5GV8A

Structure of nadh-cytochrome b5 reductase refined with the multipolar atomic model at 0.78a
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
272
structure length
272
Chain Sequence
STPAITLENPDIKYPLRLIDKEVVNHDTRRFRFALPSPEHILGLPVGQHIYLSARIDGNLVIRPYTPVSSDDDKGFVDLVIKVYFKDTHPKFPAGGKMSQYLESMKIGDTIEFRGPNGLLVYQGKGKFAIRPDKKSSPVIKTVKSVGMIAGGTGITPMLQVIRAIMKDPDDHTVCHLLFANQTEKDILLRPELEELRNEHSARFKLWYTVDRAPEAWDYSQGFVNEEMIRDHLPPPEEEPLVLMCGPPPMIQYACLPNLERVGHPKERCFAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Distribution of valence electrons of the flavin cofactor in NADH-cytochrome b5 reductase.
pubmed doi rcsb
source organism Sus scrofa
molecule tags Oxidoreductase
molecule keywords NADH-cytochrome b5 reductase 3
total genus 74
structure length 272
sequence length 272
ec nomenclature ec 1.6.2.2: Cytochrome-b5 reductase.
pdb deposition date 2016-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
A PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 5gv8A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 5gv8A02
1DARA 3AVUA 1U2RA 1E64A 1GJRA 2OTJB 1ZUNB 3FPKA 1W34A 2DETA 2C77A 2EFGA 3CD6B 4AF7A 2QEXB 1KJZA 1KD1D 1W35A 4YAUA 4HE5A 5DSZA 1JJ2B 3WY9A 4C0SA 4N3GA 4H9GA 1YJNB 3E1YE 3I55B 3QSYA 3WNBA 1D2EA 4F7DA 2VYQA 1VQ7B 4G1VA 1JA1A 3CCRB 4ZCMA 4QFMA 5GV7A 1IJFA 3ZZTA 1SM4A 3LYUA 1W2BB 1TLLA 3CXCB 4YALA 2YWEA 4ZCIA 3CCSB 1ZM3A 2CNDA 4EH1A 1YIJB 4FWTA 4FK8A 3LVBA 2BPOA 1KK2A 1G7TA 1IB0A 1QVGB 1QFJA 1VQMB 4RJLA 1Q81D 4B44A 2DCUA 1GO2A 2BF4A 1EP2B 1NDHA 4G1BA 3QFCA 1QGZA 1FNDA 2J7KA 3JQQA 4RD6A 3SJZA 3G4SB 4B47A 1VQ5B 1G7CA 4AF6A 4J0QA 2EIXA 1S0UA 1FRNA 1BX1A 3OZUA 4B43A 1IJEA 1XB2A 1AIPA 1KC8D 1AMOA 2OK8A 3G71B 3VO1A 2XEXA 4YHBA 5EMNA 2BV3A 3J81k 4IW3B 2DEUA 1M90D 3W5VA 1N0UA 4R71A 1FRQA 2BMWA 2C78A 3CCEB 2PMDA 3VNUA 1A8PA 1KK0A 3W2GA 1OGIA 1QX4A 1DDIA 3ZBUA 1W87A 3AVVA 1N0VC 4Y7CA 4HE6A 2DY1A 5GV8A 2HDNB 3CPWB 1YHQB 1G7SA 4PC6A 3CC7B 3MCAA 1YI2B 4RD0A 5TV2A 3VO2A 3CB4A 1OB2A 3AVWA 3AVYA 4TMZA 1D1NA 3W2HA 3OJWA 3B8HA 4M2LA 2QTLA 3W2EA 1K73D 2GQFA 1TTTA 2HMAA 5AN9A 3CCQB 2QTZA 2RC6A 3MHPA 4ZV4A 3MMPA 1FDRA 5H5JA 3AVXA 4RCYA 1E63A 3VNVA 5TY0A 4PC3A 4RD3A 1ELOA 1YJ9B 4LBZA 1VQOB 1QH0A 4B48A 1YITB 3LO8A 1NJID 4FN5A 4PC1A 4G5GA 4Q7JB 4LBWA 2BVNA 3I56B 2BM1A 4ZCLA 5FA6A 2VNJA 4DQKA 1GAWA 1TUIA 1OB5A 3W2IA 2HCJB 2QMUA 2PIAA 3CCJB 3A1FA 3OJXA 3AGQA 1R5OA 2BSAA 1N8RD 3CCLB 1VQ9B 4YAFA 3OZWA 3B78A 4M53A 4TMXA 3W5UA 3ZZUA 4ZGQB 4MYTA 1UMKA 3U6BA 4YAOA 4PC2A 2BGJA 3JQRA 4M1KA 3AGPA 1VQPB 4K1XA 2VNHA 3OZVA 1S72B 1QGAA 2OTLB 3CCUB 4ACBA 4B3XA 5THXA 1KK1A 3JQPA 3CC2B 4ZGNB 4B4DA 3CCMB 1VQ8B 1BJKA 2BGIA 1XE1A 4RD2A 4TMWA 1E62A 3ZZ0A 1BQEA 1DDGA 3P26A 3W5HA 1VQ4B 1EXMA 4DQLA 1QFZA 4QHYA 1HA3A 3CMEB 1GVHA 3WYAA 4C43A 4NBSA 1ZM2A 4LBYA 4M4SA 1EFTA 1R5NA 3V76A 1FNMA 5KSWB 4U9UA 1ZM9A 4MYUA 3WNDA 4BPRA 3QFTA 3QE2A 1VQ6B 2B7BA 1KQSB 4M0LA 1F60A 2XNCA 3CMAB 1WDTA 1K8AD 2PLFA 3U6KA 2DERA 4TMTA 3CW2A 1K9MD 3FJOA 2QN6A 1JA0A 4PGOA 3AVTA 2D74A 1QFYA 1VQKB 3ES9A 1DG1G 3B82A 2XNJA 1QUFA 1QVFB 2YWGA 1SKQA 2B5OA 2AHOA 5JBQA 1EFCA 4NCNA 1JB9A 1YJWB 3QFRA 5H59A 1EP1B 1CQXA 4Y9UA 4LC0A 3I1FA 1KTVA 2YWFA 1CNFA 2CRVA 3CRZA 1OGJA 1FNCA 4WQMA 2QDXA 3W2FA 1H42A 4RD1A 1G7RA 3E20A 1Q82D 2VNKA 3WBKA 1Q7YD 3ZBTA 2ZITA 5HXBA 2E1RA 4ACAA 4UAJA 1FNBA 1QG0A 3VMFA 2B7CA 4RD4A 3WNCA 2X3UA 1KRHA 3G6EB 3CCVB 4RCZA 3OW2B 1H85A 2RC5A 2QA4B 1R5BA 1GR1A 2YWHA 2BN4A 3WXMA 2BM0A 1GAQA 3P27A 2VZLA 4AC9A 3WBJA 1KK3A 1QUEA 2NPFA 2VNIA 1VQLB 1F20A 4TMVA 3LRXA 3ZC3A 1B2RA 2OK7A 1VQNB 1JNYA 1CNEA 4P3YA 1TVCA 1M1KD 2R6HA 4YAWA 1EP3B 1QGYA 1B23P 1BX0A 3PENA 1EFUA 1D8TA 4P6VF 1I7PA 1J9ZA 4N3NA 3CC4B 3U2QA 4Y9RA 4PC7A 1ZM4A 4LBVA 5TR9A 2GPJA 2FX3A 4TN1A 1Q86D 3QFSA 1EWYA
chains in the Genus database with same CATH superfamily
3GLUA 3VDRA 2ZTUA 1P2SA 2HHCA 3E8SA 4BZZA 3FSEA 3KKMA 5D1NA 4Y1RB 2E6UX 4XVQA 2R86A 1I2AA 1ICIA 2NU8B 1U8CB 1K66A 3W05A 5LQJA 3CONA 3G3EA 3O0DA 4E13A 1E6MA 1SC9A 4ZTZB 3CLKA 3T1OA 3HADA 5LQUA 4WKBA 1TUEA 3SU8A 4C1BA 1T26A 2O3UA 2Q5CA 4LY9A 4EA9A 4UD2A 3IUBA 2ZRKA 5BPFA 1CW2B 3C24A 2ET6A 4FUQA 1NBOA 2NVBA 4GH5A 4K9LA 4DSOA 4F9EA 4FQ5A 1M6HA 3BHJA 4NF2A 4EA8A 3A2MA 1YJNB 2NX2A 3UUEA 5JDCA 3RIEA 1MAWA 2J6BA 5LIRA 4GKVA 3W4JA 1VG8A 4MW2A 3ZPNA 3L06A 5J4YA 1WCIB 3ANTA 4HQRA 3DEZA 3CRQA 1TVKB 2ZYTX 1L4MA 2OZLA 2WDPA 3NZEA 3AMVA 4MYRA 2IODA 1IRXA 1L7EA 2JBAA 2QE7A 2GETA 2J0QA 4AMZA 4BNDA 2KWIA 1LBTA 1J33A 3ZZTA 1JS1X 4UBIA 1H1TA 3M83A 1E8NA 3QKUA 4BGDA 2OY0A 1LK7A 2R7AA 2YHSA 4A2CA 4DMLA 4ZYUA 4ED9A 2Y0EA 1L9XA 4ZDJA 1PT6A 1ZM3A 2CNDA 1RHMA 1WXFA 1ZAKA 2QPOA 4FI3F 5EIFA 4JQSA 1EM6A 1UQUA 2G9ZA 2V4UA 4IOJA 3VV2A 1CDDA 2CNLA 4RS4A 2FWRA 3FYDA 4XYLA 1A8IA 3QVWA 2QY6A 1P6XA 2X8JB 1Q11A 2LXNA 1WD5A 2YWRA 2AJDA 1E6UA 1Z07A 1AUXA 2OOKA 1HXHA 4EF5A 1HX7A 2UYOA 4G81A 4EKIA 2PH3A 4DN6A 4ZO9A 4CIBA 3EGDB 3FRHA 3GLGB 2JFZA 2WWYA 1X7XB 2XUPA 1P2BA 4HWTA 5FAXA 2A33A 2MSWA 2WSYB 3TM5A 3TPFA 5LVAA 2QRUA 3A4TA 1OE0A 1A9QA 4B44A 4M0FA 4MYHA 3NS7A 1WXGA 3GR6A 3MWYW 1B14A 4AD8A 1ZZEA 3DTVB 3MM4A 1YKSA 1P0IA 2G1AA 5K51A 4KBFA 2Z4SA 3G82C 4F5WA 3KUXA 1Q17A 1H2WA 2XUGA 2B30A 4I4NA 3O5AA 4JX8A 3I2KA 2I9KA 3WR5A 3IP7A 1S0UA 3I04M 3K05A 3PR1A 5U4XA 1DO2A 1MVLA 1W96A 5J2UA 4FGJA 5IM4A 3AF1A 3F73A 5HF6A 1UDAA 1GTG1 2H4XA 2Q41A 2G9UA 2XXJA 3NIDB 4ID9A 4U7PB 4UOEA 4C6SA 5CM9C 4MDEA 3ZWXA 4UDXX 2OWEA 4QEKA 1N5IA 4B46A 5ARCA 4C0WA 4BMXA 3C3PA 4U7FA 5HRUA 3CVWA 4E30A 5CRIA 4XM0A 2BV3A 1HY3A 2OXFA 2O3QA 4GR9A 4LWOA 4F84A 5KWEA 3FOFC 1JKXA 2C5BA 2P65A 2MHCA 3L0YA 2P2SA 4KZPA 3WTCA 4BGVA 4C6TB 1Q7RA 1V95A 3LOQA 3N7AA 1SKYE 1GYQA 4EL0A 4KIWA 2OHXA 4CL3A 4YRKA 5HP4A 4XYGA 3DHVA 3EH2A 5E38A 4HDRA 4OA5A 3EG9A 2ZSHA 1E4OA 2CXPA 3IMKA 3HEBA 4MWSA 1N2IA 1S7GA 3AXTA 3RSSA 4U8HA 4UVHA 3TINA 2PMDA 3DCNA 2BAGA 3WIVA 4A73A 5DSTA 3OZBA 1ISRA 2BEKA 2C88A 4QPPA 1D2MA 1LSSA 4LECA 5K4AA 1J24A 4BLUA 3PL1A 4MQMA 2V7GA 3ZBUA 3AR6A 4CUJA 1RQGA 3FUTA 4QRHA 5J5AA 1WSDA 2H51A 4K9DA 1A7AA 1AKVA 4OK6A 4LJRA 2G25A 5AHOA 1XCLA 3ZYZA 1ZOSA 1FRFS 2V7PA 2ORVA 5GV8A 3JY6A 2RGAA 3LQRA 3N0XA 3NTRA 2WYOA 3ZE6A 5HX7A 1D8AA 3NHBA 4OM8A 4HC4A 5LFAA 2GD2A 5ALFA 3PFBA 2BFPA 2UXBB 4YR9A 4ZZIA 1YZNA 4QASA 2K6GA 3RS8A 1WZEA 4HP8A 4FMBB 3H0CA 2GXQA 2IEBA 1GARA 4I55F 1RJ9A 4I50F 2CEKA 4MKFA 2P9FA 4POAA 4OJNA 3BB4A 3RIHA 4EFNA 1AUVA 4EVQA 5FNZA 1DJQA 2BD0A 2VCEA 3MQFA 3S1LA 1Z6ZA 1U63A 5JQGF 1FX1A 2ZQ5A 1TGVA 4KQEA 4QHTA 3TAUA 3Q7EA 1JVBA 1V1RB 5KTYA 4A7PA 3D5EA 1E3JA 1PEKE 3RCBA 5JD6A 2DVMA 3SJUA 1Y7HA 3UOAB 1Y8ZA 1Q22A 3S5JA 2W6JD 4AJHA 4IHJB 4QQRA 5EJEA 1D1QA 4J4BA 2HK7A 1JXMA 2WVAA 1YL6A 4P26A 3GD7A 3ZX5A 4QDJA 2QZJA 1YTLA 1R12A 1UBHS 1FOEB 2OO7A 4Q1CA 5I01A 3MTEA 1RJWA 3QEJA 4CR8A 2VF5X 4HNQA 3CE6A 3T7EA 1E2GA 3DTNA 1QLJA 1TVKA 1GV1A 1BGWA 2PLWA 2XHEA 1E4EA 3N8IA 3O1IC 1NW6A 1E63A 4FNMA 2D5BA 1UT6A 5JIBA 1U8XX 3WB1A 2HRQA 2VJDA 5LKRA 1CF2O 3WOHA 1D1SA 2O2HA 3JR3A 1M2FA 4B9AA 1SZCA 3A3YA 3FLBA 1YJ9B 4O25A 1WMAA 4S05A 1TZMA 4JV5B 4J16C 3VH2A 3CU5A 4QOHA 2UXDB 2IHVA 4P80A 1E2EA 5AVWA 4XX0A 4Y2SA 3U7FB 3NV9A 2C5GA 5CEFA 1Z2NX 3GLVA 4XGIA 4Q19A 1ZIPA 2M32A 1TECE 2J3IA 4I5GA 3DHYA 1XAIA 4JH0A 5EP3A 5JAHA 1KMHA 5DHAA 4Q7JB 1BA2A 3Q8WA 3Q39A 2VYND 4G8CA 4ROTA 1BMFA 1CEQA 2YVKA 1N6KA 4CF5A 2NXWA 1KI7A 1YV9A 1T0HB 3SOZA 3KKQA 1E2NA 2BEVA 3IPCA 1ESMA 2WSSA 1R0CA 3GH3A 5A7FA 4D4HA 4JLUA 5KAPA 8ABPA 4DQKA 4ZO4A 1X7XA 4ZAFA 5FYQA 3AERA 2AW3A 2Y1KA 1DRWA 3CV3A 1GGMA 3DO8A 3HGMA 4RK7A 4B7ZA 5LMCA 4FFSA 1A8UA 2LDBA 5JECA 2G63A 1HE2A 3OCJA 4MKRA 3SEFA 3PCTA 2WK1A 4TRMA 2R62A 4TVKA 1T24A 1QBGA 1JI0A 2D2XA 3EXHC 4XGQA 1WHSA 2CWWA 1F4VA 2B34A 4ZAYA 3RNOA 2XDQA 3ZLUA 1C80A 2I7CA 4DNOA 2IPMA 4XGRA 1FVXA 3FAKA 4RV4A 2X0RA 4EUEA 3U40A 2IY8A 4WVFA 4ABTA 3FIUA 4OBEA 3DZKA 5F4ZA 4XB2A 4QBGB 4RLZA 2OQRA 3B13B 4BP3A 3R4VA 1Z13A 1S2IA 2JCBA 5DO9A 4C4XA 4URHA 2ZR9A 2I0FA 5TX7A 2EJCA 3LUJA 4WFJA 5FNVA 5B3LA 1PV2A 3H75A 4L75A 3NBYC 4K9RA 4PO1A 1KOLA 1PSWA 1R0XA 5H4GA 3CCUB 2OMEA 4GMHA 2CE7A 4OP1A 1FTYA 2HFJA 1B43A 4X6UA 4C0LA 3OHSX 1UP6A 3QX7A 1PW7A 2G5CA 3Q98A 2OBBA 3EIQA 3N2LA 5NULA 4F2PA 3KETA 1KS2A 3AL2A 2D0PB 4O2BF 5IPFA 2ZRJA 2HBQA 1AA9A 4K05A 5A05A 3CC2B 1JQEA 1PR2A 1NUSA 2DFNA 2XIQA 3ZU4A 4HEQA 4PGMA 4AJ4A 4AUNA 5ULLA 1MPTA 5JSZB 3PX2A 4QM7A 3N2YA 4NBLA 2GOYA 1BQEA 2GM9A 5B58C 2R7LA 3MT7A 1ATZA 1QYVA 3FE2A 4RETA 4YVFA 2H3HA 4GYKA 1AF7A 1HYBA 3R3JA 4L95C 4MTLA 1DZ3A 1Y1LA 2FLKA 2IBTA 3A1NA 3SC4A 4E31A 1VIAA 1QC5B 1WW3A 1YK1A 2V7QD 3ELDA 2OECA 2QF7A 3JWGA 5DMXA 5EPOA 5I9LA 3BHMA 2ZZFA 1RJEA 3LYLA 4YPFA 1VLQA 2WYWA 4DIOA 1VMAA 3CR7A 1YE8A 3VPBA 2DHCA 5TXGA 2A14A 4IDCA 4NBSA 5BSHA 3CHYA 2JJ1A 1SUCA 4CM9A 4TKOB 5KYUB 1QIEA 3CBQA 4F4IA 2GNOA 3H5IA 4TWAA 1T2CA 4UBOA 5HTKA 2G0AA 3DBLA 4ZVQA 5C3UA 3M4ZA 4LY3A 3L7YA 3M6VA 5K4HA 4MYUA 2PMBA 3CEHA 4Z7OB 4BXOB 4OUDB 4DCTA 2C9OA 2XB8A 4UBNA 3P9NA 1BMTA 4JLWA 1Z75A 3O8NA 4MKGA 3RTBA 3SJAA 4A91A 4MB2A 4G24A 3PWTA 1DLJA 1FUYB 5IVKA 4XUCA 4OL9A 1OBCA 2ATXA 1KVSA 2XYHA 3LW8A 3OEED 4QC2A 3UQYS 2OHFA 4PVCA 2AE2A 5THKA 3KR0A 2VTBA 5BY2A 4GXTA 4HQOA 5F64A 1VYTA 4US0R 1JHVA 1VYVA 2D7DA 5ED4A 2FH5B 3I12A 3PC2A 1I9GA 1IWBB 2IXFA 5KAMA 1G3QA 3H3FA 2IXEA 2HMSA 3HFGA 3PC4A 1EXNA 1UMDB 4CMAA 2Q28A 2FQWA 2C07A 4BX3A 5JFOA 1QO0A 1Y6QA 2ID4A 2GXSA 3FHJA 5IYWA 3PQDA 5EQDA 2OR3A 3VM6A 3IO3A 3ESCA 1JEYB 3B82A 1AN9A 2O2ZA 3MF4A 3NW9A 4JUAA 4MUNA 4DLNA 4EGAA 1RXWA 3LC1O 4DCPA 1IM2A 4EB6A 5I6DA 2ATCA 1SKQA 4YREA 3AY3A 1EG2A 1TPZA 3EAFA 2C2MA 2QAGC 1F8YA 2ZSBA 3DCIA 3E8MA 2VL7A 3N07A 1EDDA 2JPDA 4LE1A 4JDPA 4QE3A 4HD8A 5DHRA 3X0DA 3ZV6A 3E58A 1DKMA 4PTYA 4NCNA 2GM4A 1QYWA 1Q91A 4PLWA 4CKBA 1BFUA 5IFLA 2LDXA 1NR7A 4NONA 5B3AA 5FWXA 1Z8NA 3GRCA 3WFJA 4BNNA 1OBOA 1DC5A 4FXPA 1ETHA 5DWVA 3VSCA 5KNBH 4Y2PA 2ZS9A 4OHXA 3CJQA 1ZQ1A 2AQHA 3JV7A 5HHTA 3VKWA 2Z6AA 3GI1A 3NRCA 1U28A 4LRQA 3MEQA 3LQEA 3JALB 4WXYB 1VXOA 3GROA 3ZR4B 5FPKA 1ZD4A 1VPLA 3WYNA 2EX0A 3LL7A 1DELA 3CLUC 4EFMA 4N5DA 5HQ3A 4NZMA 4HYYA 3QF4B 4LTDA 1V2GA 3N8KA 3QLVA 4OLJA 2H18A 4GUDA 2Q3LA 3MTDA 4YI3A 4IFTA 5EXTA 4MW5A 2IHYA 4H35A 1GTSA 2PUEA 1CUHA 1G16A 3U3JA 2ZRDA 4IMRA 3MJVA 4O4JF 4IMIB 1VHJA 3VPSA 3PG5A 4Q02A 3M6AA 4O3FA 5IAOA 3ABOB 3ICCA 2H0QA 3QIAA 1TIPA 4WV3A 4BU1A 3RG2A 3M3PA 2AEJA 3RSHA 1JV2B 2ZXFA 3L7BA 3O90A 3Q1LA 3QWBA 1C9NA 2QXTA 4G5SA 4A0FA 5IC4A 2O0HA 1ISPA 3M1LA 4GECA 4KG7A 4PZUA 4EY7A 2ZVPX 4OQYA 4Q3BA 3WL4A 5CYGA 1JX6A 3L7OA 5BSWA 3BEDA 4BFVA 3PTLA 3A6KA 1K2VN 3U9SA 1E1LA 1WX1A 2VDUE 3IUPA 3QI2A 4TLBA 5KKAA 1UWCA 3WLLA 5A4MS 4TUYF 2XKKA 4DHWA 5EQTA 2BEUA 3QBEA 3CG0A 3CZ5A 3ANXA 2Q5IA 2ZIWB 1L5GB 3LCCA 1X6VA 5LDGA 5ARBA 3TKYA 1Y7LA 2X76A 3MJDA 5I7AA 4ZJUA 3OWXA 4B6SA 5JASA 3I8SA 2PX5A 3UPTA 1B8OA 1VHLA 2P8JA 2RHWA 2RGXA 3GT4A 2BGWA 4B2YA 2UU9B 4HGRA 2H3EA 5AM0A 4GR4A 2NZYA 2YYZA 5GVRA 5HIAA 1JPUA 4DIBA 1IN8A 2BONA 2OAGA 4OSEA 3U4AA 2QR5A 3NTUA 2ZVQX 2FMKA 1JR3A 2YXBA 2PJUA 5DNCA 1HZJA 2FDRA 3HCOA 3IELA 5IJ0A 2OVBA 1GGNA 4OHYA 2O6HA 2XDQB 3SFZA 4L5YA 3PQ4A 4TTJA 4P3NA 2OOSA 3W4KA 1F20A 2ZUEA 2IP2A 3WDKA 1O97C 2EJTA 2B69A 1ZITA 2RHCA 4NMXB 1YR7A 4ENWA 3ZD8A 3RHFA 2CZGA 2A9PA 2GD1O 3FDIA 4J1SA 3GLTA 2LCIA 3DMGA 5CBKA 4ESVA 1B2RA 2OK7A 3QRWA 4G65A 3FZGA 4G4JA 4MLDA 1JNYA 1MVOA 5G0VA 3UXMA 2XV1A 4FHEA 1I7LA 4JVSB 2ZYIA 4IIJA 4A1FA 5DNUA 3HUDA 2JK0A 4DCCA 3H11B 1C30B 4LQ4A 4URWR 1FTWA 2Q27A 5HDQA 1QGYA 1O6ZA 3E3AA 3L7CA 3SIRA 2W2KB 3BD7A 4D3FA 5LLDA 4DV5B 3FMVA 1BKYA 4EM6A 4P6VF 5IWAB 1W36C 2PVPA 4H77A 5T3YA 1RHKA 4WKNA 1V39A 4YROA 1T6XA 1GSOA 3LLCA 3VDMA 4LBVA 3AIIA 3R9XA 4N3CA 3P0IA 3IUMA 4N6NA 2CK3A 3EXG1 3NJ8A 3HU3A 3D5QA 1H9BA 1ZMBA 1PZMA 1O4WA 4RL4A 2I4RA 5G1NA 3W3AH 4UMVA 3KLMX 2GN6A 5G4LA 2X7JA 3U7QA 1I3KA 2I34A 1SXIA 3RRBA 2C82A 4EO9A 5F23A 1D6MA 1XRJA 2QK4A 4CM7A 3NC1C 1X7YA 1IUKA 2WLTA 4RDJA 1QHGA 1L5OA 3C3XA 3NKFA 4RGYA 3M9XA 5AXAA 3SYMA 4Y2YA 2ZJBA 3R24A 2Q3CA 2PQ2A 1ZU5A 1M2HA 2PS9A 1AUOA 3RGGA 3WNQA 1J21A 4YAUA 4D2IA 1JDUA 2Q8PA 2WJ3A 3BWBA 3HVUA 1T5TA 1BS9A 2VJMA 3WYBA 4ABYA 2W2OA 4RVOA 3TF5A 4JNCA 3E3MA 1S2MA 1B76A 2LD4A 1DKQA 2J07A 3O8LA 3UK0A 4DB2A 3ZU5A 3W9UA 1Z5UA 4ZT2A 3IXMA 4NWIA 2Z9BA 5EXDA 3AHFA 2Y1LA 3DT8A 1XCPA 1PJAA 1JHRA 4S1VA 3FLEA 4TL9A 4JT9A 4J6FA 3Q1KA 1LPAB 2B25A 2QDKA 5E3JA 1Q1AA 4BKQA 3SXUA 3NANA 5HXAA 4HRAA 3WL5A 4WECA 1PK9A 2XCQA 3KYIB 1JXAA 4H7HA 3D7KA 4NV3A 2I78A 5EZYA 2B4TO 4B85A 3EGDA 2PZLA 4D92A 2YCLA 4XR6A 3HKCB 2VJYA 1K6EA 2WFLB 1V5EA 3AYZB 4H4EA 1QFMA 1FMLA 2VC2B 4E5SA 4MWGA 4BP1A 5CBPB 2F1IA 2EFHB 5K0JA 2ZL5A 4BN5A 2TSYB 5JQGB 4MA4A 2OQIA 4NI5A 1NI4A 2OESA 3E82A 3R7FA 3WGLA 3IP3A 5D3MB 4R8KA 4ND5A 2XTNA 2JRCA 1YJ8A 1GY8A 1BA3A 4ZI5A 5BUCA 4J29A 1P8JA 4YUWA 1IQUA 5EFOA 1GUBA 3VOSA 3QV2A 1YH3A 2DBYA 1GL9B 3GF4A 1H0KA 4P4GA 1D0VA 4BLSA 4C01A 3HXQA 3TKAA 1PLJA 1P6QA 3DAOA 3TSCA 4EPXA 3JQGA 2G17A 4Z99A 1NONA 1N2ZA 3I9FA 3JWPA 4ECEA 2VS1A 4RQBA 2PNJA 3DMDA 1UJCA 2PQMA 1OXTA 2ZSKA 5DYTA 1GL3A 1ZD8A 2ONKA 1RCTE 3G6WA 1F2DA 3ID6C 3FLAA 1LD3A 2Q9UA 1V71A 1JP7A 1EJBA 1A50B 2PSSA 2RHHA 2Z0MA 3G79A 4D0NA 4D8VA 1DI0A 1UANA 2OBRA 3U7GA 5F73A 3RJZA 4WXMA 4CQMB 5TMDA 2ZREA 4I1RA 1A72A 4M1QA 4Q48A 4E12A 3LX8A 2W6CX 1PVVA 2WILA 4B43A 2CHVA 3DV0A 4XKVA 2O14A 3TOCA 3F5MA 4UOZA 4CM1A 3HYLA 4DA6A 1V3VA 1C8LA 3HR8A 5IF9A 5EWLB 3NXSA 4EDFA 5CGZA 1ZK4A 4EMSA 1RXEA 1QS0B 2QN8A 3S2YA 3IPLA 2AR7A 3H2HA 4B40A 3GP8A 4WCDA 3H2BA 3CF2A 4ZAXA 3M70A 4E2FA 4J7XA 1USVA 1X7HA 4LSZA 2XE7A 2BFCA 3FIJA 3NHKA 1Y9ZA 3COWA 3KJZA 3KLNA 4R1PA 5IMBA 1YX2A 3DQQA 2OHVA 5FO1A 2SNIE 1JGTA 1RADA 1SXJB 2VDPB 2RI6A 1J20A 2VBSA 4TZKA 4Z9AA 1M90D 5TMEA 2HA4A 3W5VA 3OCZA 2J3QA 2OB2A 4JEIA 4NU8X 3T9EA 4R1SA 1THZA 2OXRA 1MVNA 4RZ2A 3UM9A 3QLTA 3VYRB 1TZJA 3GUUA 3DGFC 5IK2D 2ZM5A 2JIRA 3FPPA 2I65A 1E59A 3DTYA 5ERGB 1OHHA 2XE6A 1G0NA 3OE1A 3I5XA 1UK6A 1WLSA 3A3NA 1HVXA 1HMPA 1LPSA 4RMHA 2NQ8A 4N54A 5F51A 2BFFB 3RKRA 2X5XA 1KXJA 4X7MA 5B4VA 2IUTA 4GXRA 2CKMA 5C7YA 1LJUA 4O2BA 3OF5A 1CS0B 4MITA 1URPA 4LFBB 1SCQA 5C46F 4XASA 3PUMA 3TL3A 4E08A 4TPKA 4HR7A 5JYDA 3FDJA 1BWRA 3L4JA 5AVQA 3CUUA 2A30A 2JLRA 4FOTA 4QOSA 4ZRDA 3KL9A 1WDLA 4R8LA 1LLCA 5JAPA 1PD1A 2PUVA 4BWFB 1PWHA 4UNPA 4Q9LA 1NLFA 1PR3A 2BMEA 4YP6A 3FNFA 5BSFA 1GQYA 1OA1A 3CX4A 2GXUA 2HSJA 3QE4A 1DAMA 2BEWB 4BP9A 4XR9A 4C05A 4D0RA 4E2ZA 1II8A 3RPEA 4GKJB 3T1YB 2W83A 3V8VA 3MWJA 1ODFA 1WM1A 4TYYA 1AKWA 1QGUB 2H8GA 1XDSA 2YIVX 4DZTA 1T9GR 2NACA 2QHXA 1YB2A 1V7CA 2YWJA 2ZBPA 2HF9A 2R79A 5K5EA 1Z25A 3FHTA 4HFJA 1MOSA 1TAHA 1AO0A 4Z9XA 3W3AA 5B2ZA 1IY1A 3EGIA 1KZ7B 1CUAA 3IURA 2EFDB 3ZOKA 4AYTA 2POCA 1C14A 3PV0A 4XI9A 3ZWQA 1WR8A 5JSQA 5TJHA 1TKBA 4HTAA 2Y1WA 3AVXA 2PV0A 4EWLA 3AEZA 3UWSA 1F7UA 1Y0RA 4JUCA 4LHYA 5BUQA 1FCJA 2GVZC 2Z5GA 4GAEA 3OQ1A 5FA5A 3RHSA 4C21A 6REQB 2GJSA 1Z0ZA 3HC7A 4QU5A 2II6A 4NCIA 1FEZA 1XTIA 1BLIA 1V8FA 4DS3A 1MTOA 2GT1A 4U2CA 5F3RA 3S28A 4F0JA 4PG5A 4KBGA 1FXUA 2R8PA 1ZC4A 3S2EA 2WMOB 3KJHA 4DTCA 1QH1A 2VXCA 1AQYA 1SRRA 1CS0A 5K7SA 2BWJA 4D0LB 5EJIA 3UJ9A 1W5FA 4PGFA 4V3CA 1L1FA 2Q49A 1VLYA 4LBWA 1NYTA 3OKPA 3W4IA 4ZFNA 5K0BA 2V59A 2Y99A 3AHEA 1FDVA 3ZK8A 1YONA 5KYYB 1JT2A 3GB9A 2O0MA 2SCUA 4XDHA 4DANA 3K0EA 1VG0B 5T8KA 2WYIA 1CEYA 5TQJA 3LKBA 1I3MA 2HRRA 4PIMA 4EG7A 1SXQA 2IOQA 3O4JA 2O0LA 1B74A 5GM1A 2CXUA 2AI2A 2FJPA 2BI4A 1GNVA 2GHIA 3GCDA 2REQA 3GFTA 5CNIA 5IAEA 3UWKA 3IAAA 4XJSA 4TRJA 3SQMA 2O2EA 5JRDS 4PLTA 4MV7A 4RHFA 4PCUA 2OZPA 1R5OA 4NICA 5AKJA 3IQZA 3SZOA 3U31A 1S8AA 3VYWA 3KC2A 1U8YA 3IAM6 3CCLB 1VQ9B 3M9LA 4JHLA 3AETA 4YAFA 1XTVA 2X22A 2Z8YM 4Q39A 3RRMA 3TQSA 3EPPA 3ROPA 3OLCX 3X2SA 2QXYA 4DMFA 1P18A 1O4VA 1LTHR 3NR2A 1VSQA 1XC7A 4CM3A 4YAOA 3SM9A 2JIQA 4KFRA 4MUFA 1USIA 4YP7A 4WXRA 2AD1A 1E1MA 1OD6A 1W48A 5EVCA 3JX9A 2WYHA 1VQPB 3D43A 4YCJA 5JCOC 3NB0A 2FW8A 2JFYA 3ICWA 2ZBUA 4BX8A 2XCOA 1BHSA 1E7MA 3GEMA 2NGRA 4IDPA 3B1WA 1PSDA 5DS0A 4JCOA 2JDIA 5HWSA 2M1XA 1KKMA 2VJLA 1C50A 2WJAA 3O9VA 5LD2C 5DTRA 3ZQUA 1KE2A 4LWQA 1H69A 2ZBQA 3GVJA 3I4LA 4TL7A 3WIDA 1P5ZB 1XMJA 3VUEA 3OKXA 3CCMB 2W0MA 1HE3A 1LLQA 1D2GA 1O08A 1YC2A 3O1HB 5I3ZA 1YJCA 2EP5A 3MUFA 2C5SA 3OLVA 3OO1A 4KZKA 2EJBA 4GX0A 2EIHA 4BWYA 5LN1A 5FV4A 3W5HA 3DH0A 4ITUA 4QREA 3K4QA 1XDZA 2QAIA 1EEXB 2ZSUA 1Q21A 1OLSA 1Z16A 1N05A 2G8NA 4L3WA 4C0HA 2MR5A 4GOOD 2Q6VA 1SUIA 5F52A 3SR3A 2G5PA 5KC9A 5TLSA 1HA3A 1GPWB 4FZ5A 4H0FA 4LMRA 5GPBA 2V96A 4XTRA 3RRXA 5TIIA 3KQHA 4Y2QA 1A88A 5J35A 1NBEA 1Y81A 3IMCA 3KEOA 4C04A 5I4CA 2ARKA 2I80A 4MTCA 3O47A 1N9ZA 1V1MA 3BGIA 4O4HF 1QR6A 3T34A 1T2AA 3L41A 5T4FA 3JATA 1HFKA 1R6DA 3LLUA 4Y6OA 1UBUS 1H2BA 2ZYGA 3VTFA 2AJTA 4RH1A 2IZ0A 3GRVA 1IHYA 3RANA 1QG6A 1Y3DE 2EKBA 1AKMA 5BSEA 2NUTB 4MVJF 4PW0A 1AXGA 3GZTB 5AM2A 3NI2A 3ZTYA 1OJ7A 3CWZA 3P52A 4DCUA 3AWDA 4GPZA 3E5MA 4NFSA 1EUCB 1Z6TA 4N5LA 2RK3A 3B12A 3MCVA 2R84A 3TCKA 1GNPA 3QPCA 1THGA 3V4RA 2QBYB 4HAOA 1QOZA 3MBKA 2R6DA 2B98A 2FZEA 5IUNC 3B51X 4JMLA 2A9OA 3DKPA 1NVWQ 1RQ7A 1QNLA 1MR3F 3QKSA 1E1RA 4P93A 1SBYA 2C7VA 3JD0A 1J97A 1HGXA 4DK0A 3TB4A 2BHLA 3T5DA 4MPDA 3PI6A 4JT8A 2QRNA 1R8XA 2D74A 4GG1A 2FR8C 4GM0A 4TLLB 2CV1A 4RZXA 2QV0A 5BN4A 3DLPX 3VPXA 1BYUA 1NI3A 2WM2A 3DTVD 3KJQA 2BKXA 5HK8A 1GVNB 2Y1GA 3QPWA 5IJAA 5TB5A 1QK3A 1J2EA 3EGWA 3P9RA 3VR6H 2YWDA 3C3MA 3GK3A 3KKNA 4R5HA 3GARA 5DASA 4ZT3A 2HW8A 4WK4B 1SWVA 3EZ6A 1HDOA 1VLZA 1A4XA 4A26A 4S1PA 1GUYA 1K7FB 2VJJA 1KJNA 4QOEA 2AFIA 5K6TA 4R3WA 5IH7A 1AZSC 1G2OA 3DWGA 3M0EA 4IXTA 4JJ7A 4LYYA 2I62A 1HT3A 2ZR7A 1N57A 1KZLA 3CKYA 2QSZA 3IT2A 3PQ7A 4YCSA 2Y1CA 2YNMA 3MJ4A 1BE1A 1TFRA 4ARAA 4HAUA 3T7DA 2F3SA 2JJ2D 4K87A 2PZAA 4JEHA 4WMLA 4ZP1A 1L5NA 1N8NA 1R4MB 1EP1B 1RAEA 2AFRA 2IU3A 2WOJA 3BJZA 3BTOA 3N2KA 1JE0A 1P7ZA 3IVXA 5ALMA 3T9CA 5KJCA 4P5PA 1RI4A 3CVOA 3K2IA 4KLZA 4M7OA 4G6ZA 1LDGA 4GOJA 3CNNA 4OGLA 3LF2A 1NLMA 2O2CA 3P20A 1ICEA 4O4JB 2V55B 1PJLA 1EWVA 3I2YX 3AR3A 4DCJA 2OUIA 4B5KA 5K8IA 4IDOA 3F8SA 1NT2A 5L3SB 4G1EB 1WKVA 1YZQA 3DKKA 3CIOA 2GJPA 3SHQA 4BJ1A 4XSHA 1F3OA 1HLPA 1TX4B 2BI7A 4HDMB 1AC5A 1BN7A 2GH1A 3OKFA 3A37A 5DIZA 2Y76A 1H42A 3ZH2A 3B2EA 4LNHA 3FWKA 5HUQA 3GEDA 3M6LA 2GM3A 1ZA1A 3G2OA 4UFPA 1HZEA 4DQVA 3ZE2B 4G1UC 1S4QA 4DC1A 1SXGA 2P3OA 5GJVC 3AF3A 3UB2A 4ACAA 1SBIA 3F8WA 3I64A 5K6AC 4QD3A 2JK1A 3EDRA 4MB0A 4BWVA 3ONVA 1OH6A 4CJXA 5JT1A 2LIVA 3L6DA 2W4QA 3GNSA 1K27A 1C3EA 1M6NA 4KACA 4LG1A 2M6LA 5I7WA 5L46A 3RU9A 1DBWA 4LHSA 4CN9A 3TLCA 1XZKA 2C0CA 4Q4HA 1KAGA 2BC9A 1I2MA 2I66A 3O95A 1IMJA 2GB4A 3ANNA 3NHYA 3DOEA 1Z2DA 2G6BA 4B0OA 4NBUA 1NY5A 4G26A 3UOGA 4DV3B 1UBMS 1W2WB 4B76A 2O2DA 3UUFA 4L4UA 1CF9A 1NM5A 1AXEA 3BZWA 2FEWB 1KFCB 3OX2A 2Y1FA 2QA4B 1G20A 1RKVA 2ZGVA 3DBHA 4W8GA 1G19A 2XITA 4AMGA 2JH3A 2ZUBA 4M7PA 4BBZA 1YA6A 1VJ0A 1O5OA 1NZDA 1R5BA 1GR1A 4MUGA 4WEQA 1CJKC 4HB4A 5JOQA 1KGDA 1ULZA 2QMEA 3I2IA 1OZ0A 2ZJYA 4L7VA 4P4UA 4P81A 4QGAA 3NE5B 2B3TA 3ONUA 2GSDA 3IESA 1C41A 1GAQA 2Z58A 2GVNA 2HO5A 4FS8A 5JSKA 3SQDA 1UPCA 3ORYA 2YJZA 3EQ6A 5F5XA 3SZ3A 3SJ7A 2R1UA 2J7PA 3NXKA 3RY8A 2NPFA 4DXDA 3F6SA 4Q9IA 5I51A 4FQ7A 4KV7A 3WQBA 1IQPA 1WO8A 1VPVA 4BNTA 4L9RA 4V39A 1Q5PA 4EG6A 2W11A 3E8XA 4PNHA 4JVMA 2BHSA 3ZGVA 1G59A 1D07A 4TYWA 4QDUA 1Y8CA 3DE5X 2V6BA 1G2PA 1U9JA 4P3OA 5H02A 3FWZA 3R41A 1DB3A 1GCAA 2ZBFA 1Y4UA 1F8GA 1IIBA 3NV7A 3LQ4A 4P4TA 5C8XA 3A9SA 4Z2YA 2R0QC 3PXDA 1XI2A 1M75A 5IJ9A 3C1TA 1H94A 1ZIOA 2YFHA 4XL9A 1Q74A 4W6QA 5DJ5A 2IPLA 4GRIA 4Y9RA 2JF0A 2QTFA 2H5IA 1U9IC 3C70A 1YDEA 1LXCA 4X85A 2JLSA 1TUBB 3FY4A 4MCIA 7MHTA 2ZAMA 1D2CA 2ZE6A 4GE3A 4CQNA 1EJ6A 2VPIA 3A3BA 2JVJA 2C4TA 4W5RA 4P4SB 5E9AA 3REOA 2EW2A 5CTAA 1I6WA 1JMVA 1P31A 1U7ZA 3EDCA 1QOQB 1PWYE 4KE8A 4WESB 2EX1A 4WNAA 3RBAA 3K1YA 2C77A 4DSAA 3ETGA 4LZNA 4B3TB 3A14A 3PNPA 3ZCPA 5JQWA 1DEHA 1V26A 4HX5A 4LDPA 1FVHA 1JT9A 4OF4A 5GIPE 1C4OA 3BVPA 2HSDA 3JWJA 4RJIA 1FFXA 5J43A 2GFHA 4D8YA 2OHIA 2VUIB 4JU8A 1KH2A 5ELLA 2JGNA 2Q21A 1U3UA 2QRHA 4ARCA 1EIWA 2H00A 2NSJA 1VSUA 5EG5A 3OT4A 4MVJA 1RWVA 2OLJA 2PMEA 3EEYA 3UFXB 3I55B 2AJCA 4DAOA 3KYCB 1I4EB 3GAAA 4I3GA 2DIEA 3ZE7A 1JWLA 3OUZA 5JDCC 1DV2A 1EYZA 1CKEA 3D4LA 4H16A 1QRUA 1N06A 4FNOA 4Y6RA 5ALQA 2H1SA 2O54A 1XRRA 1IONA 1C4KA 1S02A 3USZA 1V45E 2Y6UA 3HRKA 1NP6A 2VPYA 3HYSA 4A8JA 1KOGA 4A8HA 3LYUA 3W79A 3NYIA 1MX5A 3R3YA 1ZPDA 4GF5A 2X77A 3LFUA 3DVLA 3NORA 5EINA 3K8OE 2B3DA 4RLHA 5CDYA 1V8BA 2F3TA 3KPWA 2AJ8A 2ZB3A 4AMUA 2QM3A 2CVHA 3MW8A 1OTYA 1R27A 1V3QE 2W4MA 1J7KA 2R1ZA 4EYOA 2BEVB 3KQKA 3R8FA 1OW3B 1E18A 5IYNA 1SK8A 3HA5A 2VH5R 2L69A 4S1WA 1PG5A 3CX8A 2ROQA 3EY4A 1CP3A 1L2TA 3KSRA 5HM8A 1K8XB 1G0OA 2DJIA 3I9OA 5HUHA 5J2TA 2BPOA 1OLUB 2WWRA 3KCQA 2P67A 1IULA 4L22A 2WYUA 1IOZA 2O48X 4TLEA 3W9YA 2PIDA 5CEEA 2B5VA 3QMVA 1X70A 4HNTA 5FUBA 1GADO 4UBMA 4FIDA 3KZCA 3PGMA 2AS0A 2CW5A 2ZI4A 4H3KB 4B7CA 4JWKA 2FSUA 2P9HA 1CUBA 2WTXA 4O0LA 3SC6A 1N6LA 3ANYB 4L5JA 3BL8A 4EK9A 4II3A 4UTOA 1T3LA 4C0AC 4F4CA 2HDOA 3QOYA 3U1VA 1LPNA 1B42A 3UQZA 4CMIB 1QGZA 2J7KA 3SJZA 4PRZA 4NPCA 1T3ZA 2B8EA 4BEWA 4ZJPA 1L7QA 3WLQA 4LNUB 3BERA 1CV2A 3QJ5A 4RMJA 5BUZA 1O95C 2A94A 4AJIA 3ND7A 3C8MA 1CQWA 3UKDA 1G5HA 2RI0A 5GOZA 1I18A 3ICPA 3R1IA 2WWXA 4D5EA 1RCFA 4FSXA 4F2DA 3ZX4A 3OOWA 5HR5A 3UCEA 3JQAB 1RD4A 3F7MA 4GIBA 2O8FB 1G20B 1GEEA 1KC8D 1DV1A 2PZGA 2XMSA 1BWSA 3JZMA 3Q3EA 4JGIA 3RBZA 2GD6A 2H2IA 5ERYA 4IVRA 3GT3A 3VJKA 3GJ7A 5HZMA 2W7TA 1C0IA 3H16A 1E3SA 2W2KA 5IJZA 1PAUA 4DNRB 3UMFA 2A78A 2HNBA 4JYBA 4YMWA 3CZ9A 2DH5A 2BGMA 3EW7A 5KQRA 1LH0A 4RF2A 1U2ZA 5CA1A 4UVDA 3GEHA 1GSAA 1U7DA 3WO0A 2APJA 2OZEA 4CGYA 3MAAC 3WLSA 4WN9B 1M7GA 1DMSA 4RDXA 2OA0A 5EZSA 5M34A 1A2QA 1ARZA 3H5WA 3CFYA 1MAVA 1JSRA 1QQTA 1D9ZA 2C3UA 3E7WA 3QNWA 1QZUA 2X6QA 4FDUA 5CPBA 5ALXA 5DBEX 4Z4VA 2C42A 2RBKA 2BP7A 2LTAA 2XNHA 1SPBS 4YT4A 1N36B 2ZVDA 3KSBC 1SCKA 4JLVA 4RENA 5EOVA 2KX7A 2R6R1 3Q41A 1JHPA 1S2NA 4QUZA 1T8PA 4EPWA 3EF0A 2PZEA 3L07A 3SKXA 4ZYWA 1GYRA 2GBLA 4P08A 4BO4A 1W87A 1QKKA 1GLNA 1YZVA 5D85A 3ASVA 4R4JA 4MJXA 5CFMA 4H7JA 5I9BA 3H5OA 2GJ4A 4MYSA 5J2UF 2XADA 4I5IA 1RC0A 4HE6A 3SEAA 1DG3A 2HDNB 1HZZA 3SZLA 2HV8A 4MV1A 4QXMA 1DT5A 3L4BC 2NAFA 1KSJA 3BY1A 3BB1A 1B6RA 1R9NA 4BAUA 3B3FA 1YI0A 5D3KA 3TCNA 3SNHA 3H4TA 3SQXA 4RA6A 2D3WA 3U81A 2X85A 2AFIB 2JGDA 2EX4A 3F5FA 4P0PB 4V1CB 3DNFA 1TO1E 1FYDA 1HBJA 7AT1A 2D8MA 4LUCA 4JR2A 4EI9A 3HO1A 1MO5A 4DUZB 3F6YA 3H4VA 3IJEB 1R2QA 4L8WB 5ALGA 3TEMA 1EUZA 1HLGA 4IJQA 5EHGA 1FFBA 5CX4A 3PXEA 1QGED 3X43A 3H6GA 2FZ5A 3H2JA 3BILA 4PRYA 4M2LA 3IE2A 1SUEA 1YZTA 3CYFA 2IUUA 5D7NA 1NJFA 4PN7A 4YMHA 1CFZA 1ULHA 3GLHA 3WTBA 3QF7A 2QQEA 4A0HA 3T38A 1RPTA 5L7TA 4J4TA 1LC3A 1QVWA 2JATA 3QE3A 2N47A 2QD4A 2FPSA 1PWEA 5JC8A 4I4TA 3OPNA 3A1DA 2BFNA 1N92A 6ADHA 2AKEA 3A8KA 1A3CA 2QUZA 2H2DA 1V16A 4KQJA 4BO8A 7GPBA 5KOJA 5CCXA 2XWSA 4BNYA 1E6EA 4Y2TA 4PFJA 5EE5B 1CEEA 1E4VA 2V8OA 3GJXC 5H7XA 1L4GA 4FMCF 3VU9B 4A27A 4AJ2A 1KAMA 2ZDGA 1I4WA 3N5KA 4NK5A 4UHFA 1F2UB 3FZQA 1F6DA 1JU3A 3A1VA 1NZJA 4R9NA 1NVVR 1SQ0A 1XEFA 3R3VA 3INRA 5C5EA 2CXOA 4X90A 2BM1A 1N5RA 5C1DA 4EX7A 3QVXA 10MHA 4ZCLA 5GONF 5CFOA 5KDDA 2G67A 4GMGA 1QHHB 1PE0A 1IVNA 2HV9A 2QYOA 3Q15C 3U56A 5FQNA 4JXXA 4FLMA 1CY0A 5KNDA 5K2MA 1RYEA 4CYMA 4D44A 1LRLA 2F43A 1LI7A 3AGQA 3GDGA 2GR9A 4AO8A 3WK6A 4I8DA 4N8SA 2C29D 1E3WB 4DMMA 3QKWA 5IKMA 1DKOA 2DSNA 2IIPA 2QYSA 3SYKA 4DSTA 9GPBA 1Z0SA 4OXIA 2WZCA 2FZCA 1ULBA 2HZ7A 3HJBA 3P4UA 5ELXA 4V2UA 3GDFA 4BNDB 4PYLA 3UAGA 3PQ2A 2VDOB 3GLSA 4XOUA 4JI1B 3UGKA 2LW7A 4E2YA 4LI0A 3RLIA 1FQWA 4LAFA 3R6DA 1Z36A 3ABZA 1OIWA 3N1UA 3PF9A 3A6JA 5JWRA 2PT7A 3LWBA 1T34A 2AEEA 1GU1A 2OTLB 3DP7A 4LEIA 5SYAA 1GDTA 2O8DB 1ZRSA 3OMLA 4X64B 4ZO7A 1A71A 3BK2A 1TQ8A 3TIGA 3CKKA 3UAVA 2P69A 1XF1A 3NT2A 1M2OA 3TTSA 2W8ZA 4DNPA 2P9TA 3PPYA 3VR6A 4CMEC 2WBLC 1HNNA 2YOHA 4TV8B 1G60A 3TL2A 3V8BA 1AG9A 4LXGA 3N76A 3TOVA 3VDQA 4UNRA 3ENKA 4JXKA 5B57C 4AY6A 5JR3A 1SKMA 2F4NA 2OZVA 5EWMB 4OHVA 4JL5A 3UAZA 4Y2GA 2CF6A 2QU7A 3ZD7A 2Z9CA 2B37A 3DWIA 1I1HA 1RYMA 3ED5A 5EKTA 2GPNA 5FLYA 4L08A 3CLUD 5BP7A 1SZJG 3MWDB 2WJPA 2I9PA 4K3UA 4MV6A 3E7FA 5DHPA 1Q7GA 3VVLA 1E99A 1GQQA 4E1BA 1QRTA 3ZDAA 2HJGA 2PTGA 1ZNYA 3EN0A 1J6UA 4XX1A 3LM8A 5IKPA 3WZ2A 3MA0A 4RQAA 3U1TA 2B20A 1MG5A 1U7OA 1ULTA 2PO5A 2ZJZA 2ZJ6A 4ERNA 5JXWA 1VHOA 1WDWB 2XDYA 4IGKA 2XNDD 4JMPA 4PU0A 4ZT7A 1I7NA 2CMHA 2X8AA 3SD7A 3D3WB 3B7PA 3IAS1 1M2NA 4XJXA 1IBLB 1NF3A 4N41A 2BGKA 2WAYA 1ZGHA 1I6MA 1V96A 3NHMA 3QHAA 4JKIA 2YV1A 3MRVA 3PICA 3A7EA 3AJAA 1P1FA 3EXAA 3UMBA 4BQOA 2ZL6A 1KI9A 3AOEC 3HU1A 4EJMA 4RCVA 1P2FA 4TYPA 4AULA 4LCJA 3DEHA 3QEMA 1GXSB 1UMCB 3ZDQA 1RDFA 4BPRA 3Q7TA 2CXXA 1XMVA 4GPTA 4YCDA 1FVOA 1UPAA 1VXRA 2UXCB 4UHJA 2JI7A 4M0LA 1H3EA 1FFDA 1XEXA 2A58A 3CMAB 1N9KA 1IAVA 3SR4A 5CDHA 5LP6A 4AI6A 1B73A 3CLHA 3MWLA 4BFYA 2I99A 1KIMA 1DO0A 2QN7A 5U4QA 4I8XA 4WGGA 1DPFA 1RWPA 3MBOA 3AKDA 3QBJA 2ZRGA 4ZVUA 1P44A 4MHOA 4R9VA 1T5DX 2XUOA 4XCVA 1KEVA 2ZIZA 4J07A 2HXYA 1NVEA 1T36A 3RYTC 1SA0B 2CDBA 2DH6A 1QRSA 4BLQA 3FNIA 4O6VA 1R6BX 1KFJB 1AHIA 1Y0YA 1CB0A 4RPCA 3R9XB 4OLAA 2IHJA 16PKA 4G36A 4BNWA 3E0XA 3QJYA 3L8EA 1EDEA 2C7QA 4AZ3B 2IZOA 4OYYA 4OOSA 3A0RB 2ZI5A 1X0XA 3K3PA 1G8FA 3R5XA 2B8TA 4INPA 5CCEA 4AIIA 2CL5A 4KX5A 4TXNA 3X1ZA 1XVLA 2GJAA 1ZD9A 4TKZA 2I6TA 4YNBA 3VKUA 3T0FA 1XTKA 4LDNA 1W75A 4O5OA 3ROZA 3VVBA 5DV9A 4ZOQI 1P81A 3IAEA 2YWCA 3JD1A 4MUHA 4N7JA 5C4IA 5J58A 3HU5A 3ESBA 3WP0A 1YQ9A 2BKAA 3UFBA 4F6RA 1FPQA 1WB5A 2Y0CA 4QICA 1BC5A 3FWYA 1HQYE 2FWPA 4MQEB 1WTHD 1AQNA 4RSGA 3H1BA 4RDLA 2F6RA 2ZK7A 3H7IA 2XYVA 4MI6A 4D4MA 2I1LA 4UQOA 4X1KB 2OFFA 1O94C 1JLKA 3IBTA 2C3MA 1J49A 4J43A 1T5EA 1IN6A 2HIMA 3B8EA 1DP4A 1FU4A 1JG1A 4JQCA 1NMQA 3EULA 3PUWA 1T1IA 1XEWX 1VE9A 2GPWA 2PA0A 1Q50A 1RBZA 3ZCXA 2CCJA 1FYFA 3PQEA 2IZ6A 1G7RA 2WD9A 5K6RA 3OEHD 3S6JA 1ZMOA 4KMSA 4MDHA 4OJYA 1U3FA 4J4HA 4NE9A 4R1QA 3TOZA 1C0KA 1K88A 2AN5A 2EOAA 3GJ4A 1LWOA 3O4IA 5KPDA 2XODA 1QRDA 3B9PA 2IYZA 4G56A 3GLIA 2QYTA 1T4CB 4DLYA 2ZJ7A 4MR7B 3KOXA 1VHQA 4CLEA 3L4BA 3OAAD 2CSUA 3JYOA 5CVUA 1ZJ5A 4NAUA 2HUPA 4QDXA 2VQDA 2WWIA 3VMFA 2NVWA 1K06A 3QV1A 5AKXA 4I9NA 2QX8A 2ZDQA 1WXIA 2OZLB 3AY7A 3UA4A 2JGMA 1IY8A 4I4IA 5C7LO 1W0KD 2F3RA 2IF0A 1UBEA 1IPEA 2D4AA 2WRZA 5E6SB 4E32A 3OW2B 2Y67A 3GY0A 2HSGA 3BBPA 1VL2A 4W9MC 1T8TA 1QYDA 2RBEA 5K8LA 3CX6A 1A69A 4OG2A 1M72A 1ZIDA 4OQFA 4N9WA 1Y34E 2WTMA 1UBLS 5B7PA 2NAPA 2P2CA 2Y9MB 3LCRA 3FI9A 3R9KA 5E7IA 3X1MA 5IKEA 3UKJA 5LOVF 1SCBA 3I9NA 4CIDA 1EG7A 3ZCRA 1K5HA 4E14A 4EELA 2GXAA 5CXSA 3GLIE 5K09A 1ML3A 1DCFA 4RPLA 3IVMA 1KAEA 3CRVA 3LOUA 3RS9A 4C14A 4KXYA 3UANA 1Z0AA 1CC1S 1YR8A 2CXSA 2C61A 2I2DA 1Y1PA 3IFSA 5LB4A 2QTVA 2WU4A 3PKZA 2IE8A 4OI0A 3JQBA 2D2VA 4GPEA 3H9GA 1EDOA 2NTNA 1B0PA 2FNAA 4R5MA 4Z4HA 1G17A 3IDZA 4PZAA 2BBWA 3MMNA 3O0TA 5DYGA 3WYFA 1X1SA 3D6VA 3DLTA 3AF6A 3JASB 3UCXA 1W5BA 4G5YA 1PZHA 4D97A 1JJIA 3TIVA 3TLXA 4HNAB 1RPZA 4GPIB 2G5TA 2UZ4A 2AN9A 3IOEA 5E2IA 4ZJZA 1CNEA 1NV8A 4HNGA 3JU3A 1GNSA 1DAHA 1UOPA 3NP7A 1KZ1A 4EO4A 1ZOOA 1II9A 5FL7D 4E5YA 2Z5FA 2HYDA 4AKIA 3DXZA 3F78A 2YJ5A 5F1YA 1B8PA 1WKBA 1N5OX 1N1DA 1B6GA 3NHSA 4F21A 2GEUA 3STTA 2VBCA 3NEJA 1XQYA 3E22B 4FJ1A 1KR2A 3TRIA 1V8DA 4YXFA 2EQ5A 1Z8FA 3EAQA 3VDNB 1MFPA 2FQYA 2G1UA 3CC8A 5TT0A 2O05A 3FNGA 1YB7A 4TN1A 1Q86D 1D9XA 1U0TA 1A1VA 1WXEA 2IQIA 5BW6B 2P27A 3ZGOA 1PIWA 1IZ0A 1EWYA 3AY0A 4UARA 4X1YB 3TLMA 4UUMA 3TVTA 2NQ2C 3OT1B 1ZEJA 4B4WA 2VHCA 2JFGA 1UCFA 2EYQA 4XIIA 1JHOA 3GGPA 2Q5LA 4DWJA 4TTRA 1PEAA 5E3HA 2O8BB 3VDXA 1IQ0A 5AK3A 3I2FA 1WNFA 2W37A 3QA3E 4HB2A 1C9EA 3D4BA 3ETCA 4JA0A 1TYEB 4MPJA 1U90A 2ONYA 3AEQB 3C8HA 3GRFA 3OFSA 4H1UA 4KXWA 3ZJYA 4CV1A 4UNNA 3R3UA 4L3OA 4Y1FA 4ZKDA 3DCYA 3M1YA 5TF4A 1T35A 3V7FA 2VJMB 1ADBA 1CVRA 1RCUA 1EESA 1KQPA 5KQMA 4U0JA 4H9GA 4U63A 4C20A 4AECA 4YACA 1VP9A 1W4AA 4MKIA 4U7DA 5J9FA 4F5EA 4B2LA 3IHKA 1TK2A 2O19A 1NA5A 1VQ7B 1YZYA 4MWOA 2XY4A 4TWRA 4CMIA 1NNI1 2Z1DA 2BCEA 2R1VB 1RAHA 1DQNA 3BMCA 3FKQA 3LIIA 3M1IA 3NDPA 3PHHA 1VJCA 1A8HA 3FYUB 4MWZA 4X41A 3R8XA 3UHAA 4QJ3A 3KVRA 4BO5A 3FDZB 1EWQA 4Q66C 4ARUA 5B5SA 2RK6A 4YC7A 2P5TB 3HYTA 3TDMA 2VO1A 4RF5A 4YJ3F 1P1HA 4QSMA 1JECA 3K5PA 3ORFA 3NBQA 2G9NA 3VX4A 4BO1A 1I36A 4CHTA 1ODIA 2FDCA 1X7DA 4HX2A 4LVNA 1CQJB 5IKOA 3QOXA 3BH4A 2YY5A 4U00A 4UUOA 2PL3A 2O5RA 1Y4SA 4RFLA 4YELA 4H7PA 2L82A 4HI0E 2MTBA 4IGIA 4OTZA 1G8SA 3LPNA 3D26A 3INNA 3HVJA 4JLDA 1HT2E 1CDEA 3NT5A 4FJ2A 2DCMA 3OZ7A 3ROGA 3OIDA 5AESA 3RTAA 2C1ZA 2PSEA 3R5FA 1LQUA 3NBFA 1DMRA 2DPMA 2GAFA 3PWZA 4G9EA 1FBNA 3HBAA 3MUOA 4RHUA 3TNJA 3WL7A 1YS2X 2B4AA 4L85A 4BCBA 4EENA 1Z2AA 4Z3KA 4RJLA 3BWEA 4LJ9A 5A1TA 4FMPA 3VJLA 4XUDA 1M7HA 3H2GA 1XQXA 3HBNA 5EXEA 3R9WA 4MRMB 4RH3A 2X0IA 3L5KA 4KR0A 1S2DA 5JEDA 1KBOA 2AC7A 4N5MA 4XFJA 4EVRA 5BVGA 3A4VA 2WF7A 3FOBA 3IEKA 1V5IA 3SKVA 4P5EA 1ZJYA 5LP6C 1KSHA 4P32A 1K3TA 2CXRA 4K5QA 3C14C 3VNRA 2LV8A 3FOWA 2O8BA 4WLFA 2E87A 4FFLA 3OOEA 2Q2OA 4BBJA 5CITA 4W5HA 4L5BA 3QG5A 2Y0PA 1TE2A 2ZUVA 4JT4A 4CL0A 1P1BA 3FTCA 5FI1B 4DYHA 4XDYA 2QZ4A 5J4LA 3U60B 1NW8A 4G9GA 3PDIB 4MP3A 3TUZC 4RVFA 4JOBA 4Q4AA 3FDFA 3QY9A 5ENZA 4CPDA 2VSYA 3TZKA 2Y66A 3MS2A 4HB0A 3EGXA 3U62A 4LKOA 3WLRA 2GPAA 3N2NA 4P9SA 4FB4A 4GOMD 3VI4B 4DR5B 1V0EA 1B15A 4IUBS 3C1AA 3W5CA 1RPNA 2R97A 4K3VA 2FPKA 6GPBA 4IDHA 3CLSC 1NMEA 3OPYB 5DTJA 3TDNA 3G9QA 1BD3A 1XELA 1XTPA 1RQNA 2UZIR 2P2ZA 1N77A 1VOTA 2IHTA 4YRAA 3BA1A 4U7JA 5B4TA 4DPKA 4RMIA 2QM0A 2CC2A 5ED0A 1N1EA 4YRJA 3PDCA 4BDTA 1Y9DA 4ERXA 3H8JA 4Y3UA 1W9XA 3NHRA 2YWXA 4IJUA 2I8AA 2P6OA 4NU6A 5JRJA 1GCGA 1Y5NA 3KJEA 2WNIA 4DDTA 4FVTA 4P36A 1FLDA 1GCUA 3BAZA 3OQIB 4YLYA 1E4EB 1ZCBA 4GPAA 5TGDA 1SVWA 1SOMA 4Q4LA 4QU8A 2FK8A 3K9CA 3RT1A 2A57A 3QPUA 4FYPA 1I6LA 2R6GA 5ERXA 2ES4A 2VHTA 3T3OA 3AHCA 3KT3A 3Q87B 4Y0AA 2IXGA 4WBNA 5JTUA 4MQLA 4KREA 4M9QA 5DNWA 2IT1A 3SXPA 2QMHA 4LDAA 3KK0A 4BNLA 5CFLA 1IEXA 1SOUA 3K8ZA 3PCRB 3R3ZA 3EHEA 3WV4A 1OHHD 2Q0SA 1O87A 1P4AA 1E1CB 1I1QB 1SG0A 1SU8A 2YZMA 3AO0B 3F3YA 5COAA 3SPXA 4BFZA 4ZHQF 3P0EA 1W4CA 4KVFA 3HG7A 3M81A 2WT4A 5DK4A 4CZ2A 5C7OO 1CS4C 2RIPA 4X9XA 4S2EA 4ER6A 1G5TA 3K0FA 3FUXA 4HZUB 1ZUNA 3BA6A 3UMSA 6ABPA 3S1SA 2JBHA 4XWWA 2HI0A 4Z3DA 1P7PA 2O0KA 1QKIA 1MJ5A 3MGGA 2F1JA 4ZZ0A 5BN1A 4ADSG 3G68A 5LQNA 1N78A 1RLTA 2CEAA 3HAGA 4KL8S 1XD2B 2YMPA 5GONA 5EXXA 1TTQB 4JLMA 4WUTA 1MV5A 2PX3A 2PAAA 2WLSA 4J2HA 4HGQA 3GLHE 3TJRA 3VGJA 5DW3A 2P6RA 3KPVA 1CERA 2AYYA 3AW9A 5F77A 1BIFA 1RXCA 1TKRA 2DFTA 2Y6VA 3FMPB 3NBAA 1ELOA 3N0TA 5F1PA 5AVVA 1FJXA 1U2PA 1N5LA 3RIGA 1VQOB 5KYWA 4I50B 1QH0A 4V3BA 1YBVA 4E5NA 4EUSA 2GFIA 3Q11A 4LFCB 3FVVA 3T61A 4D9IA 3MOIA 1JHMA 2RGWA 1MFZA 3EVGA 5FTKA 3SQOA 2ZTSA 5FWNA 4JLPA 3KSAC 3IS3A 2GZMA 3DM9B 3H83A 4EY5A 4C7OB 2W70A 4BLRA 3OAAA 2OBLA 2A2ZA 1U04A 4QNRA 1AD2A 1H1DA 2G0NA 2VXYA 3JQAA 4H60A 1TLTA 1YWGO 3LT0A 1QHNA 4X6YA 1WETA 1IBCA 3ZYCA 3S55A 2XB2A 3B6MA 4OHRA 5HTOA 1J5XA 4GMFA 2QL5A 5B53A 1C7QA 4AKEA 4KGDA 1NVKA 3CCJB 4WXHA 1RZRD 3GBVA 1QYRA 3W8NA 4DV7B 5JE8A 2DF8A 4L07A 3NU1A 4NX2A 4MDFA 4QG7A 1WMBA 4YMVA 5IZ4A 2IIVA 2JLUA 2DUWA 4JI2B 3UAYA 3UJDA 2G83A 4AS1A 2F3QA 2QX7A 2GBIA 3RV4A 4DRYA 1YLOA 3ZZUA 2Z56A 3F98A 2A1TS 3HWRA 4NZZA 2WWVD 4CTNA 4RW0A 5ITZA 1T9HA 6AT1A 5L53A 1K8ZB 4KQFA 4EY4A 1PR0A 2EARA 3GU3A 4ER0A 3SLDA 5EWJA 2R00C 3EZ7A 4DWOA 1KEPA 1HDZA 4YV7A 3TLJA 3DMPA 1ETUA 3OPMA 2PMCA 1FFWA 3CUVA 1GZ6A 1AQIA 5J2TF 3W8EA 5JYBA 4WLVA 4Z3OA 1D6SA 2YV4A 4LSWA 3CTMA 1NQTA 2NIPA 2FX5A 2VSNA 4V0MA 4BZPA 5LBTA 4AQYB 4B3MB 4PS0A 1Y42X 1UKVY 1EFVA 2JVKA 1EFDN 4GKBA 3GAFA 3LQ6A 1VQ8B 1UAYA 1ZSYA 3CJTA 4X20A 4B0PA 4H08A 4FD2A 1FA9A 1RRMA 1WPXA 1XROA 2UYYA 1GKKA 4GSKA 1L8OA 3SSMA 5JAZA 3AL3A 4LZWA 5GTDA 3TE6A 3LQ1A 4QYIA 1KP9A 1EKXA 1XVTA 1A8SA 3JZDA 4XWGA 3RM3A 3LYHA 1GLGA 1RJGA 1WEHA 4AMBA 2BZGA 3L8GA 3I5UA 2ZI6A 2VT2A 2N1MA 3I5AA 2YHIB 1SULA 4NY1A 4Z0PA 2QVGA 4DA7A 5M29A 4BDSA 3U44A 1LF5A 1SB8A 2ZIFA 2NZVG 4G0ZA 1SRQA 1H3FA 3N2ZB 4O2AB 3ONNA 3TTYA 1BOFA 3ZGZA 4TXLA 1P77A 3ABRB 3U39A 1YUNA 1KVUA 1KY4A 4PCVA 3E9EA 3VXKA 1R5NA 5IAKA 1FNMA 1T9CA 1Q95A 1UDRA 4JUBA 5JCPA 2AJBA 2VP6A 2RGNC 2ZRLA 3VHXA 2RD2A 1NZFA 1IIRA 2PRSA 1WMFA 2IX9A 2XEDA 2NXCA 2NVUB 3D8NA 1C3XA 1DBRA 1AY0A 3KYDA 4RKEA 5TS3A 4E6PA 1VE6A 3WL3A 4ZIRA 5H9VA 3ZQ6A 1YDGA 4YJ2B 1WORA 5JNLA 5A0VA 1JVSA 3AR5A 3MRSA 2JZCA 3OT5A 1FNNA 4X06A 3NALA 1NVMB 3PA2A 1H2RS 1KI3A 2Y2VA 3ER8A 4KO4S 3FSJX 4ENVA 3GLQA 1FL9A 2XNDA 4MUAA 4XAQA 1K9MD 3FJOA 5CJJA 4D45A 4ECAA 4HNVA 1XTBA 4INAA 3EVCA 2QN2A 3WLEA 2G1JA 3CNEA 2JAQA 4FGSA 3GGGA 3M8KA 1N2BA 3RJ9A 3UJNA 2EP7A 3RUHA 3SMQA 5M04A 1FXWF 2PKQO 4FKZA 1PKXA 4HRXA 2PL1A 4C4SA 3RRFA 3VO9A 1UBFA 3LKVA 1YULA 5CH3A 4B7AA 1I24A 4L5AA 3BJIC 4LXTA 5BO5A 1R88A 3AF2A 2CLHB 1I3LA 4DIMA 1ODKA 2BW0A 2FVXA 3R20A 4OQ4A 4CR6A 4UTVA 3L0OA 4A6XA 3NC0C 3UMJA 4E5UA 2Z2JA 4OQXA 2ACVA 1KH1A 2BFAA 3ITKA 4GR5A 4M1SA 4RVGA 4EMBA 3OFNA 3S3TA 4O08A 4DDHA 9ATCA 3UPDA 1WSWA 2CFCA 4HS9A 4HZGA 1KSGA 4L73A 5BWCA 4B35A 2B2XA 2BCGY 4IEFB 3DAHA 3UW3A 3LK6A 4EMTA 3OQOA 3IIIA 1UKEA 3E2IA 1XZJA 3CUYA 3REFA 4RPIA 2WM9B 1M6VB 1EVZA 3DVAB 2R4TA 2YNMC 4BAZA 1ORRA 1YD7A 4QBIA 1L1EA 5HKOA 2H4HA 1KTVA 2JIPA 3OLYA 4PLVA 4TWZA 2JGRA 3AUKA 2GCPA 4WLEA 5L4SA 2CRVA 3TVYA 1WAMA 4GKAA 4TM7A 5A0FA 1IY2A 4Q4CA 5BMVB 3RADC 1PL0A 4K28A 1AH2A 1LLUA 5D51S 1R5JA 1PEYA 4OYRA 1O95A 4EHBA 4ALMA 1UZLA 2QG6A 4Q9DA 3BCUA 1L8QA 3RSFA 1LQTA 1UH5A 1CPYA 3D2LA 1E66A 1RAAA 4XQ0A 3LVQE 1G5PA 2EBWA 3WG9A 1B8UA 1XPJA 3WNZA 2FMFA 1OX5A 3VR5D 4DGSA 2JFHA 4FT2A 2VKQA 3ZBTA 3CVUA 1JFLA 5JXHA 1H8HD 1X7ZB 5JNSA 2ZR0A 3QEAZ 3K30A 2GEVA 2X1LA 4G5QA 4TXJA 2WFMA 1S6YA 4BQSA 4U9HS 4BRSA 6NULA 2AEMA 2FJ0A 3EUEA 5CDTA 3MJHA 2VBGA 3DVQX 4XOIA 1QF6A 3EF1A 2N0SA 1EHYA 5JMPA 3DO5A 4KYUA 5TVKA 5IJXA 4LRXA 3SJCA 3ZXSA 2BRUC 1CY7A 3C3KA 3WLHA 1EJ0A 1XTZA 1ZKMA 1V7PC 4NRDA 5FOQA 4RWZA 4LTNA 1VHDA 2HBYA 4A15A 4TQUS 4GE0A 3PNYA 2YIDA 4NYJQ 1R0LA 4WWVA 2I4IA 3NGMA 4EHHA 4Z1MA 1ESZA 2WIFA 2PJDA 2BR5A 2FPGA 1R0YA 3GVPA 2ODEA 3G17A 3WGJA 1ZP6A 4ESEA 1IK6A 4QV2A 2NXNA 2PG3A 1KAQA 4JR0A 1HDGO 3NWPA 4YJDA 3RT7A 4QWMA 3ZWWA 4AAYA 1MHTA 2H08A 1AUQA 1JR4A 3LZ6A 3UJ8A 4JELA 4D98A 1DQSA 5CDFE 1W0JD 3UWMA 3T5GA 3TBHA 2ATEA 1HLFA 4P4LA 2D3NA 3KQVA 3RH0A 4ND7A 3BCFA 2VZ8A 3RC7A 5E8RA 3LECA 4HDKB 4QJ4A 1QUEA 1GTL1 3MCZA 4UEKA 5FF9A 3JYPA 3O26A 2GEDA 4OQDA 3X3HA 2D7JA 3I6YA 3LG2A 3KZKA 1NF9A 3D0RA 1KFKB 3GVKA 3HO8A 1VA5A 1G8KA 3MAJA 4K8OA 3DS8A 3QTBA 4KJXA 1KO4A 2XUHA 5EESA 1M33A 4BJ5A 3K09C 1WOYA 4L02A 2D06A 1MH1A 4CCSA 1Z6YA 1RWOA 2QLNA 3WLKX 4AZVA 3DYBA 1SD5A 4N0DA 5DT2A 4CMCA 1VQNB 2ONCA 5JSHA 2HU5A 3ACDA 1M34B 2BMVA 2WU1A 3EDYA 3KB1A 1Z33A 3R9IA 5KYXA 4CF3A 2AOXA 1BXRB 3LWZA 4RVHA 5ENVA 3ASSA 4KK4A 2P4HX 2IDMA 3IC5A 1R64A 2PD3A 4DLRA 4X45A 2OGUA 3RG8A 1BD4A 1H65A 3OQMA 4LSMA 2OLKA 4BE4A 4ZCPA 3UHJA 1V8ZA 1IY9A 3BFXA 5T41A 1JTEA 3ZE1B 5FX2A 3U2QA 1MKYA 2EL7A 3AV0B 1E61A 3JCZA 1ZM4A 4CL8A 1YDMA 1X8XA 2PCJA 1GFSA 2IA5A 1PJBA 1A4IA 3AF5A 5HGXA 5KOHA 1F5SA 4PVDA 2OUKA 1BSVA 1P0CA 3GJRA 4RIHA 1K7SN 1OFUA 3OJOA 2IOHA 1TL7C 1EI9A 2UZAA 2JEZA 3BJEA 4KO3S 4TTSA 4ENPA 1Q0HA 2ZB2A 1W5TA 3HJHA 3KHUA 2DFLA 4FNAA 3PQFA 2O2IA 1ADCA 4ZO8A 4JC5A 1UFQA 1YQQA 2H4FA 4M1ZA 2PEYA 1KJZA 1C0EA 1EBBA 1V43A 3EG5A 4PRKA 4DDWA 1DINA 1X8LA 3MQ2A 5EGNA 2X3YA 3QXJA 5JCJD 1H22A 5C34B 4EY6A 1ZR4A 4QXQA 4J3JA 5C0OE 1CUEA 4Z4GA 2C0QA 4G09A 3H1EA 3KSDO 4ZAWA 4F9FA 3L1IA 5HZAA 1YB6A 4IGFA 5JS8A 2BFDA 1JEQB 2CT8A 1JAYA 1CR1A 2O3SA 3R7BA 3STUA 5JW6A 4QRDA 1L7OA 1E9FA 4S0XA 1MC4A 1L7NA 3GOHA 2G9VA 5G0WA 4LGYA 5KREA 3E2MA 4GKKB 1DUVG 3FTPA 5M2QA 4L8YA 2HADA 2WPNA 3IHLA 4DEVA 2D2IA 5JD3A 1UXKA 4Q12A 1NVBA 2JKYA 3MINB 3WAKA 1H4QA 4PE5B 1P2DA 3H2KA 2FA9A 2VZEA 4CQLB 3NBUA 3LA8A 3T3DA 1Q0UA 5E0OA 1N5DA 2DB3A 3AFOA 2X58A 4KE7A 3ASQA 1A5SB 2F17A 3EEIA 4P58A 3ETLA 1Z4IA 3BMXA 3D31A 4AY4A 3PVZA 5GZ3A 4XLHA 5G2OA 1QJCA 3TQCA 2Q45A 2VDKB 5I5EA 4W5TA 5FORA 1CSEE 4RESA 3H9CA 1GN9A 1LQ2A 1NFFA 1I3NA 3HCCA 5FBLB 2PUAA 4DMKA 1PYDA 1YR9A 3B1FA 3BMOB 4UJ5A 1IAQA 5ESDA 1X2BA 2Y93A 3SJPA 1IY0A 3OW7A 3A4MA 3C2QA 3F7NA 5A7HA 3KQUA 1IZ7A 4YCCA 4M0KA 3IR6A 4B3HA 3P8ZA 5ALWA 2YUIA 3SBXA 1ULSA 3KFVA 2QLFA 4LZLA 4OMCA 3DZHA 1PGJA 4ZYXA 4EA7A 4KTVE 4CU2A 2Z2XA 3VPHA 1NRKA 2CD9A 2W5UA 1JDJA 3AVPA 1JRLA 4PAGA 2D6FA 4YQYA 2C9MA 4F4DA 1KSFX 1JEJA 2B1IA 2C5HA 5JISA 4D8XA 1LGYA 1GTJ1 1AIPA 2YR0A 1G9SA 2FW1A 3PUKA 4RYDA 4ROXA 3TW8A 4MV5A 3ODGA 4EPVA 3B7WA 2E6KA 4RM3A 1XQ1A 4EHNA 4WSOA 2V5UA 2O1XA 1NXOA 2WJHA 3A7DA 1DO8A 3GP3A 3L40A 4P7JA 3WA6A 2VT6A 4O33A 4YHBA 3DUFA 2V98A 5MN6A 4K9KA 4OIMA 2H0AA 1ZQ9A 4HQ6A 4X60A 3TTXA 3AM1A 3DP9A 4QLAA 3P71T 1EZ1A 2W6ZA 2XCRB 5AVRA 1AK9A 3UEOA 5CCBA 3R0IA 4YDHB 2D5CA 4IQ0A 2XWPA 4NYIR 1PF7E 1W47A 2DEUA 3C3BA 1A9SA 4FGZA 2IEGA 3QU7A 5CJ2A 2ODNA 4YAEA 3IT3A 5LM3A 3PEVA 1UEJA 3JVEA 3LXXA 3PXCX 3RU2A 1H93A 4CLRA 1JH9A 1E6WA 3EDOA 3QENA 4UD6A 1CVIA 1U8UA 1AQJA 4DLLA 1REQA 2BM9A 1C29B 2ZYWX 1J8YF 1GRVA 2V3WA 1MRSA 1OXKB 4B74A 1YKFA 1KK0A 1NQXA 1QIIA 4KKXB 1CZOA 4H0NA 4BCCA 1OGIA 4DKXA 4DG8A 5BORA 3F49S 4P33A 4DWVA 1W1IA 4FHCA 4B3DA 2J3DA 2ZCVA 3D8SA 5IDVA 4BVLA 2H4JA 2V7WA 2PLNA 4HDQB 4P83A 2FV8A 1DGQA 3G2NA 1OH8A 1E3XA 3RVKA 1XE3A 2FP3A 1C8BA 2VAWA 4BNMA 5CM2Z 2O8EB 2PVCA 1GTVA 3DBHB 2RG1A 1UZAA 4WNIA 2WYRA 3AI3A 3P0FA 5DOVA 1E20A 4KDRA 3SHTA 1JR6A 2WWTA 2DBQA 4MAAA 5KQSA 5HPYB 2WTNA 3GRRA 1GT6A 2C9BA 3FI0A 1N07A 2IZ1A 4MUYA 3DE1X 3DD1A 4PBRA 3P4XA 3V4VB 1F7VA 5CLGA 1J0AA 3CB4A 3O3NB 4F9TA 3PUXA 4OHUA 1OB2A 2VBFA 4BUCA 4RAQA 5LR6A 5LOVB 2IS6A 1U11A 1D1NA 1CUUA 1PZGA 2W8BB 4J7UA 4V0KA 1THMA 3OJWA 1NJ8A 1UXIA 3GG9A 4LNUA 5K0NA 3E27A 1JW9B 1KXZA 3DOFA 3GGCA 4OGWA 3W2EA 2PAFA 4A10A 4F4JA 1BROA 1IEQA 5FUXA 1NWHA 4BVGA 3PQCA 3PEEA 1FYVA 2X1MA 2XZPA 1XBTA 4M3NA 4PZ9A 3SYNA 2Q29A 3KM0A 1ZGAA 2ADOA 3M4YA 1NB0A 3ANSA 3O6VA 1RKQA 1WQ1R 4PSVA 4F11A 1Z4PX 2QA5A 3V2HA 4C7VA 2GN9A 4RCYA 1PNTA 5LQRA 3T4EA 3U37A 5LDHA 1CYEA 2XSZD 3DGEC 2WB4A 2Q4OA 4PHTA 1RKXA 2P2GA 2GZ3A 4KYIB 4RD3A 4MQFB 2CJWB 3R3WA 4YRPA 2F2TA 1V8OA 3E48A 5FWAA 4DJ5X 1ZWLA 5AVKA 4JBGA 1VJDA 2DUJA 4GT1A 1RWNA 1ILWA 3KTAA 3PKJA 3W90A 3I01M 4BMSA 3IUJA 1E8MA 1VI2A 3KAQA 3IJPA 1O2DA 3KQWA 1UT5A 5GP1A 4CM5A 3ET4A 1YTUA 3KD2A 1GYPA 3O8OB 4MVJE 5AXBA 3ZWYA 3LNCA 4DA4A 1F14A 4M38A 4PX9A 1RM0A 1XPUA 2PKWA 4MS3A 4KRYA 1R16A 2HWKA 3CLSD 1P5HA 1WZIA 3HDGA 2EZTA 4DK1A 4FZ3A 1UAAA 1VL5A 2GERA 4QVIA 3AV3A 1JE1A 1VKJA 3S5UA 1IXKA 4M8IA 4IDQA 4IF6A 3WQSB 4K9QA 4D96A 4DQ0A 4YPVA 1LI4A 1CFJA 2HCJB 1XZIA 1H0RA 3EVDA 4GLOA 3RKSA 4EJSB 2PIAA 2VZ0A 3I42A 3OURA 4Y2HA 2AG8A 5KQPA 1OV4A 4FMDF 3CSSA 1PJQA 5IXSA 2WTBA 2H5JA 3U48A 3RAPR 3GCZA 3E5NA 4G84A 5ALDA 4HDNB 4H6PA 3HCPA 1QP0A 2GPYA 3G6KA 4NBRA 4BE7B 2R1TB 2D1SA 4Y6QA 3ZWOA 3IRVA 3R5HA 1T6BY 3CH6A 4HFRA 4RNCA 4XLFA 4QJBA 4JJIA 3ZHBA 1P1CA 2XMRA 4RIFA 1LX6A 3EK2A 3HRIA 3ZKWA 4EPRA 3RQIA 2PRJA 4U2FA 4CW7A 1PT8A 2PT5A 4IH1A 4XGNA 3ZEAA 4HV4A 2WG1A 3H0EA 2NZXA 3PZRA 1W7AA 1AA6A 4LIPD 5H3CA 4BNVA 2C0PA 2YBEA 3WLPA 1U3WA 3HS3A 3G0CA 4XLZA 4O4IB 1FTQA 1RYHA 1AKNA 1KR5A 1Q1NA 1UJ2A 1XJWA 4MR7A 1QH8A 2F3PA 2VWQA 1NW7A 4OYLA 1SHTX 3ECAA 4IEIA 2XGOA 4MS1A 3D6AA 4OM7A 4WA7A 4RO0A 2YXLA 1AHNA 4RDCA 1JG7A 1M6YA 1Z8HA 2Z8ZA 3HB9A 1TQHA 3LHDA 3R5SA 1MQ9A 5BVHA 2ZWIA 3KDPA 3DFFA 2ECPA 3BRWA 1CUYA 2WU3A 2ORED 4R9RA 4RHEA 1E1QA 4V0ME 5E2BA 5J1SB 2R9VA 3HKBA 4DR3B 1CY6A 3OQ6A 3QYPA 2JKVA 4IV5A 4R7ZA 4UCQA 2ETVA 5HYVA 1FZTA 3FVQA 3ZVLA 2RGEA 3B9QA 2CVOA 3EYWA 4GOKA 3OPXA 4JLSA 1TRKA 2PZ8A 3AEUB 3JAKB 5CT4A 1FUIA 5TJ9A 5JNRA 4HN4B 5F33A 2CFTA 1GN8A 1UP7A 4HFMA 5KPJA 3AQIA 3BD6A 1ODJA 5IUKC 2EGUA 4IVNA 4RFVA 5AFSA 2QUJA 4JC8A 4MWTA 4KPFC 1E1RD 3NOVA 1K9SA 5EMKA 1Q7EA 1VLVA 1XF9A 1ZA2A 2GAIA 3E4CA 3ABIA 3GJTA 3I52A 3OFJA 4CEJB 3E9DA 5HJEA 4PAOA 3EGOA 2X1VA 4D9GA 4E2WA 4HNSA 5AOBA 1EFTA 3V76A 1LPPA 1P4HA 1U5AA 2CZQA 2BY4A 2HWXA 3P2IA 4REOA 4W7SA 5JCOA 2QU8A 2KW5A 3C43A 4FNGA 3PHLA 2QTRA 2Q6IA 1JZTA 1P80A 1X94A 2C94A 1O8BA 2A3NA 1VQ6B 3A6EA 1MEJA 1RC1A 2RJ3A 4M21A 5TEWA 3RVRA 1Z06A 1VLJA 5EP1A 5AMXA 2E4XA 1CTQA 5B1IA 1FLNA 3ZHTA 4Q3DA 4R83A 2VT3A 3ASTA 1N3BA 2J5QA 2Q1YA 3T4XA 5A62A 1GG2A 1V11B 1E7QA 2DERA 1EXWA 1ZD1A 2ID9A 2ZRBA 3HBFA 3BFPA 1LBEA 3OTHA 2IV2X 4B3IA 3C6ZA 2A88A 3VKFA 4NZPA 5H4HA 3L8DA 4NJMB 2PUDA 2NYVA 2POQX 2HPAA 1GNLA 2ADMA 2C57A 2HT6A 3G0BA 3UOWA 4D41A 1KZ4A 1OU0A 2Q3HA 3G1TA 3GIWA 4LWZA 4CCYB 5CA0B 4IDBA 1VDZA 3OIGA 4GX1A 3K94A 2Y1XA 5FWDA 1SVUA 4BKUA 1TF7A 3QOFA 3RWMB 4CKYA 3GZNB 1SCUB 3U44B 3FFBA 4IG4A 2FHPA 2BT4A 1LS1A 4OMDA 3HM2A 4YB8A 1GHTA 2QAGB 1M0TA 2VNSA 3H3JA 4KYVA 4C0KA 1RXVA 3ZBPA 1E7WA 5LZ5A 3S2IA 4NDNE 2AHOA 4ARZB 2X9LA 3QUTA 5DGIA 1XTJA 3HDHA 2P0AA 4AX4A 2X1HA 1BS1A 1VMEA 1EFCA 1H1LB 2PWZA 4GM1A 4YP9A 4EEXA 3RV3A 2CDRA 8AT1A 4LF7B 2W98A 1IQRA 2WJIA 4EUHA 2FXVA 2IVZA 1CHDA 2JA1A 2HLNA 1XZ8A 5ENDA 3OBIA 3C1OA 1M2JA 3DPSA 3FSRA 3ANLA 4KKVA 2J5KA 1DKNA 3FNEA 5FWYA 4MR9B 2PPVA 4A23A 4GFDA 4Q9JA 1E9SA 1RMYA 5BV8A 3IAHA 5LOVA 4MGEA 4DEYA 1QO9A 3NCHA 5LUBA 3JQDA 3ZZNA 2MYTA 1LK5A 1GEGA 2NQTA 3RKUA 3L0ZA 4YRNA 3CRZA 1TZCA 2RHDA 3FMIA 4I19A 3QLUA 4NDZA 4OAPA 4RACA 1FDIA 2B1JA 1WOSA 1GITA 4NABA 4GX2A 1C8VB 4EX6A 3KXDA 3QFFA 1LTQA 3LNTA 1MB0A 4HY3A 1HC7A 1T2EA 1YUBA 1QHXA 3DMYA 4L0DA 3LTNC 1T0UA 4BQEA 1DEXA 3OUUA 4YS6A 3W6ZA 1MJGA 3G8BA 2JANA 5BMVF 1O58A 1MB4A 4MV3A 2AKYA 2A84A 1I94B 3T35A 2G0TA 1MOZA 3DMFA 3NH6A 3PXAA 4QXAA 5DM0A 4B2IA 1SXPA 2XXAA 3KOZA 1GFZA 2J9YB 4LYGA 3NHZA 1GPJA 4UBKA 4EHAA 3MSCA 1ST2A 4IFEA 2QSYA 1QMPA 1T3HA 4KQ9A 1TFUA 2H9IA 4DNTB 3E3OA 1EXVA 2CF4A 1QU3A 4IRMA 2ZVJA 4H3SA 5MDHA 3JQ9C 1E3ZA 4G0MA 1FZQA 3L8FA 1LPMA 5JMWA 3GOQA 4ARVA 2ZZEA 4WXEA 3A1PA 5FBHA 2FR1A 2NZ2A 4OXRA 4D9EA 3IMGA