5GV7A

Structure of nadh-cytochrome b5 reductase refined with the multipolar atomic model at 0.80 a
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
272
structure length
272
Chain Sequence
b'STPAITLENPDIKYPLRLIDKEVVNHDTRRFRFALPSPEHILGLPVGQHIYLSARIDGNLVIRPYTPVSSDDDKGFVDLVIKVYFKDTHPKFPAGGKMSQYLESMKIGDTIEFRGPNGLLVYQGKGKFAIRPDKKSSPVIKTVKSVGMIAGGTGITPMLQVIRAIMKDPDDHTVCHLLFANQTEKDILLRPELEELRNEHSARFKLWYTVDRAPEAWDYSQGFVNEEMIRDHLPPPEEEPLVLMCGPPPMIQYACLPNLERVGHPKERCFAF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NADH-cytochrome b5 reductase 3
molecule tags Oxidoreductase
source organism Sus scrofa
publication title Distribution of valence electrons of the flavin cofactor in NADH-cytochrome b5 reductase.
pubmed doi rcsb
total genus 75
structure length 272
sequence length 272
ec nomenclature ec 1.6.2.2: Cytochrome-b5 reductase.
pdb deposition date 2016-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
A PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 5gv7A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 5gv7A02
1ZUNB 2BM1A 3WBKA 1KD1D 4YHBA 1FNBA 3FPKA 5H59A 2OTLB 4Y7CA 4ZCLA 3JQRA 1VQ5B 1IB0A 3FJOA 2YWFA 3I1FA 2VYQA 2BSAA 2B7BA 3ES9A 1D8TA 3WBJA 1CNFA 4YAOA 1E62A 2XNCA 4RCYA 4EH1A 3OJXA 3QFRA 1VQKB 1VQ9B 4P3YA 4RD0A 4IW3B 5EMNA 4RD3A 1QX4A 1GO2A 2DETA 3CCMB 1FDRA 3E1YE 3SJZA 3VNUA 2GQFA 4G1BA 1IJFA 3VO1A 3WNCA 3JQPA 4ACBA 5GV7A 2EIXA 1FNMA 3QSYA 4F7DA 1YI2B 2E1RA 1JB9A 4B48A 1VQOB 3VO2A 4LC0A 3W5UA 2BN4A 4PC3A 1A8PA 4PGOA 2VNKA 2PIAA 4TMTA 1VQNB 1N8RD 4ZGNB 1BX1A 1BX0A 1ZM4A 3CMAB 2HCJB 3ZZUA 4AF6A 1KQSB 1HA3A 4DQLA 1YJ9B 2CNDA 4FK8A 3OJWA 1YITB 2QTLA 4Y9RA 5HXBA 2AHOA 1FNCA 1JA1A 3AVUA 3OZUA 2C77A 2PLFA 1J9ZA 1GJRA 3CCUB 4J0QA 2YWHA 1UMKA 4RD6A 5THXA 5KSWB 1R5NA 1GR1A 1ZM9A 1H42A 4TMZA 4K1XA 1R5OA 4LBYA 2BGJA 4AC9A 1EP3B 2NPFA 1WDTA 1E63A 3WNBA 3WYAA 1QUEA 4N3GA 1BJKA 2EFGA 1Q82D 2D74A 4FN5A 1ELOA 1G7SA 3LO8A 4B43A 1EP2B 2BPOA 3CCEB 2DERA 1OGIA 4YAUA 3B82A 4YAWA 2QN6A 3P26A 4Y9UA 3LYUA 1H85A 5TR9A 1K73D 3G4SB 4WQMA 2HMAA 1VQ8B 1BQEA 4RD4A 4M0LA 2RC6A 4ZGQB 1EFCA 3CCRB 1QFJA 2BMWA 3VMFA 2BGIA 4Q7JB 1YJNB 1KK1A 3G71B 4ZV4A 1DARA 3E20A 2VNHA 1XB2A 1QVGB 3MMPA 1KRHA 2QDXA 3PENA 3U6BA 1AIPA 1OB5A 3CMEB 1G7CA 1KK2A 1KK3A 4BPRA 4RJLA 3W2FA 3CPWB 3I56B 1EWYA 4ACAA 1W34A 4TMWA 2R6HA 4TMVA 3B8HA 4PC2A 1QFZA 5AN9A 4G1VA 3LVBA 1KJZA 4DQKA 3W2HA 3U6KA 1KK0A 1W2BB 3AVVA 1XE1A 1U2RA 1QH0A 2DY1A 2OK7A 1DDGA 2QTZA 1YIJB 3AVWA 1JA0A 1SKQA 4B44A 2GPJA 3WXMA 4ZCIA 3V76A 4ZCMA 1ZM2A 4NCNA 1FRQA 4C43A 3AVXA 4FWTA 4B47A 2B7CA 3AVYA 3CCVB 2XNJA 4RCZA 4B4DA 1TVCA 4YAFA 1KTVA 3MHPA 5DSZA 3U2QA 4P6VF 3AGQA 1YJWB 3W5VA 1E64A 3CRZA 1K9MD 3CCLB 4C0SA 3W5HA 3WNDA 2XEXA 1QG0A 4QHYA 1VQPB 1W35A 4LBVA 3CW2A 2QMUA 4M2LA 3ZBUA 3CCSB 1VQ7B 1OGJA 2RC5A 4M1KA 1JJ2B 1CQXA 3QFTA 1QFYA 1AMOA 1G7TA 3I55B 4MYTA 1GVHA 3JQQA 4B3XA 3VNVA 1VQ4B 4H9GA 4HE6A 1W87A 3CD6B 1F20A 2J7KA 4YALA 1EFTA 1JNYA 1ZM3A 1I7PA 2YWEA 3QFSA 4UAJA 3A1FA 4M53A 4U9UA 1F60A 1CNEA 3CCJB 1G7RA 3CC7B 3LRXA 1YHQB 1QGAA 3QE2A 5GV8A 2BM0A 4PC7A 3ZZ0A 2C78A 2VZLA 2OTJB 1NJID 5TV2A 4MYUA 3OW2B 1M1KD 3ZZTA 4G5GA 5H5JA 1FRNA 1QVFB 3B78A 3CB4A 1TUIA 1FNDA 3CCQB 1Q81D 4TN1A 2QEXB 1QUFA 2VNJA 4N3NA 5TY0A 5FA6A 3AGPA 4M4SA 1R5BA 3CC2B 1VQMB 4RD2A 4AF7A 1IJEA 1Q7YD 1K8AD 3OZWA 3CXCB 1GAWA 1TLLA 4PC1A 5JBQA 3QFCA 3AVTA 1S0UA 1D1NA 4R71A 2X3UA 1B23P 2PMDA 2CRVA 3ZBTA 2BF4A 4LBWA 1VQ6B 2FX3A 1OB2A 3J81k 1SM4A 3CC4B 1Q86D 4PC6A 3W2EA 3W2IA 1DG1G 3MCAA 1QGYA 2YWGA 1D2EA 4TMXA 3WY9A 4NBSA 3G6EB 2B5OA 2QA4B 2OK8A 1GAQA 2BV3A 3P27A 2VNIA 1M90D 1EXMA 4LBZA 3OZVA 1N0UA 3ZC3A 1DDIA 1VQLB 2BVNA 2DEUA 1KC8D 1EP1B 2HDNB 2ZITA 4QFMA 1TTTA 1B2RA 2DCUA 1EFUA 4HE5A 1QGZA 1NDHA 1S72B 1N0VC 3W2GA 4RD1A
chains in the Genus database with same CATH superfamily
2WU0A 4FXUA 1LX7A 1RMYA 1L5OA 5D6OA 2IS4A 4J76A 2BFEA 4OP3A 3VO8A 4I0WB 2GCEA 1PNQA 1JJAA 1LBTA 1TGVA 5AW8A 3FPKA 1DAGA 2VBIA 3AL3A 1GITA 1AVTA 3SJ7A 3NWPA 3KWJA 4C4SA 3N8KA 4BEJA 1C2YA 1E2IA 2FJPA 5DTJA 5DYIA 3HFRA 3F98A 3TTUA 5TPWA 2ZJ2A 4TKLA 4EENA 1G8MA 3WGIA 4NXNB 3HVRA 3ZYCA 2O6HA 2HY7A 2J08A 5H83A 2C4UA 5EJGA 2J4CA 1AKEA 5GPBA 4DLNA 4Q1VA 4TPKA 1UMCB 3MTQA 4INZA 5BW8A 1F8GA 1LI5A 3EXAA 3IR7A 2IDJA 1U9YA 2G36A 3GOQA 4F5YA 2ZVQX 4GM4A 1C7JA 4PQGA 4KFCA 4OX9B 4XVUA 2GZMA 4YAOA 1IXKA 4XB1A 1Y4UA 5FQNA 3LUPA 1ZGGA 3LOPA 3ML1A 3PJFA 4OBBA 4US0R 3PA1A 3LY8A 4Y6GB 4YP0A 2VAMA 4RCYA 2I8CA 2CLCX 1VLJA 1DS6A 1YOVA 3GPDG 3LWDA 4FYMA 3KWMA 1NVGA 4K81B 5CFNA 3PR1A 3VZSA 4EJMA 4HQLA 4LV5B 3SVZA 4RD3A 3HABA 3Q7EA 3MVEA 2J48A 2J07A 1D1SA 1K66A 4AW9A 5A06A 1MW8X 2IH5A 1YQQA 2H1OA 3WXBA 2VRCA 3OQ6A 3U39A 5KU7A 1F8UA 2I2XB 2WA2A 1XX6A 2RGNC 4URHA 1JMVA 4JBWA 2W6JD 4UZUA 2OESA 2Q6OA 3V1YA 1ZCFA 4H3HB 3X1WA 1POWA 3VZCA 2W48A 3ZQKA 2IH4A 4MV4A 4N3BA 2JIZD 1Y3HA 2X9NA 4ACBA 5GV7A 2WDZA 3JALA 2VHVA 3GZNB 4N9QA 5D5HA 3EBLA 4IDQA 1EINA 2ZRQA 4MINA 4MP6A 1WV0A 3SC2B 1O0BA 1TTPB 4IEFB 4KIJA 2C20A 1WZ2A 2IY8A 1B73A 1QQ5A 5GONF 5F35A 5JPDA 1Y1LA 3KJZA 4RVGA 4XIGS 5EXXA 3AMVA 1ES9A 3HV2A 4OMFG 1E2MA 2NU7B 3FPHA 1BW9A 2YS7A 3I9OA 4OHBA 3RFVA 1J22A 5TSDA 3AFNA 5I9TA 3UAOA 3B9BA 1IQ0A 1Q74A 3QXHA 4V3CA 1XD9A 3LS2A 3DLHA 3C3EA 1ANKA 1ZLXA 4V2IA 5FBHA 5INTA 2CMKA 2ZULA 1M2VA 1W88A 3KAJA 4REOA 2QSUA 5EJ8A 1N5IA 3MMNA 3K0CA 4YO8A 2OM6A 2R68A 5IYPA 3ZZUA 3B8EA 4BZZA 1J2YA 4DLWA 4RH0A 4AXXA 2O0JA 4Y98A 1FW8A 1Z9BA 2HMSA 2LVBA 2I76A 2I4IA 3OKXA 1L8OA 4QDJA 4QDKA 4YJGA 4DAEA 2OP0A 5K0NA 4BO3A 4GP7A 5BRJA 4PS1A 4ZVLA 4EMTA 1GTSA 1I4DD 5HE8A 5FDFA 3SIPA 4ATNA 4X61A 5C8YA 2QZ4A 1PL0A 2CLFB 3HKBA 3OQPA 4F93B 1H9BA 1VI6A 3EEIA 3KPYA 1DKOA 1KU6A 4H7IA 5B12A 4GR4A 3NVKI 2G0TA 3LXRA 1NR7A 3V33A 2WYOA 2ZL5A 1E1CB 1O6GA 3AVUA 1TLTA 4R31A 4BP8A 4IKEA 4RC9A 2CVOA 4RDLA 3BIFA 3OPYA 4DXHA 4ZN6A 4YY3B 4N76A 1XZQA 5IP5A 3L8GA 3UNXA 2ROQA 3HWRA 3G8CA 2OBFA 3ISJA 1G8AA 3RROA 4R2KA 4D92A 2O7QA 4LUCA 5IYZB 1YKSA 3OHPA 1Q0UA 3C3JA 3A3YA 4MEAA 3SFVA 3L7IA 1OUMA 5EE5B 3VPFA 1TA0A 2IUEA 4DQXA 2DH6A 2V4DA 1L3BA 1HR0B 1AS3A 4X6XA 5IT4A 1V1RA 4LPKA 3ROXA 2WRZA 2JJ1A 1GQQA 1YR3A 2PKWA 2XDWA 3ZH2A 3T7IA 4E32A 4EARA 4N5DA 4PO1A 2GM4A 1H1LA 5CXUA 2QNRA 3A2MA 1UFQA 2P4UA 2ZI3A 2ZR8A 3VU1A 2AXEA 1UR5A 4R69A 3V6MA 4TTPA 2X6YA 4AC9A 1G1AA 5J5CA 2Y1LA 3I2GA 1N3YA 3SE7A 2A5JA 5J4HA 4TLLB 2WTNA 5CTJA 3X1ZA 4EUFA 1Y98A 3OZXA 1EFAA 2CYCA 1AZLA 4UBOA 4ZTZB 4XAQA 1UJ6A 1VKNA 2AK2A 3OA0A 2O1WA 3CUSA 3HPQA 2HUNA 3PUZA 1QZUA 2Y9MB 4RQBA 4OHZA 1MG5A 2AQ8A 2J30A 2PGAA 5IM5A 1G7SA 2AF3C 3TM5A 4WVFA 4CLRA 3WGNA 3ZDCA 4FT2A 2G67A 4KGVA 1OYWA 2N42A 2QTGA 3P8ZA 4YCJA 2AZMA 3TG2A 5B4TA 1N2XA 1BWQA 4G9GA 2N0SA 2VJCA 3B5JA 1MFPA 2H7XA 3JASB 1H0RA 4HB0A 2BP7B 1CU1A 2GN8A 4HDOB 3LYHA 1H3FA 3KEQA 3KZOA 4LXIA 4D26A 2NNLD 1TEXA 1OH5A 3PFFA 3K0FA 1X7ZB 2ODBA 4CEJB 4G2TA 4QPCA 1YB6A 4L27A 1WVMA 4Z7OB 4YIHA 5LA6F 3D9QX 5E8RA 5EJIA 4LWOA 3C4QA 1PWZA 1U0EA 1VXOA 2A1IA 1VQ8B 1RVDA 2GFIA 1LVHA 5KYNA 4AJ1A 1D04A 1K3TA 2GT1A 4Z1MA 1VKHA 4ZGQB 1XMSA 1E0KA 1IATA 1UDRA 2H65A 3ELDA 3HBJA 5A9SB 2ZTVA 4L74A 5IXYA 3N2NA 3WIUA 2BGIA 4EB6B 3C41J 3PNYA 1EFRD 3B2NA 2H06A 2QRGA 3EF3A 3WLPA 4D0NA 1PFQA 2ODWA 2LNDA 5ICCA 5IFKA 1A2QA 2Q28A 3MTBA 4RSMA 3TTYA 4CM3A 3ROFA 3WDKA 4MVJG 4HL6A 2IF0A 3M9WA 1Z73A 5H02A 1U0TA 1QOQB 3C5CA 4TKUA 3IXLA 4AMUA 1A1VA 1NXPA 2A5GA 3NTQA 2O3JA 3DTVA 3OX3A 4JT8A 1KS9A 4NOMA 5E6UA 4C0JA 2ZIAA 1IHOA 4V0SA 2GM9A 5BY2A 5DNYB 3CMEB 2C3OA 2QVLA 1CY0A 3CEJA 5AYVA 5TEVA 3KB6A 3SXUB 2XY4A 2SECE 4HVCA 3QE9Y 2VWHA 2V7PA 3PFBA 4CL8A 3I56B 4PY2A 3UV6A 1MENA 3LBAA 4JH0A 1U8CB 3PEVA 3N8GA 4M60A 3B53X 1P7YA 1LEHA 2R6HA 3FUVA 2HJGA 2ONJA 3B8HA 5J2TA 4MGHA 2NVUB 2GYYA 1LH0A 4J0DA 2JI6A 4N1AA 1ECJA 3JCZA 3GGPA 2ZB2A 3BWBA 5EIWA 1P9OA 1PLKA 3I9V1 3W2TA 3T6KA 1CZNA 3U4DA 4MWBA 2VBGA 1KEPA 3G1WA 2XGJA 3ELUA 4G89A 5FOTA 2ZRJA 2WYRA 1IONA 2VSOA 4XR9A 1GZDA 4P2NA 1LNZA 1UC4B 1XCJA 2CUZA 2ZDGA 3PKIA 1ARZA 3C8MA 1U2RA 1J0XO 1Z18A 2DVMA 3HXLA 2NO6A 1CUXA 1IPFA 4WDRA 2WTBA 4BZPA 4Q01A 1NPDA 1U1EA 4EHIA 3QX8A 4RS4A 3VAAA 2GN4A 2ESRA 1S8FA 1NAIA 1QJCA 1EX9A 3D6HA 1KSJA 1M0SA 1CS4C 4CPDA 4GQBA 1V11A 3HA2A 1ACMA 4AZ0A 4ECEA 4PG8A 2XB4A 4JX9A 4ZGGA 4OUDB 1MDFA 5FTKA 4K9LA 2HSJA 4R0NA 3JD3A 3F8TA 1Z7YA 1ZM2A 4U0JA 3NTVA 3MGCA 2BUBA 4NARA 4QDZA 2AG6A 2Y8EA 1WUHS 3IS3A 4GT1A 2F8LA 4MA4A 4CL2A 1KEKA 2BI8A 2D0PB 3JVEA 4ZZ3A 3A8IA 3OJEA 4P33A 4Q4AA 4WZAB 1U7WA 5ALJA 4FINA 3ZDQA 2PGJA 3HMKA 3AF1A 3PZBA 1AS2A 3JQ7B 3KYJB 3LDHA 4UCQA 4UQLA 3G5LA 1RRCA 1T9GR 2FWJA 4G0YA 2WJHA 3WK5A 3H16A 3VHQA 4W6ZA 3OQJA 3VC2A 3GUUA 2WFMA 3V8VA 4M1WA 2E85A 4WESA 1UL1X 1ZO8A 3FTPA 4H31A 3UV3A 1Z16A 2Y6VA 3RAEC 2AG8A 2WUDA 4CDGA 3FYUB 3KFXA 4D57A 2W71A 3D5TA 4ZVPA 1EFHA 4JA0A 3OPOA 1JKFA 3JQ8B 4XJXA 4ZQIA 4DA8A 5K05A 5MGBA 1CQIB 3AJ8A 3M6AA 3P9KA 5K8IA 3AG6A 3UB2A 5AHXA 3HGMA 3SJPA 2WBLC 1WUIS 4EB8A 3O94A 2ODEA 3K9HA 3LBIA 3TXAA 1R6XA 4PFKA 4WBNB 3RKUA 1F51E 2J7PA 4EABA 3AFIA 3H5TA 3ROGA 4ZEWA 3TS1A 4XKVA 121PA 4ERXA 5F2KA 3I92A 1P7ZA 4NQRA 2D9RA 1G8HA 3G8DA 2K7FA 1IY8A 5F77A 3DM9B 3PGVA 4K40A 3ICOA 1YC5A 1JF8A 2CLOB 4LZZA 2HSZA 3ZU4A 5K0CA 4F7WA 1LSOA 4JCOA 1U5CA 3LKBA 1ZCBA 1R5JA 3COPA 1MO6A 4XM2A 2G5TA 2O4CA 3GFFA 3W9UA 1NZDA 2ZZKA 4E09A 5C32A 3NGLA 1GZ3A 1QGED 2I54A 2JANA 2PAAA 3E35A 4XLEA 2G9UA 4GDMA 4AJOA 3I55B 2PS3A 4L2IA 3MUFA 4NOKA 3B3QA 4X92A 2FWAA 2YFKA 4KLAA 4DAOA 1TA9A 2CZCA 2VI5A 2XUHA 3GJ0A 4HDNB 2CHFA 4LHWA 4BBZA 5C5CA 4IUCS 2O8DB 4EX6A 3A2LA 2M6SA 1F20A 1YR1A 2GTHA 2WWXA 3AG5A 2G63A 2PKEA 4B34A 1SCUB 2BHTA 2BTOA 2ZRCA 1JH8A 2YCLA 3HSYA 4WW0A 1XDGA 2WZPP 1GZ4A 3I6YA 4OLFA 1WR8A 3OZFA 4GBMA 4I1SA 3L0DA 3W4IA 4A1FA 1ZD4A 2BJVA 4I50B 4C7XA 1T1JA 4FHZA 1RCFA 4WFKA 3ETCA 4RM0A 3UV7A 4RXMA 3UB4A 3O7WA 3UTDA 4CEJA 2W6CX 3QTBA 2BEUB 1GFWA 2FZGA 2GX6A 1X38A 2XHEA 5YASA 2PL5A 3HRHA 5F64A 5BWBA 3MELA 1GPH1 3EIQA 4GR5A 1KEEB 4B76A 1JLSA 2A9OA 3O6VA 2C78A 4NHEA 4WGFA 4HYTA 1DWPA 1ZRSA 4O59O 4A2PA 1C3EA 3GLKA 3T52A 4GVPA 1WQ3A 2VJDA 5AI6A 4QYMA 1N3LA 2R6JA 4YWJA 4JVLA 2ZI7A 5CDTA 3PRYA 6REQA 5KX5F 2UVPB 1UT8A 2J6IA 2OHHA 1ECGA 3H17A 1YBVA 3BS4A 3DDSA 3ANLA 3MWLA 5ALZA 2P7IA 4ROSA 3S7ZA 2VS1A 3I6BA 4HOYA 4YLGA 1ZP6A 3UK6A 1TPZA 1ODLA 4CLHA 3L01A 5DLEA 3DV0A 3U37A 1NG1A 3BRQA 3AFHA 1NJ1A 1GNVA 1I14A 1NA5A 3AEQB 4Y9TA 1RQRA 4NNPA 4A8JC 1QCZA 2XSZD 2HWWA 5K03A 3B5EA 4G97A 2ZJ5A 1JHXA 3LPLA 2VUSA 3G9QA 4L4SA 4I4TA 1XRPA 4LJRA 3T9EA 2A6PA 5KSYA 2DHCA 4MWEA 2Q50A 1B3BA 4L8VA 1BMFA 4MQFB 4DIFA 5BR7A 4C6SA 1T0JB 1UD8A 2CYAA 4BO0A 4PBRA 1SQGA 2Q99A 2XKBA 1YVDA 4GMDA 1M2OB 4KYVA 5D5QA 3QVGB 5IJ9B 3CX6A 4UZSA 3ZD6A 2AZXA 1JJBA 1C9JA 3PG5A 5ELMA 4B46A 5IS2A 3FHOA 1VQ1A 5G41A 4EHNA 1E1MA 1XT6A 4HX2A 3L9WA 4LA4A 4UOZA 2ZJBA 4DGQA 3TUZC 3TE6A 3ZD9A 3FYUA 4PVCA 1Z5PA 4EG4A 2YFHA 2OBBA 4BFZA 5FUMA 2JGNA 2JBHA 1DHRA 1R0CA 2EFEB 3F90A 4G1CA 4OSEA 5GZ3A 1IDOA 1E8MA 3IPXA 1FVFA 1LVGA 2XE7A 3H0EA 1NF2A 3EPHA 1MJHA 3KPWA 3VYTB 3EC2A 2ERYA 4L6AA 4Y30A 4E3ZA 3KDSE 2NZVG 2W22A 3ZEAA 1SCDA 1P91A 1LFAA 2EJCA 3FF1A 5KOHB 3OZEA 3T3GA 2UXCB 2WSBA 1S2GA 2XB8A 2W58A 1BGVA 3CF0A 4I9FA 4A26A 2DT8A 1VF7A 4ZOEA 4CKWB 1V6SA 5GONB 2YMQA 2Q8PA 4UUQA 1XF1A 4HB3A 1FDVA 3DGFC 2DOGA 3CF6R 4QPPA 4XGIA 1C81A 6GPBA 2RK4A 4TYMA 1DRKA 4JB2A 4ZHQB 1T36B 2BVNA 3H3JA 3LK6A 5CA1A 1Z33A 2R6ZA 3G85A 1YI0A 5DOZA 1NW7A 4F6LA 1RIFA 2H5EA 2J6CA 2ZSFA 4HKTA 1VLOA 4I5FA 4RA6B 2PSDA 1EGHA 1OXBB 2PE3A 5IAAA 4KB5A 5IKXA 2WR8A 1XC7A 2I3DA 2RHRA 3KBBA 3B13B 4ZI7A 2WV7A 4C4XA 1EUYA 4Q4LA 3T3PB 2VPZA 5EUCA 2DQZA 3WIBA 1AM4D 3W90A 5BV2P 1TJNA 1TKBA 1R0WA 3PTLA 3LU1A 5TQJA 3DR3A 3LX4A 3RUEA 1QHNA 3A8TA 4MQ4A 2C2KA 3PSAA 5IDYA 5CCXA 2DTDA 2AI1A 4HX5A 1FRFS 3J7AC 1UBHS 1G4HA 1WMEA 3HXPA 3HKDA 1HK7A 4URFA 2M2IA 1IK6A 1RJ9B 2C1EA 1KNQA 2H1LA 3OAAD 3QKRA 4PLFA 2EKPA 4PFQA 4KQCA 1L1EA 4YYEA 4PLTA 2ATIA 2QMEA 4QNMA 2TYSB 2BUAA 2ZWVA 3CTAA 4Y7CA 1TO1E 1YE3A 5CNMA 5J5VA 4FB4A 4CM4A 3H9EO 3HMQA 1MOSA 1ABBA 5CIYA 4UFNA 3QLUC 2P1RA 5K3FA 1YA4A 4TMKA 4R8MA 2CLIB 3WQBA 2ZCUA 3TEFA 1UPFA 4QXAA 3OOCA 1PS9A 3FLMA 4NJMB 3BTSA 5B3KA 4QX6A 3IQHX 2W6MA 2V7VA 5AXCA 4FMDB 3FA2A 4CG0A 5BN5A 3NM6B 1P1FA 1RWQA 4DNFA 3N53A 5EIEA 1U3FA 5U1PA 1W581 3AHJA 3M2PA 1DKMA 1HDRA 2QP3A 4X8OA 1AQUA 2XZTA 1DC5A 3PGKA 3RAFC 3ERCA 4AT1A 1CRLA 1G8FA 4FW8A 4IW3B 3G2KA 2JFUA 3I9KA 3DZDA 3GEBA 3CC8A 4DWJA 2OBSA 3JYLA 3P2IA 2W9XA 4IWXA 4DCMA 1W0JD 1X86B 2M9MA 4J7XA 1W0KD 4L7QA 3GEDA 1DBQA 1JPVA 1DTSA 3MGBA 1SUIA 4JLPA 1GQOA 3ETJA 3OTIA 4MP8A 5K3CA 5JASA 3RM3A 1MVOA 1HEYA 2WMDA 1UXOA 2AH5A 2ZT6A 1XCGB 3TRIA 3U16A 2F3UA 4MP3A 5CVDA 4O5OA 3T9DA 1HT1E 1RABA 1ZWKA 3IEPA 4KODA 2R00C 4L22A 1RYHA 3C3DA 3MTIA 1PYGA 3OCZA 3TL6A 3AX6A 2FKNA 4UEQA 5EE9A 2O14A 4CM8B 3H0CA 5EPOA 2QTTA 3CNBA 3QQPA 2ZTMA 1JB9A 2VYVA 2GLUA 3JVDA 3C39A 5JHHB 5KWEA 4NTZA 3AOGA 4CT4B 2DBYA 4KE9A 3V8QA 2QGZA 4M1TA 4AUMA 4GLBA 5I7FA 3DT6A 1II8A 2ZS7A 5HWSA 4DN6A 5K8CA 1QTIA 2WFZA 3BXHA 4M1ZA 4UHFA 4QUDA 5JDCA 3P52A 4RHEA 1Z4MA 1M6YA 2J3QA 4QYWA 3CEMA 3OLWA 1SXHA 1QU2A 1UDWA 5EKTA 3SSMA 3CO0S 4YJ3A 4UC0A 3JZAA 3K3PA 1SO8A 3OMLA 1AXEA 2RHDA 4IINA 3WWDA 4E5VA 1EFVB 4YO7A 4HY3A 1YA8A 1ULAA 5BN3A 4NULA 2R8OA 1F2TA 3RVJA 2YVLA 4M7PA 2IZ6A 4EFDA 4N65A 2HA5A 3FYUC 3K92A 3N59A 5H3LA 3GJ7A 4DRXA 2I4MA 4JUCA 4ENUA 2WQ7A 4PCUA 3UT0A 4Z3DA 4AMZA 3NETA 3U0BA 1M1NA 1M1NB 2VJNA 4DA7A 3PQ5A 4JLVA 1UDXA 4EVQA 4UM9B 1K4YA 4AZ0B 5B57C 4MV0A 1P18A 3CN9A 3I1JA 4QREA 5D5PA 2QVYX 5CX4A 4UPEA 3ID6C 1M73E 4NCJA 4UEJA 4XQGA 1IBLB 3KB2A 1QDUA 5KOHA 1W85B 2Z83A 4TRMA 4NPHA 4MGKR 5DRTA 2Z3VA 4JNKA 1H2EA 1E2PA 4J0QA 1HMYA 1ML4A 1NBME 1KPHA 4FZ5A 4MJLA 4RETA 3RS9A 1DP4A 5FWDA 3UA3A 1P74A 1PW7A 2GNAA 3RSQA 4EJ0A 4ABYA 1XZHA 3GP3A 3MSXA 2UYYA 5LZ8A 3COJA 1TIKA 3UFXA 2HK8A 4MXDA 5KVVA 3C6YA 3TH5A 1BRTA 1CZOA 2JAWA 4URXR 1QNFA 1ZNWA 4ZQFA 3OCXA 1G41A 4M7WA 4C30A 1NX9A 1VDMA 4WOKA 3ETLA 3N2GA 2OAEA 5ER6A 5HG0A 2AX4A 1E7QA 3JR3A 5COBA 5C51B 2AFVA 2WD7A 2ZJ8A 3HDGA 4JMPA 4D99A 4WD3A 3D0OA 1HLFA 2YUIA 4UDXX 4YR9A 4EKEA 2P5UA 3R0XA 4N82A 2XX3A 4LJ7A 4L3OA 4MWSA 4KQFA 1XALA 1H1DA 1V3VA 1H4TA 1T1EA 3HR8A 1MB4A 4X05A 1JPJA 5JQGF 3M1IA 2R6GA 1UMBA 1T9BA 3QEMA 4PYIA 2C5GA 1QRSA 3COSA 2PMEA 2Q0XA 1U3WA 3NW9A 3O8BA 2WJZB 1ELOA 3TTXA 4PS0A 2E48A 3VR3D 4D82A 3U1BA 2BEWA 4U02A 1M1XB 2P8SA 2G1KA 1Q5PA 4RAOA 3JAKB 4M0EA 5ETJA 1HETA 1ZNYA 3CCEB 4K5QA 3JQ9A 5EXEA 3X44A 5BQXA 1XQBA 4AN1A 3AEYA 1JHZA 4Z0HO 4BLWA 4D9IA 2GCOB 2QJTA 5JHGB 4Q7MB 3THYB 4XPIA 3K9CA 2B4KA 3V1UA 1P7WA 1CKEA 2W2OA 2HSDA 4KAJA 5DLDA 5EHGA 3VJLA 2FRDA 5EJAA 4BFVA 1P2GA 2GN6A 4BO9A 3TAHA 3VNBA 3FR7A 2WNIA 2AJTA 3BWCA 5HMMA 4I3FA 3SXJA 4BB0A 1BQEA 4EM6A 4S0XA 2HEIA 2R60A 2IQIA 4C7KA 4IXTA 1MRSA 1U0SY 1NVTA 1KORA 3IO3A 2FMHA 3I53A 2JRLA 3GBSA 3QX7A 4ZU6X 3WLAA 3WGKA 2FWPA 2P6MA 2WA1A 3ESDA 2ZTSA 4IUDS 4ND7A 4H7KA 4HLUC 4OQMA 3NHJA 3UXMA 4F04A 1W19A 2PT6A 1UIMA 2W43A 3C1UA 4J43A 5ENVA 1EDBA 2WU4A 3FOZA 1G8SA 2W2MA 3WK7A 1H22A 2Y0BA 2WJ6A 1AIPA 3GPCA 4Y2XA 3KXDA 5JDIC 3ADDA 3OLQA 1JQBA 1Y7TA 3G5TA 4KR6A 3H42B 6NULA 3ETNA 2RAVA 1VE1A 3JXEA 4JI2B 1T35A 1QE3A 1ZXBA 2R5WA 5BSUA 1Y3IA 4XD7D 1QG2A 2ZYRA 1N2SA 1MMFB 1GNLA 1KH2A 1SXJB 3EVFA 1NJSA 3H2IA 4MW7A 2FPUA 1CJUC 1EWQA 4BC0A 4HCJA 4URWR 2X8AA 3ZY2A 2J5RA 1XVLA 1Z0DA 4TV8F 4XH9B 4Y18A 1V8FA 1YS1X 2Q2VA 3HL4A 4L2IB 3WWCA 2NV0A 1O3YA 1R8XA 2IXGA 3DCIA 3KTDA 1VHEA 3L8DA 4TTVA 2GRJA 4BAUA 2BYTA 3ZVLA 1CUHA 3DS8A 1DIGA 2JH3A 3RIXA 4XUDA 4EB3A 3L77A 4DC9A 3W2HA 2ECKA 1O57A 3E8XA 3QYFA 5IBPA 1U80A 4KOAA 5BSYA 3LX5A 4HAIA 3RK4A 2J5BA 5I6DA 3RW9A 1LU9A 2F3RA 1DPGA 2IYOA 3G68A 5JZOA 3SAJA 3I6MA 5A88A 3WFJA 3GB9A 1MFZA 1BPLA 3RT7A 4EHHA 3JD2A 4HJXA 4GI2A 1DDGA 1A4RA 5ICMA 3EUFA 4LYAA 3U17A 2OHGA 1CY1A 4J0HA 3PTZA 4KR7A 1I36A 1L7OA 4N6OA 3EC1A 3ER6A 3O8QA 4LMBA 4F91B 1LK0A 4HFJA 4QA9A 2B4YA 4DVGA 4KXNA 1NQUA 1XN4A 2CLEB 2VIIA 1A9OA 2XQGA 4YCAA 5EGNA 5FULA 4YV0A 5KHOC 5EESA 4AJLA 4NCNA 2PSHA 2O8EA 2GZRA 5C53B 2CN1A 2NV6A 5EA2A 3QU2A 4AY3A 1PR4A 4TLCA 4GI5A 4F11A 2EJTA 3CUKA 4GOLD 3DUFB 1I3OA 2XGGA 4B4DA 1Z2AA 1IXRC 1MIOB 2DGDA 3L04A 3O8OB 3SSAA 3PI6A 1Z56C 3B3FA 2UXBB 2JFVA 3ASVA 1OH6A 3KSDO 1EJ6A 2X85A 1YAHA 2QQ0A 1QHIA 2GUWA 2WHXA 3I8XA 4K87A 4KO1S 2KM1A 4P6VF 1E9RA 2BF7A 4G1UC 1VL8A 4I5GA 4S2EA 5EHQA 3ZR4B 2CB0A 2FG7C 4KIUA 4WAUA 3QHAA 1GGHA 4RNCA 2J31A 4CR8A 4TTQA 2J1LA 2RH5A 3KUKA 2J6HA 4P34A 4DLSA 2GHQA 1E64A 1T9HA 3HHEA 5BP7A 2L0XA 2ZYWX 4YAIA 5ICSA 3OESA 3N7AA 2ZZGA 1RJWA 2B98A 4QPZA 2VF4X 3EOBI 5ER9A 1O9BA 5SZKB 3D3WB 4B2YA 5CFMA 1QG0A 3GJRA 4R40A 3ASZA 5DWQA 4ZV7A 1VDZA 4CLEA 4XDZA 1N7GA 1IEXA 4IFEA 2QTAA 1FUIA 1X7WB 2VDVE 2ZBRA 4IGAA 2M5SA 1HOXA 2GDJA 1LF5A 1WPQA 2Q1WA 1DJQA 3DDWA 4FOSA 3ZBUA 3HKEA 5BPHA 1OGJA 1N2CB 2J5KA 1JJ2B 2P2DA 5L7YA 3PFCA 1PR3A 1PJ3A 5EFZA 4XYEA 4UDNA 3SZMA 1C3OB 4JSRA 3CLSD 4J1TA 5EIOA 1JEAA 5J1TB 3R7AA 4HF7A 1Y8ZA 3WNQA 5CXQA 4Z3OA 4TLAA 4FR0A 4KDCA 3NPAA 1E0JA 4JUIA 3PZRA 3Q7IA 4DARA 4PAAA 1LBHA 1JI0A 1RU3A 2UZ1B 4ECAA 4PZAA 3UJNA 1Y9ZA 2I6XA 2IC5A 3SS7X 4YFYA 1TYDE 1XKLA 4RFVA 5IAJA 1KWKA 1ZK4A 3O9ZA 3DEKA 1E9CA 3AM5A 3PC2A 4NBVA 2ZIXB 3K0HA 4O5AA 4GUAA 4AUEA 3CCJB 4LHVA 3R7BA 2Q7DA 8AT1A 4XA8A 5DCLA 1MGOA 3KEOA 3MOGA 4H59A 5EJ7A 4ALLA 3BQNB 4CMHA 3F8WA 1Y1SA 3ZQJA 3QNWA 1FFDA 2FZLA 3FZEA 5DULA 1FUYB 4YXFA 3COVA 3FVRA 3KFVA 1QOPB 1J4AA 4M1SA 5IC5A 4R1OA 1E3MA 2F2TA 2I67A 1L4FA 5FLXA 5KINB 4BU0A 2Q2NA 5EJ9A 4H1UA 4WI1A 2IHZA 2KLHA 1P5FA 2OV4A 3GU3A 4HNUA 2IUTA 1ODJA 3SQMA 5ESDA 3BMCB 3D0QA 3IDZA 3H6HA 2ZCJA 2GEVA 2O2DA 2I4TA 1EGMB 3LCCA 2I8AA 1XMQB 1Y7HA 1T43A 1M6NA 1SVOA 3DTYA 3DONA 2QAIA 1C8LA 2X58A 3AB7A 2OO3A 4ZIRA 5F5NA 4E4RA 2E89A 2I8LA 3H18A 2POQX 2ZVDA 1JFFB 3GA0A 1FRZA 1XKTA 1VG1A 1VL1A 1U8XX 3IAEA 3LG2A 3R6GA 3PVDA 4HGPA 5AKHA 3WHIA 3WLSA 2CUKA 5BYAA 3RSHA 4ETNA 1Z68A 2VQDA 3GLHB 3IQXA 2X13A 3N76A 1NBEA 4HHEA 2QROA 4YRAA 2JGMA 2F90A 3F74A 3NTXA 4KX3A 4O4JB 3LBHA 2HJVA 1KAMA 1P4AA 5IBRA 8OHMA 1XWFA 4HZUB 3NORA 3N8HA 1W4AA 2JARA 3R09A 1L4LA 1IB6A 5ALWA 2JIQA 4HDSA 2CJFA 4OQLA 4RPLA 5DO9A 1G3UA 4D5GA 5AUQA 2UZ4A 1DAOA 2JKVA 2WTEA 1G59A 5AI4A 4XZ3A 3QFHA 1XCOA 5A1JA 4NENB 1JL3A 4F97A 2XYRA 3QFCA 2ICAA 3UMRA 3C3YA 1S0UA 4JR0A 3PEEA 1GTMA 1UEJA 1W25A 3KB1A 3OZ7A 2GNOA 3MUEA 1NI5A 3DO5A 3QUQA 5TQ0B 3WDLA 1B23P 1XBTA 1NI3A 2IF2A 1E6EA 1LQTA 5J4KA 2EFCB 5DBHX 1N07A 1Q19A 2Z8XA 5IN4A 2XE6A 2HDHA 3AETB 3F46A 3MGKA 5LIRA 3I58A 1P29A 4KKUA 5DHTA 3HH8A 3MIIA 4NYMQ 1V16A 1T8YA 2I7TA 2FX3A 1NBAA 3X1MA 3TIVA 1RWVA 3LUKA 4QNNA 4ADSG 4U7TB 4ALMA 4QTTB 1JW9B 5CDHA 1Q86D 2BR4A 4L95C 3RTAA 1DG1G 2FV8A 4I1YA 4G86A 3UZUA 3TLZA 1JG2A 4YRMA 1FMTA 1PFVA 3LWZA 3MJFA 4ETMA 1XRLA 1FX0A 1YZNA 3WL3A 3LD9A 1RXYA 2BTQA 3MAGA 4XDYA 3KOOA 3RT9A 3ZDZB 2O59A 2ODQA 3T3IA 4EKDA 1A3CA 1H66A 1VJTA 1G6OA 1Q7BA 1WXEA 3K0BA 4BX2A 1FYFA 4JGGA 1IHPA 5KW9A 1GAQA 2QLTA 4DV0B 4B3RB 5LD2B 5MHTA 3S68A 3LKVA 4REQA 5KX5B 4JR2A 1KYIA 1NXOA 2OV2A 2P2NA 2GSDA 2RCNA 5JWRA 3IBTA 5K0SA 1KI9A 1PKXA 4E5MA 4JU9A 3WGOA 4MEJA 5EQFA 1GDHA 2KHZA 1RRGA 1KC8D 5IJZA 3NNSA 5CX1A 1FLNA 4LXQA 5LNK6 3IDFA 4J7UA 1TQ4A 4YAJA 4C0HA 2I3BA 2Q2WA 1YRYE 4J0GA 3WIVA 1V8PA 3GJ5A 4KVAA 4LXYA 1ZMTA 2BZGA 4FOPA 3IUNA 1X1AA 2X5KO 1DKNA 4EY7A 5A1TA 2V5AA 4KUEA 4C1BA 3LFHA 3PE6A 1GRQA 1I8TA 3E05A 4JC8A 1ZGAA 1XZDA 2W11A 3HN7A 3Q39A 3KFLA 2CFOA 5IKPA 1TFRA 1O58A 2C7RA 1FP4B 1HI9A 1OFGA 3BREA 1YD7A 1W9HA 2JAHA 1WMFA 1E60A 3DNFA 3B3GA 3S1AB 1Q0PA 1C7IA 3ZKWA 1O87A 4DTCA 3UFBA 2CXXA 2V7QA 3O9MA 4WKNA 2ZJ1A 3DEHA 4NZMA 5BR4A 3WFZA 4R6WA 3M5WA 3PYLA 1FFXA 3ZWCA 3FGNA 2EZ4A 3GLTA 3S40A 1KIAA 1PJAA 2HRCA 4V2UA 5I8PA 1E4EA 1SU6A 4NYIR 2PY6A 6YASA 3CWCA 2JZCA 5AJUA 1TUGA 5T4EA 4TKZA 3EAQA 4UTVA 3VZPA 1TQ8A 4MDEA 2VYQA 2C2GA 2WP0A 4HQKA 5TMBA 3JS5A 1CVRA 3SBOA 3T0GA 3W7VA 4BMOB 1C3XA 2OVFA 3RYHA 1YTLA 2ACVA 3DULA 5P8WA 3VFDA 1HNZB 3I2IA 3OD5A 2W37A 3QE4A 4XD2A 2GZHA 2I3ZA 1LI4A 1Z5WA 3EG9B 3TK1A 2ADMA 5JI2E 4OI4A 2AFIE 2B99A 4MRAA 4JLWA 1WTAA 4ZIRB 5C7LO 5ILOA 4ZO6A 4W5TA 2REBA 4KZPA 3WYGA 2RG7A 3ZBPA 1X80A 4DPLA 4OQPA 4TV9A 3NGMA 1U2EA 3A7DA 2GKGA 1T13A 1SUWA 2Y0EA 5A3SA 5HRAA 1NVWQ 2W42A 1VBMA 4M9CA 1E6CA 3O1LA 1M2GA 3B9PA 4DA0A 1LS1A 2X2FA 3PGMA 4LZOA 2BEJA 2VPIA 3LOUA 1GEEA 1MAUA 2IHBA 4U5QA 2XWQA 4OHWA 2PMFA 2X8LA 1F5NA 4G4IA 3I45A 5FFFA 1V8BA 1YDHA 5JH7A 1TU0A 1KQNA 4CIVA 2IBTA 1ODCA 5E1DA 3EC7A 1IJFA 2O3RA 3SQDA 4EITA 4YAKA 3K8YA 4ARSA 4KO8A 1T29A 2DAPA 3ZV6A 3PHJA 1EGAA 2P9QA 3M3DA 2HB6A 3ZHUA 3F5SA 4CE6A 3IAFA 1U0RA 4RH1A 1L5SA 1TPYA 3HDVA 1FNMA 5DNCA 3EGXA 4DCNA 3AYXB 5F7ZA 2FB9A 4OX9Y 1KRWA 4RIHA 1NUHA 2WMNB 3QG5A 4RELA 4AS1A 1UXJA 2MIIA 2CVPA 2FSIA 3W5UA 5FD8A 4F46A 4I8XA 3FE2A 4AXBA 1C8VB 5AVXA 5B6IA 2PIAA 2C4KA 1ESDA 4UXIA 4X3PA 2NU8B 3WLRA 1BDJA 3Q41A 1WUJS 1QS0B 3GZNA 4Z53A 4OL9A 1E2JA 1FIUA 1GTL1 3CPHA 5CBPB 1Z38A 1X7HA 4ZT7A 1EUQA 2EKQA 1KBOA 3KV1A 2BMVA 2X2OA 3QPVA 4IG4A 3D3NA 3CH5A 2ZM6B 3U3ZA 2J87A 2OV1A 2WF7A 3TPZA 4DCGA 4RAQA 4OOFA 4HD8A 2XT9A 1M67A 2EIHA 4DIKA 2VTVA 3CIFA 4YRRA 3W34A 1ODTC 2IS6A 4XX1A 2MWMA 2IIVA 2CLDX 1L4NA 1HFEL 3KR1A 3USCS 5DTEA 3PHGA 5ELXA 1QIIA 4H6PA 1PFGA 2XUPA 3ELWA 1Z35A 2ZDHA 4N8DA 3L1VA 3IUJA 3TGLA 1XF9A 4LHSA 1DAIA 4BOYA 2FEMA 4PLVA 2RI1A 2DQYA 3TNJA 4BLOA 3A9TA 2BEWB 3BA1A 3C70A 5HXBA 3OQ1A 3T61A 4UAVA 3DT9A 5HYVA 1Q17A 3DMYA 4NNOA 3FYSA 2C77A 2PLFA 2XVAA 5EIHA 5C4MA 1XD2A 3LGAA 3JQFC 1SA0B 4NYJR 4ZAVA 3IUQA 5KVAA 2D4AA 4F2HA 4IRMA 3R0VA 5LBIA 1D1QA 3UJCA 1KP9A 5JRZA 1DEOA 1E4YA 3BKXA 2ODTX 3CY6A 3H04A 1VJCA 4W7HA 1QF9A 2OLKA 3EZ2A 1JZSA 3MJEA 2BELA 4IIJF 3WL8A 2DUUA 1QIHA 3OE7D 1QP0A 1R5OA 5KJEA 1D4AA 3TI9A 1P6UA 3SM3A 4TLMB 1NB9A 4DSNA 2ZRAA 2C2MA 1E1QD 1WOOA 2A7QA 1VJ0A 4L9SA 3SOPA 5A4JA 5G3ZA 4MR7B 3FKQA 2A67A 5HKLA 3NBUA 1E66A 2X0EA 4G1MB 4FU0A 4X71A 4EGCB 5JMWA 2FOIA 4TSKA 3SLDA 3VU9A 1Y4SA 1ZH6A 2Z5GA 1GU7A 1VSUA 2D0IA 3FYDA 2XMQA 3RY8A 4GRDA 2Q2QA 4WZBE 4AZTA 1QK3A 3JAWB 1Z75A 7MHTA 1OLSA 3QENA 4MS1A 2FZCA 3S2IA 2HLNA 5I9NA 1GAXA 3AILA 2PX6A 1KYWA 3LF2A 4MHSA 1NW6A 2AOUA 3GAFA 4WEQA 1CT9A 2OWEA 2YTZA 5HJEA 5KNCA 4UXJA 3ZIDA 2QT0A 2O54A 1V5FA 5DASA 3GRUA 1TD9A 3ASTA 3KQYA 4MV7A 3SZGA 4RCVA 4PVDA 2ADFA 3U4IA 1FB5A 2EDCA 3HCBA 4YNBA 2FK7A 3WC4A 2I4OA 3QVVA 1JHUA 3P9RA 5T3UA 4RZUA 1E2NA 1GTZA 1TU3A 2JIRA 3H7AA 4DZTA 4NS4A 4YX9A 4D44A 5BV0A 1UMDB 1S5PA 1BKSB 3P20A 4MR8B 1SD5A 3WZLA 4B09A 4QZVA 5DCUA 5FBLB 3GJTA 1SZDA 3BL6A 3ONYA 1Q0TA 4ARUA 1PFUA 1V39A 1BHJA 2QD4A 1TK2A 3FUXA 3WQQA 3IVXA 4QOHA 2HDOA 1UOOA 1ZD5A 3F49S 4Q9NA 4U2BA 1QFJA 4GOJA 3EPLA 5F73A 3KTOA 4D9EA 2WYWA 3NHRA 1CY6A 5FV7A 2VHYA 4E22A 4F3KA 4IIDA 3GNLA 3U3OA 3P2OA 3W06A 3DZ8A 1T2UA 4O4IB 2AZ4A 2DKFA 4MAMA 1J7KA 1WXDA 2FFBA 4Q39A 3ADBA 1QPZA 1QJ4A 1Y42X 5IRCD 4JA2A 4NK4A 3R77A 4GKJB 2PSEA 3BVPA 1RKUA 3LFTA 2QDXA 5DBOA 3TLBA 4P4NA 5C5EA 2IH2A 2H17A 1VRVA 4Z4QA 1NP3A 3GX1A 4BGUA 4BECA 4HR7A 1UPBA 1R9MA 1W9MA 3RLIA 5SZHB 2VA8A 2B8EA 2VG8A 5TT0A 2VH5R 1KK3A 4W63A 4BNVA 1DJLA 1I4LD 4GBJA 5D86A 3GT3A 4MUAA 2XUQA 2AS0A 5CD1A 4JJZA 3L6OO 3DHVA 5DM4A 4R9NA 1MVNA 4HRAA 3VI3B 3VZDA 1Z4LA 2ZBEA 4P81A 2DUJA 3C7DB 4W7SA 5EXDA 1RW4A 2ECOA 4JV5B 3Q7RA 5L45A 1IE3A 3UKDA 1NJ6A 4EG7A 3LDFA 3RS4A 4CF7A 4Z4WA 1CSEE 1DEKA 1NP7A 2V7EA 4YTEA 4Z4ZA 1DFHA 2RSLA 3S8MA 1T8UA 4P3NA 4B4KA 1JWLA 2D5BA 4Q66C 3R9KA 1XLTA 1V5IA 4FYWA 4LWQA 3RRFA 1NVVQ 4QYXA 3TTWA 3AM4A 3BA6A 4IJMA 3VGJA 3TQRA 1B8NA 2PXAA 4KV7A 4W1SA 4OJQA 3RWOA 3WRYA 4WN3A 4YMWA 1V1MA 4OKIA 3SYKA 1T4CB 1XTSA 2VAWA 2Z9CA 4XKWA 1BXZA 2G8NA 3BNWA 4KN5A 4QXMA 1QH0A 3O8RA 3ZWPA 4DDMA 5F7XA 2JW5A 1T25A 1KO5A 3U3RA 2DY1A 1HDOA 4WY8A 2WZDA 4ZI5A 1BE0A 5CURA 1P39A 1I2CA 1YIJB 3CINA 1DWQA 1X3SA 3BWVA 3EW7A 4M8KA 3SP1A 2WPDD 1JHVA 1JE1A 3T53B 2IQ5A 2I6QA 2RGRA 2GLTA 1GG9A 5L7WA 1CUYA 1UZMA 1N2GA 2FSGA 3DP7A 3PJGA 4TS1A 3V76A 2VK2A 4IJUA 3TOSA 5MN4A 3Q0EA 1G8YA 1ORIA 1BS1A 1E3JA 1KEEA 1EFPB 4PTYA 5DGDA 4ESEA 3QPDA 5K20A 1XMXA 4FE7A 4Q9JA 2IL1A 2NADA 3DKIA 2PD6A 3VDQA 2X8JA 4C43A 2Z95A 2C4NA 3GWZA 4NJOA 1E77A 2JLQA 4D9NA 2B7CA 1SIWA 2INGX 5KEIA 2LPMA 4M55A 4PCAA 1VSVA 1RXIA 1WDKA 1XU7A 4Q3AA 4N41A 4ZYUA 2FRDC 3WWEA 3BJZA 4CHTA 1HNNA 3KM0A 4MULA 1PWEA 4IIEA 4ER6A 5B64A 1RXEA 1DG3A 3AERB 4JQSA 3RADC 1U2QA 2ZRKA 3ANXA 4BB6A 3G82C 3HWSA 2P9GA 5K3DA 5CEEA 1UDCA 3M89A 1UPCA 4UU7A 1O6BA 1BN7A 1Z47A 2QY6A 5K3SA 3TB6A 1OB0A 5BXQC 5FV4A 3BGWA 5JCJD 4C6HA 1TTHA 1BMDA 1YQUA 2O2YA 2XTJA 3C6ZA 4GYWA 3VYUB 4IX1A 3L0CA 4CJXA 3GLFE 3HXQA 4X7FA 2Z9BA 3EPPA 5E7IA 2AYZA 3FAKA 4ND1A 2NU6B 3TKYA 1AHHA 1JDNA 2PGLA 3OLCX 5EP1A 1M6HA 3S44A 1JKJB 3JTEA 1CUAA 1IXYA 2N47A 3IPYA 1RC0A 1LQUA 1OJLA 3O83A 3OETA 1IEQA 4P5PA 5E38A 5E95A 4F2WA 2QX4A 1NMQA 3QY9A 4B0PA 3Q7PA 4I36A 2OBNA 4M2LA 4DLXA 1YRLA 4AYXA 1TCCA 2D7JA 4ICIA 3IKLA 5FFMA 4O2RA 4BP3A 4TKVB 1XQYA 5KYTA 1N5DA 4A92A 1CQXA 2WE7A 1F12A 3EY4A 3GHHA 2X9VA 1PBNA 3BM5A 4M1YA 3T1NA 5JJ5A 2IPAB 1VHDA 3OIUA 4LZAA 1Y3CE 4CN9A 2DJIA 3TFWA 2HNKA 1HQKA 1VLHA 2XMSA 2Z1NA 4HAZA 3I9NA 1EWTA 3Q8LA 3UAGA 1ZS9A 2J3IA 1JLKA 4PZ0A 8MHTA 1AS0A 1OIVA 3QYJA 4LQDA 4DG9A 1I5EA 1Q0LA 2VZ0A 4YALA 2OQRA 3NZEA 1SKYE 5A3JA 4QULA 5CFQA 5E8JA 4B75A 1JHRA 1GGFA 5ITSA 1MW9X 3A9UA 2K7ZA 2E5FA 1TZ2A 4BHTA 1EG7A 1F60A 3D4OA 4YRBA 1M2HA 4GOXA 1IBCA 1NVMB 4IDNA 5CB8A 2HLDD 5DYNA 2P6NA 3WHKA 2Y6UA 1K89A 5JAZA 2Q9BA 3LNNA 4P38A 5IWCA 5JFTA 3BL8A 4H0CA 2RHLA 2X2EA 3N8DA 2HWKA 2CF5A 4QPJC 2ZWMA 2V8OA 3T5GA 3GBVA 4LY3A 5IG2A 1DX6A 1PEYA 1WY7A 2Z8YA 4JYMA 3C74A 3WV4A 4JYPA 3EIXA 3BE5A 3HSKA 3FGZA 5HDBB 2ODNA 3ROMA 3UJHA 1DUSA 1SOMA 3B9RA 1B1CA 2PS1A 3V32A 2DRIA 4IH9A 1YRAA 4E30A 3A3BA 1NQAO 4Z9BA 1KZ1A 5SYAA 4AX8A 3B36A 3H7IA 5DHQA 2VPWA 5ULLA 2ZL6A 5K4AA 4W82A 2HPVA 5DZSA 5FYQA 4DVJA 1XMVA 2FVYA 2DPLA 4Q48A 3FWZA 2YRXA 4Q6BA 4RPJA 1QR6A 4U00A 4F5WA 5LP6A 3V80A 5DW0A 4D56A 2JGFA 1XJ0A 3EQ9A 3ED1A 2OGUA 2RGDA 3UXEA 5AJHA 1QIMA 1DQYA 2QQFA 4KMRA 2W90A 4DLVA 1QV7A 1A8UA 4Z6KA 3I5AA 1UPXA 3GQVA 2IY9A 1Q0HA 1UT5A 1JLMA 5DJ5A 2V0NA 4L7VA 1JIXA 3GFQA 4GGOA 1ZC4A 1VCIA 5A4DA 3A58B 1SHUX 2NQ8A 2QD1A 1NJ8A 2ZUBA 3GLUA 4G5FA 4CGZA 1GNTA 1ZPDA 6REQB 1N7IA 3CUYA 4HXFB 1QK4A 4KFSA 4P3PA 3TRDA 4UTPA 4UQPA 1FS4A 2X6RA 4EQZA 2GBCA 2HSWA 3GJQA 1CUGA 1KIMA 4X7MA 3SLNA 3OZWA 2DFNA 1P1BA 3AR6A 1WAMA 4UHKA 2O48X 5AO9A 3UG7A 2G0NA 2VJQA 2ZU0C 2BH9A 4CM4B 5CK4A 1QYWA 4J7AA 2HHJA 3KP1A 4BVGA 3KEWA 2X0JA 3F6EX 3HLKA 3BHJA 5A4FS 1XU4A 2BUCA 3OE7A 1E3ZA 3D59A 4HJRA 4ID9A 1Z5VA 5H81A 2B2CA 2V1XA 1U5BA 3WL6A 1UKZA 2RHTA 1SUEA 3NRBA 4MUMA 5ALUA 3TJRA 4BWGA 1VMEA 4KIFA 4BRUA 3ET5A 5DHUA 5HUHA 4OJMX 2CB9A 4I9HA 3U4MA 1HZZA 1J1IA 1JEDA 4YGYA 1CDOA 4AWXA 1X74A 1XCPA 3SBDA 3I6ZA 4RMIA 4U9HS 3ZHVA 4PX5A 2FG6C 3GZ4A 5F21A 4D8WA 1LXCA 3P9YA 4ZODA 4CUZA 5FEMA 2OXEA 4D6YA 4YCDA 4LV6A 3QBEA 2JLYA 2ZVPX 5BQ3A 2HGZA 2QR5A 3DZGA 4Q18A 2HBZA 4RX1A 3RFUA 2Q46A 4K9SA 3ZCPA 1WXGA 1TU4A 3K5IA 5FWXA 2O0MA 4AYWA 1ZRMA 4MKIA 4QXOA 4BATA 3JYHA 3AYZB 2C9DA 2V9PA 1JHDA 5CB4A 4TL6A 3ADCA 3PK0A 2PTHA 1N9KA 3VR6H 5IF3A 3HI6A 4KXYA 5L46A 1E6KA 3NCHA 2OG1A 1GCIA 4K6MA 2G7MC 4M98A 4BFUA 1II0A 1YR7A 2ZB3A 4PBSA 3SKBA 1OT3A 1L5YA 2X0RA 4X3CA 3A6DA 1PJRA 4LNAA 4Z9FA 5GGYA 4EQ6B 2OHXA 1LJUA 2HDNB 2FSHA 2FQWA 1WBBA 4CT0A 1ZICA 2P9FA 5CDUA 4PG6A 3PQ3A 5JPCA 1FUKA 1ESZA 2YASA 2ST1A 3O82A 4TWJA 1LTHR 3AB8A 3TRJA 1ILWA 3KIPA 2CLSA 5D1HA 3WGGA 1OLUB 2DBVO 3C4VA 1LBSA 3RRYA 2TMKA 5IARA 4RULA 3QITA 4GX2A 3X1DA 2HH9A 1S72B 4PFJA 1X1SA 4DYVA 3UPTA 1F7VA 1NFQA 4MVCA 4CTOA 2R2AA 1E4VA 2ZJYA 2IXEA 4AF8A 4D1YA 1EGVB 1FY2A 1Q3KA 1MA3A 1N6PA 1VFPA 1YT5A 2WHPB 5IJWA 5J4LA 5JNLA 3KT8A 5FTWA 1NY6A 1AZWA 1KZ7B 3FI0A 3O7MA 3LXMA 2WICA 3IELA 2X8WA 4NZYA 2OTLB 3TBFA 3L4SO 2C5HA 1YCDA 1E3EA 3I52A 2QRNA 4GGPA 4NC9A 4W9RA 4ZVVA 1MPXA 2FW6A 1L5ZA 3R24A 4HNSA 5F9HA 1U3VA 5G2OA 2ZLBA 4POAA 5G4KB 5A5VA 3WV5A 3HCCA 4FSXA 3A6KA 5JSFA 3I23A 2GPBA 1C1DB 1XZKA 3EYAA 2LIVA 4MYSA 4NDZA 2BKUA 1EZ1A 1FQJA 1K98A 1ONPA 1PJ7A 2WJ3A 3K2BA 1ACLA 1JE0A 3IEUA 3K94A 1TC1A 4GYKA 4W9NC 1C4OA 4G5YA 5LZ7A 2RGWA 3WBJA 4C4PA 2JH8A 1E1RD 3ZI7A 2VKQA 3MD0A 3DPUA 4CQLB 1P4HA 2VPQA 2JGLA 4KQ1A 5GJCA 3CLHA 4QUZA 1BX3A 1ADGA 1E62A 1H0SA 1SRQA 4K9DA 3DV9A 5EC8A 4B7ZA 1O94D 3WS7A 4Z9XA 5FOUA 5DGCA 2F9LA 5FAKA 1SCIA 3ODPA 4KXMA 3F1LA 5TGTA 1N7HA 3QI2A 9LDBA 5JOQA 4KQ6A 1D2HA 1GUBA 2B25A 4CG2A 3RVMA 4IMJB 4DQDA 1SK8A 5B2ZA 2HXYA 1NVUQ 3L8ZA 3HA7A 3NHFA 3T5CA 1IL0A 4W5WA 3I8OA 5F4OA 3C5VA 4I2NA 1KDZA 3IIIA 4V0KA 3RU9A 5BXYA 3DEAA 3EEBA 3JWEA 1ZN8A 5HOEA 1K92A 3U7JA 3RVOA 1J33A 1P7CA 1ESCA 3MMXA 1F06A 1BW9B 5ELLA 3TD9A 4S1PA 1KVSA 1M6EX 1TI7A 2BT4A 1SIBE 2B1JA 3HZRA 3T1OA 2Z6QA 1OI2A 2OCBA 1VQOB 1WMDA 3OHSX 1QIJA 4CUJA 5JXHA 3OLVA 3G8BA 5EZYB 4TWZA 1IN7A 2FE1A 2HK7A 4PGOA 2PT9A 3OIVA 4F84A 2KLBA 2JIOA 1YVRA 1TT7A 3CX8A 3RVPA 5JJCA 1L5FA 2O8NA 2GYWA 2FPXA 5FTNA 1JEOA 3ZDAA 1CTQA 3TW8B 3WSTA 3ST7A 4DDVA 2P2SA 2PX5A 4PE5B 1N6LA 1LDYA 1IQPA 4XCQA 5AOCA 4F71A 3TCXB 3VR5H 1TCAA 1V6AA 1OFIA 2PSSA 4COKA 2QQGA 4WRRA 1W88B 4MEBA 4IIHA 4UDYX 1J8MF 2D4HA 4JP8A 4R2HA 1UJ5A 5LDDC 1OE0A 1BHO1 1DUIA 4YEDA 3OZTA 2O8FB 3W9BA 1F0KA 1HA3A 4IXMA 4Q1EA 1GOTA 4ZVRA 1NVXQ 4XB2A 1JJ7A 2AR7A 3BL5A 1R9NA 2AK3A 2UDPA 5IJ0B 1GYQA 4GF5A 3UJDA 2QL7A 2Z6VA 2V98A 3FVTA 1UZNA 4P4GA 3R7LA 5KQGA 4E07A 4UMFA 2PUVA 1A9QA 3ZVNA 3U7QB 2IXAA 4S35A 3MMZA 4MUBA 3R3YA 1LLCA 5HQ3A 4MRVA 4B3JA 2AL7A 2MINA 4PPFA 4CKEB 2YXEA 3RSGA 3NBQA 2JLXA 1K27A 2OENG 4G67A 4YJHA 3RJ5A 4DRXB 4E15A 3V8PA 3SI7A 4IVQA 3RI3A 5F4ZA 1P2DA 3GOHA 4AROA 5JMOA 4Q12A 4PZYA 1MHPA 4YC7A 3BPSA 5CG1A 1XNJA 4NE9A 3OKPA 4OHPA 2WSSA 3UVEA 2AN4A 3I5MA 1RAGA 3OFND 5THXA 2PGIA 4C0KA 1O96B 4XN0A 1MC1A 4EW3A 3T3OA 5JTTA 5HZBA 1Z6ZA 3BMOB 4IIUA 5CPFA 1CB7A 2G1AA 1O6CA 3FTCA 3ZS8A 4BAGA 1BYUA 2FW9A 4J29A 1BQ4A 4A16A 1I2ZA 3FSGA 1CE8B 3JYNA 3NHSA 4O4IA 2QRVB 1MT0A 3FMGA 4F8EA 3RSCA 1SXPA 2A3RA 2I6FA 4MVJH 1DXOA 2BGWA 2IYUA 2XMBA 2QN2A 4JITA 2WF6A 5KUTA 4DOMA 1D07A 3KQKA 4TZ6A 4ANFA 1R0LA 1V1MB 1QNLA 1GL3A 5B7QA 2F3QA 3D8RA 4O33A 5ESXA 2ZRLA 1DKRA 2JD2A 4FR2A 3EDRA 5KTSA 1JFLA 2VHJA 1RLJA 3BB3A 2WKWA 3H97A 4PZZA 1X92A 1OKKA 5JDIA 5CIWA 2C03A 3MQ2A 1U02A 2PVPA 1M7GA 3HB4X 1E6UA 3KK0A 2VKTA 4RKYA 4YQZA 3LLVA 5BMOA 4IG9A 1FFYA 5KVSA 4DY6A 1LPBB 2YJGA 4WBXC 4D4KA 3BE4A 1YJ5A 3DOIA 4H15A 4C06A 2FP4A 2OXRA 4ZREA 3RVLA 2JJMA 1ZMRA 1QPGA 3TSOA 3O2SB 3VISA 4CTMA 3DBLB 3HU1A 4URUR 4U3JA 1MV8A 2CXOA 4QOEA 1XDDA 4IIBA 5F1YA 2O3UA 2PZ8A 5HKOA 4K9RA 2Z0MA 4ZJZA 2PWYA 2NUPA 3DTTA 3H2HA 4JD5A 4L8WB 5HJ2A 2X22A 3E3LA 5JE8A 5FTLA 3N05A 1GGKA 5FL3A 5CT6A 1EFCA 4YACA 5F4BA 1O9HA 3RK0A 1CLEA 1XAHA 3GCZA 1YJNB 4JQZA 1MH1A 2AJDA 3KG2A 1PCXA 4ZV4A 1OZGA 1Y1QA 2C9MA 4HFNA 1XXHB 1QHYA 3N58A 2VNHA 1R0XA 3DE4X 3IOYA 4Y2RA 4YRIA 3LV8A 4MR9B 3I01M 4BZXA 2GWHA 5M29A 2CD7A 5DXJA 3SBEA 2VC2B 1W6RA 1UJCA 1FFAA 3C6BA 4LXTA 3RGWS 3ZWBA 3LVFO 4NMXB 3VSCA 4MRMB 2DUNA 3Q1LA 1DSSG 3L8CA 1M1ZA 3JZFA 4RFSA 1RQPA 5J40A 2IIBA 5BORA 3FNEA 3H11B 3GUZA 1O5TA 2G72A 4IZOA 3R3JA 4CHGA 4YS6A 3VR2D 2WIKA 1FTWA 2QQEA 1EVZA 2P9BA 3A05A 4Q4JB 3ZHSA 4Q3KA 2XT6A 2HU5A 4QQRA 1QYXA 5F2NA 5JAIA 3TW0A 3AUAA 2FTKE 2DX7A 2YOGA 3M4NA 5JMPA 2GXSA 4G1VA 4DC0A 2X77A 4Z4GA 5CXSA 2JF0A 3DR5A 3DBIA 4JFRA 1GUZA 3RU3A 5HF5A 1JG6A 3DBHA 4MUFA 2JCGA 4LC1A 4YQEA 2GB4A 4BWFB 4Q24A 4YI3A 1IOZA 2ZUTA 3NC1C 3CLRD 4PSKA 3VYWA 4A3SA 3CZ5A 1OD6A 3QX9A 4ZYVA 1TEZA 1VSTA 4P93A 4EI9A 2WY2D 2DG2A 4ZEXA 3HFGA 1E61A 1AQJA 1B1AA 1WOYA 1FDWA 3DQPA 4JLUA 3IP3A 4EKIA 1ZK2A 3PKJA 3Q9SA 1KKUA 3JRXA 1T8RA 4GW3A 4IQGA 4TXJA 4Z0TA 3ZY3A 1E32A 4QARA 1W0JA 3I6QA 4Q34A 1DEAA 1OC4A 1ZMBA 3H2ZA 5AHRA 2O8BB 1E5LA 5KNDA 4CDRA 2QXYA 1ZM7A 3KKMA 3OLZA 1QC5A 1I6KA 1I7NA 2HRBA 1OI7A 2NWQA 2AOXA 2JPDA 3U09A 3T5TA 3KUUA 3ACCA 3FWHA 5LYYA 2MMCA 1TC2A 1TM3E 1QE5A 1R4ZA 4ZQHA 4TLBA 5AICA 3RVDA 4ER5A 5ITVA 1FJGB 1PFYA 1XFAA 3GAZA 5BNIA 1TM5E 5EERA 1TEVA 3B1YA 3PD7A 3RUIA 1Q1EA 5DSZA 1UBCA 3JX9A 2CJPA 3VXKA 4ZOQI 3AGQA 3KCQA 4PYNA 1FJ2A 5CA1B 2I2FA 2ORYA 3OH8A 1M8PA 4FDVA 5FOQA 3I61A 3UJ8A 5EINA 2X1MA 2QPLA 2OXTA 3K2QA 1K9MD 5C18A 4ZKEA 1M1YB 2A58A 2QW1A 4X44A 1NMXA 1CUCA 2GCPA 5AW9A 3CN7A 2PZKA 1G3QA 3UHFA 1EVIA 4Q3BA 4A8HA 3ORYA 4EBBA 5GIOE 3UAXA 3TOZA 2R3SA 2R84A 3A4TA 2QV0A 4DA6A 3COWA 4PYJA 2FDCA 3RRNA 2OYRA 4CDNA 2I7XA 1QP4A 4EUEA 1NXVA 3B52X 3LT2A 3KEMA 1XPUA 5I3ZA 4QUBA 1ZESA 1VBFA 3AZQA 1EB8A 3F73A 1Z2DA 1A04A 3DLAA 1EVEA 1S3SA 2VQ6A 4BNGA 4E5KA 2D7DA 3FY4A 4HB2A 3PCTA 3R5FA 1KXZA 1NHGA 4W1QA 4H3SA 3TQOA 1ZJ5A 3JTMA 5E3HA 2GETA 2AN3A 4TYNA 3TRHA 1W73A 2G83A 1DC8A 4IO0A 5SZJA 2PAFA 3TLKA 3JSAA 3SJBA 5CT8A 3G9ZA 2GF9A 3B6IA 5FA5A 3A37A 3PPYA 2CEKA 2G5CA 1JEQA 1AN0A 1CYEA 2QN3A 5DS0A 2J7KA 1U0OC 2WSMA 1JG1A 1WG8A 4D9HA 1Q1ZA 1YJ8A 3EGDB 4BO8A 1QGUA 3HB7A 1TAGA 4ARVA 4FHEA 1EFRA 3QPBA 1BJTA 1R2QA 1ID8A 4P22A 2AEMA 4IRUB 1RMQA 3NYWA 1G7RA 3CC7B 5EP3A 5DEOA 1N2JA 5CVEA 3FPPA 5FWYB 2WUGA 2P4HX 3OI7A 3KETA 5LZ5A 2C61A 1P4GA 5TT1A 1CUIA 1M1UA 1DKPA 2WMOB 4XSHA 1AQLA 1WMSA 1CYDA 3VR4D 2AOWA 4BQRA 3DBVO 4O1MA 3U40A 5DT9A 1FVOA 3ICWA 1A9PA 4JEUA 4R2WA 4XE5A 5J2TF 3VC1A 4CCAA 2F62A 3UXYA 3MLBA 1A71A 3QXXA 1NV9A 2VHTA 4NFHA 3PUKA 4X66B 3BEOA 3OLXA 1NRJB 3DD1A 1VHWA 2C3MA 4WH0A 5GM2A 1K6JA 1Y48E 3OCCA 3ZU5A 4F2DA 2WHQA 4DMMA 3M4YA 4Y6RA 3CCQB 1SGWA 1PNOA 2ZSHA 2V3WA 1SKAA 4OLBA 4MVJP 4JJGA 5HZGA 5I47A 2CT8A 4NF2A 4Q3OA 3ITKA 2B9EA 3SPXA 1VIYA 2JGKA 2Y2UA 1ML3A 5EE3A 4EB0A 3I83A 1SKMA 3NB0A 5LIPA 2VNJA 2EERA 2HX1A 3BGOS 2W6QA 3VR3A 4UCFA 2RK6A 5GIPE 3C3MA 5C1PA 2J8ZA 2J4FA 4LJ4A 1QP7A 1GRNA 1GWNA 2EW2A 4I4LA 2ACWA 1AV6A 1S8NA 2YV5A 3E4DA 5F1KA 2DPMA 4PNHA 1FFXB 5JSQA 2NSLA 3DYVA 4PLGA 3NI2A 1F3LA 2WFLB 4UEWA 1YHNA 4YMVA 2O8BA 3L7OA 1IEVA 3CSDA 4L0DA 3B20A 3CXCB 1N1GA 5JCXA 1H8HA 1STOA 3UUFA 3TLXA 4H1HA 4B8WA 2B35A 1TLLA 1BFKA 1R6VA 1UINA 2Y71A 5BQPA 1XCBA 3ASRA 5D7BA 3CGWA 1D1NA 4KN8A 3UJBA 3PVZA 3BTUA 3OJOA 1BJRE 1U8EA 2C7VA 4LWZA 5ERXA 4P98A 4B5KA 1D6JA 1Q12A 5GADl 1I9GA 3PIRA 1JKIA 5BWMA 1Y34E 2NXJA 4D9JA 4XUCA 1Y33E 1TIBA 2UV8A 1Z63A 1E69A 1NQ5A 2IEZA 5IYZF 4EG0A 4XM0A 2QUBA 1XVTA 3B1XA 4ZJYA 2Z2KA 2GPTA 3FMOB 2CV1A 2EVWX 5SY4A 5FL7D 3VC3A 1YFJA 1S3FA 4OG2A 4ESHA 4H16A 4BQNA 1ORWA 4UM5A 1E43A 3L8YA 3VKWA 5BT8A 1F2TB 2NXEA 2B1QA 3A3OA 3R0JA 4R16A 3STYA 5AKKA 1YWGO 4CLOA 3W79A 5JANA 1K5DA 4ZXFA 1OBFO 1CRQA 5KTTA 3GLFB 4BAZA 4OQFA 4CIAA 3AO0B 2B5OA 4K8RB 5JXWA 1VLZA 1K8QA 2ZYTX 4EA6A 1VPWA 4BC1A 4TS4A 4ALIA 5BOSB 2PJDA 3CMMA 5DPMA 1LDGA 1VJRA 3NASA 2P40A 2CDRA 4ZT2A 1QHEA 2R86A 3EB9A 2FR0A 2DHQA 4Y2SA 1ISMA 1NLYA 3H2GA 3VPHA 5DGTA 3VM6A 1W52X 4UDOA 4ZJPA 1QE0A 1ZHOA 3CB2A 1IHYA 1LTQA 5FH9A 2RIPA 5AKIA 3EFOB 2P6OA 4R1MA 4LX0A 4PG5A 1RAHA 3LL4A 5JI3E 4C4YA 4DLPA 4F56A 3ABRB 5T3YA 3WB2A 1PJZA 3ZX4A 4EYQA 1U3TA 2XW6A 2HU2A 2I34A 5E6TA 3FUCA 3MINA 4GIBA 1Y80A 1UZAA 1WUYA 3EH1A 4MKGA 1WCIA 1H6DA 1PG5A 1XO1A 2IWHA 1VMIA 4H4DA 4D0RA 4ZDWA 2BKAA 4Q37A 3A10A 2F6RA 1SBNE 3AC0A 2W93A 4J16C 1Y1TA 3SS9X 1PJ5A 4B17A 1NT2A 4L4ZA 4DIBA 5CR9A 1I3KA 2I1LA 1CZLA 2BGTA 5LBUA 4BE4A 3ZNQA 3ODGA 4WCFC 3DTVD 3T7JA 1ZA1A 3B6JA 4D9KA 5MFPA 1KS2A 4KH0A 1QSGA 5AK5A 1VBKA 3DMRA 5CYFA 3TKAA 3WADA 1FP1D 2ZROA 5T57A 1N36B 1MVLA 1O54A 16PKA 3U3DA 4G07A 4JL5A 1SFRA 2EDAA 3DZCA 3UUGA 4QLAA 5BMVB 4MLCA 5BSKA 5JYDA 3WBKA 2BE9A 2R7KA 3WHLA 221PA 1GARA 2ZRGA 3GG9A 3HZOA 1DE0A 2P62A 3FNHA 3KOYA 3N7TA 4J6FA 4Q00A 1I7DA 1BNCA 1KYXA 1HDYA 2LIPA 3IVCA 4BLUA 5BQFA 2QT1A 3CU5A 2EGGA 5BT9A 3ZTYA 5EUMA 4MV9A 5ARDA 3AR9A 1V71A 1G8KA 4GR9A 3QRWA 4PGMA 1KTIA 2XRZA 3IAUA 2W6ID 1V9SA 3TD6A 1U11A 1M9NA 2YW2A 3OG9A 4HRYA 1Z88A 4QU9A 3ZU6A 4CKEA 2IX3A 4BO5A 2I4NA 2JFGA 4LTNA 4Q19A 3G79A 1M0WA 2I2WA 1WKBA 4OSPA 2R4QA 1Q92A 3BDVA 4FNGA 4U4AA 1N6OA 3SE0A 1EXDA 1TF7A 2Q1XA 2XNCA 1RRVA 5HRCA 4OUDA 2DLNA 3K20A 3UUEA 3PSHA 3V8MA 2WYUA 4N54A 3PFNA 4KK3A 1QIDA 4OFZA 2CKMA 5BWOA 4W5QA 4GM1A 4YELA 3ULKA 1R0KA 3BMOA 4M49A 5KYWA 3VMMA 1W4ZA 1O97D 2H2DA 3CCMB 2A5LA 1XZCA 1FDRA 1X0VA 4RQAA 4L8JA 1ZHFA 1K2VN 1JILA 3QU5A 4OJKA 5JZ9A 5K0TA 5D3MA 5K6TA 5KQSA 3IL2A 3SZUA 1CDZA 5CFPA 4BNUA 4G0VA 1UKAA 1NE2A 1S9HA 2V96A 2WKSA 4QICA 2O3TA 4XDGA 3C45A 2HF9A 3PWKA 2H4XA 2O07A 3FHCB 4CBVA 1W9XA 3DVRX 4U6SA 3RFFA 3WMFA 1KQGA 1X7XA 4WFJA 5DHFA 3ENNA 2XYVA 5LYJB 4UVIA 1ND6A 2P75A 5IDWA 1YKGA 2Q5OA 2XUZA 2Y66A 2QT9A 2ZI9A 3MWYW 3OURA 1EVJA 1SCKA 1XZFA 4PWZA 1SHZA 1SOUA 3G5MA 5FI0B 2AKYA 5K8LA 4J9UE 1P0MA 3PXEA 4F60A 2HT1A 1ZKDA 4RF5A 3PEWA 5F4MA 3WRXC 4DQVA 4EF6A 4A2QA 3QWIA 1IU9A 3G17A 1Q2XA 2N1BA 2C7GA 1NVAA 4UOQA 3P96A 5EMKA 1F48A 3W1VA 1VYUA 3KL9A 2Q5FA 3K4HA 5LMNB 2VUHB 4Q82A 5IASA 4JY7A 4B32A 1VZ3A 1FBTA 3A4MA 2KJQA 2IBSA 3SQOA 2PO5A 4B6SA 5D3QA 1SUBA 3WBFA 1UFKA 3D1JA 3WK6A 3P71T 1J7JA 3H6KA 3TAXA 3LHSA 2HRZA 3FZYA 3WNZA 4Y7DA 5AUPB 3A1DA 3EF0A 1A4XA 2WUFA 3ZV4A 1BEUB 1MPTA 1YHYA 3VR5A 1EUDA 2L69A 2BW0A 2PEZA 4AMVA 1OIWA 4ASUD 2FUNB 4G9EA 4D3ZA 3TLJA 3Q87B 1SRRA 4GI7A 4N0DA 2W6ZA 3AR5A 5LCXA 1ZEJA 3UH1A 2QMYA 1JT9A 1O1YA 4KCGA 3TLGA 1ZN2A 4PIMA 3UAZA 3UT6A 3ECAA 3KR0A 3LUDA 1YS7A 1MOQA 4EWLA 3NKVA 1NULA 3ZZ1A 2HR1A 4G24A 5GY7A 1LPOA 2IPLA 4Y3UA 5E0KB 2B2NA 5G40A 3SOZA 1IWOA 1ZN7A 4AKSA 5JYBA 4OH7A 5AVWA 4NDAA 5KNBA 1YITB 3PNLA 2QTLA 3RG8A 2OCGA 3C5EA 1INLA 3DAHA 2C2BA 3L7YA 5H16A 3FCAA 2JCSA 1VL6A 3CPJB 1SAYA 5CLGA 1SG6A 3L6CA 3F47A 2CXHA 2C2XA 1J9ZA 1U98A 3DWGA 1GPKA 3PQ8A 4O4JF 1YJXA 3RWBA 3UIEA 3UW3A 4NCBA 1GA6A 4G3XA 4N12A 3Q6QA 2PV0A 3PP8A 1PWHA 1KZGB 2XUAA 3DJFA 4WLNA 1DKQA 1CY7A 3LWBA 2NUAB 5K7SA 5IDQA 1VPTA 3D8UA 4B3SB 4D25A 1R5NA 4B4WA 4JLKA 2Z4TA 3IIMA 1NW5A 4BQOA 1M3SA 1URPA 4PPQA 4F1JA 2GBGA 1ENPA 1M2JA 3RHFA 1ZM9A 3OICA 3MLAA 1H42A 1XDBA 2X7HA 4IRXA 1IIRA 2ZRDA 4JUBA 1W8IA 3JV7A 4TL9A 4X1KB 3ZHZA 1F5SA 2BE7A 4DKXA 2IVFA 1BE6A 2JRCA 5JVDB 4CV2A 4DNTB 4BN4A 1MX1A 1JQEA 2EHDA 3IVGA 4FKMA 4HQ6A 4DDWA 3R5HA 5E6UB 5FORA 3IP6A 1E3WB 1YMVA 2QMZA 2OV8A 1E63A 3CO5A 3JAMA 3KKKA 3DQQA 4ZDKA 1FSFA 2F8MA 1YI8A 3ASPA 3NWEA 4ML3A 1UXKA 5AH0A 3DV0B 3K16A 1E5VA 2ANCA 3E7DA 2AQKA 3ZQUA 5GTDA 2ZZMA 4KUHA 4NH4A 4JEIA 1O08A 2W6NA 1PKEA 1GCOA 4XEUA 3NWJA 2HRQA 1N4AA 2BZ1A 2D74A 2V97A 3TCKA 2E49A 1EAMA 1KR5A 5F3DA 5TC4A 4BFWA 3PA8A 3KYDB 4YP6A 5C52B 4XWKA 2NVUA 5HSGA 2GNPA 1W2GA 1DXQA 3CP2A 2WD9A 2VRBA 1JAHA 4ZZIA 4R01A 4QTUB 3JQCA 1XZAA 4K3UA 5IJ0A 5BR8B 2DR0A 1G17A 1RYBA 3TZEA 3DPSA 1T4MA 2WT4A 3WMXA 2FEAA 5BMVF 1IG3A 1PV4A 4O6VA 3PI7A 3V7UA 4L78A 3PDCA 1A9XA 4KQMA 3OU6A 5CH5A 2R751 4A6DA 1H2HA 5IAGA 2FWIA 1I6LA 4WASA 5ESWA 1L5HA 4M0UA 3KT6A 2W4MA 3L93A 1R18A 3EXHB 2N9UA 4OK6A 3SDZA 2OZEA 2P9TA 4BFCA 2E2WA 2W00A 1M74A 2HPHA 2QEQA 2ZXHA 3HHPA 4X45A 1XAGA 5SV2A 2QD5A 1F6WA 3WWPA 1K08A 4KWTA 2CXSA 5C0OE 1UQRA 5T8KA 1QVGB 3QVWA 5ALXA 5GWXA 1X9IA 5ALGA 3WG9A 3RC7A 4KPYA 2HM7A 3KDAA 2JI8A 2D1FA 3TQTA 1RYYA 2JFYA 4H7HA 2E4XA 2ZUUA 1G0OA 3AL2A 2QRLA 4UE2A 3MJCA 1ZHHA 1CHDA 1QRDA 3MS4A 1ORVA 3Q9UA 5HDQA 4KMOA 3VVLA 4UNSA 1KK2A 5DM2A 4D4IA 5AW5A 3JQFA 4D4GA 4OXXA 1XLWA 3BGSA 1QO9A 3R9WA 1D2GA 2YDYA 3AHDA 4Y1GA 1YI1A 1TAUA 2NXCA 3ZCSA 5K2MA 2BFEB 5LQMA 1EU1A 3NEAA 1VL5A 1I32A 4JDUA 1P4RA 2CUNA 4ODIA 2GVNA 3K1AA 4W9NA 4MO2A 4DLBA 4DMGA 1WSWA 1JR4A 1UODA 1UXGA 3IKJA 2OV3A 4YN3A 1N34B 2YJTD 4X1OA 5D84A 3BG5A 5CM9C 1HDCA 4JZYA 1KEUA 3B12A 4C3VA 3PFGA 4W5JA 1N8SA 1HT3A 1ODIA 2KQUA 1VI2A 2A14A 3F4LA 3GLHA 1SC4A 4CMEC 1YFZA 1XMOB 2F64A 4GSYA 4JC0A 2H1RA 2AR0A 3FETA 3KTAA 4BDSA 3F0TA 1IZ7A 1DT3A 3NHBA 3RJMA 4LSZA 1BVHA 2EAUA 2XSZA 1A50B 1RQLA 3EISA 1C1YA 5K0JA 4X3OA 2WSLA 4QT0A 3V8NA 3HNPA 1V7QA 1SU4A 3RJZA 4C4AA 2CXNA 2N46A 5G4KA 2QZ9A 1Q1GA 5PNTA 4JI1B 2VBSA 3LECA 2X4GA 1PKVA 2FEXA 1Q15A 1GQRA 2ABWA 2H2WA 3FYHA 4QJ4A 2PNJA 1EJ0A 4Z4RA 3NDIA 3PE4A 3OM1A 2FMFA 5AUOB 5JATA 2OGWA 4ZCIA 1LSJA 2ZANA 1NXWA 3THSA 3V1LA 1G21E 2E18A 1P0CA 4ZCMA 3KQQA 4FFRA 3V7NA 4RHFA 1NVKA 3ENKA 4YMUA 4PNEA 4DREA 1GPAA 2GBLA 5IKOA 4R81A 4DPKA 1L5VA 1ZG3A 3HGQA 4YUVA 3R20A 2ZS8A 1RYDA 4FWTA 2WU1A 4XLCA 3WGJA 4GQNA 1V41E 1V95A 2B83A 4JQOA 3CKKA 3BY2A 3IT3A 2JFXA 1WU7A 3L7NA 2CBXA 3UWSA 1K6XA 3KX2A 1ILEA 1O95C 2HIAA 3UG6A 5F3RA 5AP9A 1SVIA 4PFSA 4H77A 2NGRA 1TM7E 3LHIA 5ICGA 1GYRA 1XL1A 3I09A 2XWBF 1U6IA 3CVOA 5E9JA 3URKA 4OFXA 2BONA 1VPLA 2HCTA 3B2EA 5CGZA 5ALSA 3TTSA 3VPBA 2BZSA 1Z2OX 3G0DA 3LC0A 5E6SA 1WJGA 3NT4A 5I8ZA 4J0IA 1EK6A 2VHWA 1IK4A 1J8QA 1Y4ZA 5DI3B 4E94A 4YASA 5E1BA 4C0SA 3WNDA 3DOEA 1BS9A 3WP0A 3REGA 5IT5A 2IEGA 4W6QA 4HEJA 1OLXB 1PJTA 5DHPA 5JALA 3IO5A 1ZJYA 2OVBA 4NDNE 5U9CA 1UD4A 1QH1B 5B3AA 3CW2A 3U19A 3EMKA 3LQ6A 3KHKA 4JQYA 4LVUA 1VFNA 2AIRA 4UOEA 1XEAA 2E82A 4ZV9A 1P8JA 2GK7A 1Z12A 4IHQA 4K7JA 4HAYA 5DU2A 1CUDA 3PXGA 3I9MA 5CB0A 3CONA 3ZKAA 1KARA 2GYUA 1V3TA 4TSFD 2NXNA 4HUQB 3GJSA 1AHPA 1TQ6A 2AG5A 4AKIA 1BXKA 2PL3A 3DB1A 4K86A 4BGEA 3H9NA 1T2EA 5KCZA 3BCSA 4HN4B 4BJ6A 4FM9A 1BD3A 4UZEA 2P5SA 5HKAA 1WEHA 1JR3D 2G4LA 1A1SA 2NOAA 3DBRB 3PT9A 4D74A 1YL6A 5C4IA 3KQMA 1R8JA 1MJ5A 4WOJA 2ASVA 4KQWA 4DCOA 2JFZA 3GEMA 4YROA 3FTDA 2Z2ZA 4BFTA 5JNWA 3E2IA 3V4RA 4CMAA 5A62A 3R1IA 3RCBA 1S3GA 4CM9A 5EWLB 1QRTA 1QVAA 2YFQA 3KKZA 4ZO4A 4B31A 3LLUA 3GZTB 4KQJA 5AKXA 1CNEA 3KJHA 1X6VA 3TE7A 5BVGB 4QRDA 2ATXA 2VATA 1BE8A 5JFOA 2D1QA 2FPGA 2AOUB 4OA8A 4KWIA 1E9EA 1EK0A 3VPCA 4Z4VA 1NOKA 2XCLA 4XUGB 3A6EA 2VDKB 1N9GA 3BBLA 4KLNA 1TEHA 2Z04A 3MFYA 5JSZA 1NZFA 4XLLA 1VRWA 2X19A 5LMZA 5EMLA 3VUFA 1MQSA 3ZLJA 4XOIA 3CGGA 3I4FA 1UBKS 1DIRA 4MYUA 2QY9A 3J81A 2CHQA 2I80A 2EC5A 2Q5QA 3D7NA 4J0JA 4HAWA 3P1JA 2WVAA 4X94A 5C4GB 3RRZA 1JU4A 1D4OA 3G49A 3IMGA 3T94A 2ZJOA 3OF5A 3PIIA 1DUVG 3B78A 1IPEA 2AFHA 2XA9A 2OHFA 4R3UC 3VC7A 1PZXA 5G1OA 4LYDA 1Z4PX 2OXCA 2OCYC 1KMQA 3OPNA 1L4EA 4J1NA 4DNOA 5CU7A 1KZHA 4CIDA 3RS3A