5GV8A

Structure of nadh-cytochrome b5 reductase refined with the multipolar atomic model at 0.78a
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
272
structure length
272
Chain Sequence
b'STPAITLENPDIKYPLRLIDKEVVNHDTRRFRFALPSPEHILGLPVGQHIYLSARIDGNLVIRPYTPVSSDDDKGFVDLVIKVYFKDTHPKFPAGGKMSQYLESMKIGDTIEFRGPNGLLVYQGKGKFAIRPDKKSSPVIKTVKSVGMIAGGTGITPMLQVIRAIMKDPDDHTVCHLLFANQTEKDILLRPELEELRNEHSARFKLWYTVDRAPEAWDYSQGFVNEEMIRDHLPPPEEEPLVLMCGPPPMIQYACLPNLERVGHPKERCFAF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NADH-cytochrome b5 reductase 3
molecule tags Oxidoreductase
source organism Sus scrofa
publication title Distribution of valence electrons of the flavin cofactor in NADH-cytochrome b5 reductase.
pubmed doi rcsb
total genus 74
structure length 272
sequence length 272
ec nomenclature ec 1.6.2.2: Cytochrome-b5 reductase.
pdb deposition date 2016-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
A PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 5gv8A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 5gv8A02
1KC8D 2ZITA 3PENA 4MYUA 2VYQA 3QSYA 4NCNA 2E1RA 3W2EA 4FN5A 2PIAA 3WYAA 1DG1G 2QTZA 3OZUA 1K9MD 1E64A 3CB4A 4RCYA 3AVVA 1W87A 4ZCMA 3CCRB 4LBWA 2BSAA 3G4SB 1DARA 1KD1D 1TTTA 1VQ9B 3ZBUA 3CMAB 1OGJA 1ZM9A 1R5NA 1YJNB 4PC3A 3WNBA 3QFCA 4RD0A 2QN6A 4PC7A 1ZM3A 1FDRA 1W34A 3QFTA 3AVXA 5H5JA 1N8RD 1YHQB 2RC5A 1I7PA 2AHOA 1JA1A 3ZZUA 1VQ7B 2RC6A 1Q7YD 4RD6A 3ES9A 3OZWA 1BJKA 1IJEA 1EFUA 5TY0A 1QX4A 4ACAA 2DY1A 4RD3A 4B3XA 3LYUA 5GV8A 3ZC3A 2YWHA 3CCSB 3G71B 1YJWB 3ZZTA 1Q81D 3VNUA 3CRZA 5EMNA 3W5VA 1IB0A 5GV7A 2HCJB 3CD6B 4YHBA 4YAUA 1OGIA 1KRHA 2GQFA 3P27A 4G1VA 3QFSA 1W2BB 1ZM2A 1S0UA 1ELOA 3AVYA 3QE2A 2BM1A 4QHYA 1R5OA 1QUEA 3WNCA 2BF4A 1BX1A 3SJZA 1EXMA 1M1KD 4R71A 1EP3B 1FRQA 1VQ6B 3MHPA 1DDGA 4M1KA 1YI2B 2HDNB 1QFYA 3CCLB 3CW2A 2FX3A 4H9GA 1K8AD 1F60A 4YAOA 4P6VF 4Q7JB 3P26A 4ZCLA 3CCUB 2HMAA 2VNKA 1D8TA 3I56B 1EFTA 4NBSA 2EIXA 3AVUA 1Q86D 2XNJA 1OB2A 1G7SA 1YJ9B 1QGZA 4WQMA 1BQEA 3OJXA 2BGIA 1EFCA 4LBVA 4M4SA 3W2FA 3JQPA 3WBKA 1H42A 1UMKA 2BVNA 4MYTA 4YALA 4M2LA 4TMWA 4EH1A 4RD4A 1GAQA 4M0LA 3W2HA 4QFMA 1QGYA 3W2GA 4ZV4A 3A1FA 1U2RA 2B7CA 2EFGA 4B47A 4FWTA 1S72B 1N0VC 1B23P 3ZZ0A 1EWYA 5DSZA 3AGPA 4IW3B 1HA3A 2QMUA 3J81k 3AVTA 1KTVA 1IJFA 1JB9A 1CQXA 1EP1B 4C43A 4PC6A 1BX0A 3MCAA 1ZUNB 2B5OA 4Y9RA 4N3GA 4U9UA 3B82A 1TUIA 1VQ5B 2J7KA 1KJZA 4PC1A 2OK7A 1Q82D 1XB2A 4RCZA 3G6EB 1A8PA 3AGQA 3MMPA 5KSWB 3W5HA 4K1XA 1QVGB 1QH0A 3CC4B 3WBJA 2BMWA 4TMXA 3VMFA 1G7CA 2YWEA 2R6HA 1D2EA 2QEXB 5AN9A 3JQRA 3B78A 2XEXA 1K73D 1XE1A 4YAFA 2QDXA 3W2IA 2QA4B 1FNMA 2NPFA 3CC2B 2DEUA 2DETA 4HE6A 4LBZA 2VNHA 1GR1A 1GJRA 4AC9A 3JQQA 1JNYA 2XNCA 3VNVA 4BPRA 3LRXA 2DERA 1VQMB 2B7BA 3AVWA 1FNCA 3W5UA 4B43A 1NJID 5HXBA 1VQKB 1NDHA 1FRNA 4Y7CA 3I55B 2VNIA 1KK3A 2QTLA 3FPKA 2OK8A 4B48A 2BGJA 5TR9A 1GVHA 4TN1A 5THXA 1ZM4A 4F7DA 2GPJA 3U2QA 3CCQB 3CCJB 1F20A 4ACBA 1OB5A 4AF7A 3VO1A 4UAJA 1JA0A 1KK1A 1VQPB 1FNBA 2BPOA 2CNDA 4B4DA 1D1NA 1FNDA 4RD2A 3LO8A 4FK8A 4N3NA 1M90D 1YITB 4AF6A 1QVFB 3OW2B 3WY9A 2VNJA 5TV2A 3U6KA 3E1YE 4TMZA 4G5GA 2BM0A 3ZBTA 4YAWA 1KK0A 4DQKA 1YIJB 3OJWA 3I1FA 1QFZA 1G7RA 2D74A 1VQOB 4LBYA 4ZGNB 2X3UA 3E20A 2VZLA 1R5BA 1GAWA 1QGAA 5FA6A 4B44A 3VO2A 4TMVA 2BV3A 1QFJA 3QFRA 1EP2B 1G7TA 4ZCIA 3OZVA 1J9ZA 3LVBA 2PLFA 5JBQA 3CCEB 4PGOA 1QG0A 4RD1A 1JJ2B 1E63A 2DCUA 3B8HA 4M53A 1VQ4B 4C0SA 3U6BA 1WDTA 1SKQA 2C77A 3CC7B 3CCMB 2CRVA 1VQNB 1QUFA 4RJLA 2BN4A 1AIPA 1W35A 4G1BA 3V76A 4ZGQB 1SM4A 1TVCA 2OTLB 4J0QA 1DDIA 3WNDA 1B2RA 5H59A 1KQSB 1CNFA 2C78A 2PMDA 4LC0A 1KK2A 4TMTA 1N0UA 2OTJB 1VQ8B 1CNEA 3CXCB 1VQLB 3WXMA 4DQLA 3CCVB 2YWGA 1GO2A 4Y9UA 3CMEB 4PC2A 3FJOA 4P3YA 1AMOA 2YWFA 1E62A 1TLLA 1H85A 3CPWB 4HE5A
chains in the Genus database with same CATH superfamily
1F3OA 2NNWB 3KYBA 4CG0A 1MIOB 1Q12A 5FNVB 1VJTA 1QLWA 3KU1A 4F45A 1RLOA 2QIOA 3OZBA 3EIFA 3S8EA 3G2MA 2PCJA 1O4WA 2UVDA 2E1RA 3I8XA 3PIDA 2CDCA 2R8XA 3QBTA 4LVCA 2EHJA 2V7UA 2V7QD 4EX7A 1EBBA 2P6MA 4ZKDA 4ZT6A 2P6UA 1LJUA 1P1RA 3UAWA 1UH5A 2EQ5A 1GGVA 4MGZR 5LA6F 3T5AA 5FTKA 4K9MA 3A35A 3OEHD 1YB2A 3A4YA 4PSUA 2J41A 4QEZA 1Z22A 3BMOA 4IVNA 1M2NA 1Q74A 3CNHA 1O8CA 1G2QA 2QN1A 5EPEA 1YA6A 2XMZA 1Q92A 3DDZX 3EFHA 4CT4B 1NYLA 4OBXA 4CM4A 4PGGA 3JQ9C 5CDHA 1U9IA 4P34A 3RTBA 5K99A 1LI4A 1JHDA 1JJAA 4MVWA 4YDSA 4XYEA 3I2KA 3L02A 1PG5A 2XAAA 3I1JA 2YRFA 1HETA 1NOJA 4PNEA 1R6BX 4A3SA 1JVNA 2XA9A 2M32A 1E2BA 4BKPA 4S1WA 1IDOA 4PC3A 2ASVA 1T6ZA 5CB6A 4RHUA 3B6MA 3F5SA 4O3MA 5DYTA 5EIHA 3PLAE 2NP6A 3KL2A 3DL7A 5EZYA 1BRMA 1L5YA 1BLIA 5E4FA 5A0TA 1IM8A 1EK6A 2P41A 4NENB 1H1LA 2FUEA 3KWFA 1Z5VA 4KPUB 3RIYA 3VSEA 3ESQA 5JNVA 1BYUA 4ECAA 5G4LA 1JWBB 2P5UA 5CLGA 5TNXA 2A92A 2GK7A 3ZDBA 1RXYA 2PIDA 4DRXB 4YEDA 4JUCA 4EITA 5FUMA 4HWTA 3EFEA 3KKQA 5A4MS 1T2UA 1N9GB 4QXOA 3L4KA 2OBBA 2FMKA 2XWQA 5L3QB 2RKWA 3G79A 1RAEA 3QWAA 1N5JA 3G89A 4FNGA 1BWPA 2QWXA 3T1OA 4H3SA 3VJRA 4MW9A 2QTGA 1DBPA 3B5JA 1VMIA 2ZANA 3LGXA 3PRYA 3LCRA 4RH0A 4B5LA 2X7XA 1I3NA 4Y6OA 1XOIA 4DSNA 3VV3A 4BNLA 2ATIA 1UPFA 3B1VA 1B6RA 1L5WA 1NUQA 1JBKA 1RAIA 3R6WA 4GZ6A 2QZ9A 4CZ2A 3CJTA 3Q7EA 4EBBA 4DA7A 4C6TB 5DWVA 5K2MA 4DR1B 1UODA 3O9VA 4UDOA 3ETHA 2D3NA 2QY6A 4YT5A 5DMXA 1A88A 3EF1A 3UH0A 5K45A 1B4DA 4IJUA 4QVAA 1BW9B 1JAHA 2ORVA 4X8MA 5F51A 4BUCA 5IH7A 3CD6B 1VC2A 3N2KB 1Y7HA 5FWXA 2CB9A 1VF7A 3LDHA 4PPYA 4YAUA 3EIQA 5LMNB 2QP3A 3P27A 2J7PA 2GDZA 2IT1A 3T7JA 4GQNA 3AEKB 4G1VA 2IU4A 3Q9SA 3UFXA 1R6XA 1KEEB 2AIRA 3AHIA 5KNBA 3KQLA 1KMQA 1PJTA 5CM8B 1Q0QA 4UU7A 1IG3A 1MV8A 1ZZGA 3B9RA 2IHTA 3DCYA 4AG6A 1BMFD 1DAMA 2ZAIA 4IH9A 5DK6A 4PZPA 2Y68A 3BUSA 2GNPA 3I1IA 3HBAA 4GVLA 2FKAA 2MSCB 4DMGA 3EVNA 1QRAA 2F1IA 4FFSA 1NP3A 2OXIA 2FFAA 3AEZA 3H1FA 3QKRA 4ENSA 1YV9A 3DLTA 5BUZA 4LTNA 2EFCB 5GINE 3G8CA 3IP8A 3QU9A 3ONVA 3OCCA 1VHWA 1WXDA 2QRUA 4G01B 4KWCA 4D8TA 4ZXPA 5BXQC 5HR5A 2FXIA 1UJMA 1V26A 3QKWA 1H3EA 4RPJA 4E5UA 4BB6A 2BDUA 2OGWA 4HBGA 1N6NA 4RAOA 2GEFA 1BHO1 2IEGA 2VEOA 3REFA 3BCRA 1Q1AA 2R5NA 5KYNA 1IXSB 2NVOA 4M0CA 4B5KA 3VDMA 3CCLB 4RK6A 3EIOA 3PC2A 3GDWA 4GMGA 3B5EA 3L77A 3RJ9A 4HFJA 1EB9A 2WICA 5HUJA 2V55B 5BY2A 4GGMX 3U7EB 3I53A 3BF7A 1PQWA 3QXXA 4TRJA 4KYIB 2OZLB 1HT3A 2NLOA 4KC0A 5D87A 3PJDA 2Q9CA 4WZAE 2WFLA 4RQUA 3L43A 4CWAA 2WDPA 4KXVA 3CVJA 2IUYA 4ER0A 3CF6R 2A9QA 2BFFB 4NY1A 4W8HA 3G2LA 4J0DA 4KW7A 3CG0A 1YJ9B 5T5QA 2NTEA 3V1UA 1BDHA 4MZXA 4IDEA 3OZAA 2ZRLA 3VGJA 3BE8A 5F12A 1U0JA 3RU7A 3ZLVA 3ISTA 1JJIA 3B2QA 5BWMA 2Q3JA 3HJNA 4CCWA 2QPTA 5FB3A 4INAA 5HZKA 4BC0A 3AUJB 3TQFA 3CYFA 3PQ2A 4Q3CA 4JI4B 3OCVA 4ZVLA 5LUBA 2ZB7A 3KJQA 3L8EA 1YVUA 3P2JA 6PFKA 3U3XA 2X9NA 1MOZA 4NNJA 1V2GA 1N2OA 2QM7A 1T34A 4FFLA 3DEKA 1I3OA 2MSEB 4M7WA 1KDPA 2YVQA 4B2LA 1J90A 1MQAA 2AH5A 3W2HA 2XNSA 3LF1A 3VHQA 1T8PA 2PZBA 3IQEA 1JWAB 1LDGA 2OAGA 1Z4MA 2NSHA 2EFGA 2VPWA 5LOVB 2ZRFA 5I7UA 1XHLA 1XTSA 2XUIA 3D7SA 4RSMA 3DDHA 3IVRA 3R5TA 5H4GA 2HRZA 1JIVA 2GZ3A 4WL0A 5H1YA 4A7PA 3VSAA 4NBLA 5EUMA 1PYOA 3O21A 1NUTA 3L8MA 4Z8YA 3RS5A 3WQHA 3GO4A 4ZO6A 5AD1A 3W8RA 2EJBA 4PPGA 1T4GA 3JCZA 1V8DA 2UUCB 5FUVA 3WLQA 3KQHA 4LZNA 1CRWG 1LFAA 1CS0A 1LTKA 2ZG6A 4K5QA 4ZO8A 1QU2A 5JLAA 2BEUB 2FPSA 3GRVA 5T7BA 1RSZA 4WDQA 4GGPA 1O94D 1G2PA 4HRYA 3GEGA 3MCAA 1IBSA 3H4IA 3JSXA 1NAIA 2AQKA 5A4AA 1LH0A 1E2FA 4IIVA 3BQNB 2PRJA 4KO1S 4L78A 2PL3A 5H80A 4U8HA 3W4JA 4BJ1A 1VL6A 5ECDA 2FQWA 1TXGA 1LDEA 1DWOA 3H2SA 4FGUA 4L5BA 1WHTB 4WECA 2PX3A 5F35A 3KSDO 3IKTA 1UBKS 3R0VA 4WCFC 3RFUA 3U56A 1UBNA 1YS4A 4YR9A 4CEJB 3BEOA 3QBVA 2J9FA 4UBKA 4P5EA 5EGSA 2YFHA 3B3JA 4CV2A 1F3LA 1ICEA 3CKKA 1M83A 3F71A 4LYYA 2QORA 3OKFA 5LLTA 1SKYB 3HA2A 1YB1A 3PQ8A 1RHRA 1AG9A 4KUHA 1MV5A 3V42A 5FF9A 1JZSA 2BP7A 3TSOA 4B8ZA 2ZULA 3HHEA 4GNRA 3KU4A 4Z9AA 4Z51A 3UJPA 3IA7A 2G1PA 2BR5A 1KWGA 5H16A 4CV3A 3LW8A 3N1UA 3Q87B 1THTA 1HE3A 3J80A 1NQTA 2DT8A 3FRIA 3HHPA 3JTMA 4ZHQB 1V48A 3SQNA 3PDIA 3AHCA 4EKIA 4ZCTA 3U60B 2IH4A 3PNPA 2PO5A 1NF9A 1AKVA 1K73D 1VL0A 3ZXXA 2ECKA 5K8TA 4EZBA 4DR3B 4K6MA 3TQSA 3PWKA 4KOEC 5BOSB 4X7FA 1RQ2A 1J0CA 1W2HA 5E6SB 2QA4B 1EVIA 2AFHA 2FU5C 4XA8A 2CHUA 2E4YA 2L19A 2OY0A 3A6KA 4PFSA 3ZXUB 4XWKA 4N1AA 4BASA 2JFFA 1GL9B 4XVUA 5CFLA 3MJSA 2ZIAA 1QOQB 3WYBA 4BRUA 3D3EA 3QXSA 5KWJA 4L0QA 1C8LA 2WSMA 1DJLA 2GXQA 2NQTA 4GYYA 1GAEO 2XR1A 2J85A 5T67A 2DULA 3WV5A 2VCHA 5JQGB 2PHZA 1QF9A 3DO8A 2NXJA 5I7OA 2YY5A 1XK7A 1AGNA 1YRHA 2GBIA 3LRXA 5D51S 2DERA 3M6MD 3MFQA 4JBWA 5L4LA 3GLGB 4TLEA 1H23A 1PFYA 1XBTA 5C4MA 3SGLA 1BU5A 1FW6A 1JKJA 2FQXA 1PKVA 4GUDA 2I8LA 4EYQA 4PNZA 3LYLA 1T35A 3CPHA 4MYHA 5FUBA 1WCXA 4DILA 1OXVA 4B43A 2F9LA 3CH5A 3KZCA 4L3OA 5FTNA 1TCVA 1U3TA 2P0YA 4CM3A 2ZBDA 2ZB3A 4US2R 1GRVA 3WGIA 2JGNA 3WLSA 3NATA 3AFOA 2IEZA 1SBHA 2YZ2A 3TH5A 3ZE1B 4F9TA 3IIIA 1G21E 1RRPA 1SUPA 2I7DA 1X8JA 3GRAA 3RIGA 2PRZA 4ZICA 2JKYA 2HADA 1OC4A 3ST7A 3VH3A 4CLRB 1ZGHA 1PWEA 7ABPA 3TTXA 1SFRA 3IBCA 1IULA 1AS2A 3ESBA 3HCWA 3BZBA 4RA6A 4B1FA 4KIGA 1RM5A 3T3PB 3KR9A 2VBGA 3Q85A 4HGNA 1EK5A 3WTBA 1GSOA 2WP8J 4NJOA 1E1QA 4UVDA 3UENA 3IELA 5FV4A 2K7ZA 2EZTA 2RHRA 2WKSA 1V9CA 2F6RA 4HDSB 2EKLA 2CL5A 2B1QA 3QSGA 1U31A 4EGAA 4P53A 4D25A 2XOKD 2B4KA 3X1WA 5ALZA 2J0UA 4ZAVA 4EDHA 2RK6A 4ARZB 4ALIA 1F06A 2CNDA 4EPYA 2W4IA 3B6JA 3GIDA 1XMXA 3CH7A 3QUQA 4MQ5A 4MVXA 4ZV9A 4R8KA 2CF4A 2C3MA 5G0TA 5SY9A 4WBXC 3SMQA 2Q41A 1DC3A 3BQ9A 2VK8A 3WFJA 3LY7A 1DSSG 4EUHA 2DMRA 4CLRA 1KJJA 1LTQA 1L8OA 4NU5A 2IEDA 4OUDA 4QUBA 1GEEA 1UBOS 2AZTA 2DFDA 3E1KA 1XKXA 3OW2B 3N2IA 3DE4X 1XI2A 3P32A 2HMYB 5DSTA 2GPBA 3WMEA 1MVLA 2MT9A 2R47A 5IKOA 5MN4A 5FLKA 1SEVA 2G0TA 5ARDA 2ZL6A 2GBLC 2JG3A 5G0UA 3E9EA 2L2QA 2VOJA 2JFGA 2L18A 4AZVA 5T3YA 1DIGA 2VNJA 5JJBA 1KXZA 3EA0A 3O8RA 4DK0A 1B0PA 4TQUS 5DSXA 5K6RA 4DC9A 5G0SA 1E3IA 5GJWC 2A9KA 5DB4A 1E20A 1P9OA 4KO2S 2CJFA 3KFLA 1L4MA 1Z2AA 1Z6TA 2A58A 3WIBA 3I5YA 4L5CA 2WUFA 3QGMA 4XIJA 4NMMA 4II2A 5K51A 4L5AA 3NHAA 5DH9A 2X0DA 1T5LA 1YB6A 4Q3NA 1AQYA 1P7PA 5MN6A 1EZ1A 1VSQA 3FUVA 2UYHA 1PV1A 4TUYA 4HAWA 4MV3A 2D54A 3ER8A 3Q3JB 4Y3UA 1N05A 1YCFA 2FMIA 1G7RA 2PANA 2V6IA 3GP3A 5ULLA 5FPTA 1PJCA 2O8DA 4IPTA 3EBOA 3GQBB 2R0QC 1XYVA 1FTNA 2O3RA 4TOIA 3HV0A 4NZZA 4UD6A 4D4KA 4NSNA 2ZPTX 3THYA 3MTAA 3AINA 2JHGA 4GBMA 4X71A 4F91B 2HTEA 1XKLA 5B6PA 3QLVA 1J8FA 2ZREA 4BX8A 4HYEA 3FD8A 2GD1O 1O0BA 3H8JA 2ZB4A 3MBKA 1HNNA 3RAGA 3WTCA 5BN1A 4PCUA 4YQEA 1GV1A 2R65A 4L50A 1ESDA 1S3SA 2BC9A 2GEJA 1WB9A 3NMUF 1PKEA 3U4IA 4QLBA 4N6NA 1DHTA 2KLBA 4L9RA 2ZUTA 4I50F 4Z8XA 4UUPA 4DMHA 4YRMA 1E3LA 3C3EA 3O0TA 2RGGA 1V3VA 3Q11A 3IAFA 3AUUA 3ASSA 1TCCA 1J9ZA 3LVBA 3NC0C 1TRKA 3P5SA 2O8EB 4FCWA 4U3JA 3ABOB 3LAWA 1R4NB 2XITA 4PGOA 5AW5A 4C4SA 4RDXA 4YMHA 1HL7A 2HPHA 3DBIA 4QQ8A 3DDNA 5JWRA 1TPZA 4XLEA 4DG8A 2W6ID 3LWBA 1XFOA 4AU1A 2DCUA 3SQXA 5EA2A 2XZDA 4LDZA 2QM0A 2EGGA 1YMVA 1ULZA 2IS4A 1BXRB 1IJKA 4RPHA 3ZVNA 2DR2A 3KZ1E 4U0KA 4EHFA 1YDFA 1G66A 1PZXA 1EEHA 5A62A 2JLRA 2DIEA 1HYHA 3PQ6A 1UBUS 1TLFA 4JT9A 4HDQB 5ERYA 1PNOA 2HLDD 4M0MA 2UZ1B 2ZYSA 3DZ8A 1Y4DE 3AB3A 4U7WA 2I22A 1YBAA 1SCQA 1E6EA 2VT2A 4RYDA 3NHYA 1SHTX 2OWEA 4G6ZA 1KEVA 4L95C 4RQBA 3VYUB 1PL7A 1P0MA 4PW0A 3FFXA 3LUCA 1A9XB 2Q3MA 1K9SA 3IUPA 1RFGE 2PYZA 3FYTA 3NNDA 4IY1A 2XX3A 1E0DA 3VI4B 5HZGA 2DP4E 2VDOB 1NYQA 3QBDA 5JSZB 4FN4A 1QQAA 2O8BA 2WHXA 2H1RA 1C3JA 1H3NA 3QWBA 2ZIZA 4EYSA 1GZHB 3AJRA 4L28A 4MTCA 5BN4A 3SJBA 1UC9A 2PX0A 3V8PA 3ZCRA 2QN2A 3CNOA 4P33A 4HAZA 1C0IA 3QHQA 4LHYA 2JGDA 1JPVA 4PANA 2G17A 2TMKA 3CQ9A 1F12A 4LJ8A 4Y6GB 2OCYC 3V1KA 1FUUA 1F6WA 3ZLBA 3UW1A 1RLIA 1H2BA 1PW5A 4RK0A 2ZZMA 2AX3A 3I5MA 1IQRA 2QLNA 2Q2OA 3V7WA 2YWFA 2EJVA 2OCPA 3EGDB 4RANA 4XR4A 1GUDA 2NUAA 1QF7A 3SJCA 4X1IA 3RC3A 5JR3A 2OCDA 3T5MA 3ZZMA 1FQOA 3QUAA 4K87A 5G02A 3TDKA 1X15A 3H17A 3U7JA 4NCNA 1KJQA 1SUDA 2VT6A 3EXEB 3GVCA 3KFXA 5LNK1 5EIOA 1IONA 1QGOA 5KKNB 3PI7A 2CE2X 4H18A 4ITUA 4NBTA 2M1XA 3OIFA 4J16A 3BDVA 1DG1G 4OF4A 1GWNA 1IN4A 3Q9NA 3ZGOA 2OV6A 4EYEA 3FY4A 3LCMA 1GCAA 3CB4A 4Y0VA 4F9GA 1OI4A 2EWWA 2VJMA 3VPDA 1LSOA 2ZBGA 2HNAA 3VDXA 1M7GA 3VA7A 3QEMA 1TGVA 2AWOA 1W52X 1B76A 1E9RA 1ZY2A 1Y1RA 2W2XA 5B2ZA 3AEXA 4M0FA 3PFWO 5LR6A 3WDLA 4QO7A 2JJ8A 1U1GA 1Y7LA 2SCUB 4KBFA 4INPA 1X2BA 3WL8A 1INLA 2PX6A 4J43A 4TS1A 1LTHR 3UK6A 1R4NA 1ZM9A 4K6GA 5I01A 4TQGA 1TEVA 3TLKA 3KE9A 4QATA 2AFIE 1FP7A 3C3DA 4M60A 2WJGA 3H2BA 5EIEA 1CU1A 1X8LA 1W76A 2I1QA 3LWZA 3OHPA 3VR5D 1KMHB 1K0FA 4L08A 1KZYC 1I9GA 2C9OA 1N06A 1ZM3A 1QOZA 3BHNA 3I3OA 4XWWA 4EY6A 4NMXB 5CX4A 5IJAA 3SXUB 1OLXB 5D00A 4EHDA 2DY0A 1RQNA 1H5NA 1SA0B 2O0MA 2VAVA 4XQGA 3ZZUA 2VRNA 3D0KA 3DEAA 3MGBA 5A3JA 5I4KA 3L9WA 4UCXA 5JC1A 1EB8A 2WM9B 5JYBA 1XUOA 5DEIA 3K0KA 2I66A 3EEFA 1AGRA 2JEOA 3HB9A 3JYQA 5I4CA 2PD6A 3T9EA 4GR9A 1JS1X 3K2EA 4BEVA 2AYXA 2EJUA 3H2IA 1TLTA 1YS6A 3HJBA 2WA2A 3KEFA 3T7EA 5K3OA 2HU7A 3WWEA 3TAXA 5JI3E 1GLGA 1DGQA 2CHEA 1AOXA 2I2AA 1GZVA 4OGLA 3FFTA 4MI6A 2P91A 4U4AA 1VKHA 3KUUA 2I4MA 1L5QA 2OXCA 1PQ4A 3OP1A 4A82A 3ZS8A 3PFHA 4B3MB 3CS3A 4FB5A 3LFTA 3RASA 1JZTA 1SY7A 1KBZA 3D5TA 3OPMA 2X4GA 5KCMA 3S2ZA 3W5VA 1GPJA 2XCSB 5GV7A 3DDWA 3JVUA 4OP1A 5IYWA 4L8VA 3TIIA 2OLKA 5A7FA 4JUIA 1Z2OX 1BXZA 3A3OA 3IR6A 1OGIA 3IX7A 2KBEA 3ZY5A 4HXYA 4G37A 1UXOA 3X1MA 1OX6A 4WWVA 1X7YB 5B6JA 3BGDA 2FPGB 5AJXA 5LYJF 2BISA 1ZM2A 2GZ2A 3JD1A 2CXQA 2ZWIA 1NIPA 4TV9F 5FHRA 2X7JA 1H2RS 4N54A 2VYCA 1QDEA 4HSEA 5EHXA 4ZO4A 3PTAA 4PEVA 2FQYA 2J33A 3TPFA 3CRRA 3QKUA 3LUJA 1NTOA 1JHAA 4BQPA 3ANXA 4BX3A 4I55F 5F78A 2PMCA 1F5SA 4D9FA 3HK2A 1GQSA 1ODSA 1TQ6A 1UP6A 2QZ4A 4ONEA 2ZWAA 5EIBD 2B99A 4H17A 1ZN9A 3T3HA 4TRMA 3HUDA 1QE3A 1AUOA 1GPMA 5F52A 3CVWA 3N07A 3E9NA 3OPXA 1FLAA 1Q84A 2Z9BA 3C3AA 4K9OA 5CX1A 3DGFC 1KC1A 3G02A 5DW3A 3OIGA 1NT2A 1CB0A 4MQBA 2GAFA 4WSOA 5LFAA 2IODA 4CG3A 4BQNA 4KDCA 1JJFA 4B09A 2C9BA 3CCCA 2ZAMA 5BRJA 1FQWA 2ZR8A 1FUYB 4W6ZA 3TQOA 5AM3A 1YHYA 2RGNC 4KWHA 3V8BA 3DBVO 3IV9A 1GSAA 1QYXA 3NHJA 5JO9A 1L5HA 1SRQA 3NQ41 3L6UA 4N3BA 2C8KA 4EOGA 4JC5A 1E4YA 4LOJA 2ZSFA 3T06B 1JG1A 4J0JA 5K6AA 2PO7A 4MYCA 4R2JA 2QP9X 5CK5A 1A9XA 4W9NC 1OAOC 2Z04A 3T4EA 5TGDA 1ACLA 3E9RA 4HQ6A 5CNMA 1UKZA 3N0VA 4ASUA 3K2QA 4WESB 1UQRA 1PJZA 2WNIA 4BQOA 1EEXB 2XA2A 1JJ7A 1MIOA 3BTVA 3GIWA 1EFCA 1LUAA 3EEYA 3VZQA 5LXTB 1QJCA 4CL0A 4EL0A 2X14A 4KRGA 3RSGA 3RVQA 2MOKA 3KQVA 3EHDA 3VKWA 3ZCUA 1LWNA 3ENKA 4XEUA 2WYWA 1TK2A 1RRCA 3SBEA 3SOZA 2FHPA 3MMZA 4CLHA 4UZSA 2WILA 1XNHA 3FHOA 3VTAA 5JZ9A 5KS2A 2CMKA 2PQ6A 4Z6KA 1JIQA 3HO1A 3R9WA 1K06A 1EIWA 2P78A 2R3SA 1I5RA 4DIKA 2FRDA 3EQZA 1K88A 3GVPA 2CHFA 3A9TA 2VHZA 2DHCA 3LUGA 4RMGA 5BQOA 3V00A 3LFUA 4KFUA 1MJFA 2QRGA 5AKEA 4HEA1 3UK7A 4OLAA 3SX2A 2H52A 3CVOA 3BIXA 1KKUA 2Z43A 4ALMA 2VK4A 1PGNA 1Y6ZA 3CLUD 2JKVA 2ZE5A 4YP1A 4RPDA 3Q0TA 2WJ4A 3L1JA 1SXHA 3O93A 4Q9DA 4QQRA 3VR6D 4AF8A 4HSGA 2O0JA 5HF6A 2I2DA 3HKEA 1DHRA 4DCMA 5KMGA 5DNYB 3HVUA 1M76A 2R1TB 1QO0A 1W29A 1MOPA 1XFAA 4XOUA 4L2IA 2IHYA 1NVFA 1JB9A 2ORWA 1LVHA 4JLVA 4FS8A 3UKDA 1D03A 1EVQA 1GA6A 2EZUA 2BP7B 3WLRA 3T94A 1GRQA 3G82C 4PC6A 3AI7A 1AGYA 3EXFA 5LJLA 3ME5A 4AB1A 1NVMB 3Q1LA 1R0CA 3JD3A 4ND6A 4CJXA 1XD9A 4OH1A 4Z4IA 3FCAA 3KUCA 3GH1A 3WAGA 2WTEA 5LL6P 2C61A 1OWMA 4WKCA 3SC6A 4TTRA 1A9QA 2J7KA 2J9GA 1FP4A 1BQ4A 4OIMA 4DW8A 3NV9A 3HJGA 5G0VA 3V8NA 4ARIA 1I0ZA 1RCTE 3DR5A 4PG4A 3VR3D 3R3YA 4PZ0A 5EIXA 1J33A 5JU6A 3ZDRA 1GQYA 4OAQA 2Z95A 4BNIA 1Y1KE 3QPAA 3U44A 3MMPA 2Z6UA 2IQ5A 3EMVA 4UBOA 2ARKA 3BCUA 2RJOA 1ZOLA 3MJTA 3TLGB 4F8JA 4Y2GA 3RKSA 4RPGA 1XVIA 3ANSA 4BO6A 3I9V6 5EESA 5GWXA 2QXYA 2OWDA 4HNUA 5KQMA 2QTVA 1J22A 1V2HE 1XQBA 1V3QE 1QB8A 4KQ1A 4MEAA 4JNCA 2IV2X 1QKJA 4NCBA 3L40A 4GGOA 4NJMB 4TWZA 4YIKA 4OLFA 1XE1A 4KCGA 4JGIA 1CFZA 2HBQA 2UYYA 3RYIA 3VSDA 1X86B 4BLTA 1EGVB 4HQ0A 5AW7A 5FUXA 1GL7A 3S81A 4DV1B 1MJ5A 4JT4A 5BR4A 3D54D 3GFVA 3AZOA 2PS3A 1WEKA 3DAPA 1BDMA 4AFNA 5F77A 1B0UA 3KPVA 5FLXA 3SNHA 2J3JA 2FG7C 1KY3A 1NRKA 2YQ5A 4E94A 1NBME 1JVBA 4OQYA 2IEIA 3JYPA 3RJTA 4NPHA 2FVYA 4P2BA 4JB8A 4UOEA 4GKKB 3O8LA 1ZIDA 1Z25A 5E6TA 2N46A 3EWAA 4UFNA 3O95A 3OD1A 1W4ZA 3ESAA 3FHTA 3K71B 1U8FO 2WSSA 3A2KA 4Z9FA 4XRGA 4JKOA 4DDMA 3S28A 4EHAA 4CIWA 2FSPA 5THKA 4Z86A 2YV1A 4XDYA 2H0RA 3VBEA 2WUVA 3C6MA 4MPPA 2QT1A 4BRWA 4D42A 1PKXA 1TJ4A 2QZZA 2YYSA 4DLXA 3AZPA 2I6QA 2FW7A 4X63A 4Q4JB 1NONA 2DOKA 3MAGA 2COEA 4K9RA 5JQGA 2OAEA 4CG1A 4QUJA 1TQ8A 5JEEA 1CV2A 1NMXA 2O5VA 4FGWA 3HVIA 4LJ5A 4LWQA 5FFNA 4K6HA 1IBCA 2GD0A 3D6AA 4UAUA 1VZ2A 3TIGA 4XWOA 2QPAA 3JRNA 4QVJA 1FPQA 1R5JA 2EKBA 3NUGA 1JAIA 5FPPA 5A9TA 1I2CA 4IOKA 2XBLA 4V0NA 1FQKA 1AGPA 1Q16A 3K0CC 1WVIA 3S5JA 3MHTA 2AVNA 2OKGA 4EMSA 1T5HX 2ZB2A 4NXMB 3INTA 2WZDA 3IIEA 3KBOA 1JG2A 4C0BA 5CB4F 1TO2E 3IBGA 3JQ9A 5A2QA 1AQLA 1L7BA 2K2WA 2QGNA 1ISPA 1NVGA 2O2XA 1II8B 4KOAA 4NULA 4EA8A 1I94B 3K6JA 2FPXA 5AR1A 5HMLA 2FWIA 2ATCA 1YFKA 1GQ2A 3OLCX 4HLNA 5B3AA 5GONB 1F20A 2X8WA 1J5XA 1IPEA 2OBYA 1USIA 4K9QA 1SOMA 3VTFA 3DAFA 3C5HA 5AXCA 1SHZA 3GARA 2DSTA 2RHDA 2HLDA 1JA0A 1L5MA 2VF5X 2Y6VA 3FVRA 1A50B 4G3XA 4BXOB 3GJ3A 5KOHB 1G5QA 1WXHA 4YO8A 4CT0A 3Q15C 3YASA 5FUWA 4YWHA 1FNSA 2VBCA 4AKSA 5F1YA 2REBA 2I3ZA 4N3NA 1PW7A 2YJNA 3R6LA 4CF5A 4KX3A 2FSFA 3Q7SA 3LT0A 5EEGA 5F2EA 3NVMB 3TZHA 2JW5A 2XGMA 3ZNQA 4QEDA 1T9KA 4RVUA 5A04A 1TZ2A 4P3XA 3D2LA 1FDIA 2TMGA 2K2QB 2JZNA 4MCJA 4WZ6A 3S2FA 3LX5A 2WHPB 4NKRA 3U7RA 3NTOA 1L5VA 3COSA 2QAGB 3NZEA 1U0LA 1SXJE 1X1SA 1IPFA 2YBEA 4HB0A 2A9FA 2SBTA 3IOEA 3NIFB 3KDAA 3RJMA 3D3WB 2BEUA 4KFCA 4HC4A 3GDOA 2FX2A 4E22A 1NR7A 4YCCA 3Q6IA 2WPNA 4Q4AA 4S05A 4DLAA 5K01A 1HLPA 1C80A 4G0OA 1M1ZA 1N3BA 3OIUA 4F4JA 1FVHA 1SBYA 3TK1A 2FWJA 2VC2B 1QFZA 4NE7A 2X6WA 3SX4A 3X2SA 3X2FA 5JJLA 4FMBB 2W2PA 1AC5A 1E18A 1UOEA 3OZSA 2XB6A 3NM6B 4RELA 3F8TA 2R62A 4C7KA 1CRZA 1VQOB 4FC7A 1XL1A 3V2IA 5DWDA 1UZNA 1M2JA 2YOFA 1DEKA 2H4HA 2WQZA 1FFBA 1PR6A 4PHTA 5AI0A 1CRLA 1DQSA 2GKSA 5C46F 1YZFA 1CJTC 2WPDA 1N6LA 1OIXA 1E4EA 3A4NA 3P97A 1KQNA 5HRAA 1NM5A 1SULA 3L5OA 3A11A 3H9CA 4HVCA 4YAGA 4NENA 5AM0A 4XCXA 1KFJB 1GAWA 2PK3A 1XZHA 1ESZA 1FFGA 1L7RA 3KOYA 4ZT3A 3VO2A 3HV2A 5SZHB 1AF7A 4FGKA 4MWCA 3LA6A 1QTQA 1WTCA 2WSLA 1UFOA 2BM8A 4PLVA 4ZCIA 1OF1A 1S7CA 3DZGA 1M6WA 2JFPA 3OY7A 1Z9BA 3RHZA 3VDNB 1RWXA 1NYTA 2PLFA 2ZZKA 2XXAA 2MMCA 3QF7A 4FYPA 3ZU2A 2VHEA 1TIBA 3NJRA 1BG6A 1M7HA 1KFKB 2E7ZA 3QF4A 3DEYX 2ZJ7A 3HNPA 3OE1A 2ID9A 4IP0A 4RGBA 4WK4B 3TLEA 4RD1A 5EIFA 2XDWA 1OSNA 4DDKA 2ZJ8A 1JJ2B 4LSWA 2JGFA 5AI4A 1AQNA 2HY7A 3DQQA 5TRTA 2RARA 3P19A 5KW9A 1F0NA 4TTPA 3E05A 4FCTA 4A6EA 1PL8A 2LDXA 1DU4A 3LJKA 3EXIA 1GGNA 4C0SA 3H99A 4Q66C 2YMQA 1GILA 2BCEA 2WVJA 4JC8A 3A3KA 2AN5A 2GCNA 4LX8A 4JLWA 4G89A 4ZYVA 4HGRA 4DLUA 3RC7A 3WHIA 2CLLB 3DG9A 1M1YB 4YONB 4RVSA 4I4LA 2WJYA 2FJPA 3TZCA 3ZTTA 1E6UA 4EJ0A 1I80A 4KK4A 1SQ0A 1U8ZA 2QVGA 4LDQA 4XR6A 1OJ7A 2DBVO 2GUWA 4FT4A 4LNAA 4F97A 2OHHA 3E8MA 5FR1A 5B1IA 3JASA 1IZZA 2KLHA 1N5RA 1AIPA 2VJPA 1XAGA 3KOWA 3RJ5A 1IU9A 3IAAA 2XTJA 1OIWA 3FB1A 3ZI4A 1YUMA 1HG1A 1E5VA 3DA8A 3WDSA 3QMMA 2YHBA 1Y6GA 1MEEA 1NJGA 2FFBA 2D1FA 4NAVA 3Q8KA 2ZI5A 3ZQ6A 3VC7A 2QG4A 2X15A 4FEYA 2OILA 4RY9A 2WAYA 5CFQA 1FYEA 1ZSYA 2HSGA 2RB4A 3RS3A 5B58C 2OPHA 1NMYA 2WQ7A 4MVJI 4BZPA 2BUAA 5CMLA 1DKNA 4V1CI 4P12A 1KKMA 1HM5A 3QVSA 4FOTA 4M22A 1CNEA 1VJ1A 2H06A 2MR5A 5AVZA 4NFHA 5D3MB 3RNOA 2J9XB 1OREA 1QGED 4FOPA 3MF4A 4Y2PA 2A5YB 2FCAA 2P6PA 3NGXA 5ICGA 3JQFA 1IFXA 2GEVA 5CPFA 4LVOA 3HWRA 2DBYA 4U9HS 3MWEA 3QEJA 3RV3A 1AMOA 2G7ZA 3V8VA 1Z08A 3L4BA 3NOVA 4Z3OA 3GNQA 1C8BA 4BV9A 2IYEA 4X62B 1PJQA 2IYOA 3QA3E 2QYTA 5EE3A 1FDSA 1J99A 2E48A 3T9FA 5E1OA 1IYZA 4GEGA 4Y9DA 1HE8B 5EJ9A 2GPWA 4C0AC 4C29A 3I4CA 1SMKA 2J3IA 1EFDN 3N2LA 3CXRA 4PM4A 5BPFA 1NF8A 1DJMA 5A4JA 5K2OA 2XNKA 3M6WA 1EG2A 3PZRA 3SEZA 4JKIA 2DTDA 4FC6A 4PLFA 3WIVA 5EKXA 1YFLA 2O8EA 2VIIA 5B2EA 3SC2B 3SP1A 1K9MD 2O5RA 2R6JA 1QB7A 3N6XA 4WZKA 5DDIP 1H2AS 3OP4A 1ARZA 3MYRA 1OYWA 4MAMA 3SZ3A 3B3GA 4RIIA 5LCXA 1Q7GA 1GN8A 2ZZQA 1N9GA 3MGKA 1XDDA 1CR4A 2Z5VA 1KI3A 2PZGA 2EBHX 1IOLA 2HCBA 4ARVA 2BEJA 1Q77A 1DARA 1PD1A 1HFJA 2Y0DA 3FMVA 2VPZA 1XD2B 3OLQA 3TUJC 4IJQA 1C0PA 2DU8A 3TBHA 4P6YA 1AXGA 3OJLA 2BGLA 3CWQA 5MFZA 5KYTA 3I0ZA 1GRRA 4CMIA 1ADGA 3NDPA 5M2QA 3MWDB 2HK8A 4RD0A 1QPZA 1ZHOA 3AMVA 4YRDA 4DFDA 4WOJA 3O7MA 1VJSA 3KAQA 1D1TA 1X7ZB 4I55A 3TXXA 4MEJA 1SRRA 2IQIA 3L8HA 5EIAA 5IKXA 1MU0A 4URWR 1K6MA 4IQ8A 1ID8A 2ODBA 2R84A 1OBCA 1JNXX 1U0SY 2MDTA 7YASA 5LDHA 2AHRA 3V9PA 3ZWVA 3GLIB 4TWIA 2JVJA 3ENQA 1GDTA 3JQGA 1OCEA 1TAQA 2DFLA 4EPTA 3TMAA 4M7PA 2WW8A 5JSKA 4Z99A 4CQJA 2XUDA 1ZISA 4O5OA 3K0BA 1ORTA 4GNKA 5EXTA 4B46A 3BNWA 2EDCA 5DIZA 3MWYW 1YC5A 3H75A 5K03A 1GXSA 2IHJA 2ICAA 3O03A 5DS0A 5C1IA 3V1LA 3OUUA 1KRWA 3ILXA 5K3DA 3REGA 4MHTA 1K3FA 1BE8A 3AF0A 3DAGA 5FQNA 4BKQA 4XOPA 5FNVA 3G71B 2OXFA 3QH4A 3MUEA 4ESHA 4GMXA 1JIIA 1ULTA 1CW2B 2KM1A 4AXBA 3RUDA 4BN4A 1Q81D 1VKRA 3OA0A 1EWQA 2ZS9A 4H3HB 4QSMA 1F38A 1N1EA 1T2DA 2O4UX 3H5VA 3I9OA 3F6BX 5J4LA 1KP9A 1ZI6A 1DIOB 1SXJC 2DH5A 3ANLA 3C5WP 3K96A 4GBGA 4MW1A 4IMJB 4WCVA 2OL4A 1Q0PA 4WY5A 3CLTC 1GA4A 3BIWA 5JYCA 3WGGA 2BGUA 1D9XA 4XGIA 1SUFA 2PVSA 3PLRA 4R2XA 2HHAA 2YW2A 4YMVA 2GVDC 5FBHA 3G7SA 1UKVY 1T3TA 5MF6A 1A5SB 3Q9LA 2LD4A 3U1VA 1ZW6A 2A0UA 4OCZA 4HUTA 2BBSA 1G21A 3IPXA 2XOXA 1TQHA 4RESA 1NXXA 3GP8A 4YUWA 4Q1FA 4X06A 1KIAA 2FN8A 3TJMA 4PQRA 2FR0A 4ZIRB 4M9SA 1SEPA 1JDUA 4FW8A 4ALKA 5CEJA 2VFAA 4BBAA 3MUNA 4KPEC 2O19A 4BTVA 1LK7A 3GUYA 4M7RA 4QTTB 2FEOA 1WQ3A 2B98A 2JS7A 4G26A 2JLUA 3TVTA 1KAOA 3A1PA 2E49A 3M2TA 3X3HA 3H3XA 5HIAA 4KXXA 1PZEA 4Q9NA 1G0OA 1ZP6A 4HLQB 5DXJA 5KTMA 5H3HA 4M37A 5DM1A 1XNJA 2G0AA 4ZI3A 1TAUA 5BR1A 4H9GA 2C5GA 2FVXA 4ZGWA 1I1OA 1CNMA 1ZMBA 4AP9A 3ECSA 1BCSB 1Z06A 1RVDA 3KZKA 4ZVTA 1NV8A 2B94A 2V7EA 2HIGA 3B2NA 1P1FA 3CEAA 3LU1A 4Y2SA 2XDQA 1X39A 2H1IA 3PB3A 3ROTA 4WASA 2B1JA 2VNKA 1D8TA 1U8XX 3KPWA 3LVRE 4N8SA 4OHUA 3MFYA 3A1DA 4AUKA 1AA9A 1Q86D 1XWIA 3H1AA 3QUSA 5A1TA 5BQ3A 2XNJA 3G6WA 5JY1A 3W9YA 6CHYA 4PTYA 2Y1WA 3RUAA 1GXSB 1P31A 1ZUIA 4ZCQA 5DYIA 3T12A 3OKXA 1JXOA 1U3VA 1E99A 1JSRA 1QZXA 1G6OA 4ON9A 4PR0A 3HYNA 4RMHA 5J63A 1LPSA 2H85A 8AT1A 4M8LA 1KI2A 1N9ZA 2IBMA 3H2ZA 3HCNA 1E7RA 1ZG3A 1Y5MA 2VXBA 4QV2A 2HMWA 1VL2A 2ZRPA 3IKMB 3TOSA 1UKCA 5D5HA 1ABEA 4RTQA 1AK1A 3FBGA 3KYIB 3IYLW 1V39A 3D0RA 3HDGA 5CXXA 4BJ6A 1KGSA 1U1FA 1M33A 3W8NA 3IMCA 4M2LA 4JL8A 4Q9IA 3UJ8A 2QW0X 1QP4A 3NHZA 1CSEE 1CEEA 1N0WA 1S1CA 3GOHA 5KDDA 3RM3A 2DYIA 2VDPB 5CG2A 3DE5X 4NWIA 2Y76A 4UFOA 3ZDEA 1X7XA 5CLJA 4IHJB 4EY8A 3CTPA 1W6UA 2W6PA 4G07A 4XVHA 4X85A 4D2IA 4OKIA 2AX4A 1ESNA 3B1YA 3OQJA 1VE3A 2QQ5A 2ZROA 3E22B 1PSDA 4GYJA 4TQAA 4GKJB 4XYGA 1YR3A 2EIHA 1DCTA 1C1YA 3CZQA 3M9XA 2XIJA 1W5TA 5KHLB 1KJ8A 1AV6A 1XP5A 2JGKA 5IFKA 2X1LA 5C8YB 1WVMA 3FPLA 2LCIA 4DPLA 5A4FS 1Z8HA 3BS4A 5EE5B 2IC5A 3HJRA 3ZEAA 6AT1A 4I9FA 1ZUNB 1NQVA 3ND9A 5IYZB 1QVWA 1CHDA 3AM5A 3O7WA 3PUYA 4Y9RA 4K40A 2IYFA 4DJ5X 1VA5A 3TTUA 3E2PA 1T25A 1YBVA 4IDPA 1O95A 3D7NA 1J09A 4MIOA 3VU1A 3JD0A 1NP7A 2CCKA 1N6IA 4GWKA 1Z7WA 2IH5A 1ZLYA 1PLLA 5K0ZA 4PCLA 2R6CA 4B6FA 4EJSB 1QZ3A 3X1KA 4BU1A 2VHYA 3BIFA 3A4TA 3O73A 3E1SA 4U7GA 2NAFA 3ICVA 3DZFA 5CYPA 4HOYA 5GGYA 2D3LA 1Y8QA 3UANA 2D5BA 5A3SA 5GZ3A 1D2MA 3W5HA 3LC7O 3M6FA 2JGLA 3I92A 5E7JA 1OXXK 4KP7A 2OKCA 2ZRCA 3K73O 1X77A 1E4OA 4IFBA 4MWZA 5HS4A 1ZYUA 3UAYA 2ILVA 3BSYA 4JOBA 5CCEA 1D2EA 1OWNA 2XTAA 4YEJA 5AUPB 5SYAA 2WRZA 1B0ZA 2Q3BA 3FGOA 3FLBA 2QNIA 3DUFA 2ZUVA 1FQJA 1S4MA 1EX9A 1V3TA 2YXBA 3MCTA 5G1NA 3WK5A 1HQKA 1C3EA 4XYBA 3P0IA 2C8LA 3EMKA 1FMCA 5DBOA 2FI1A 2NSJA 4KVFA 3PJRA 3HZHA 3AM3A 1E5QA 4WOKA 1QGUB 1Z5NA 2OT3B 2PZAA 3HBNA 2AJ8A 2UZ3A 2NPFA 3CUYA 1QTRA 2WMOB 4D9NA 5ALIA 4PRZA 4M1ZA 5B7QA 5FYDA 2WY2D 1DAPA 2XWPA 5BVGA 1I36A 2QX7A 1XK6A 3FMPB 2CNWA 2VTDA 4GP9A 4CU5A 1V43A 4E21A 1PEYA 2WM2A 1IUNA 2ODQA 3F6YA 1A7AA 3BF8A 4G09A 3WQSB 4BPRA 3DYVA 4J7XA 3P0RA 1O77A 2G5CA 3C4JA 1WOSA 3DT8A 2ZJYA 3AVWA 3ZDYB 4DN6A 5JJCA 3FHCB 2IYXA 4X90A 2VKQA 1P5ZB 3H3JA 3N59A 4IVQA 4WY2A 1MAAA 4M46A 1IQUA 4I6EA 4KIUA 4MLDA 4QG7A 4PXAA 2OXRA 2DFKB 5AI5A 4RSRA 3AJ8A 2RFLA 3NIDB 4E5PA 1TECE 4G5XA 3U1BA 3VMMA 4JWTA 1L4HA 2OBFA 1Y1TA 1U8EA 1Y5IA 3SEQA 3IAHA 4V2IA 4JLDA 4RVHA 3LZDA 1CTQA 4JBGA 5DGIA 1HDRA 3KKLA 1OPXA 1BOFA 1XALA 2DQKA 3GUCA 4PFJA 2Q6TA 2COKA 1J8DA 1GVHA 1S6YA 4OH7A 1TJ3A 5H70A 3BN3A 4OQPA 1N8NA 3AH8A 3AQIA 5CH3A 5TF0A 2RG1A 3PV0A 1NVBA 4ZCSA 2RH5A 5YASA 5AHKA 1Q1EA 3N70A 3QG5A 4MA5A 3TLZA 1KOFA 4RVGA 1RFLA 3WAJA 2QVLA 4YRFA 3CCQB 3DDSA 4HWPA 2O8VA 4YJ2F 3S99A 1M34A 2FW8A 1DUIA 5E2BA 3RABA 1DT3A 1W0CA 1WVGA 4TL7A 4AG5A 4TT8A 4O4HA 2HMVA 2B61A 4WI1A 2QPLA 1H2HA 3STYA 4UHDA 3MINA 3MJDA 3ONNA 1L4LA 5BORA 3D43A 1BE0A 1URPA 2M6KA 3I6ZA 4AZ3B 4FK8A 1DC8A 1WDLA 3IQXA 1J2TA 1COWA 1IBRA 2WIJA 3IURA 1L7DA 2CLOB 1Y5NA 1NTRA 4ZT5A 1D0VA 3F74A 5IXYA 3I1YA 1QRSA 2CF6A 3P20A 4UZEA 2VI5A 3K31A 4MI1A 4OXIA 3CF4A 5ELMA 3G2QA 5A02A 4Q24A 1M2EA 3BXEA 4JUAA 5DN6A 3NYWA 1Y1PA 4QBGB 3T4PA 3THWB 1M2OB 3KZMA 4PYNA 3JQFC 5TGZA 2EHDA 1DV1A 2H2IA 3D3WA 3R41A 4ZYUA 1FVFA 5JEDA 1LZLA 1EM6A 3RC2A 2W4MA 3RYTC 3ZQJA 2F43A 4D4MA 3ZU4A 1JXQA 5B7PA 5IHPA 3WP0A 1Q0RA 2ZUFA 4TMZA 5ILOA 1OZFA 4MV7A 5JQWA 3NH9A 1YMUA 4XM1A 3HGQA 1Z34A 1E6MA 4D82A 4B81A 3M5DA 1KNQA 2B2XA 1W0KA 2ONKA 1Z7YA 1NSTA 2YH2A 2GZSA 4GSKA 4LXGA 4RC9A 3VZSA 3AESB 4ETWA 3FIUA 1ZUHA 3IO3A 4AS1A 1M5TA 3H2YA 4UNRA 4H15A 3FFBA 1ND6A 3R76A 3ETEA 4IIHA 5BOVA 5IMBA 3QVGB 1BVUA 2HMUA 3LBHA 4HNHA 4F3CA 1RYBA 3RF6A 3B6IA 4UNQA 4D3FA 5H82A 5CD1A 2SICE 4D8YA 3FOEC 1YJXA 1CDDA 2NYRA 2OM6A 4G8BA 1PDWA 2QLMA 4GWGA 4NNPA 5HQ3A 3GAAA 4IMRA 4KVAA 2AC7A 3V4SA 5A5EA 5JCJA 4KXMA 5CB8A 4NOLA 1NRWA 1ECCA 3H9JA 2FSVA 4F38A 3ZDZB 4CN8A 2C96A 2P3SA 5FA6A 2XCQA 1ABBA 4Q3AA 3SJPA 1DRJA 4PVCA 3WLPA 2WWGA 3QXHA 3ANNA 5KINB 4I66A 2G8LA 4UM9B 2GN9A 3CCFA 3CO5A 3U7IA 4C14A 1MH9A 3CWZA 2OA0A 1XSEA 4LE1A 3REOA 4W7SA 4GI2A 2JFWA 4ZEMA 5KQGA 1OI3A 3M70A 2B37A 4H1VA 4RNCA 4UCWA 1E3MA 1JPNA 3EEIA 2ZJ4A 4POOA 4DR4B 1TD9A 5AKYA 3ITNA 3NR2A 1CLUA 1K9VF 4KQCA 4LNUB 4NAUA 1ZK2A 4M53A 4BNGA 1GFWA 5IDYA 3ZE2B 4EYKA 5B12A 4C7OB 3A31A 4OQLA 2YHSA 5F5LA 4CETA 4MPDA 4BX0A 4WNYA 1LSJA 1XCMA 4ZYZA 2KJQA 1O0CA 1P4HA 4XPZA 1YHZA 1OU4A 4BZZA 4HADA 2C77A 2LWIA 3IUEA 3UJ7A 5IT0A 3FNQA 2MMGA 2NYAA 1AXEA 2X5KO 2ZM5A 1P5RA 4XDZA 3MILA 4R8VA 4BP9A 1ZAKA 2HFKA 4G4IA 4NR0A 4ZJPA 1YL5A 4LGCA 4DA6A 1W35A 2KQUA 2X42A 4FQ8A 3RGGA 1WBDA 1NLUA 1RAHA 3NCTA 4CCYA 3E9CA 4X8IA 3AJEA 4JP2A 1HE5A 4RKWA 5FBWB 1KSFX 3GFGA 3QIVA 5ENVA 2Q6IA 4ER7A 3N76A 5BPHA 3CZAA 4EY4A 2QQEA 4IICA 1EAMA 3GMDA 2WU8A 5FNVF 2OHXA 2N0SA 3RSZA 3CUVA 2VQEB 1BDJA 2C78A 2AR7A 2Q2NA 2Z3ZA 3CX6A 3LXMA 1KJYA 5LMUB 1C7JA 1ZK3A 3IP3A 5HS6A 3BY2A 4I46A 2X76A 3PHIA 3R7DA 4DCSA 2BCJQ 2GGSA 3EDYA 4YPOA 4ZYLA 1WW3A 4MVJA 3CINA 1R6AA 3KQQA 5B58T 1MZVA 2P62A 2RKOA 4QJBA 3EGEA 2VSQA 1I51A 4ZMRA 3P2MA 2ERYA 3O0DA 2YV5A 2FPWA 3A4IA 3W7AA 1VLHA 2C95A 2VP0A 3F6SA 3LF2A 13PKA 4BWYA 4OU5A 2YWGA 1MX3A 1Y48E 3BULA 4BU0A 1QHSA 4DDTA 4OPOA 2B78A 4HX9A 1RWWA 1VBNA 2C7GA 2DUNA 3DO6A 4LJYA 3SFVA 4B6GA 3U44B 3GPBA 4R0MA 3AF2A 3CESA 2X8KA 3V7AA 3PNLA 5BMVB 2AR9A 1EFAA 4CMCA 4XOIA 2IYSA 3T61A 3UGJA 2HSZA 4BLOA 4QXPA 3CP2A 2NM0A 2WE7A 1UMBB 2B5WA 1MNQA 4OB7A 1T3ZA 3ISVA 3VYWA 2A7XA 4B75A 3EX7C 1SUIA 2HSWA 1OI2A 4NNOA 4QT0A 5DRYA 1TQ4A 3UAGA 3T41A 1BFUA 1JU9A 4X64B 1FTQA 3WGUA 1GR0A 2ZLBA 2J5QA 1QZZA 1NW3A 1L3BA 1USUA 4P98A 3GG9A 2HWWA 3OFSA 4O59O 4UHFA 1JEQB 4B4OA 1W87A 1SQSA 1K68A 3MS4A 3GGSA 3BKWA 4D99A 4FE4A 2JCXA 4L07A 1UMCB 4BGDA 2QUZA 1OASA 4ZT7A 4BO8A 2FDCA 4TV8F 1JR2A 3DYBA 4TMFA 2FSUA 2HLPA 3WNBA 1VKOA 2JI6A 3UOAB 1IE3A 1N2XA 2HWXA 4CHTA 2Z8ZA 1NQWA 5SYMA 3L8FA 3W9SA 4M38A 3AVXA 4NBVA 2HSEA 2HX1A 3BCSA 3F1KA 1PX2A 3ORQA 1N7GA 1MW9X 4D6YA 5BXYA 1T13A 1U3UA 2IL1A 3LSTA 3PCXA 4WZBA 5CFRA 5LNK6 2WWYA 3PRHA 1W73A 1I3LA 3LBIA 3SXJA 1XZNA 2BEWB 1TCAA 3BAZA 3KG2A 3A8KA 4EEXA 1FX1A 2JASA 1FX0A 3FMFA 4HLUC 4OHOA 5LQNA 3GLTA 2FZ4A 1VYUA 2GCOB 3RJZA 2Q2QA 1ZNQO 2XTZA 4QARA 2WF6A 5PNTA 3CNLA 5IC5A 3HXQA 4AJ2A 3HPQA 5T57A 3AHJA 4B6RA 1RPAA 2M98A 1YS2X 2JIDA 3EE6A 4ARAA 1XKTA 4CKBB 1FK8A 2GERA 4UREA 4UBIA 5LXTA 5LKRA 2F9FA 3KYDB 3PNQA 3U7FB 2EWMA 3SE0A 2VYNA 4ZOQI 1YBFA 3H87A 4CLEA 4G1MB 2AXQA 4I8XA 2G70A 1L7AA 3DLIA 3ZLJA 5EQJB 3FYUA 2B3DA 4WKGA 3VR6H 4ECEA 4URUR 3AV3A 5C8XA 3C1OA 5DCLA 1VECA 3H04A 4M6WB 3A2NA 4RDKA 3SD7A 4BFWA 2C92A 4DT1A 1YNSA 3TRJA 1O08A 4HFMA 4EM6A 1MQSA 5EMNA 1AKUA 4MWBA 3ROKA 2FSSA 2NUPB 1SAYA 1T4MA 2UVQA 5DF1A 3A1NA 4ZVSA 4LJ4A 4G1FA 1PT5A 1Y4AE 4FUQA 4B31A 3LUHA 3WLHA 4OBWA 2I4LA 1AKWA 1GZ7A 1YBMA 2N1MA 4L4SA 4OO3A 5FBLB 2HDOA 1RZ3A 4Z4YA 3EPPA 4XPIA 3SY8A 3RIHA 5EYPB 5IU6A 5I9NA 1UEJA 5LSAA 1W2BB 3H86A 3AF6A 1OVMA 3UHPA 3FM9A 2DUJA 1S0UA 3QX3A 3I09A 4ER5A 2QUJA 5LYYA 5BMOA 2IV3A 3QE2A 5AI8A 3UG7A 2PWYA 3GF4A 3LDUA 4YMGA 1OX4A 4GKAA 1WXXA 1O2DA 1QH1B 3L18A 2CBXA 3EA5A 4OP3A 1KU0A 1AKQA 1UD6A 1E3WA 5I9SA 2XKKA 3Q12A 3I37X 1R0YA 5A5GA 2Y1LA 1K8QA 1CUVA 4YDHB 2JFUA 4B0PA 4D9IA 4DBLC 4ZJZA 3AR9A 4ZTUB 1EP3B 1PCXA 4BGVA 4BQSA 1E8DA 1T2EA 4U2KA 1L5GB 1M74A 4J7UA 1QBKC 2Q49A 1E5DA 3ROZA 3VNBA 1VQ6B 2C0PA 4BJ3A 3R44A 1RIFA 4WNIA 3KSAC 2HDNB 3JWJA 1GA1A 2JI4A 4JQZA 4WUVA 4PPFA 1DKLA 5FFFA 3RK0A 2FX3A 4ZOAA 3I32A 3NIGB 1MUUA 4YAOA 4X91A 3F46A 4ENTA 3STTA 4J6EA 4S12A 4Q7JB 5EFZA 4EB0A 5DTMA 4HDOB 3FJYA 2IY8A 2IF2A 3AHGA 2HMAA 4QZVA 4WZBE 4E2XA 1RYYA 1HZEA 3JATA 4X61A 1L7EA 3L0IB 2ISCA 2E89A 4J1QA 3LPMA 4D8WA 5BVHB 2Y77A 3EUWA 2QJOA 1FJGB 4A0GA 4TYYA 2Y93A 3P5BA 4MWSA 2AK2A 1CEXA 1PIWA 2FRVA 3VU9A 1R1DA 1H0RA 1NG9A 3IRUA 4Q3BA 4LOKA 1ZH4A 4RWZA 2C5FA 2Z9CA 4GOXA 1VBMA 1YRYE 4HG2A 4OJKA 5GONF 3LZ6A 3N3BC 2I5PO 4FGZA 4P08A 4D26A 3UAVA 4QJ5A 4EYOA 4MUGA 4QTZA 2EBWA 1KEWA 1RTTA 5IAJA 5IEJA 3L41A 2C07A 2YCBA 4G8DA 4C89A 4RD4A 1ZONA 4OHMA 3SF0A 1U7OA 1SA0A 1NE7A 4L02A 4QFMA 3AL3A 2I2FA 3BC9A 2H0QA 2XQGA 3GYBA 1O95D 4LHEA 2LKDA 4S3MA 4G84A 1KPIA 5G53C 2NU8A 3UHOA 2IXBA 3WQQA 2C9ZA 4MIEA 4BLUA 3HKBA 1RQXA 2B35A 3RHSA 2NUTB 1DBIA 3ZIUA 4QRDA 1S72B 2JGAA 4G5YA 4X44A 1WMFA 1OY1A 5ALPA 4S1VA 1JDNA 3SM9A 1EWYA 5A2GA 1FMTA 3BMQB 2UYQA 2OAQ1 4AZ0B 5GVSA 2AC2A 1EQ2A 1SCJA 2QD4A 3QK7A 4QYMA 3MIZA 3VOSA 3D31A 1QHGA 3CIFA 3ZY2A 1YI8A 3K70B 1X7XB 3H6GA 1K92A 4I0WB 1F2DA 3H4VA 2I33A 2ILTA 2VRWA 1B8UA 4B4KA 5HZHA 5CBPA 2YKGA 3F3SA 5JXIA 1QVZA 1GNQA 4DNRB 3LPLA 4MA0A 4NFLA 4P8RA 3KQYA 1SZDA 2O2JA 3IR7A 1W0JA 2IBTA 3UY4A 2Y1FA 1P1HA 1FDUA 3N7TA 4ZYXA 1M5UA 1MFZA 4U9UA 1YJAA 3BGSA 1PG0A 2FOXA 2Z2JA 3JVDA 5JG7A 4MCHA 4CMEC 3RYCA 2IYRA 1VQ5B 1TUIA 4GLOA 4QXAA 4JOQA 4ZVUA 2E0IA 1CZOA 4JJGA 3KUDA 4A0HA 4DSZA 1RWMA 4I1PA 1MW8X 2A14A 1MBZA 3GLSA 2V7QA 3DBHB 4YRNA 1QG6A 2AW3A 4R7GA 3TLBA 3OT1A 3JWHA 3K6KA 4LE0A 4AMVA 4R68A 4FFMA 2R66A 4N6OA 1VRVA 4B6SA 4A1FA 3RY8A 4EFNA 2Q28A 2HHLA 3H83A 1R0RE 2ZU0C 3TVYA 3ROMA 3LLCA 5GTDA 3WBJA 1AGXA 1F2UA 2BMWA 1G8KA 2QLBA 2PYIA 3KPUA 1FU8A 3RU2A 9ABPA 4TS4A 2GNOA 4MVJP 3OQHA 3PK0A 1H69A 4L0CA 2Y2VA 1O4VA 1UXIA 4KAJA 4M88A 3RFTA 3FDIA 4RVFA 1JQAA 2F3QA 4TKMA 4UOQA 5A71A 5ESWA 1GUAA 3H5IA 4DUPA 3U19A 1T9GR 1N0IA 1VSBA 1Z8NA 3GBSA 2DOGA 3PQ7A 4HO1X 1OXTA 2PD3A 4YRAA 2FPLA 5BN4B 1GQFA 5K8IA 4CTJA 2J9ZB 3W2IA 1OFUX 1I4WA 1QV6A 3D7RA 4OB6A 4US0R 4TV8A 1G8SA 3DF9A 4W9NA 4B35A 3I6IA 1C9JA 3HP4A 1UUFA 4HAOA 4D6XA 3NTQA 2HJRA 1I2AA 2PGAA 1N5IA 1P18A 3PA2A 2ZXHA 1AO3A 2YUTA 4MLZA 4S0XA 3VJLA 4U7TB 1N2EA 1TKAA 1RJEA 4PICA 3ROEA 3V4PB 3KLMX 4K9KA 1LCIA 4DVJA 1QIIA 4CQMD 1PZMA 2FF5A 2YYAA 3GJ4A 1B7GO 4ZAGA 5KBYA 1GKUB 1LV7A 5JS2A 5AYVA 3PPXA 2HZ7A 1E1KA 3EULA 3QJYA 3QTLA 5E6UB 4AD8A 3H0EA 1BXGB 4EUFA 1DVRA 4DMCA 4O02B 1XDBA 2X0NA 3IDFA 4B7UA 4ZOLB 4BN5A 1VL5A 1C7RA 3FMIA 4J1NA 4CFZA 3A6PC 1T4BA 1G8MA 4QUKA 2E5FA 1N7IA 3PGJA 2Z5FA 4QOGA 4KQIA 1G64A 4W1PA 3UXEA 4WMLA 4E5NA 3ZJTA 1PFVA 3WB1A 3WG9A 2REQB 1VMAA 1ZUWA 3D5EA 3TW4A 2G1KA 5DGHA 4H1TA 3AR3A 1PS8A 3BGWA 4P35A 4X20A 4IV0A 3GJ6A 3PDJA 4ISBA 3MLAA 2Q0SA 5ESDA 4CVNA 4LHWA 4YO7A 2WWFA 2W8BA 1Y3CE 4HMQA 4DLRA 4XGKA 3HCAA 4FHFA 1PT7A 3AYXB 5JAOA 4UUAA 5DGDA 2BHSA 3DEFA 3OT5A 4O5AA 4A8JB 2C03A 2E87A 2A0FA 4U2FA 5EKDA 1U0NA 3TRDA 4OIFA 1OILA 5EN4A 1TM2A 3GJRA 3IEVA 1U5CA 1X42A 3U2QA 2A57A 2O57A 3MTIA 2J46A 3NAZA 3H5NA 3TF5A 1M72A 1E1NA 4EG1A 5KDOA 5J4KA 2OBTA 2D5LA 2NG1A 3DMNA 4QQNA 3ZHRA 4F2GA 3OLWA 2Z6BD 4ZJUA 5LWHA 4WFJA 3G9ZA 5IWAB 1JIUA 3EZ9A 4I8DA 1VQPB 2XRZA 4C05A 1S3FA 2X6YA 4GE0A 1T0PA 1ACMA 2GZAA 3TI9A 3MG9A 3ET5A 2WFAA 3P4YA 4NJMA 4FFBA 4E30A 3ESZA 2PWPA 4A5OA 5AVUA 2FJ0A 2GPSA 5BNFA 3LVQE 1EBUA 1Z2CA 4XRRA 2O8DB 4OHFA 1ZD1A 2P75A 4E6EA 2QRNA 5A0VA 1G18A 1W75A 1MTZA 4P3IA 4KDFA 1G3UA 3VZDA 2H2WA 4URHA 4ZZIA 2Z6AA 5AVVA 3CEMA 4K0KB 1CUEA 4Q3EA 3TZQA 1RPJA 2NV2B 3MJHA 2ZYWX 4V0MA 3HJHA 3G9QA 4AULA 4E07A 3DHNA 3JQ8A 1U2QA 2AA3A 3CVUA 2QBYB 4EB6A 3TYXA 1KNXA 1XD2A 1M2HA 3DJFA 3IDSA 3L8DA 5TV2A 4GZLA 1A96A 2QJRA 2QMOA 2QUBA 4RJIA 2W2LA 4UHCA 1H4TA 2IU0A 2C8JA 4P3KA 3U3KA 2H59A 3VR2A 1U0TA 5K0BA 4J3NA 3ORFA 4H6WA 4CL8A 1X1RA 1D6JA 3NONA 4HNTA 1DC7A 4O4IB 2AUMA 5K3SA 4HQLA 3VKVA 3HI4A 3R1IA 4GU5A 4R1TA 1KOJA 2CNOA 1SG6A 1KHTA 4JC4A 3HNRA 5E0OA 4ZVQA 5KNLA 4OUDB 4Y1GA 4J07A 1NE2A 4BTEA 4I1SA 3UXHA 1VL1A 1VSUA 2IHBA 2WDZA 5ALVA 5ELXA 1ZIXA 3GGDA 1TU3A 2Y1EA 4FLMA 4QDOA 4R2LA 2H1LA 2G3YA 3WKAA 4BRSA 5DISB 4WZAA 5TX7A 2J0EA 1RT9A 2HQRA 2VZ8A 3OKCA 4GM4A 3SICE 1WX1A 1FFEA 5AW2A 3KEOA 3GN1A 1P0IA 4E09A 1W5BA 4BMSA 3KVVA 1RC8A 3BIJA 3CT4A 3ECAA 3P9KA 4ER3A 1Y9AA 1X92A 2R7LA 1R5BA 1A2QA 1PJ8A 1VGVA 3GFBA 3KL4A 5D8DA 2ODAA 5T4BA 1HPLA 4FIDA 3CBQA 1VRCA 1UK9A 5FBZA 3V8QA 1PFGA 4WCFB 1U2EA 2XYRA 4MJLA 3RSHA 3V7NA 5F7ZA 3UICA 3L0PA 1JG3A 2LIVA 3FWKA 4OJMX 4Q7MB 3OZVA 5FOVA 3ZWCA 5I5EA 3IP9A 5I8WA 1YZHA 5CLQA 3U4MA 5HE9A 1BWSA 2Q8QA 3HB7A 1K7FB 1W1UA 4PYLA 1PNQA 2O3UA 4RCVA 1YR6A 2X9LA 2WKPA 4KQFA 4DYVA 1S2LA 4GO1A 1GZ3A 2W2TA 2WAMA 4G23A 4JIMA 4QYXA 5B30A 4GDMA 2ZRIA 4U0JA 1M0EA 2X8BA 5AFSA 1NMQA 1FRFS 3B1JA 1YA8A 2Q0HA 2P3LA 1EJ2A 3P9XA 3M4JA 2HA7A 4MS4A 2NU7B 3AUTA 4PLCA 2V9ZA 3TAHA 4HIZA 1WDTA 2HK6A 4KE7A 1E3XA 2C3YA 4BLSA 3W5BA 3BRSA 5FOWA 4LZWA 4M3NA 1P1JA 4IWYA 1S4QA 2AI2A 2IRWA 4IR7A 4R40A 1ULSA 3GJ8A 3FDFA 1HOTA 2DF8A 3WGJA 2NZXA 4YT2A 4Z7NB 3O2JA 2AVDA 3DOCA 1CF4A 4LX0A 1E98A 4OBEA 4QD3A 1LBSA 1X6VA 3VYRB 2ZYUX 3COZA 3WKBA 3V55A 5LJIA 4G1BA 1LGYA 1PX0A 3ZUPA 2ZIXB 5TEWA 3V48A 3W5JA 2RK4A 3V76A 1JHXA 1PJ6A 1L5HB 5KOJB 1NV9A 4NYJQ 1H93A 3FGNA 3O4VA 5LIRA 2AD5A 1V1MB 4H59A 5IF3A 4AKIA 1UFKA 1RNLA 3TX6A 4QPJC 2GEUA 5JXHA 1XJCA 3OPQA 4PHHA 1KYQA 3PPIA 2C4KA 2ZQZA 5DCWA 1AXRA 3SLRA 3K53A 3KSBC 4B7CA 4Z0TA 1ESEA 3CZCA 1V9LA 1V5GA 2OTJB 3HACA 3H9EO 1QH8B 4PVDA 4KH0A 1FZQA 3BJIC 4A6DA 4BS9A 3G17A 1P81A 3B20A 4Q6WA 3UG6A 4CN9A 1OH8A 3F7TA 4G67A 4BP8A 1YH3A 4IV8A 5H02A 4BBZA 3GLIE 3N8KA 3F5FA 3V9AA 2FZVA 2HEIA 4Y9UA 3PFBA 4PC2A 1VHDA 3GLHA 3GI1A 3WB0A 4J2HA 2F1HA 3N8DA 1T5BA 4LJLA 3DDUA 4FKZA 4HB3A 5KYUB 2ETVA 1TC1A 3NETA 2GREA 2X8AA 1TMGE 3PHLA 4WLOA 3EG9B 1I5EA 4AN0A 1F0KA 2EG5A 2X2FA 3MTBA 1RWQA 4OHKA 5CK4A 5ANRB 5INTA 1I01A 3S4YA 5HKLA 4OQFA 1JLHA 3WX0A 2YOHA 4OPSA 4WK0B 4YV0A 2MIIA 5ENZA 3TTTA 2EW2A 1P5FA 2PUJA 3PXUA 5DK4A 4HZGA 1XZIA 3C7TA 1M6NA 4XEHA 3DOJA 3IUSA 4N0DA 1MABB 1R74A 4DV3B 3B7PA 4AICA 1CUGA 1FS5A 3GW8A 2R7NA 3E9DA 3HS3A 5G1OA 3TR5A 2JH3A 4GZMA 2J07A 3PC6A 3SYLA 4G4JA 1JR4A 3L7JA 2BDTA 2VF4X 1RS0A 3TMYA 1V1RA 1TTTA 2EFHB 1JMYA 4F1WA 2H7CA 2QAGA 5TS2A 3DOOA 1RPZA 2Q1SA 1UFQA 3RYCB 2P4SA 3HY6A 3IQFA 1UOOA 1TMOA 1YVEI 4XD2A 2X4LA 1YJNB 4XONA 3FNIA 2FEWB 5M29A 5G41A 2X40A 4Y2JA 4L0MA 4XCVA 1Q7RA 5JD6A 5AK0A 2YN2A 1M34E 2J31A 5DNAA 1UBJS 3M34A 4PXYA 3H16A 3IT2A 1LK0A 3JR3A 5EJ6A 2B20A 1TB4A 1XZBA 1IHXA 1QVAA 1E2PA 1DBRA 3C8ZA 3SXUA 1Q7YD 3LT1A 5JHHB 1V11A 4CM1A 3MT8A 4YRCA 5J1TB 4J94A 4U2CA 1TADA 2E2WA 3Q2OA 4UEQA 2POCA 1X1TA 3THSA 4ROXA 2OR3A 2BZSA 4M9UA 5GONA 1M67A 1PDOA 3FCEA 4KZPA 4X84A 4LKOA 4I08A 5K3FB 1T15A 4XB6B 4PN7A 2RK3A 1ES9A 2ZPAA 4YRIA 1N33B 4UXJA 3D4BA 5DNDA 4CL2A 4LXQA 4M99A 4KNWA 4RPLA 2O3QA 3W6NA 1JU3A 1LZKA 5DYGA 1QONA 2Y0PA 3E7XA 2WP0A 4PCAA 1JFSA 1QAQA 3IVMA 4FM9A 1LEHA 2BAGA 2CJWA 4XMYA 2D3TA 4B3XA 2V1XA 5ICSA 1WA5A 3ZC3A 4Y2UA 5C7YA 1GSIA 3VVCA 3AIKA 3MTEA 1KBQA 1ZL2A 3K5PA 2WR8A 2D2FA 2VS1A 1DIHA 4XJSA 1PRYA 4E1VA 2I8AA 4Z7JA 4GVPA 2DRIA 2QKYA 3D3NA 2WB4A 1XDGA 3JX9A 3SN6A 3LL4A 3LUDA 3WB2A 2Y3IA 5F76A 2OD7A 3D59A 3IPYA 1VCNA 3ONWA 1NJ2A 1W2GA 3QUBA 1QCYA 4R1SA 2VDJA 2VPYA 3SU8A 5KYVA 3W5AA 5DX8A 3IDAA 5JWHA 1XMPA 3GEBA 1T29A 1LDMA 1YDEA 4GOOD 4F85A 1ZIPA 3OEED 4J9VA 3HJTA 4NZPA 1N5KA 1W5AA 2RHOA 5AWFC 1EXWA 4MICA 1VXRA 4TSKA 2WJJA 3F67A 4OAOA 3VISA 5HDQA 5FNZA 4ILKA 1SHJA 1YACA 5DHPA 2AE2A 1SVSA 1S9HA 1N5DA 2BF4A 2W98A 3I8OA 1KMMA 4M1QA 4I81A 2FPRA 1JLSA 1EXMA 1M1KD 1SU7A 3OOWA 5IYRA 2XUFA 3C5CA 3NGMA 4NYJR 1NWCA 1MO5A 3R5KA 4WLEA 1UIRA 1UL1X 4IINA 2BR3A 5CLLA 3VUEA 4ENPA 4QPDA 1O57A 2E85A 2FSIA 3D1JA 1E3WB 2FY8A 4PO1A 5I7AA 5A05A 5JH7B 3UFXB 4BFVA 3BKXA 3DE6X 3LCCA 4DYDA 2FDRA 4Q48A 4WN9A 3AXTA 3KT0A 5IF9A 2UXBB 4Q4LA 3MAAC 3ZU5A 1QO9A 1M66A 4EVQA 3WISA 5KC8A 1FXSA 1THZA 3NEPX 1PI3A 4DEXA 1VGQA 2EVWX 5ARCA 4EWLA 9LDTA 5KAPA 1BMDA 3M3DA 2QAIA 3G2HA 3LH5A 1PYDA 4MCIA 1ML3A 3CCBA 1RTKA 2DHRA 1GUFA 2XADA 3K8QA 3NEAA 4J1TA 4PU0A 4REMA 2I0FA 4DJDC 1G7SA 3RYHA 1XROA 4EG4A 1GZUA 1T8TA 2QE7D 3BAFA 5LB2A 3ZH2A 1FE8A 4YCLA 4QA9A 4R54A 3BTSA 1J4AA 1H2FA 4YR7A 2DR0A 1GN9A 2C4UA 4XL9A 3VV2A 3RV4A 3CZ9A 2AWNA 1NY6A 2OLJA 4FDVA 4UTOA 3KEGA 4W5HA 5A7GA 3UOWA 4YCSA 2CLKB 5I9MA 1H42A 1C4KA 1NBEA 3JALA 5KJCA 2WG1A 2P67A 2X6TA 2QTHA 3SKYA 1G3IA 1NM5C 2BVNA 1Z6AA 2VF7A 3HSKA 3HBMA 3LWNA 4JC0A 4EMBA 3BMCB 1J5EB 2IH2A 1M9NA 3MOSA 3RLFA 4OGFA 1CZNA 3NBFA 3JAWA 1RYZA 3LQ1A 3I9MA 4F0JA 4EH1A 4G5RA 1JLMA 2VJBA 2XDYA 2JHFA 4O4LA 4MWDA 4RLHA 1J0AA 3TNDA 3WRYA 4E14A 5AVTA 4QVIA 2QW1A 1MTOA 2OFWA 2XQVA 3CB2A 4YT4A 1GPUA 2IHKA 4GUAA 4KYTA 4B47A 1KYYA 1P6QA 1YRAA 1QFMA 1L5SA 2AN4A 3IAM1 1JBQA 1RE1A 4D4LA 1MGPA 2ZAOA 1NWHA 1ZHHA 3QPVA 3WR5A 3SVZA 2AJTA 2O2ZA 4C3OB 2FDXA 4M0KA 3OOYA 5HJEA 1MC4A 2UZ0A 4GMFA 3WGZA 4BQRA 3B6EA 5K0LA 2R1UA 3DP9A 4FFBB 5K0CA 4UNPA 4ZPJA 4C20A 2R5FA 1FU7A 1BOOA 1U11A 1UJ6A 3IOMA 3MZ0A 4G9GA 4IIGA 4Z4UA 5K4GA 3IVAA 1KFCB 2GAIA 1SD5A 1MGOA 3O8NA 1TTQB 2CEAA 5AJWA 3STWA 3HU1A 2P2LA 3EVDA 3O4JA 1FLVA 2ZZFA 3LUKA 4O3FA 4R5HA 5EJAA 2NYUA 3WK4A 2O8FA 1ECJA 4LWPA 1J20A 3QY9A 1P4RA 4TUYB 1MPXA 1RJDA 4YELA 3EYAA 1HQDA 1JAYA 3OAAD 1DLIA 4UHHA 4KR7A 1CERA 1JECA 3IP7A 3PFFA 1WL8A 1IOWA 1S2NA 4J29A 1C0LA 4MS1B 4K8RB 3U37A 3OC0A 3W5SA 5DI9A 3OFJA 5K3EA 1JEQA 2IITA 2HQ1A 4LZAA 5CCDA 1NKSA 3WBBA 4KITB 5H3CA 1NNEA 5EQFA 4Z9XA 1Z3IX 5M04A 3KK0A 1CJVC 1J06A 3D8SA 4KE8A 1Y7PA 4I7EA 1L4UA 4JB0A 4X05A 4JDUA 1YQGA 4Q9LA 4QHSA 4KO8A 4J90A 5L3RA 2P9EA 4OSPA 1RXEA 3QLEA 1RYMA 2IIBA 2JAUA 1ODKA 3ZKWB 3QNWA 1U98A 1UFVA 1XJQA 3A2MA 1D09A 1LC0A 1JG7A 4G85A 1G4HA 3PCTA 3GH3A 5J9FA 4ZOLA 5IZ4A 5BMVA 4C7BA 3I62A 3T54A 3KPYA 5A4IS 4CEHB 2YZ7A 1VPDA 4XX0A 3AU8A 5CW1A 1STOA 1T8RA 4P38A 3SSAA 1GPDG 1P8AA 4KMMA 4WH0A 3W79A 3BX1A 1R8JA 2R4TA 2EARA 4Y0NA 5LVAA 1M6YA 1O6CA 2WWIA 3L7OA 3HNOA 4BFSA 2A1TS 5BNTA 4K1LA 4FJ0A 1NX6A 4FCCA 1SXJD 2Q3LA 4WN9B 2B21A 3NW9A 1I6KA 1A04A 4FSDA 5PGMA 3PR1A 4WFKA 2RBGA 3HM2A 1CWUA 2R4QA 2BZ1A 4DCJA 3G0HA 4CMJA 4AC9A 2D4AA 3W4IA 2CC2A 1VHLA 4ARUA 1I24A 2NQ8A 2VTKA 3WGTA 4HDCA 5BYJA 4WIAA 3HKCB 3LZCA 1CULC 4RK1A 1QIJA 1V6SA 4EIWA 2ZXIA 5J3OA 1C30A 2OYSA 4UZUA 3D64A 4YCAA 2VRCA 3FTEA 1L4FA 2C2BA 3L01A 2JD0A 4Z3KA 2VDUE 1F9EA 1XAIA 2HCTA 3MWKA 3P0EA 1QK5A 4ZZ2A 4CCYB 3M81A 4D81A 1A9ZA 4K46A 3DBRA 4OQZA 5CLHA 2JZOA 2B2NA 1VHTA 4H27A 1GDDA 1CF2O 2GFQA 2VHQA 4GE3A 3NG1A 4OG2A 1USVA 4Q16A 3UMVA 5L40A 3MJVA 5EVCA 5IJ0A 1JKJB 3ZD7A 4JZYA 4QTXA 2QMQA 2HIHA 2WD7B 1E7MA 2CUZA 1GVNB 1X7GA 3OIWA 3A36A 3PQEA 4KMOA 2MSDB 3AZQA 4C0XA 2QI9F 4KIFA 3RD5A 5BWBA 2X8JB 4X97A 2HQSA 2ACEA 3IAXA 1KP3A 4RXMA 4B32A 2G5PA 5IP5A 1HT1E 4BB5A 3P0JA 4XKWA 1ZVJA 2O1WA 2QRJA 1A98A 3LBNA 3T1QA 1W85A 3A06A 3W77A 4YAEA 2GWRA 4PIPA 4GWLA 1DFHA 2GZHA 4G5SA 3KT6A 1P72A 3VDRA 3HM9A 4AJJA 5ALMA 5IJ9A 4N18A 5AHWA 2XSZD 2FPMA 4UPEA 1DJPA 2XUAA 1JTFA 2ZK7A 2Q46A 4J6FA 5F3RA 2XNDA 3UPTA 4KRXA 2QN3A 3ASYA 4JWKA 2IDZA 4RV5A 4YGXB 5AJTA 5JUWA 2IS6A 2WF7A 4YQZA 5A0FA 5J2UA 1GAXA 4YCMA 4L8FA 1AKTA 2I4NA 1PJRA 3U80A 1NPDA 2PGJA 3DOFA 1YXMA 5IAGA 3G8DA 5A5FA 1TIKA 1Z18A 2PLRA 4IOJA 4UBLA 2Q6LA 2JRLA 1NOIA 1RPNA 3FN4A 4JJKA 4ZRMA 5ITWA 4YXWD 4AM8A 4FYMA 1RADA 1EM8A 4QU9A 1NXTA 1E2DA 3FUTA 1QIMA 4PINA 4YHHB 2FMHA 2D62A 2PMEA 3OVMA 1Q2UA 3DKIA 3BCDA 3R3WA 4IS3A 1MDBA 4PYOA 1QS0B 3PQDA 5T3UA 4F4FA 3JQBC 4BFYA 5I4BA 3DV0A 4UM9D 5JAUA 4EF4A 1QQ6A 2WHRA 2EFJA 2FZLA 1EWVA 1L0BA 2GFHA 3THYB 1GPH1 1ZH2A 2CNLA 2GOYA 2PPLA 5EWLA 5HK9A 2PE5A 4TZTA 3K6SA 4FW9A 4B3TB 1W8DA 4QKQA 5ALKA 2REXB 1B6GA 1XN1A 2DG2A 4ZQEA 2YIMA 2KE5A 4OHBA 1XMIA 3LNNA 1AJEA 3QW4B 3V7FA 2BM9A 2ZS8A 1QDUA 3NBAA 3RDPA 4MJ7A 4MWOA 2Q7XA 3RODA 2B83A 3HSSA 4NONA 4EJ6A 1A2KC 1Q0TA 2X8LA 3E7WA 2ECPA 1II9A 2F48A 3QWFA 3FSRA 3ZDAA 3H11B 1BMQA 1JTEA 2F1KA 1JG4A 4V24A 3W8FA 1CS0B 4EGJA 4JEMA 2IWHA 4PWZA 2FWBA 1QZUA 3KLPX 1QMGA 4BO4A 2X3UA 1TK3A 1DQRA 1EDBA 1NVEA 2WD9A 3E20A 3O26A 3DMDA 3KELA 1VYVA 1YKGA 4INZA 1KEZA 3ITKA 3A6ZA 2YXDA 4IM7A 2ORIA 1VKNA 1EG7A 3IQWA 5LA6B 5FWNA 2X0EA 4XSVA 2ZTGA 1S2IA 1UINA 4U39A 2B8EA 1EPUA 1K75A 4NV1A 1LQUA 3EG9A 5DBIA 3QX8A 3RBXA 3BYZA 3LPDA 4H08A 1VLVA 3QVWA 1Z36A 4ZI7A 2NSYA 2XB2A 1KVTA 1T2AA 1AO0A 1R3DA 3U16A 3TLJA 4ZARA 1NBMA 1GKKA 4QJ4A 4E5MA 4KNVA 2H8GA 1JI3A 5DASA 3IKLA 4EB8A 3HADA 3A2LA 421PA 3GCWA 8ADHA