A 4B84A 5JOQA 3DEKA 7YASA 2X40A 4KWIA 1JFSA 4A0RA 2LVBA 1EMDA 2PD3A 3FPCA 1KFJB 5JEEA 2Z1DA 4CEJB 3SIWA 1NR1A 2QXTA 2EBHX 1S01A 1TCVA 2P3LA 5B2FA 1S3FA 3R6DA 4BP9A 3TIFA 1QGOA 3EFBA 2G40A 4FCVA 2XNDD 2QLTA 1YS7A 5CDTA 3LKVA 1XEFA 1IUKA 4Y2TA 1NC3A 1OIWA 1L7XA 3JYQA 3GR6A 1HT2E 3UNXA 3VYSB 2BMEA 2FPSA 2ZWAA 1CYDA 1OU0A 4V0QA 2WILA 4H0FA 3T9CA 2PXHA 4V38A 4PGMA 1G5QA 2P0EA 2NU8A 2CXNA 4AKSA 2CDBA 4QVGA 2NZ8A 3BBLA 5EUMA 2UYCA 4D9JA 1SQGA 3U31A 2I6SA 2P6PA 2VL7A 3DV0B 3LOQA 3PS9A 1FBTA 1OXBB 1VE5A 4X07A 4JYPA 3JR3A 4Y2QA 3TXYA 1AUVA 1PR4A 1YZKA 2PWZA 2ECFA 3KOOA 4WOCA 4DUGD 4NCIA 2B1QA 4YRCA 3DTVD 4JUAA 3OOWA 5HF8A 3WYAA 1V3TA 4LFCB 2H06A 4UU1A 1MDBA 2CHVA 4NMWA 2W98A 5ESRA 3EZGA 1BX1A 1PYDA 2Q5HA 1SEPA 5EYPB 4F4FA 3WGOA 3GI1A 5JCOC 4KIFA 1OLXA 1YT5A 4D6XA 4KR3A 3HR8A 3NPMA 2WPDD 1K0UA 3OBIA 4KQMA 2Q3DA 3MTQA 3VPHA 3O73A 1DC4A 4CRWB 3R3YA 1YZYA 1R4MA 5GONB 8ABPA 4WY8A 4UNRA 3ZC3A 2ZL6A 3BQJA 1NDUA 1IHOA 1J39A 3THYA 2IW1A 2WDZA 1QFSA 1BMDA 2CSXA 1XRLA 4C3OB 4R8MA 1VDMA 3E1YE 1YTUA 4JR1A 1S4MA 3MJCA 3SU8A 2RARA 2D0OB 2O8DB 2WZPP 2ZPUA 1NUAA 1FS4A 1O95C 3KTOA 1U0TA 4M3NA 4PQEA 3ESCA 4Q82A 2SKEA 4HB4A 2PGAA 3QKRA 3E3AA 1G3IA 5AH0A 1KP3A 3SZLA 2GN0A 4YYEA 4E5KA 5JNLA 1ZI8A 1RQNA 3E53A 1XALA 3IDZA 3NU1A 4MUAA 2D7JA 4TYMA 5FV4A 4V3CA 5IRCD 1VYHA 3RAPR 4RM3A 1P45A 1P77A 2FUG6 2H1WA 3GMIA 4CQLB 5A2GA 2RBKA 3QFHA 3PU6A 4PLYA 3GOHA 4R3WA 5I5GA 2NP7A 1C3VA 2C42A 1GYRA 3AHHA 1PJ5A 1F51E 1I3NA 2ZJFA 3CF4A 1K0FA 3IB3A 3UJHA 4P9SA 1QHNA 2CL0X 4IHQA 3RS9A 1L8QA 3R20A 4AI6A 3K4QA 1CY6A 1Q21A 3AHFA 4WNAA 2B3TA 3SLRA 1I7QB 3IUEA 4YBRA 4MCJA 1WO8A 2D2IA 3HYNA 3AH8A 2PZEA 3F8SA 3JQAD 1YO6A 4FXUA 2XB9A 3I9V6 4AKTA 4BMCA 3OQJA 1ZGBA 2IYAA 1RYEA 3L7MA 5DK4A 3MOIA 4HD8A 5I9MA 1A71A 4O29A 1Y4SA 4CLOA 3IESA 4FIZA 5JSFA 3ENVA 3IB6A 2XMSA 3UPDA 4F3CA 2IOFA 1PNRA 2OZEA 2J7PA 1SPXA 3QVJA 4QOGA 2VLIA 3IILA 3VR5H 4ETMA 3P19A 1BVRA 4LYJA 4Z3DA 3BSSA 4D1YA 5HCNA 2OYRA 3RUPA 4XGQA 3VMFA 1NBOA 5KYUA 1DC8A 5E2AA 1FTSA 3ROQA 3RU7A 1PWHA 8LDHA 2DQKA 3H9NA 4JOSA 4LRYA 3DEYX 3RH0A 1PR0A 2F4VB 3JD0A 5DM4A 5I7AA 1T3GA 1KK1A 2FOXA 3U13A 6CHYA 1XRSB 1JUDA 4LNUA 4AN0A 5ADVA 4DV3B 1R0ZA 1S2IA 1KMIY 2GK6A 1JHAA 1R6VA 4G36A 4X3CA 1X8KA 4IIXA 1NRIA 3VSCA 4A0FA 2AWOA 3JQFC 4FEYA 3PX7A 1O97C 2LP4Y 1YZTA 2BFDB 3REQA 3V7AA 3LY8A 3OQOA 2W22A 1QE5A 2W0MA 4MUGA 1JAZA 1GT6A 1Z08A 1RXEA 5G4KB 5ER9A 3ZX5A 1E6CA 1FP1D 2PA0A 4FJ2A 4CDNA 3OIVA 4JB3A 3RF7A 2I22A 5HOEA 1TL7C 1WULS 2VK2A 4XDGA 2JJ8A 2HZ7A 3LXXA 3AVXA 1K08A 4HGQA 5H0IA 1KWKA 3VSBA 3TCNA 5KJFA 3KUDA 5FBRB 3J81k 3CCCA 5GZ1A 2QAGA 4A73A 4J9VA 4KLCA 4B3TB 3K09C 1XT6A 3R0ZA 1L7VC 3FPGA 3TIGA 3WLEA 1G4UR 1TYCA 1ZW1A 2R47A 2XYHA 4Z7OB 5LOVF 4A8JC 3ZWWA 3O4JA 1MPXA 3IP3A 2PUCA 2Q6VA 1JQAA 3BTUA 4EB0A 4M22A 2NW6A 3DJYA 3ZCPA 3LVRE 1CY4A 4GW3A 1S7GA 3C7CB 1RWMA 1HTBA 3NONA 1JHVA 1GL6A 2VHYA 4HRVA 1O8BA 1TYZA 4XLLA 5FXMA 1RVV1 5THKA 3QQ5A 3UK0A 1K6EA 4KHZA 4DNFA 2FPGA 2O0LA 3OE1A 3QU4A 5F2OA 5DIZA 2Z2IA 4TTPA 4NS4A 3FH0A 1JR3E 2AOUB 4KPUA 5DNAA 3DWFA 2PFSA 3FBTA 3DZDA 2WLTA 5KPJA 3CVYA 1ZAYA 3I04A 1UC5B 3PQ4A 2CLMB 2A9QA 3O03A 1WOMA 4TVBA 3HVIA 3H83A 3EUFA 1RAGA 3ZD9A 1PTKA 4N0MA 3V5NA 5FEMA 5C8DA 1JHZA 1K6IA 4IXNA 4PFJA 3WOVA 3PICA 2IUSA 1LZKA 4AZVA 4O2RA 2O19A 1DAEA 4DZRA 2MSEB 2Q4OA 3L82B 1T0IA 1QAQA 1NHGA 4XKWA 3GGCA 4W1RA 1VZ3A 2ZR9A 4N39A 1YI1A 2V9ZA 1VLJA 3Q2OA 3UHFA 4IUYA 4EVSA 1DWUA 2BFWA 1XJ5A 1F5SA 1PT8A 1NPDA 1Z88A 3NHLA 2X9VA 5AKZA 1T2VA 1I51A 4FS8A 2VKTA 1AHPA 1VJCA 2FUG1 1CFZA 2AEJA 1X7YA 1ZHHA 3BIJA 3CH7A 4G5OA 5GJCA 2C20A 2O4UX 2QU7A 5JG7A 3VZPA 2HJHA 1ZEJA 1X8LA 4B8YA 2A8YA 3P71T 4Q1FA 1VHWA 3FZYA 4AK9A 1F0KA 4OK5A 4ARZA 3KVRA 4HQRA 1LVHA 1KC8D 2IEDA 2WTEA 4HLNA 1QJ4A 4Q01A 1HTWA 1A9TA 3AF3A 3H7IA 4C30A 2FWMX 2Q3LA 1J0BA 2D54A 1O94A 5BMVF 1DAKA 4EHFA 1JVSA 1U8CB 5ULLA 3TL3A 1B0ZA 4MHSA 1DAFA 2JIRA 4FEAA 4KRXA 3VSAA 3H2HA 3R5FA 3I58A 4LYEA 4F5YA 1GQYA 1SUSA 1A8UA 3CIOA 4OQNA 5EE9A 3RS2A 3NTLA 1X1CA 3AVVA 5LOVA 3STYA 3BMCA 3ILYA 4ITUA 1NIPA 3MLBA 1E4EB 3VFDA 2CF5A 3OAAA 1K66A 3AVPA 1CZRA 1DVRA 3DCIA 2QLNA 4B79A 1W7AA 1ESEA 1QPZA 2C9ZA 5F5NA 1FRNA 3CCRB 1S3SA 4TTIA 4IJ6A 1ZEMA 3B3QA 4ZZIA 4TYWA 1R0YA 2VTVA 6REQA 2DMRA 3GJ4A 4V0ME 2FN7A 3IAAA 4LXGA 5ABPA 2OBSA 1CUIA 1JPNA 2IYEA 2C5FA 4R1TA 4FUTA 4Y6QA 5HGJA 2YYYA 3OM0A 3QA3E 4AZ0B 4OPSA 4MUFA 4BNLA 1NSTA 3FTDA 4Q3LA 3IPYA 3MTEA 3UMFA 5DCLA 4AVZA 1Z33A 4Y2GA 5JWRA 1Y82A 5KI6A 3BY1A 5KYYB 1JU3A 1FJ2A 2PPVA 5LWQA 1EUYA 2COEA 2ZBGA 4WKPA 2C1EA 2Z43A 3LYLA 1Q1NA 3H7AA 2BFEB 5CFRA 1JR6A 2JHPA 3HN7A 3PVSA 4D98A 3IERA 3DZGA 3GVCA 3RRBA 4Q6WA 3SGLA 1I2BA 4AY2A 2CVPA 4HN2A 1UDBA 4IIDA 1Q95A 1OWNA 2YHIA 4JI4B 4B4WA 3G13A 3SZGA 4Z3KA 2QF7A 3IQIX 2UVQA 4AJ9A 1VBMA 3KEQA 1PEKE 4Z4HA 1CRWG 1MB2A 1RBYA 2Z1MA 3K31A 1DKUA 3H1GA 3P0RA 4HGPA 1FDIA 2WUFA 1N8NA 1IWBB 4RJJA 5BVGB 3EA0A 3QVOA 2BWJA 3ZTYA 5LN1A 1XDGA 3O8DA 1QFZA 1H23A 1UOQA 4IJMA 3E0QA 3PC8C 1KEUA 5AYVA 3O92A 1UBUS 4ZCPA 1KERA 3LBHA 2ZBFA 3SQLA 3MCZA 3P4YA 1GGVA 1ICIA 4Z8XA 5ENVA 1JG6A 4LZPA 4MTLA 3UMRA 3V8VA 1U5BB 4CF6A 5BMVA 5GVRA 1GPNA 2ONKA 5JXHA 1N0UA 1LLQA 2AJLI 3LUDA 2DETA 3VPFA 1YC2A 3G8BA 3I73A 1BN6A 4D2IA 5E2BA 1S6YA 4FR2A 1E5LA 2WABA 1RKQA 2AH5A 4CV1A 4DN6A 2CDCA 1X3LA 1LTQA 3KPVA 3PQ2A 1BYUA 2ERYA 3EIHA 4P4TA 4Q9LA 2E21A 5B1HA 1YVDA 1V4NA 2VQSA 3FD8A 1P2FA 2V7BA 5DX1A 3WYCA 3E3LA 1BD3A 1NXOA 3H9GA 2I0FA 4CYMA 3C1OA 3LK7A 4FKMA 3ZGNA 3QE4A 1OKKA 3HJTA 4KN6A 5KTYA 4M36A 1OBVA 4QPCA 1ABFA 3F7MA 1O4WA 5BWOA 5DVZA 1SXJC 3IUBA 2FPWA 4KPYA 3QU7A 3BTVA 3FFBA 4MHOA 4UARA 5DU2A 2C97A 2Y0EA 4X24A 2Y1OA 1X1QA 1NMQA 5A8AA 1YLOA 1SOMA 3AFMA 2A0YA 2R4TA 4CU5A 4YCCA 1GARA 5EIEA 4NK4A 3DOHA 4WA8A 3C5EA 1HEUA 3K9FC 3C8ZA 3FDZB 4HDSB 2P4EA 1RRFA 2ZDHA 3N2KB 2PGXA 2FDXA 3D7LA 5D3ZA 5H68A 2F90A 3U6KA 1GPYA 3LY9A 5C31A 2CKDA 4C2BA 5IASA 4DLTA 3A6EA 3BK7A 3EASA 3C5CA 3BGSA 4MV6A 2WIKA 2H2IA 4PLZA 4REQB 3EPRA 3VXKA 4BKOA 1WKVA 4U9HS 3A58B 2P2YA 2W2OA 2Q3HA 1GRVA 1FE8A 2OHXA 3OQIA 4A8HA 4W7IA 1FRZA 2B7LA 3DT6A 3D6NB 3HCOA 2D1RA 2I4TA 4FFPA 1VSVA 5JDCC 3DBOB 3Q0TA 4FCTA 2JB9A 3ITEA 3AIIA 3O2QB 3K9GA 1RWOA 2GCIA 5ADWA 4RJ2A 5A6SB 1LFAA 3TLXA 5GJBA 4GZ5A 1WTHD 1G7RA 2YTZA 3DSRA 5B1EA 3K2EA 3IAM6 3DLCA 1WABA 3UFXA 3VI4B 1QIEA 1T34A 1THTA 2XE6A 4KMMA 1FVOA 2WG1A 1HMYA 2Y6UA 4AL4A 5C8ZA 3ESDA 2G6TA 721PA 5C8YF 2YJTD 4KB5A 1NQUA 4EI2A 3KQHA 2JLSA 3D0OA 3ABSB 4S05A 2F59A 2HEGA 4IFIA 3N8GA 1E2FA 2OZVA 1THGA 2Q4BA 4MWBA 4R98A 5E4YA 3ZE7A 3AL2A 2OZKA 1C1YA 4GKVA 2OO5A 4GQAA 4L02A 2LTAA 3RS0A 1NN0A 1JE1A 1QS0B 2EJBA 3GRPA 4CDMA 4QC2A 3I2HA 3SQWA 1OZAA 3D3KA 1VHDA 1TT5A 1Q3TA 1YZNA 5T4HA 2WJJA 5IJ9B 3ZZUA 1JALA 1T0PA 2HFKA 3EXIA 3LWBA 5LZ4A 4JK3A 2PANA 5AXDA 2I3AA 2J3KA 1XZBA 1AQLA 5D5PA 1E9VA 1VPVA 5C34B 1NVEA 2FW0A 4AZ3A 3CUUA 4DZTA 1Q91A 2PMFA 3V7UA 3VSEA 4YUZA 4ZEMA 2P5YA 2VWPA 1CG6A 1EA7A 1GN8A 2IF2A 4C4XA 2PZMA 1TAHA 3PGXA 1RLTA 4XARA 5DBHX 3F1KA 2BFFA 1Z2AA 2WVJA 3LPCA 4UCQA 5DCUA 3CX4A 5DNYB 3QVLA 3SBEA 3QLUA 2I2AA 3N86A 4GOXA 5K09A 3L46A 3ROXA 3LPMA 4EA6A 3ONNA 4HVAA 4BFZA 1C30A 1L3BA 3R2JA 4LXHA 2AV6A 4HRYA 1KJYA 5FUMA 2I6TA 4MW0A 5K45A 2HMYB 1PD1A 3IT2A 1Y6GA 4XD7A 4D3ZA 4BMNA 4DIKA 5JSHA 4RGBA 3V7FA 5KQGA 1T9HA 1U1EA 2O23A 3L8EA 4KXMA 4KR0A 1GNQA 4RTKA 1P2UA 2A92A 1F4LA 3KDPA 4HHEA 4RM0A 1ODSA 5D84A 4TKUA 3QKUA 4C3UA 4LRQA 2KW5A 4Z3OA 5JZMA 4M7PA 1XVIA 1Z2NX 2BCGY 1GILA 3NKFA 4QTYA 3JPWA 2BMFA 2O1SA 2QQEA 2GKOA 2WJWA 2ZYWX 5AQ1A 3K9HA 4I4TF 4OK3A 4QT0A 3T5GA 4O08A 4PRLA 5LNK6 4MIOA 1WBDA 3FSJX 1E2GA 3KC2A 2QSZA 3LMKA 3NHWA 1U94A 3RASA 4NE7A 5H81A 3REFA 3ZWDA 1GZUA 2QUAA 3Q6QA 3CNLA 3G8YA 2IHZA 4DMKA 5A9SA 4JELA 4OFWA 2W9XA 3M70A 3HVRA 3KM0A 3Q8WA 1W48A 3T3EA 3THXA 3FHTA 1AO3A 4YV1A 5IK2D 4QU5A 3SHFA 1DBIA 4EFDA 1KAMA 2BR3A 2X2PA 4GLLA 3L4BC 4EL5A 1DQRA 3W6UA 5C8YA 3LT5A 3FNQA 4FCWA 5JH7F 4WKGA 3SE7A 2ZFUA 2QX6A 4MQEA 1ONBA 1VL6A 1P8AA 2C04A 3OF3A 4BMSA 1X1SA 3EPJA 4KIUA 1FNSA 2D1QA 2VFAA 2XRYA 5BN4A 5LQMA 3NRJA 4G07A 5TEWA 3TQOA 2FKNA 4EARA 5F3WB 4GKKB 3F4BA 2IVZA 4YAGA 4LWOA 1MT3A 2IX3A 3H9UA 2HEIA 2YZ2A 1QH8A 1F8UA 1JX6A 4P7BA 1XYYA 3U5ZB 2JD2A 5J3OA 4WXPA 4PEVA 1XXLA 2J48A 1XGKA 3QWIA 4FT2A 3GJQA 1Q14A 5EKXA 3SF0A 1Y6RA 3SIRA 4IDQA 3BT7A 3T4EA 3QG5A 2X13A 5EHNA 4E7OA 2PD6A 3B6ZA 2PUFA 4Z4FA 1T9CA 4DRYA 3VHXA 1NSFA 2G0NA 4XYLA 4DABA 2PKQP 3IAM1 3WIDA 2OGSA 4MS3A 4DRXB 3UF0A 1COWA 2A1TR 2RAVA 3A1TA 3ZZMA 1IMJA 2XTNA 3ONEA 4FFLA 4UULA 2HIAA 2ZZQA 1VKRA 4L28A 5FQOA 5AVRA 1SVLA 3IEVA 2ZYRA 2AFHE 2P35A 2JH3A 1QHIA 1HQDA 2B1GA 2QMQA 3ORRA 3NI2A 4C4AA 3K20A 2FMFA 1IRIA 3A3NA 2KQUA 2X42A 3L0CA 3AUUA 1DKNA 4OQEA 4ZZ0A 4D99A 4BO3A 3VHLB 4EYOA 2AMFA 3N75A 1G55A 2XSZA 1R8QA 4MDHA 1FPQA 2GGSA 3TFQA 1GTVA 4EY8A 3GAZA 8AT1A 3GEMA 5AXCA 3E82A 4K05A 1ORWA 1TTPB 1RABA 2RHGB 3GLQA 1GSHA 1UKBA 3ILVA 4I4TA 4L5IA 1BSVA 3SHQA 3R9WA 4JYCA 2WHQA 1FMFA 2ES4A 1LV8A 3LFUA 2X6XA 4KMRA 2D13A 4ZC1A 3IMCA 5FWAA 1KMHB 1W0KD 4Q9IA 3P0EA 5DGXA 5JD3A 4C20A 5JS6A 3ADKA 3Q3AA 1Q83A 1NLUA 1RVDA 2VT6A 3M2TA 2OC4A 1ADJA 2YMMA 3I64A 3OA0A 4LFAB 1HSOA 3OX4A 3WQSB 2ECKA 4ITRC 2F4NA 1QVGB 2QDKA 1V96A 4MV3A 2ZRGA 3H1TA 4FYYA 3WWOA 5ALVA 2P91A 3FLBA 5AW8A 9GPBA 4N76A 1DPGA 1TZ2A 4PBRA 2NUAA 1CUUA 3V8MA 1YNOA 3AM3A 4QLAA 4DXHA 3GLRA 4ZHQF 4KWCA 2FCAA 2QLFA 4Y6RA 5KQSA 1ZOIA 3IP7A 3R9KA 2V58A 5L3VA 1E99A 2ZLBA 2VYVD 4U6NA 2XNDA 4PYNA 3B9BA 1L6RA 1O89A 2OZLB 5A9TA 3TKAA 3SG0A 2GD1O 1EQUA 3H4VA 5MGNA 4JUFA 2CCGA 4CEHB 3NBUA 2GESA 2UXBB 4ZVQA 2JFBA 5HDQA 5ICCA 4CUZA 4U7DA 3EY4A 2WU3A 1ZVMA 4NPAA 1PBTA 1LSSA 3C15C 4JU8A 4C78A 2TMYA 4XIFA 4Y6GB 5IYPA 3TINA 1JA9A 3FSRA 1JR3D 5EQFA 5FLEX 1IG0A 1Q82D 5AI9A 5EEGA 4F4JA 2BGGA 3CCMB 3A10A 1NDHA 2J9ZB 2J7KA 4IUBS 3KUXA 3I9FA 4Z8YA 4BNTA 4DUGA 1P4GA 3OC6A 5K3CA 1J20A 2QN3A 1QYIA 3FN4A 3DTVA 2G5TA 2P8SA 3BCUA 3LX5A 5DCYA 5KTNA 1TOAA 2UZ1B 3M34A 4D43A 3RK4A 1TLTA 4HDMA 2O2DA 5JNTA 2KMLA 5IANA 4B45A 3Q1LA 1QX4A 5BV1A 1R66A 4R6WA 1RWWA 1DE0A 3KEFA 3DOCA 3E84A 1WHTA 3Q7TA 3WJ2A 2J33A 4BAZA 4D5EA 2AKAB 2QSYA 4ZFNA 1OBCA 4I46A 4YRJA 3D4IA 2HT1A 4NRDA 5P21A 3U60B 2WPDA 1QKJA 4UUBA 2PJZA 1QRUA 2Z5VA 2CZQA 2XMDA 3D4BA 4Z0NA 4DGQA 5A5DA 3UANA 3RR2A 4YALA 2JARA 3T1VA 3M6MD 5IBRA 1V4BA 1B3BA 1BFDA 1XD8A 1TRKA 2ZRDA 2PGJA 1KH1A 3D02A 5HEKA 1TO1E 3EWAA 4UPEA 1IY2A 4IQ8A 2GD6A 1V11B 4XSVA 5CLGA 4YRBA 4OQQA 1ISSA 2AI2A 2HDHA 5EZ6B 3W9UA 1VBKA 3BRSA 1S8AA 2VH5R 5E1MA 2XF8A 1NATA 3CZRA 3FOWA 1ZL0A 1KC1A 3V9AA 3WY9A 1ZVVA 3H11A 1ZLYA 3G0CA 2MDTA 5K7SA 2CFIA 4U7PB 3TGPA 5COBA 3KU4A 4KZKA 3AR4A 5MN5A 2IUFA 3NBKA 2YHUA 5FYQA 3FWKA 1JMVA 3HVHA 3FNGA 2AQ8A 4Q4JA 1NGSA 2R1UA 5E4TA 1PN3A 3PUWA 1UIMA 4PG7A 3TRFA 4ZHQA 4LJ4A 2VP6A 4KO8A 3DVQX 3DZBA 1DKRA 4MB6A 3WNZA 4BBJA 1G2PA 1TZJA 4NULA 4DGSA 1HEYA 1A27A 3BSFA 2XNJA 3K0BA 2FYTA 4PTYA 5JMTA 2O05A 2VCHA 3C6YA 4HWKA 4L5YA 3WV5A 1FXUA 3K5HA 3K0AB 1HZEA 1IN7A 3NC4A 1CULC 4YJDA 4OU4A 1NAHA 1Y1TA 3FUUA 5AKGA 5DLDA 4DA0A 5I4BA 2WSMA 2OBFA 3JQAA 4YRTA 2ON6A 3O8LA 5FOWA 2BEVA 2FFBA 5BR1A 2JAHA 4ZU6X 1GQFA 3T3HA 2DLDA 4B3DA 4JBHA 1D2CA 1V9CA 4DLBA 3M5CA 4MW7A 2X0NA 3FTPA 4WXRA 4WXHA 5D1NA 1ZN9A 3ZVMA 2B5OA 2DPMA 3EFOB 1I3LA 3KTAA 5F2KA 3RSLA 3AHGA 4QVKA 3HYCA 1OQAA 1OTHA 2ZYDA 4MOWA 3KOUA 3ITKA 1R0SA 5ITWA 1DADA 4A6PA 1EHYA 1SQ5A 2P9HA 1UF9A 2YOFA 2CHQA 1QXSA 3JZMA 1L4YA 1T8TA 3LQRA 3MRTA 4PGFA 4TUYB 4BMOB 4EG5A 4HVLA 3OZAA 2KBEA 4Q4LA 1FNDA 3DS8A 2BHSA 4QT4A 3C16C 1E7WA 4PQGA 5K3OA 3JVUA 4LKRA 4N4AA 1UK9A 4O1MA 1A1SA 2C84A 1FNCA 1V5WA 1XA3A 4G9EA 1EDZA 1PL0A 2QVCA 1VTKA 4OHFA 3JQGA 2ZBDA 2EW2A 2O54A 4IY1A 1DOAA 1YIOA 2XXJA 2GDJA 4QUZA 1SVIA 3I28A 3NHZA 3OECA 4FTWA 4ZT2A 5KC8A 5HRCA 4PAMA 3BDAA 1VJ5A 1HI9A 2QRGA 3LLUA 1X13A 1Y0YA 3CC2B 1XRQA 1WQ3A 1JHYA 1W88B 2ZROA 3ZV4A 5HZKA 1PYGA 4LF8B 3ASTA 5IT9A 3IQWA 3B1KA 2CRVA 4R54A 1M6EX 2DHRA 3BHNA 4ZA2A 3IVXA 5AW6A 5MN4A 1E1NA 4MUXA 3QUBA 2FX3A 3P2MA 4KBGA 1FZTA 3KALA 2HU2A 1YI8A 3K32A 1PG0A 1ATIA 1JWBB 1S9DA 5EZYB 3MMSA 4KV9A 4HGOA 3W6ZA 3KOYA 3FCUB 5I48A 4BNGA 2VP3A 2W4IA 2PKQO 4FLMA 1SXJB 4MW4A 4UAUA 4XPIB 1B8OA 1GVHA 1L4GA 4C7VA 3MUEA 3T94A 1E1CB 2BT4A 3GUHA 2BTQB 2V4UA 3X1MA 4NCNA 4B87A 4TV9F 1QP8A 3KKEA 4ZO6A 5LBIA 4A0QA 4BVFA 3GLGB 2JBWA 4KGZA 2W42A 3C24A 3OOSA 4RA9A 5CX1A 1NBME 3ZHOA 3DVAA 5FI5A 5ESXA 1P1KA 4RHEA 2R1TB 2XF2A 5CGZA 4WXYB 4A0HA 3R76A 5BWCA 4EQ6A 2G72A 3KJEA 3L0DA 4E5NA 1F2UB 3QBVA 1P80A 3JZFA 3TQTA 4YMGA 4HVTA 5JI2E 2BSAA 1WXDA 3WFJA 2FSHA 4EITA 4YV0A 1K6MA 2AOTA 3FR8A 2NU6B 1U7TA 3K72B 3BN3A 4K6KA 5DLPA 4DWVA 4MDFA 3LOPA 1KQGA 3VR3D 2IYSA 3I1JA 2X0DA 2GHRA 1KAGA 4KXLA 2RIPA 1X7WA 2G0TA 2H1IA 2X4DA 3IV7A 4B74A 1RXUA 1VQ9B 2B21A 3VKUA 3WBFA 4ZDKA 1SH7A 3KLMX 3OKFA 1NLFA 4E5SA 2XY4A 1JQDA 1YRHA 2ERCA 2OTCA 4LRUA 3OSZA 2DFVA 1BPLA 1IH8A 1LRKA 1R1DA 2DRIA 2WJ4A 1PO7A 3BWXA 3DL7A 4IFTA 4HUQB 4JC8A 3U4DA 5BY2A 2VDVE 3DZJA 2BMDA 4QPNA 5FTJA 1LLCA 2P75A 2FN8A 3KR0A 1FYFA 3UO8B 2I54A 4OKNA 16PKA 3C14C 1OPXA 2JJQA 3O8NA 2FF7A 3R0JA 1ZSVA 5AN9A 5ALLA 4YEJA 3B6KA 1L6IA 1MABB 2PX4A 4WHMA 4OB8A 2XIJA 4QXMA 4AO7A 2AS0A 2J0UA 1U8TA 3C4JA 3ML1A 2A1UB 2O2ZA 4AJPA 5ENDA 1TK2A 4AD8A 3C5HA 3MWEA 1SXJE 2H18A 3U4QA 4B6OA 4TWAA 5LLDA 1JJ2B 3GBSA 4ACBA 4RCVA 1W2HA 5ALPA 1GD1O 2WIFA 4HLCA 3GLGE 4WE3A 3AV3A 3CLUD 1ZU5A 4TRRA 2BYTA 4JZKA 5CHEA 4MIYA 4NPHA 1WPRA 2PGOA 3GJSA 5HYVA 1Q1EA 1P18A 3P5BA 3NTOA 4X3PA 3AI7A 4X84A 1TD1A 1E1RD 5A71A 3O8CA 4E70A 3U7QA 5AI5A 5K0FA 3H87A 3D8BA 2QUJA 4YMHA 5CTJA 3VAYA 2PKXA 4TV9A 2M6KA 4V39A 1UT6A 2WKPA 4OGFA 4RHYA 2Q0SA 4N0EA 4CF4A 4MW1A 2PXAA 4FOTA 5J43A 4XJSA 3WBJA 1SUEA 4R7ZA 1OFTA 2OMEA 2YFHA 5EHZA 1DARA 2AF4C 3HQ4O 1CEQA 2IPNA 1SC1A 2C31A 2Q5IA 1EFKA 4J7CA 1U3VA 3IYLW 3ASSA 2FPRA 3EMKA 4PZUA 1U3CA 5HK9A 2F3QA 5AUQA 3R8FA 3JALA 3MHPA 2A14A 4BVBA 5A0VA 1T2AA 2G8LA 1PK9A 4QQRA 2BFMA 4S2EA 4JXKA 4LV8B 1PJCA 4P5DA 5E3HA 1UJNA 2D3TA 7ABPA 1FXWF 1MORA 3JYHA 3K4PA 4MRMA 4NMMA 4I1OA 4YMTA 1EBUA 3HRIA 3I1YA 1AS0A 1JU9A 1CHDA 1SHKA 4WCFC 2ZI6A 1UWLA 2O4CA 3DOJA 3RARA 2DUWA 4NU5A 4EG6A 4MP6A 2P3SA 3EQ7A 1HMPA 5CB4F 2EX0A 1TGYA 4JLNA 2GF0A 2CXOA 4EPYA 3HFRA 1RQLA 1ZOLA 3LPLA 1BCRB 4ZK2A 3EG9A 2CJYA 1QDEA 3RABA 4AF8A 1KQSB 1RI4A 3BPSA 2WAOA 3TLBA 5C4MA 4KLAA 3ZU4A 2IXDA 2BJHA 4XWKA 1XTBA 1AD2A 2QW1A 1GPUA 3I6YA 5CNMA 5J4YA 1GVNB 4WN9B 1P0CA 3O93A 2O14A 4P35A 3N7UA 4EHNA 3E7XA 1KD1D 1DEKA 1PW5A 4BLTA 1ZW6A 3WFZA 1U2EA 4YLYA 3IQFA 1ECJA 5E6TA 1XZNA 4RHXA 4K9KA 1E79D 1CF2O 1Y48E 4TT3A 1EG2A 2DQSA 4JR2A 3KYDB 4MJXA 3VKFA 1R15A 3WK4A 3EZLA 4DEYA 5A04A 1PNOA 5KX5B 1TUIA 1TC1A 3NEYA 4E5YA 2WKSA 4IMRA 1YBFA 3WWYA 3D7RA 3OZDA 1PFYA 5TQ2B 2A78A 1JAXA 3GEPA 4B82A 4G67A 4KR9A 4J16A 5JAQA 5KNBH 4RV9A 2WSIA 2CVFA 2AEMA 2OTLB 3AF1A 4E7PA 1M76A 3EZNA 2X8JB 3N0RA 4KH0A 1AQUA 1LDNA 3MTDA 1M8KA 2ZTVA 1LK0A 4ZT4A 3FCXA 4UBKA 4XQFA 1QOPB 4NWIA 4GSKA 2OD9A 3CINA 5AK3A 3S2IA 1Y3BE 4OQMA 1WSDA 4K1LA 4BX3A 4ZYXA 2A33A 2Q1TA 3BM5A 3GGSA 4P3YA 4G0PA 1C9YA 5EIHA 3WICA 1HZZA 3H05A 1N9ZA 1Z13A 4BC0A 3GP8A 1BDHA 2PR2A 1PI3A 1I7NA 4P83A 5AK0A 2WWXA 1U7HA 4QGGA 4L8LA 4CKYA 3RNOA 1IOVA 1JG1A 1FXWA 3KOMA 4OQFA 4DCCA 2FXVA 1F6WA 1RYZA 3KJFA 4L0MA 4F3KA 1P8JA 2HB6A 1CRPA 2GPYA 1T0JB 2EDAA 2VN8A 2BDEA 4PRZA 3LS2A 1SUCA 1DC5A 2CDRA 5CB4A 1J2YA 1KFCB 2TSYB 3KAPA 1WUIS 4Y2SA 1PZXA 3KQOA 4ZEXA 2UKDA 4QM6A 1XD9A 4BO2A 3ROFA 3DMNA 4C2TA 4XVHA 3JQPA 1CUJA 1RJDA 3W5AA 3KCQA 3OY7A 1W5AA 1KIAA 1XEAA 2CHUA 4URYR 5BWNA 1JEQA 1KEEB 3C3XA 4QDTA 2VXOA 3AFNA 4W63A 1JFFB 2YWCA 4HNVA 1BQ3A 1EK1A 2Y9MB 4HTFB 3WGNA 3ZWYA 2GJRA 1AVTA 2OSVA 4H3HB 2GEVA 4N5HX 4NHOA 4JVLA 4DBVO 5FAKA 3Q3VA 2C7OA 4Y9UA 1AG9A 3NWPA 3C45A 2B8WA 3DR3A 2PUHA 4C7OA 1Y6QA 3T7DA 1SXGA 4GE3A 3QY9A 2X6QA 4DNRB 4OI2A 5CBPB 2A0UA 1ZISA 5T6MA 1AU9A 4WJLA 1KO7A 1NUSA 4H3SA 2PO7A 3H1AA 5KAPA 3W90A 2NM0A 4Q9DA 1C8LA 1HDZA 4S1WA 3WTBA 6NULA 1XFOA 1JQJC 1V25A 1E60A 2E1PA 3VU0A 4BN4A 2H1OA 1SUAA 3CRVA 2XCTB 1ZGZA 3VR6A 3GDGA 3ZGYA 4UW9A 3W06A 4QVAA 1C9JA 4G8CA 3KR1A 1Q3KA 3ULKA 1S0UA 6GPBA 5TB5A 5AKXA 3QEMA 4CKWA 1R6UA 1NW8A 3UAXA 3KL2A 2ZYSA 1L5YA 2GB4A 4NL4H 3P96A 4NYMR 1NXSA 1WOSA 4YO7A 5KWJA 4E30A 2FEPA 3WO1A 3TNFA 5HJEA 2PBRA 3HU5A 3VU3A 4LYFA 5SY9A 4NR0A 4P4SB 3QWAA 3IVGA 4KPEC 4OQ4A 4JBXA 3K8OE 1Z62A 4YCDA 5ALQA 5CK5A 1C1XA 2YJ5A 1NI4B 2FHSA 1VE1A 2UYHA 2ATEA 2Y71A 1VA4A 3IXMA 3VNBA 1T0BA 5TT0A 4P54A 3EODA 4EHDA 4EHJA 1RTKA 3HVJA 1QSGA 1LW7A 2WHRA 3GP3A 4NSNA 1GNSA 4WINA 4WLUA 1SCUA 4A1OA 4AJJA 4YPOA 5TX7A 4NK5A 4TZTA 1HFWA 1L4HA 3WXMA 4ZGGA 3CRRA 4R01A 1XP5A 2CD7A 4HZIA 3DE4X 4Q9KA 4AUMA 5JS7A 4OGLA 5GONF 4W5HA 4WBSA 3GRAA 2ZUVA 3ZGZA 4Q4CA 4RLQA 5HKBA 1KE2A 2GKSA 1Z9BA 3ZS9A 4KW7A 1YZFA 3M3HA 4BMZA 1CK4A 4FE7A 1UBLS 3H19A 3BCRA 4PYIA 4DSTA 1NC1A 4J1TC 3HEAA 2HXSA 2XT9A 4UHJA 3AF2A 3L06A 3QWHA 3KXLA 1JIVA 1X80A 3QTBA 2Y92A 5FBVB 4UXIA 1K8YB 3NBZC 4Q18A 4GVLA 3KNZA 3TDMA 4JOQA 4CJXA 3KV1A 5IK2A 4WLVA 4XGKA 3SHVA 1Y33E 4TLEA 1TKBA 2AN4A 1WAMA 4KK3A 4UASA 1HFJA 2HN9A 1T35A 2ZRFA 4MCHA 3HWRA 1FJHA 2CMHA 3U1TA 4BX9A 4EWLA 1JR4A 3HY6A 4OQYA 1IEXA 3JYOA 4BZZA 2PBLA 3OZEA 3AYZB 3I92A 1FSZA 3R7NA 4ROTA 3FNIA 2OZPA 3B3GA 5TF4A 2GN9A 3IBTA 1XMSA 1N6NA 3RC1A 4KKXB 1YB6A 4ZEWA 3CO0S 2PX2A 4IOJA 2PFKA 4G97A 2DWPA 4DA9A 3PSAA 2PCLA 3WFIA 3I4FA 1EVKA 1YR3A 5DBOA 5CFZA 1NG9A 2Y2VA 4YQYA 2R2GA 3SEQA 3WL5A 1BRMA 4HI0E 4IIYA 4JBGA 3SPXA 5DM2A 1IY0A 4WWVA 2DUJA 3PWZA 4LHYA 1RXYA 1YMQA 2F1KA 3UJ9A 1ONOA 3WLLA 5F1PA 2O3UA 2PS0A 4HQLA 2VBUA 4YJHB 3HJGA 5D1HA 4PZEA 3MJSA 1Z0SA 5CCDA 3KJZA 1WPQA 4G4GA 4KUGA 4FM9A 1QG0A 1UBNA 1VGVA 1V7QA 3AM1A 3O3OB 4INZA 4MSUA 3OQPA 4HNUA 4DJDC 3OM8A 3CH6A 3ROEA 5JY6A 4YLGA 4RL6A 2VEOA 1ODKA 2GA8A 3A1FA 4KAXA 1U04A 3RFTA 2AJBA 1DRJA 3CC8A 5ALSA 4ABTA 1CE8B 2WWVD 1A7AA 1WHSB 3F8WA 3L8GA 3N7AA 1SKUA 5EYPA 3X44A 2O9JA 3PFKA 4D3FA 4IIJB 1JHQA 5B3AA 2WTUA 1GGNA 4YCNA 3CWQA 3MTAA 2VVTA 3G49A 4IS2A 3FJOA 1PG2A 1U8EA 1JYEA 2FTKE 2XNSA 4NY1A 4W9NA 3UWPA 4DDHA 3GA7A 3CRQA 2FZEA 5GONA 3WTCA 2YWEA 4MGZR 3MS7A 1VLHA 2AUTA 2I99A 1DINA 4LE0A 4EZEA 1FLAA 3C3BA 3IA7A 5H02A 3BJZA 5AVQA 1OIVA 2J3IA 3M0EA 2RK3A 4G0NA 1J2JA 4IDGA 421PA 3Q5DA 4XCVA 4FGKA 3KT8A 5MF6A 2FGJA 4TT8A 2O8DA 1EGMB 3VKGA 1W0KA 2IHJA 2X9QA 1ONPA 2IHBA 4RFSB 4DG5A 3TR5A 3LRTA 2JAUA 3MJ4A 2VDQB 1X1TA 2ZTMA 4XFDA 2CJFA 3I3OA 4GGOA 3ZWMA 3B9RA 5G02A 4I9HA 5CA1B 1CUAA 5P8WA 1RBMA 1T9ZA 1X70A 1P1RA 4J0CA 1G7CA 4CHGA 3NO4A 1U90A 1RM5A 2FQQA 4HWRA 4CLRB 1ECFA 1KMCA 1JEJA 1FIUA 4CQLA 3B6JA 2WDPA 4FONA 4PYJA 4H4EA 3W0LB 5HQ3B 5LWHA 3UMMA 4TTVA 4FN4A 5JO9A 2IBSA 2JLVA 4UKDA 2XBLA 3PYMA 5CVVA 5I51A 1WL8A 1CX9B 1TZKA 4K7JA 4RZXA 2CY0A 4DY4A 3GU3A 2R6ZA 3WIBA 2BEJA 2J0SA 2P41A 4MXDA 4B3XA 1HRDA 2VYVA 4WBNB 1P91A 3DD1A 4UDXX 1IIRA 4DLXA 2B83A 3F6CA 1NBMD 1NTRA 1U5AA 2XHZA 3MLEA 4DRZA 2ZB4A 2X1LA 4KTVE 1M75A 1AMNA 2CYBA 1CQXA 5A4AA 3QVGB 1DU4A 3JZIA 4FDAA 3P0HA 4R6XA 1P9NA 2IV7A 1X19A 3TXAA 4EG1A 3FCYA 2EFCB 4V02A 4UFPA 1QIJA 3P9RA 4ZN6A 3PEWA 4UAJA 3MWDB 2OSBA 1JR3A 3BB1A 3NIFB 3UMBA 2RGNA 4Y6LA 1OHHD 2UZAA 4AN1A 4DV7B 3M5DA 2LXNA 1BE6A 3ONWA