5GVRA

Crystal structure of the ddx41 dead domain in an apo closed form
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
234
structure length
234
Chain Sequence
b'ILVEGDGIPPPIKSFKEMKFPAAILRGLKKKGIHHPTPIQIQGIPTILSGRDMIGIAFTGSGKTLVFTLPVIMFCLEQEKRLPFSKREGPYGLIICPSRELARQTHGILEYYCRLLQEDSSPLLRCALCIGGMSVKEQMETIRHGVHMMVATPGRLMDLLQKKMVSLDICRYLALDEADRMIDMGFEGDIRTIFSYFKGQRQTLLFSATMPKKIQNFAKSALVKPVTINVGRAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable ATP-dependent RNA helicase DDX41
molecule tags Hydrolase
source organism Homo sapiens
publication title Structural and Functional Analysis of DDX41: a bispecific immune receptor for DNA and cyclic dinucleotide
pubmed doi rcsb
total genus 79
structure length 234
sequence length 234
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2016-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5gvrA00
3KFVA 4U5XA 1N0VC 2H1LA 5E7MA 1GSIA 4IDPA 5KNDA 2RCNA 4B3GA 4O25A 4P4SB 1W4BA 3BJIC 4DLZA 1XMSA 2GILA 1NY6A 2AD1A 5DSZA 2CJWB 4WA7A 2BV3A 1OXSC 2GZHA 2W6JD 4OK5A 3IILA 3Q8XB 4G5OA 3UMRA 2W83A 4XWAA 3NH6A 3TW8B 1DG1G 4IOJA 4DDTA 2IW3A 3I72A 4Q02A 2PLRA 5FR2A 1G5PA 2B92A 1HQCA 1IY2A 1R8QA 2OBMA 1L4YA 5J4VA 5KDDA 5FFMA 4QHSA 4RSGA 2HJVA 1OXXK 1FTNA 2HF9A 2DWPA 2FPLA 3DHWC 1VG8A 1PJRA 1JJ7A 5FL7A 4MRPA 4TQ9A 2Z4SA 4LGMA 4PHGA 3K9LA 4QFMA 1ZC4A 1GL6A 2GXUA 3FHOA 3B60A 5JHGB 3TAUA 4NCJA 2AK2A 3GLIA 5IK2D 3TUJC 1DTSA 2W6ID 5FBQB 5JRZA 3OIVA 2YC4C 1OH8A 1Z5ZA 3VR5A 4KVAA 3WXMA 2V6JA 4WBSA 3RANA 4C0AC 3A37A 5FPKA 1QF9A 3L82B 2UZ3A 1W2HA 3QKTA 4RD3A 2ONKA 3GEHA 1VECA 4L9SA 4OI1A 4C4PA 4V0LA 2IF2A 1NMXA 2J41A 4C0JA 3AKYA 2FFHA 1JJVA 1Z0JA 2E87A 1P62B 2P5SA 4JJZA 1VHLA 2WWIA 3RAPR 4J0QA 5JZVA 2FGKA 4BFZA 3MUFA 3FWYA 4DIDA 1LTQA 3L43A 2IUUA 3CBQA 2CK3A 2KB0A 4S2EA 3AVVA 3LDAA 1KNQA 3TSWA 3VHXA 3PUVA 1M7GA 2XNDA 2ZUBA 2D74A 3P32A 1UBGA 4I4LA 4G5RA 2XX3A 4OYHA 5AJWA 2X1VA 1X6VA 1BYIA 4H1UA 1ZINA 2HT6A 4QOSA 3L0SA 2VYFA 1TU3A 2QAGC 3B9QA 4KLNA 4RFSA 2WKRA 2BWJA 1E9AA 2DFNA 2X8AA 3DEFA 2GBLA 4PZLA 4ZV4A 3BFKA 4FWTA 1Q57A 3T15A 4CEHB 3CF2A 3F8TA 5FOUA 3I62A 2ZS9A 3V4FA 3M1IA 2RB4A 4WZBE 2IS4A 5A0FA 4E03A 1EFTA 3CO5A 3IDQA 4WXRA 3I5XA 2P67A 4RFSB 5FL3A 3B13B 3SZRA 3ZIAD 1BH2A 4IFBA 1HQYE 3BRWD 4LBVA 2OFXA 1SVSA 3NEYA 3RABA 1N6LA 3B9PA 5UKDA 1NVVQ 2IYRA 1EG7A 2BJWA 3ADDA 1Q1BA 2XZPA 4X8HA 1R4AA 1N0UA 1KI6A 4TYWA 1DADA 3W3ZB 4FN5A 1GP2A 1XXHE 3QENA 1HTWA 2L0XA 4CDGA 2CCKA 1JECA 3Q72A 1W4AA 4LJ4A 4AK9A 1R0YA 4NKRA 1NI3A 1F3OA 1O87A 3GLFE 4DB2A 1KI6B 3SBDA 2BKEA 2G3YA 5TY0A 3BK7A 3VU9B 2JLZA 1G3QA 3UMSA 1VCIA 1UJ2A 4QBGB 2CMKA 2OT3B 4YMUA 1SVIA 3QF4B 1ZJ6A 1P61B 2RKOA 5A5GA 2N42A 1T4GA 2NTYC 421PA 1N6RA 1ZCBA 3AKDA 1WQ1R 3NXSA 4JBYA 4TWZA 1KMHA 1XXHB 4YQFA 4PHFA 3SYLA 3ZVMA 3NKVA 1NIPA 4D0LB 1IONA 2ZI7A 3PVSA 2CEAA 2QI9C 1W49A 3OHMA 1AGRA 1N5IA 4W5WA 3EA0A 3LQQA 3PCRB 5KU1A 3NEJA 1YZNA 3EWSA 2W00A 1XXHA 3KKOA 4PC1A 2O0HA 3MAAC 4FMCB 2VBCA 3HYTA 3QXCA 2JAQA 3X2SA 1G8GA 2GEVA 2WJIA 4NYMQ 3OEHA 4F4JA 1NN3A 1F2UB 2CLDX 4URVR 3QKSA 2RMKA 4GMDA 5FL7D 1NP6A 2GEDA 1P7CA 4BFYA 2V8OA 4LC0A 2RGAA 5FH9A 2O8BB 4BQSA 2F9MA 3LA6A 2FFQA 3NVAA 4DSNA 2JIZA 2OILA 1KKMA 1T9HA 1XB2A 2JLSA 3DOFA 2BCGY 2GCOB 5EZ6B 1E0AA 5CB8A 3RWOA 4R9UC 1IN5A 4Q48A 1KO7A 2OE2A 1T3SA 3CPEA 5GJBA 1NVWQ 5E4FA 1JB1A 4LHZA 4M21A 4HLUC 3LBNA 4GZMA 1YZTA 1SVOA 2DR3A 1VG0B 1K5DA 3GCGA 4C7OA 3WNCA 1TQDA 2WICA 1T6NA 4HLDA 1E9DA 2G6BA 2ZM5A 2ZUCA 1E2MA 3NWJA 1ZRHA 2IYUA 3KKQA 4QC2A 1K6MA 3I4LA 4Q21A 3I32A 2GXSA 1HH4A 2PMDA 4FCVA 2O8EA 5KPDA 5C1BA 2C77A 3B1XA 1OFHA 1Z2AA 2FEMA 1SHZA 4N1AA 2WPDD 2ZU0C 1WCV1 4L8GA 1YHNA 2BKUA 4PHHA 1PLKA 4RY2A 2WPDA 5TV2A 1OKKD 4DEXA 3A8TA 3AV0B 4OJQA 1FNMA 4XVQA 1G17A 1KSFX 1W4RA 4WIAA 3L0OA 5CDFA 2DFKB 2OCPA 4MRNA 1G8YA 2PJZA 2GCNA 2KE5A 2PZFA 4EIWA 2BMFA 1E2KA 4M0LA 2WWFA 3T34A 2CBZA 1M8PA 2ORWA 4JL5A 3FPAA 5CM9C 4MDFA 2E1RA 2F3TA 4M9XA 1N0WA 3AF0A 3U6BA 1MO6A 3AP3A 5JSZB 2ZRLA 1N5KA 1M7BA 1XP8A 1OT3A 3FMPB 3PUWA 3KZ1E 4LYHA 3QOFA 1KGDA 1SXJE 2ZYVX 2WZQA 3SHWA 1FX0B 1ZUNB 2X2FA 3IHLA 3NBXX 2LKDA 4GI7A 4IEEA 1QG4A 2YWGA 3TSOA 3CH5A 4CIDA 4DRZA 4XTRA 4TYNA 4LBZA 3VR3A 2VHUA 4L4UA 4Y0VA 3CPJB 3BWDD 1F2TA 2WTUA 4B48A 5FPYA 3THWB 4HI0E 4KODA 2EFEB 1G6HA 5CDFE 2B7CA 1KAGA 4MA4A 1H8HD 4JSTA 2ZRBA 4HAVA 4KLZA 5JEEA 3C15C 2QZ4A 1W36C 4RJLA 1F2TB 2O8CA 4Q7JB 4EQ6A 4LI0A 2WWYA 3IO5A 4XOIA 5HZHA 4LZZA 3T06B 1I4TD 4G0NA 2ODEA 2OHFA 4LJAA 1G16A 2WAXA 1FOEB 1VYUA 4CGZA 1JI0A 2OZEA 2ZR7A 1AGPA 2ZU6A 3E1SA 4XSHA 2QQ0A 1SXJA 2O8CB 3SFVA 4KFTA 3EZFA 4KV9A 4TSFD 4B2LA 1U90A 3U3MA 1QVRA 1R0WA 4HLUA 1GKIA 4D4KA 2GBLC 4IDOA 4Z1MA 4FMCF 2F43B 3GJ6A 2CCGA 1OV4A 3TRFA 4EPWA 1E2EA 3IPXA 3BE4A 3NG1A 3P27A 1UADA 3W8NA 3WNDA 4AYWA 1CS4C 3FYHA 4G5QA 1KZ7B 1W48A 3QQ5A 2A3RA 3MGCA 1E2PA 2H18A 3QF4A 4V0ME 3VKHA 2CLCX 3SQWA 2ANCA 4IHQA 4Q5IA 4LBYA 4LJ8A 3QY0A 1VMAA 3BOSA 2QP9X 2HJGA 2KI5A 2GTPA 4IXMA 1EFHA 5KPJA 5FI1B 4I1OA 3IO3A 1TPZA 4ZO4A 1OF1A 1Z28A 2XNDD 5EUQB 4DCUA 4MKHA 2PZEA 2GRJA 5DGXA 2J87A 3X1YA 3QPVA 4CT5A 1RJ9A 1VDZA 3ND8A 2REOA 4B2PA 2ZPTX 3CX7A 3WHKA 3MWYW 1JBKA 2AXPA 4V03A 4PX9A 2R8RA 2BVNA 2ZJBA 4QGGA 2QORA 4IRUB 2QG6A 3QE0A 3SE0A 1QHXA 3B1YA 4Q4HB 2C2HA 2NOAA 3O8BA 1E0SA 1FL9A 3HR8A 4JLMA 5TXGA 4AWXA 3AP1A 3FFAA 5J4YA 4UNSA 2O8BA 1UEIA 1E6CA 3ASZA 3OIWA 3SQXA 1HT1E 2PMKA 4BEBA 1NKTA 3I61A 5LD2B 4DLRA 4TL8A 1Q21A 5D3MB 4MGYR 1DELA 1TF7A 3AF3A 1BS1A 4A6PA 4D4JA 4Q4HA 4AC9A 2V9PA 4YXWA 2Z43A 2IYQA 3QNUA 2JLYA 3IEVA 4NYMR 2XITA 4GPTA 3C8UA 5AUPB 1K5GA 4G1UC 3K0FA 1Z0DA 2VF8A 5FPTA 3GLGB 3HR7A 3AM1A 2H16A 4NYJR 2IXGA 2DFLA 3P1JA 4D80A 3FGNA 1KK2A 1ZM3A 2Z6VA 2ZSEA 3EXAA 4YMWA 1Q20A 1YQTA 4US0R 3A58B 1XMJA 3AUXA 4GT1A 4O2LA 4TLDA 5H70A 4KI0A 2W2VA 1CR0A 4WAUA 2V7QA 4BPBA 1II8A 3GJ5A 3LX5A 3GLGE 1TNDA 5JSZA 4UNNA 2IHYA 2BCJQ 3T12A 1Z6XA 4DVGA 4A15A 5FUXA 1SXJD 2ZRPA 2JDID 2OXRA 2XZOA 4QGAA 3U61B 1MRNA 2ZJOA 4M53A 1KI7A 1AK2A 1ZM2A 1E1RA 1ZU4A 1GRRA 3EZ2A 1II8B 2JASA 5HZKA 1KO8A 1DAIA 4N0DA 4V0NA 4MGKR 2J45A 4EJSB 4UXIA 1DEKA 3JVUA 3OAAD 5E95A 2FPMA 3U5ZB 1G3MA 1I2DA 5KSPA 1W1WA 5EXTA 1XMVA 3G5UA 3KX2A 4Q4LA 3UIEA 2O5VA 3PUZA 2EFCB 3OEED 1GNRA 4CRWB 1UBFA 2H92A 2DPXA 3QPUA 1DOAA 2EW1A 4I1VA 4PSAA 5CK4A 5AK0A 4DUGA 1GIAA 1CKEA 3E5HA 3Q7PA 4Q9IA 4KSCA 5KYKA 1S9DA 4NP6A 5JEDA 2GZDA 1IXZA 1W36B 4KBGA 1WBDA 2GA8A 2YINC 4X8LA 1US8B 4WZ6A 2RGNA 3B6EA 2W2TA 3BH0A 2V6IA 1GOTA 3GJ0A 1OIWA 4M1OA 1MABA 1E9BA 1X1RA 1MT0A 4MYHA 4PC6A 4BGDA 2V3CC 1MRSA 5EE9A 2WOJA 1KI1A 2UKDA 3KXIA 2GAOA 3BH6A 3TLXA 4IOMA 1OFIA 1P3JA 2BMJA 2GJ9A 1P72A 2ZEJA 3S1AA 1EWQA 1E98A 1COWD 1G8FA 4TLBA 5LB2A 4JLNA 3X1DA 1U8YA 2OCBA 3LO5A 3F5FA 4URWR 1JXMA 3IBGA 5K8IA 1P4SA 1R5OA 4N0EA 2IYLD 3A4LA 5JJIA 3W5JA 3PEVA 2JLQA 3K0CC 1T8UA 2RGGA 1CJVC 2F1RA 1XD2A 2FEOA 4GOXA 3K09C 4XTCS 4TMWA 1OYYA 2WMOB 4C0QC 1NRJB 3NHBA 4O2RA 3TNFA 3CW2A 5J47A 2HF8A 1SGWA 2QQEA 3K9NA 3R7WA 3P4XA 3T61A 1NIJA 2O8DB 3EIHA 1G7TA 4M4SA 3SC3A 4JLVA 4IW3B 3D7MA 3QKSB 5JS8A 2QT1A 1NVUQ 4MDEA 1QRAA 4XVRA 1VG1A 1T5LA 1W47A 2WJVA 1Q0UA 1W36D 1VYVA 2WWXA 1Z07A 2GCOA 2PX0A 3RDPA 4BZPA 2W58A 3M0EA 2DWOA 3VR2A 3TQCA 2O8DA 1LV7A 1P73A 3U4QA 1QDEA 4LJ7A 3NBFA 3T1VA 2QBYB 5BQ5A 4MKIA 5FI0B 1PUJA 2IS2A 1U2RA 5EE5B 2KJQA 5AJXA 1WB9A 2LKCA 1DAKA 1OKKA 4C7OB 1XCGB 2R6CA 3EWAA 1UF9A 4B47A 2WV9A 3OE7A 4Q4AB 5C2JB 1YE8A 3FMOB 4CW7A 4TMKA 2VP2A 4QL3A 2BM0A 2J7PA 2B8WA 3TUZC 2EQBA 4OK3A 1GUAA 2ATVA 4CEIA 4BRWA 5L3QA 3QKRB 1JALA 1CU1A 2ZI6A 4TQAA 3VR4A 2PCLA 2EYUA 1G6OA 2HCJB 3HU2A 4GDFA 1Z6AA 4QRHA 4TZ0A 1FQKA 4KYUA 1SVMA 4PC7A 4A8JC 2IS6A 1KK1A 1P2SA 2J7KA 4JIMA 4KBFA 2OESA 4JLAA 2FF7A 2QE7A 1G19A 4TMZA 3N5CA 5B57C 2QT0A 5EZ5A 4Q19A 1GAJA 1KZGB 1FTSA 3QKRA 1GTVA 5TB5A 2BMEA 1P9WA 2ZS7A 3TAHA 3TIFA 5K8TA 1F60A 2GHIA 3GMTA 3I92A 3PITA 2D2FA 1ZAKA 1BYUA 2BBWA 1Y3AA 2XTZA 3PV0A 2JIZD 4WVFA 3GLGA 3AVYA 3X1WA 2KWIA 2ZRDA 1XTQA 4JVMA 4YDHB 1WP9A 4NMMA 5FTNA 3KXLA 1XEWY 4NE2A 1U0LA 3AF4A 1T3LA 2HYDA 3FKSA 1YVDA 4JVSB 4DCNA 4PZYA 5CM8B 2IUSA 4NU0A 3CNNA 1NLFA 4JLKA 2GEUA 4QHYA 1ESNA 4P0TA 4IJMA 2AKYA 3W3AA 4DB4A 1VCOA 2QP3A 4MYUA 5JWHA 1J70A 4DDUA 4GMXA 2FZ4A 2ZVPX 4DCSA 3THWA 4HEJA 2ODNA 1N6HA 4V0OA 4LJ9A 2BC9A 5DH9A 5FPSA 4ASUD 4B75A 4Q7KA 1KSHA 1TX4B 2ZREA 4Q7MB 3FB4A 2CHGA 5CK5A 2G88A 2CLSA 4TMVA 4IOKA 4Q47A 4NPHA 4KITB 1IN6A 1G1MA 5B2ZA 5AUOB 4DT1B 2YHSA 4LX0A 2TMKA 2ODBA 5HCIA 2NO7A 2G0NA 2OM2A 1GDDA 4U7DA 1OHHA 3TE6A 4HZUB 3FHTA 3A1SA 3GEIA 1IN7A 2R6FA 4ESHA 3PQCA 2RGCA 5C18A 4JMPA 2XXAA 2J46A 5AUNB 1SVLA 1KNXA 1U81A 3OESA 4LV6A 1AQUA 3SJCA 1LNZA 1E2NA 4BASA 2A5GA 2IHBA 1M7HA 4TZ6A 2GK6A 4ZCLA 1K8RA 3TGPA 1KIMA 1YZGA 2GESA 3C4JA 4QNRA 2X77A 1XDBA 2O52A 3NBZC 4LOAA 4Q1AA 3P20A 4ILEA 3G82C 1J99A 2XOKA 4PTLA 3RC3A 3TKLA 2HLDD 3RS7A 2WM9B 3CRVA 3A1UA 4HAZA 3UMFA 1E69A 1MV5A 4R2HA 4R7ZA 1ZCAA 2ZJZA 3PG5A 1FFHA 2VSFA 4C2TA 2YWHA 2ZRIA 4XWKA 3AVPA 3IIJA 3Q85A 4B43A 2F7SA 4HYYA 2OBLA 1KI2A 3KKNA 1AM4D 2D3WA 4XD7A 4A9AA 5J4LA 4U00A 2V1XA 1GILA 2IYXA 4XWOA 4M22A 1ETUA 1TEVA 1Y63A 3A1VA 3JVVA 3LX8A 3FTQA 3WRYC 1JR3D 2C8VA 3LNCA 2WWWA 4F7WA 2QMUA 4DJTA 3AH8A 4RZUA 2UVQA 4PAQA 2I4IA 1CRPA 2QN6A 3H0KA 2C03A 2FSIA 5GADl 2AL7A 3CF6R 4KVGA 3FKSD 4EPTA 5E7IA 4LCBA 2FFAA 4PZZA 2JATA 3K70C 1ZM9A 2CNWA 5HKKA 3QSYA 2IK8A 4HAXA 2QRNA 2O0JA 1ZC3A 2Q3FA 1UPTA 1JR3E 1SVKA 2WIAA 3OEEA 4E09A 3IGFA 2P6UA 3IPYA 1VHTA 3ADBA 4XIGS 2ZJAA 4LBWA 4TYYA 3RS5A 3TSZA 4M1MA 3SS8A 4EUNA 2D62A 2QSZA 3IBYA 1W7AA 4YMVA 1FP6A 2NMVA 2JLXA 1OB2A 5CYOA 4D4MA 4EJSC 1QHSA 1ONBA 2DCUA 3U7HB 5JJLA 1E1RD 1NY5A 4I99A 1XTRA 1RIFA 3TBKA 2ZR9A 4R98A 1QHHB 2R9VA 3K9HA 4X8OA 1KJYA 1IQPA 1KOFA 4QJ4A 4MQBA 1E3MA 2IXEA 3MSXA 1H8HA 3RVBA 1KY2A 4ZCMA 1FUKA 3C14C 3BB3A 4ZIRA 3GLFA 1GZSA 3C5HA 3EARA 2J0UB 3DKPA 1N6KA 3QJYA 5KSOA 3UK6A 1VPLA 3K1JA 4A0HA 1HURA 1OFUX 1KK3A 4PPGA 3ASYA 3CONA 3THXB 4UNRA 4UXHA 1VKJA 2QMHA 2Z4RA 2RHMA 5FTJA 3I8XA 4ESVA 4RZXA 4OKSA 5BYJA 3GFOA 4M1SA 3IQWA 1XTJA 1UKVY 1VCMA 1VIAA 4KU4A 2ZI5A 3ZDQA 1S3GA 3IHWA 4DSOA 4MKGA 4TMXA 4A2PA 3AB3A 3W6NA 3UWKA 2VP0A 4ASUA 2G1JA 3GLHB 3KXKA 3T1TA 3DVLA 4S35A 2SHKA 5DLQC 4D4LA 1Q12A 2DWQA 4M1KA 4ARZB 3SOPA 1E2QA 3QIAA 3QUSA 2QPTA 3B8HA 5SZHB 1KY3A 4JKYA 3R8FA 2ZE6A 3KJIA 4PHTA 2EFHB 1NJGA 1ZM7A 1HEIA 3CR8A 2XEXA 2YKGA 4EPXA 3DMDA 2WJGA 4L9WA 5JECA 2YWFA 4FIDA 3QBVA 4HB3A 4LPKA 2QY9A 1YR6A 3LAWA 4BECA 1OJLA 3GJ3A 3DOEA 5K8UA 1CTQA 2QM8A 3A36A 3KQNA 4PSVA 1RFLA 1XEWX 3BC1A 1ZVQA 2QPOA 2HEIA 4DC9A 2XSZD 3KJHA 3SEAA 3S1AB 2AN9A 4MKFA 3A1WA 3TK1A 1LB1B 2OAP1 3CM0A 3CRRA 4ZDIA 1XPUA 4LYJA 1G4UR 3QPWA 2ORIA 1M74A 2KBEA 5GJVC 5DYGA 1S3SA 4B73A 3FMIA 4WW0A 4A1FA 1JR3A 1U8ZA 2WMNB 4RZ3A 5JWRA 4HUQA 4P33A 2VTKA 5IDVA 1OXTA 4FMDB 3THOA 4AD8A 4B3FX 1CEEA 2QAGA 1QHYA 1P5ZB 3D3QA 3MCAA 1LVGA 2JLUA 1MR3F 1D8TA 1F48A 2XSZA 4Q66C 4CEJB 3LXXA 3W5IA 3R7WB 4ZKEA 1NBME 1KDOA 1YR8A 3WHLA 2J7PD 3OIYA 3WBKA 3W6OA 1Z06A 3BB1A 3LWNA 4GP6A 5FBVB 4PC2A 4WZAE 5SZJA 2CNWD 5HKKD 5FOWA 4BFXA 2FWRA 4MUAA 1F5NA 2PL3A 1WDTA 1M6NA 4A4DA 5BXQC 3AVUA 1A2BA 2GDJA 5EXPA 4OJKA 2H7VA 3MG9A 121PA 3IIMA 3PR1A 4YMSA 5BN3A 4PPQA 4KXFB 5IK2A 4D6PA 4B2IA 1WBBA 3CKLA 1P2TA 1W0KA 3G0HA 2V4ZA 1T91A 2ZRNA 1S96A 3CRW1 3H84A 1QHGA 2H5EA 4IKEA 4LJ5A 4DWJA 3NIBA 2Q9BA 2FFBA 4GZLA 3TR0A 1Z47A 2VA8A 5KSZA 3QG1A 1C9KA 1T0JB 1D2MA 4OHYA 2ZRMA 4FCTA 5AWFC 4G5GA 4YLGA 4DDWA 1GL7A 1L4UA 4C0HA 4K81B 5L3QB 4BWYA 3SHFA 5GVRA 1LS6A 2BHRA 5FUWA 3MRSA 3E70C 2GF0A 3RNLA 3EPHA 2C78A 5LB4A 5SZKB 4BLOA 4D0GA 4Z1MD 5JBQA 3IIKA 1A7JA 4TLCA 3Q5EA 5EE0A 1E2FA 2EYQA 3EIEA 1E9FA 3PIRA 1QHNA 1G21E 4M9QA 5C4MA 4URZR 4A0RA 1E4YA 4P4SA 5BWMA 3BAFA 1XRJA 3KJGA 3CPHA 1G5RA 3L8ZA 4GRAA 2C95A 5FPHA 3QG5A 1Z6TA 3GJ8A 2VHQA 3HDTA 1WMSA 4Q01A 1ZNYA 5CJPA 1F2UA 2AD5A 3SR0A 3U3JA 1EFRA 3THYA 5JJKA 1GL9B 2WBLC 721PA 3K0AB 2CDNA 4LV5B 1CR4A 2QL6A 2VL7A 4BZXA 1I2MA 4NL4H 2NZ8A 4DLXA 2CCJA 4CZ2A 4F4CA 2ZYTX 2AK3A 4DIEA 4PQYA 1P60A 1QHIA 5BN5A 2DHRA 1HA3A 3B82A 2IWHA 2VP9A 4H1VA 1YU9A 2F1IA 1TQ4A 2FG5A 3VR1A 4AKEA 5DHFA 3ZGXA 4ZIRB 3PJRA 5L3SA 3SU8A 2A30A 4TYPA 5L3VA 2XB4A 3HP1A 3GD7A 2QROA 4LHYA 5B30A 1Q22A 2JLVA 4ARZA 1ZW6A 3MWLA 3K9GA 2XJ4A 2VLIA 3NC0C 2NO1A 3FE2A 1N6NA 2CVFA 2WJHA 4D82A 4V0MA 3K70D 2X19A 4G01B 3B1WA 4QGHA 1RJ9B 4GFDA 4OI4A 2R65A 5KNCA 1XEFA 1KDTA 4DLVA 2O8EB 2NPFA 4B34A 1E9SA 4BRUA 4US2R 1CJUC 1R2QA 1TADA 1R0ZA 1NL3A 1WA5A 2CHVA 2JDIA 4RVCA 4GOJA 2Q21A 5LPNA 1KO5A 4TL9A 1AS2A 4L16A 5C46F 2HYIC 3FKQA 4IVPA 1YZLA 2RHDA 1CF4A 2WHXA 1TTTA 2ZE7A 4DLTA 2XNSA 2ZVQX 3ZD6A 4N3NA 2JJ2A 3L8YA 1SHKA 2VHCA 3B85A 4JT2A 5IF9A 4PO9A 1CXZA 1FMLA 2YOHA 2ZS8A 3GQBA 6Q21A 4I1SA 3DM9B 1KI9A 4B71A 5CLQA 5FOSA 5HPYB 3HPQA 3BB4A 4HUQB 4Q1BA 5EP2A 1CJMA 1I4LD 5EXXA 5DO9A 1NN1A 2Q3MA 5JMTA 1WXQA 2GETA 3HPRA 2EFGA 1EXMA 3NBYC 3V00A 2D7DA 4M9ZA 1G3UA 1KYIA 2AWNA 4JLOA 1PZNA 3DL0A 3BGWA 3KB1A 1NNEA 2GVDC 2OFWA 2ZJ8A 2AXNA 2FE4A 1G20E 4HB2A 1XZPA 1PUIA 1XJCA 2P6NA 1N6PA 2HT1A 3GFPA 2ZSAA 1W44A 4DBLC 4RKFA 4B3CA 2EU8A 3GLIE 3PEUA 4EFNA 1KJWA 3C5CA 3IEUA 4D25A 2PX3A 1G8HA 4URUR 4OI0A 2FH5B 4PSKA 2QPAA 3CRQA 4Y0AA 4QXAA 4CF7A 3LRPA 3R9IA 2FZLA 2GZAA 3LD9A 4NCKA 3EZ9A 4Q1FA 3GLHE 2PZGA 3KUDA 2HDNB 4RFVA 2C9CA 5HCNA 2PCJA 5IT5A 3ETLA 2CE2X 4PO8A 3A4MA 3RRYA 2IX3A 2FSHA 4CEJA 5DI9A 1YZUA 5B58C 4IDHA 4OI2A 1FW6A 5HE8A 1JAIA 5EP1A 1D2EA 1IN4A 1FX0A 2YNMA 4DCVA 1ZIPA 1HYQA 221PA 2ZRJA 1BKDR 3IUYA 4FI3C 4M8NE 4KSBA 1VYTA 3FOZA 3LBHA 3VKWA 1OSNA 3I73A 4MUBA 4TMTA 5AJVB 3U7GA 4A8JB 2GXAA 4YONB 3U44B 2OSBA 2IF0A 1SQ5A 4JLPA 3B7GA 1J8MF 1EX7A 2ZSBA 1RYFA 4ZDJA 1J8YF 3SJZA 2O8FA 1P2UA 2NPIA 2QTHA 3QF7A 3I1FA 4MITA 1B23P 3U44A 2PH1A 4AI6A 1N5JA 3TMKA 3UPUA 4C9BA 3N2IA 2WSSA 5H68A 2P2LA 4IVRA 2HUPA 5AUQA 2G77B 1UEJA 2ZRAA 3FMFA 1U9IA 1AIPA 4JYCA 4DSTA 1E32A 3THYB 3O8RA 3D31A 4BLQA 4NTZA 1OIXA 1CIPA 2IUTA 3VKGA 1EESA 4ACBA 3K0AA 2YYZA 3U60B 1Z0AA 2ZJ5A 2J0UA 4ITRC 2K5UA 3WRXC 4M1TA 2NIPA 5SZIA 2ZI9A 4LHVA 4JYBA 2ZE8A 3BBPA 3FVQA 2FNAA 3R8CA 3SYKA 1FPMA 1W0JD 4A6XA 3Q7QA 4Z8XA 3LVQE 3B1VA 5L3SB 3K0SA 3KKMA 1XMIA 2ERYA 2WIBA 4B35A 1D5CA 1DG3A 2AR7A 4LSGA 3REGA 1NMYA 1PLJA 3FHCB 2ZAOA 1W4CA 3W8RA 3OE7D 4D0NA 3QXSA 1EGAA 1KSGA 1GNPA 1Z6GA 1KI3A 4BFUA 2VQSA 4IEIA 3WP1B 4Z8YA 4IDNA 4NH0A 3U6KA 4TTQA 3ZQJA 4HUTA 1M1YE 3BXZA 1ZMXA 2WVJA 3JZMA 3QXJA 2R44A 3GLIB 1E2IA 3TW4A 1RRPA 4JVNA 4LPSA 2FGJA 4KFSA 1IY0A 2IYSA 2OUKA 2HXYA 5J5CA 1LY1A 2JJ2D 1XZQA 2XOKD 3AVQA 1E2HA 4IDQA 3NDBB 3KTAB 3MLEA 3T5DA 2W6JA 5AJYA 5BW8A 1ZNWA 4MYCA 5FUVA 1PVOA 1KSJA 1B0UA 4IXNA 1IJFA 2NO9A 2BBSA 4Q00A 3ZQ6A 3LXRA 4BFSA 3HU3A 4Q4JA 2ORVA 1RRFA 1F6BA 2D7CA 3EPJA 5HR5A 3BFXA 3H1TA 4OQLA 1ANKA 2DB3A 2HV8A 1R0XA 1D2NA 4B74A 3VNVA 2NGRA 2Z83A 1A1VA 1CRQA 4UJ3A 1X86B 2V7QD 4NHOA 2ONJA 5JLJA 4Q7LA 4US1R 4PC3A 1ZYUA 2WKQA 3ZZ0A 4GL2A 1TL7C 3ZZTA 2XJ9A 4UNPA 4UJ5A 4B44A 1WF3A 3K09A 4EKDA 4UXJA 1CP2A 4Q1CA 1RE0A 4HAUA 5D3QA 3P4YA 1E9CA 2F9LA 3AGPA 3CNOA 2XGJA 3ADKA 4EJSA 1XTIA 3CB4A 3R9WA 4BLTA 3CR7A 1OE0A 4ZDWA 4HATA 5DNYB 3CZPA 1GRNA 2H17A 2XTMA 2WJJA 2H8KA 2GJSA 3KJEA 4HAYA 2P6RA 2LCFA 5FTMA 1Z2CA 4RD4A 2Q0HA 4P4TA 1Z0FA 5L8VA 3AVWA 2QENA 1A5TA 2QSYA 1Z08A 3U7FB 2QTFA 5GVSA 2LWIA 4U02A 3VMFA 1GG2A 1UBCA 2OFOA 2ZUDA 4BLRA 1N2CE 1E99A 2FX3A 3EW9A 3LV8A 4JBWA 3V9PA 2YOGA 4B32A 2G83A 1OHHD 1Z83A 3EZ7A 2GAAA 4GNKA 1E2LA 1Z22A 4Z51A 4HDCA 3OFND 1KK0A 4LUCA 3QEJA 3A6PC 2IA5A 3L0IB 4BE7B 2A5DA 4K8OA 4CEHA 1OH6A 2ZSFA 2WAYA 3CWZA 1ZBDA 2REBA 2AX4A 2KBFA 4LHXA 4NBSA 3O8CA 4I1UA 3DDCA 1Q1ZA 2J3EA 3AQ4A 2AHOA 1G3IA 3BD9A 4KFUA 4AYTA 3LW7A 1VIYA 2IEYA 4PAOA 2ZR0A 3U3KA 5GJCA 3PFIA 1WRBA 4P4UA 2I1QA 1EFRD 8OHMA 4KAXA 4XD7D 3WP0A 1OXUA 1FUUA 2Z5FA 3QVUA 2IYVA 1MO5A 1ZNXA 3WBJA 4CT4B 1Q1QA 4OL0A 1FP7A 1MABB 1OW3B 1VG9B 1SZPA 2F43A 2MMGA 4BEJA 2RGNC 4Q03A 1G64A 1KMHB 2ZRGA 4IFEA 4EFMA 3PUXA 2RGDA 1IOZA 2WSSD 3CRMA 4JKIA 1G291 4GBMA 2HLDA 4X8MA 1DPFA 1YRBA 3B1ZA 4HB4A 2UZIR 4B6EA 2CL7X 4A92A 2DYKA 1IJEA 4XH9B 5HTKA 5EE3A 1CJKC 3O8DA 1HE8B 2R6GA 1Q1EA 5AJZA 5FBLB 1DBSA 4AKIA 2ZYUX 4P32A 2BDTA 2CJWA 2V1UA 3H2YA 4M1WA 3P26A 1W2GA 1E1QA 3Q3JB 4FCWA 5B64A 3C16C 1BMFA 3EPKA 1JEDA 2P65A 4RKEA 2VP4A 5E3HA 2ZROA 2B21A 4FWIB 4M9SA 4AURA 2XAUA 4CYMA 1RW4A 3AP2A 4KYIB 1CULC 4HZIA 3VNUA 2YVUA 1NLYA 4IOLA 5EXSA 2BM1A 1SKYE 1TEXA 4Q1EA 1GRQA 2FOLA 4K46A 4AG5A 1SKQA 2WWGA 4DLWA 1D6JA 1XX6A 4TYQA 1LFDB 4XJXA 2VRWA 4NONA 3U3OA 1Q3HA 1SVWA 5BYKA 1DAMA 2FPKA 1ZD8A 4ABYA 2GK7A 5H8WA 2IC5A 5TARA 5CITA 2YWEA 1NVXQ 1P75A 5KHOC 2QM7A 5L3RA 3KQLA 5LD2C 2ZITA 1OPXA 4QM7A 4DSUA 1A4RA 3VX3A 1ZP6A 5J40A 1BIFA 4JLBA 4RCYA 3DZ8A 3RYTC 3EX7C 4LDJA 3U4QB 1E9EA 4LY6A 1M2OB 1G8PA 2QU8A 3T1QA 2QBYA 1UFQA 2VH5R 2B6HA 1U9IC 1C4OA 2RAPA 3WYFA 5F3WB 1ODFA 4FINA 2W0MA 3BERA 2W6IA 5JCZA 2QGNA 2OLJA 5KDLA 1Z3IX 3LW8A 4V0KA 1X3SA 2Q3HA 3RSLA 3V4RA 1TQ6A 1G7RA 5KO2A 4HDOB 1IM2A 4TN1A 1GM5A 2GWHA 1E2GA 1V5WA 1G18A 3ZS9A 3OIUA 1UAAA 1KJZA 2F3RA 3SJAA 4DKXA 2BJVA 3AF2A 3OZXA 2GXQA 4ON9A 4H9GA 1AZSC 5JCPA 2QGZA 4Q4JB 1HE1C 4C0KA 4BFTA 1IY1A 4HLCA 2PLFA 4LC1A 4JSYA 4A36A 1JAHA 2ZRFA 3TR5A 2VHJA 2JA1A 1KTVA 2QA5A 3B78A 4TQUS 3AKEA 1UBEA 1CR1A 4B3DA 3CH4B 4JS0A 1XTSA 3HWSA 3GJ4A 4NYIQ 3PEWA 3K70B 4QM6A 1JPNA 4JLJA 1OYWA 1IHUA 1XEXB 1DAFA 1I4DD 4TL7A 1RKBA 1S0UA 2W0SA 4OHZA 4QBIA 2OBNA 3IQXA 4POAA 1X1SA 1G5TA 3NHAA 4OQMA 1IXRC 4FMDF 5JRJA 2J1LA 3F3YA 621PA 1WE2A 2FA9A 2J5XA 4DT1A 3D8BA 1AZTA 3HYRA 3CIOA 2CVHA 1US8A 5DIFA 4GSYA 5IRCD 4HZUA 2JLWA 4ZCIA 3KL4A 5G40A 4L15A 1S8FA 2ERXA 4QJ3A 2GVZC 3MFYA 4II7A 4PAMA 2WSMA 4EDHA 3N70A 1O3YA 4R2IA 4NDZA 4LJ6A 1Z6YA 2IYYA 2OEPA 3JZAA 2ANBA 1ZM4A 1NF3A 2PT5A 4HLQB 3LLUA 1E79A 1NLZA 2IYZA 3VU9A 4EPYA 1ZU5A 2V54A 2O0KA 4AG6A 2I1VB 3VX4A 2QRZA 1ZD9A 5F2EA 1RRCA 1GITA 4C30A 3RS2A 1BO6A 1XPRA 1U8AA 1UKZA 2IT1A 2YC2C 4G3XA 2I3BA 4ZI3A 2RGBA 2CHQA 2HCBA 1OLOA 3RC8A 2C9YA 4PFSA 3TUIC 4W9MC 3I3SR 3LVRE 4EQ6B 2VPPA 4YXWD 3KKPA 4M2LA 2BEJA 4TT3D 1TUEA 1L7VC 3PXGA 1ZD1A 2PT7A 2GJKA 1RZ3A 2DY1A 1E79D 1MO4A 5FOTA 1RC8A 4KJZA 4PPNA 1UM8A 3RRMA 5TMPA 4PQFA 1G7SA 2FDCA 5G3YA 2A7QA 2FJUA 3WNBA 1E0JA 4NZYA 4NCIA 1U98A 2V55B 1EFCA 2J9RA 3GFTA 1TMKA 1S1CA 4NCHA 3WMFA 2ZAMA 5CIQA 1J90A 2WOOA 2XZLA 1OB5A 3VFDA 1ZNZA 4DCTA 4MYTA 3VR6A 3SFZA 3I8SA 4Q9LA 1GNQA 1JR6A 2FU5C 1E0KA 521PA 3ZH9B 1YZQA 1JQLB 3CX6A 5TVKA 3WMEA 1S1MA 3ZZUA 2VO1A 4E07A 1GKUB 5DN6D 1PLLA 1LS1A 4PXAA 4F4IA 1DVRA 3AGQA 2H57A 2C9OA 5E7JA 2ODWA 3KFXA 4ZDKA 2ZRKA 4MRVA 4PQRA 3NDPA 3M6AA 3AVOA 3KTAA 3D6TB 3W34A 2CL6X 4QJ5A 3OEHD 5D3MA 1IBRA 1YR9A 4WOPA 5H1YA 3FFBA 4TSFA 4NYJQ 4DLUA 1P9NA 1AKYA 1N25A 2MMCA 1XD9A 2OG2A 3M4YA 1L2TA 4OHWA 1GWNA 4D2IA 1Z63A 3CX8A 3RS4A 4MGZR 4MH0R 2CL0X 3VQTA 2ZJ2A 3UG7A 1N5LA 1NJFA 2YV5A 4M1YA 2EWVA 4DZZA 1M34E 4EPRA 4UQOA 4RD0A 4Q4AA 1NG1A 2DFTA 4OK6A 4QBFA 4Q9HA 4ACAA 1XFAA 2IBMA 4XSGA 1DO2A 3A4NA 3EZ6A 1QG2A 3C41J 1LF5A 3EG5A 1S2MA 1SXJC 2X2EA 3H4MA 1HV8A 3GJXC 3L2OB 3C7KA 2GNOA 1X8JA 1SKYB 5CB6A 1CR2A 4W5JA 3EAQA 2GKSA 4AYXA 3Q5DA 3K0FB 2MSEB 4JVLA 3TVDA 4EFLA 2QMEA 3DPUA 5J4KA 4UKDA 3VTKA 1T5IA 4L5BA 2AFIE 2Q9CA 4OQFA 2NZJA 4B3XA 2J0QA 1AJEA 1E4VA 3CLVA 1OH5A 2A2ZA 4C3ZA 1Q3TA 2E9SA 5FR1A 3BFVA 1KO4A 2AFHE 5BN4A 4DDVA 3FDIA 3AKCA 3ADCA 1X8KA 2FMXA 1DO0A 2IS1A 3W9YA 2NO6A 1J7KA 1NG9A 1II9A 1TF5A 3T35A 2ZE5A 1XPOA 2W2XA 4JBXA 3UWOA 4B3BA 3THXA 3DKVA 3LH5A 1FQJA 1G7CA 4TTRA 1R8SA 1ZUHA 4OHXA 5A4JA 5CIWA 1NSFA 5F9HA 1KKLA 4D26A 3ICQB 1UDWA 3SDZA 4B6FA 3RLFA 4BFVA 4AKHA 2VF7A 5LBIA 4JJKA 1Z0IA 1Z29A 1U94A 4AIIA 3GPLA 3CZQA 4YMTA 4LYFA 1PV4A 1BMFD 2IXFA 3TVTA 1L8QA 4QBHA 5HE9A 4A82A 2FN4A 4RCZA 5K8LA 4HB0A 2BBOA 1KMQA 2OCAA 2C5LA 3K0EA 5G41A 4P3YA 4DUGD 2F55A 3KQHA 1RYHA 1MOZA 1XWIA 4KCGA 2P3SA 5EQTA 1ELOA 2JJ1A 2NG1A 1P6XA 5C4GB 5FUYA 5G3ZA 2QNRA 1IXSB 2MSDB 1SXJB 2FSGA 1RPZA 4MGIR 1U99A 4GP7A 2C96A 1KHTA 2OAQ1 2ZYWX 3CF0A 3RHFA 4Z54A 1FNNA 3IKJA 2Y8EA 3X1ZA 1DS6A 4F91B 2D4HA 3DMNA 1CLUA 3GEEA 4DXAA 3OF5A 2BIFA 1A2KC 4KFRA 2OLKA 4URYR 2N1BA 2C99A 3ECCA 3LY5A 2QP4A 4WXPA 4XVUA 4ERNA 1W46A 2EWWA 3CUEF 4BLSA 2VSOA 1XD8A 2JJ8A 3NH9A 5FOXA 3UXMA 5LDDC 4LRWA 1DAHA 5FTKA 4I81A 5FTLA 1UKEA 1CBUA 5AR1A 1P2VA 4FMBB 3QXHA 4TTPA 4Q9JA 5TDHA 3EASA 4PR0A 1RRGA 3ZS8A 3T1OA 2Q6TA 1SULA 3W6PA 2BBTA 3QKUA 5DN6A 4C0BA 3AEZA 1H8EA 2F6RA 1NVVR 1RVDA 3VAAA 2AWOA 1C1YA 4HAWA 3ZJYA 1W0KD 1XD2B 4V02A 1DAEA 1LW7A 3EA5A 2ZQ5A 1MKYA 1E96A 3DM5A 4OHVA 4Q18A 5JFGA 3L0PA 1NN5A 1W5SA 1IAQA 2ZJYA 2YOFA 4QNMA 2IL1A 2IWRA 4E22A 1HT2E 3MJHA 1W5TA 4FXPA 1AQYA 1A82A 3AVTA 4BZQA 3DO6A 5EUMA 3AVXA 2WJYA 1E94E 3EIQA 1QZXA 3BH7A 4BFWA 1OFTA 3LBIA 4Q9KA 1GFIA 1OXVA 3BORA 2CK3D 4YDSA 1XBTA 1R5NA 2J59A 2QEQA 1JEEA 1HUQA 2ZIAA 4OQXA 4UNQA 5JI3E 1OH7A 3TJZA 1H8ED 1V43A 3PENA 1Z0KA 4BLPA 4AKGA 2RGEA 4EPVA 4RZ2A 4CEIB 5F98A 1JPJA 2REXB 3QVVA 3GJ7A 3SN6A 5JS7A 4P31A 2ZSDA 1KDRA 2A5FA 3MMPA 2A5JA 3NTUA 4QGFA 1U0HC 3SJBA 2O8FB 2P0EA 1TUIA 5CLLA 2B8TA 5M04A 3RWMB 2XTNA 1R6BX 1D9ZA 3TH5A 2QTVB 4LWZA 1DE0A 1ESMA 2ZI4A 4QKQA 2ZRCA 1ZIOA 2P5TB 1KI4A 3W90A 1KAOA 3SI7A 4F93B 1T3HA 3N2EA 4DEYA 3QEOA 4CVNA 5KOYA 3A1TA 5FOVA 5JI2E 2EFDB 1KI8A 3SBEA 4ZI2A 3MD0A 4JT4A 1DAGA 4LK2A 4PO1A 2BOVA 3ZVLA 3BS4A 5CYPA 1II0A 2A78A 2YZ2A 4LJYA 1D9XA 2R62A 2YJTD 2J0SA 1XEXA 1XF9A 4JL8A 3RRZA 1E2JA 4KHZA 3EPLA 3QBTA 5DHAA 3PUYA 3WMGA 1KDPA 2JJ1D 2FV8A 4LV8B 3J81k 1FMJA 1TU4A 1UDXA 1JQJC 3RRNA 2D2EA 3GLHA 2ASEA 2OV2A 3MWKA 3U3RA 1YJ5A 3LQRA 1ZUIA 1YZKA 2R2AA 5CJ2A 1T0HB 2VEDA 4YC7A 4D81A 1NMZA 1IN8A 4KO8A 5J4HA 5KTYA 2PJRA 2GJ8A 2F1HA 3R20A 4E5UA 4NYIR 4C0LA 3ZLJA 2OCYC 2BMDA 3OAAA 2D06A 3WY9A 2QUZA 1AS0A 4RD6A 5KDOA 2C98A 2VP5A 5DI3B 1G3RA 1G4AE 1G41A 5P21A 4BUJA 1AS3A 1YRAA 4W7SA 1EWRA 3HJNA 4NCNA 4LYAA 1R10A 2IYWA 3SNHA 5GJWC 1MO3A 1TQ2A 2GF9A 4A0FA 2KSQA 1AN0A 4PPFA 4DLYA 1YKSA 3K53A 5DYIA 2C04A 2ZXUA 5DI3A 2WWHA 3H86A 1X8LA 1UKYA 2ZRHA 3AF1A 1N3BA 3KDSE 1T8TA 4OBEA 4JLDA 1XCMA 2DBYA 4OQNA 2GCPA 2A5YB 3X1XA 2G0TA 4ZKDA 3F0TA 1KO1A 2R6DA 3EC2A 5KNBA 1GKYA 821PA 5EP4A 3Q9LA 2MSCB 3K0CA 4GOKA 3ZVRA 1HY3A 1S4QA 1R5BA 3CNLA 3ZD7A 1VCNA 4MRSA 5JHHB 5FBWB 4TL6A 2BEKA 1DARA 2JEOA 2PBRA 3ZVNA 3KB2A 3NC1C 2CE7A 1COWA 2VIIA 3UG6A 1Z8FA 4O0MA 1N6IA 5DISB 2ATXA 3REFA 4MRRA 5G53C 1XJQA 4RD2A 5EP3A 3R9XA 2G9NA 1JNYA 1TF2A 3RS3A 2XXAB 3ICEA 5FBRB 3U2QA 2OXCA 2JLRA 2ZANA 1AKEA 3K8YA 3PEYA 2OO7A 3LFUA 2N46A 1EX6A 1N6OA 2G1KA 2VSXA 2JCSA 4RD1A 4FD2A 4AY2A 2GJAA 1NN0A 3T5GA 3ND9A 2QMOA 4FW9A 4ZPXA 4A0GA 3AUYA 3OFNA 1VTKA 2QAGB 1YR7A 3EC1A 4HSEA 3UATA 1NSTA 1FZQA 1G9XA 3ONWA 4IVQA 4F92B 3GP8A 2NO0A 3B5JA 3KUCA 1BOFA 2RGXA 3O47A 1U0JA 2CXXA 3ZIAA 4URXR 4DHEA 5DE3A 1XCPA 1XU4A 3E2IA 1S9HA 5KUTA 4C2UA 5F9FA 4B76A 1NKSA 3ZYCA 2VP6A 3LLMA 1EFUA 1MH1A 4JZKA 1LF0A 4TLAA 3I5YA 1GVNB 1TAGA 2F1JA 1J2JA 1W0JA 2Q9AA 3DZDA 3BIFA 3QXXA 1XJ0A 1P9RA 3RSOA 4O3MA 3HU1A 1Q44A 2ECKA 2AKAB 5JWOA 4DLSA 4TLEA 2B7BA 1E1QD 1R7RA 3UANA 2NQ2C 3QI2A 1OIVA 5EJEA 3CWQA 1NBMA 4QG7A 5IHPA 4F38A 1E9RA 1CJTC 3KQKA 4A2WA 4QHTA 2JGNA 1XNJA 2VHTA 5EE1A 3VHLB 4PANA 5ELXA 4A8JA 2PEYA 4W5HA 3TQFA 2FSFA 2IEZA 3WYAA 4HDQB 2WKPA 4A2QA 1JXOA 4C0SA 5KSYA 1AA9A 1E2DA 3U7EB 1H65A 1EK0A 3B2EA 3SYNA 1QVAA 2Z0MA 4G5SA 1QHHA 2QE7D 3MJRA 4EAQA 1XTKA 3WYGA 2QAJA 4R71A 2PEZA 2ZTSA 2R6AA 3KQUA 4TT3A 4B33A 2ZI3A 1NBMD 3RS0A 3UKDA 2HXSA 3GLFB 1QBKC 2EVWX 2XB2A 2IYTA 2RH5A 2J0VA 4Q1DA 5ANRB 2ZETA 2A9KA 4JL6A 3MWJA 4LHWA
chains in the Genus database with same CATH superfamily
2ZIUB 3TMYA 4AZ3B 1QBGA 2G36A 1CLEA 2VXYA 4FS3A 4Q15A 4UARA 5HYVA 3F5SA 4NU6A 5E7MA 5KNDA 4HTFA 4QA9A 3I2YX 3ET5A 4X61A 4MZDA 4P4SB 1W4BA 2C58A 3GRUA 1SBTA 4ENWA 4UBMA 1G21B 2GILA 1NY6A 3KE8A 1D2RA 2GRAA 2NYAA 2BV3A 3DTVB 3NEPX 2GZHA 4TKMA 2AG1A 1M67A 3IILA 4MW6A 2PYDA 5KYVA 3Q8XB 5CFQA 1TM1E 3BSFA 3F1LA 2W83A 3GVIA 1MHPA 2J9GA 3F96A 4PFKA 1L7NA 4DADA 2PRZA 1IJKA 1DG1G 1KEUA 1GPWB 1XDWA 2IW3A 4Q02A 1G5PA 1Z4LA 4RSMA 3WSVA 4QT0A 4DMHA 1IY2A 4QPCA 2KX7A 3AETB 4ZEMA 5E3IA 1OASA 4YHBA 1NJ6A 4LRUA 4ALJA 4BX8A 5K20A 5K8JB 1MD9A 3H87A 3QMWA 2FPLA 3DHWC 1E63A 1XHEA 3ZJ4A 3M1YA 5B55A 4HNHA 5FL7A 1WZUA 5FLKA 1UODA 4MRPA 5HK8A 4TQ9A 4G56A 3HDHA 4HYEA 2Z4SA 3BULA 3PNVA 1GNLA 1JS1X 1VSTA 1F14A 2VYCA 3O95A 2P9JA 3OQHA 3VZRA 3ZHRA 4EHKA 5C53B 3K9LA 2O9JA 3RVRA 3H3FA 1EB9A 1XZKA 1ZBQA 3WGGA 4C5BA 4YQEA 1L7BA 5FLEX 1XLTA 3R5HA 5IHXA 5ITZA 1ACLA 2OZLB 1RMTA 1T1EA 1YB2A 1I4OA 4WOJA 5FIUA 1IPEA 3D8UA 1XCBA 1T36A 2B61A 2O2GA 2R7NA 2WMYA 1ZQ1A 3A1DA 2XLCA 3KPJA 3TUJC 4D92A 4JQYA 3VOBA 5JRZA 1AUQA 3LPAA 3OIVA 3L7AA 4IQ0A 2HK6A 1T9KA 3T7DA 5BRJA 3LP8A 5H80A 3HJGA 4WBSA 5HBGA 3M4ZA 1Q83A 3OPYB 3U3ZA 3A37A 2UZ3A 3NAGA 2Q3BA 2QOEA 1W2HA 3QKTA 4RD3A 2IGTA 4JLUA 5BVHB 5EJ9A 3V4SA 2BGMA 4B85A 4V0LA 3C7CB 3WLKX 1ABBA 3NT4A 1Z0JA 3MLAA 3BRSA 3WIEA 4RIIA 2LCIA 4R2LA 2P5SA 5I7FA 1M0TA 2R6R1 3DMPA 3T7TA 2FGKA 2A1UB 2VUTA 3NBKA 1YI0A 1QMGA 2Y2UA 2IUUA 1SUFA 3PGKA 1AHHA 1R9NA 3HABA 4S2EA 3AVVA 1N7HA 2ZIZA 4P81A 3VHXA 4OHUA 1M7GA 2BSQA 4ISCA 1L9XA 1UBGA 2VUIB 2XECA 1LBTA 3P32A 4G5RA 5C8XA 2V7TA 2X1VA 1N5RA 5TMEA 4AZSA 4B6GA 5A03A 3KR9A 4OIMA 3RAEC 2DY0A 2HNKA 4ND6A 2XT9A 2VYFA 4ENRA 2RAFA 2HIHA 2WSYB 1LPAB 2OVFA 2PWAA 1E6UA 3L6EA 1UAGA 3WWCA 1E9AA 2X8AA 4MR7B 4C6HA 1WOMA 4L8LA 1MW9X 4WX2B 5HMLA 2W2KA 3H8WA 3T9CA 5FPPA 5AIBA 4FWTA 4CEHB 3CF2A 1CC1S 5AVKA 4A8HA 1R4ZA 3Q7EA 2HV9A 3FLBA 3A6DA 5AKGA 3ZKWB 5MF6A 5A0FA 2O14A 5K1ZA 5B1EA 1U7ZA 4U9HS 1H2XA 2NM0A 5IZCC 3I5XA 2P67A 5K4GA 1X7DA 5JY6A 1XN1A 4AKTA 4EECA 4ZMSA 1KZ4A 3EF3A 1PCXA 4NNPA 3RABA 4XDZA 3R77A 2D5IA 1Y3BE 2X0FA 3O91A 3OT1B 3ZK8A 1E89A 3B9PA 4QAJA 1D7AA 4WKNA 4IGEA 1A5ZA 4ZYZA 4AN1A 5AVVA 1Q1BA 4FDUA 3TLBA 2XGGA 3DZBA 1ZGZA 3ZV3A 3RIHA 3FNGA 1N0UA 2G25A 5JD4A 2WR8A 1M1XB 2R751 1XA3A 4BWFB 2R86A 2L0XA 4IGAA 3KSZO 1N7JA 3SQOA 1W4AA 2G72A 3DR5A 1F6DA 4TXJA 4LJ4A 3CMCO 1V39A 3RSZA 4Y0NA 3K9BA 4YQZA 5JCOA 2QUJA 4L8YA 1NI3A 1F3OA 1W1UA 5FFNA 2WYHA 3MGGA 3SBDA 5J5VA 1CY0A 5TY0A 2JLZA 1QGAA 1DUVG 3UMSA 1DFIA 4QDXA 1T5HX 3AFIA 3BDAA 1EUZA 2AG5A 3DDSA 3EIWA 1NBAA 1GU0A 3GG9A 3EISA 1MVOA 4L9RA 5IC6A 4ZRNA 1AV7A 2R5FA 3QF4B 3Q0IA 1E3JA 1P61B 1ZJ6A 3EEIA 4L8WB 2N42A 1XLUA 1R9MA 3I6QA 4Q3AA 2VS1A 3OO1A 3SR4A 4Z9FA 3OJOA 4MDYA 5E6UA 1EWVA 1H69A 1KMHA 4PHFA 3ONFA 2AC2A 4ZXFA 3R0XA 1GN8A 3TYXA 3V7NA 4YQFA 2R6HA 1BWRA 3KEMA 3NKVA 5CH8A 4QXMA 2OHGA 2YVQA 4D0LB 1IONA 4F2WA 2CEAA 2QI9C 5DM60 1W49A 1BSVA 3TLAA 4FGSA 1OBFO 4X0EA 3VR4H 5KQLA 1AGRA 4W5WA 1TGVA 5JH7A 1PU2A 1KEVA 2D00A 3KWMA 3SIWA 2B4AA 4O3MA 3OCVA 1VE1A 2GHRA 3H11B 3KKOA 4S0ZA 1ZK3A 2P1ZA 2RH4A 3AETA 2O0HA 4G4GA 4IDDA 4PCLA 4Q12A 1FBNA 4CM8B 1OI3A 1GUFA 1TIBA 1TZJA 4PO3X 4YEDA 3TQOA 4NYMQ 4HK4A 2ZQYA 4CN8A 3CKMA 4F4JA 1SK8A 5EIAA 5H0IA 4AJJA 1MB0A 3R6LA 2R1TB 3VTAA 2IIVA 3OQIB 1JG2A 2JHCA 1QP4A 4K9KA 1Z4KA 5THKA 2VAPA 4DW8A 2FY8A 4JYPA 3ES9A 4KXXA 1T6XA 2JIZA 2M6KA 3WIUA 3DSRA 4BYGA 1T9HA 4ZCSA 2BCGY 2GCOB 3DLCA 1CWUA 1EVIA 2FQXA 5EZ6B 3X1JA 4R9UC 2IP4A 1IN5A 2WIGA 5GM1A 5DGTA 1I24A 1PF7E 3CPEA 3ZNOA 1NVWQ 1JB1A 1BW9A 1PGNA 1FNBA 1ZSYA 4D41A 5KBYA 3GPCA 4X85A 2GM5A 2DR3A 1FP1D 1V5FA 2P0YA 2XUHA 3CSDA 3H4VA 4ZXPA 5B3LA 4Z4EA 4WTOA 5FO1A 1DIOB 5T8KA 1TQDA 4AFNA 1YK0A 3OWXA 1WHTB 1IHDA 2ZUCA 3LT2A 4DV1B 3IDFA 3Q87B 3PSAA 1M8KA 4RLQA 2PLAA 3I4LA 4O2BA 5IKPA 1OYVA 1L7PA 1HH4A 1F20A 1TC2A 2GXSA 2VSNA 1UMDA 3FPLA 2FWJA 2VT2A 2ZJ6A 4YLEA 4FGUA 5AW7A 2EWMA 4RJJA 4X97A 5E9AA 3H8SA 4HH3C 3EPPA 7YASA 1CZNA 1QXSA 1CUUA 2TECE 5HM8A 4HWGA 2WPDA 4OY3A 3TJMA 1NWHA 3A8TA 3AV0B 3HV0A 4OJQA 3QNMA 4J94A 4V3CA 4MJ3A 2IV2X 1G17A 2FEPA 4C78A 4WIAA 1JKFA 2PUGA 2GX6A 1HNWB 5I9LA 3UFBA 1O95D 2FPGA 2OCPA 1B16A 1Y82A 1BDJA 3SQNA 3DO8A 1A5SB 1MAVA 1WPGA 4JI5B 4GG1A 1FNDA 3EDYA 3QRWA 2V7VA 2I66A 3QWHA 4I2VA 4LJKA 2IBSA 2OO5C 1AXEA 4FPXA 1Z5NA 3T34A 3AHHA 1EDEA 2R85A 4FN4A 1J8VA 4W5QA 1BX3A 4F85A 3FPAA 4R54A 2EW2A 3TX6A 1EVKA 2E1RA 2EKZA 2F3TA 2FB9A 1NSYA 4PY2A 1FFXA 1N0WA 3AF0A 2VPZA 3AP3A 3G3EA 4MUMA 4N6GA 3V1MA 4KREA 3TLMA 4HDKB 4M7WA 1IMJA 3IAM6 3PUWA 1XP8A 3EAFA 3FMPB 4PYLA 3DNMA 3KZ1E 1H2ZA 3EVGA 3JYPA 1KGDA 1SXJE 2ZYVX 2WZQA 3BM5A 1FX0B 3QOFA 1TLTA 3IHLA 4FDTA 5DULA 4CG0A 2LKDA 1ZMTA 2H5IA 2HJSA 3WB2A 4IEEA 3WYBA 4G5YA 1CE8B 1KVQA 2V58A 3IMGA 3JQEA 4DCVA 4DMGA 2ZSJA 3G13A 1DDGA 1K88A 3TSOA 1MQAA 1S2OA 3DE5X 4YJGA 4XTRA 3W05A 4EJ2A 1IBCA 2V98A 1GR1A 3OZVA 4JFRA 2PKCA 3ITDA 3NIWA 1ZCJA 3AR7A 5KNBH 4C07A 2JLAA 5FPYA 4FFDA 4RIHA 2CZGA 1I4WA 2WG0A 5GZ1A 1G6HA 2WHPA 4O02B 2GCGA 2Z3VA 3R0IA 4CKBA 2OA0A 5HUQA 1OXKB 1CZHA 4C7BA 3FH0A 4JSTA 3T0GA 3TOXA 1TQ8A 1ZD4A 3C15C 3IDZA 3K9FC 3IHTA 5IH3A 1W76A 4DLAA 4LISA 2O8CA 4Q7JB 2F8TA 5BQ3A 3IO5A 3O26A 1JLLB 4XOIA 1KYZA 5E6SA 1Y4AE 2IYPA 2BH9A 1Z2DA 3D8NA 4KG7A 2I8LA 3U7RA 5JNRA 1FYDA 2JGIA 3DMGA 3QVJA 5I9NA 1VYUA 2ZYDA 3GJRA 2F59A 1KYWA 2OZEA 2WYWA 3E1SA 3ACDA 4XSHA 4F56A 1C3LA 4Y67A 4QEZA 2H4ZA 3EGEA 4ZU3A 3SBXA 3SFVA 3V48A 3UJNA 4C5CA 3UH0A 3EZFA 3TIVA 1UT6A 1ECBA 3G17A 1XRMA 2F1OA 4QDOA 4N01A 4B45A 4B2LA 1ZFNA 4KB5A 2AF4C 1Y7TA 2QR2A 1QVRA 2XE8A 4RW0A 1XTPA 1GKIA 2AOTB 3T5MA 2WU3A 3N6VA 1XVTA 2E4AA 1ADJA 1XA0A 2REQA 4FMCF 4QICA 5B53A 1E2EA 1XF1A 1CRZA 2DBRA 4KOAA 3BE4A 3ZU3A 4AYWA 1I9CA 5C8ZA 5COAA 4CU5A 1EU1A 2DECA 1B74A 1KZ7B 3Q7TA 4OATA 3DNPA 4WQMA 4E3WA 1U4OA 2A3RA 1FB5A 2H18A 2K7FA 4Q16A 4EHDA 3VKHA 1B6RA 4ZQIA 3VAYA 4IHQA 2VWQA 3SHVA 3JAKB 3NFRA 2GD0A 3QY0A 3RIXA 1VMAA 3BOSA 4HFNA 2GM9A 2HPVA 2HR1A 1IZZA 4IDGA 1UT8A 3T7SA 3GMIA 2GTPA 1RAHA 3TR6A 3IAXA 2ZPAA 5KPJA 1L1QA 2YDYA 3E0XA 4I1OA 4X1KB 2NAFA 3LUFA 5CEFA 2GYVA 4GI3A 3ZQ4A 1W96A 2PZEA 4NICA 1F0NA 1KDVA 2XLBA 3H1BA 4AY5A 1QQAA 1H2WA 2J87A 4IIBA 1GPDG 1WHSA 2C5EA 5JFTA 3DE2X 3KR1A 4BV2A 3CX7A 4JELA 4HVLA 1PS8A 1JBKA 2AXPA 2Y1EA 4V03A 4M3NA 1CNFA 2BVNA 2ZJBA 3INRA 2CXOA 1X7ZA 3MMZA 1O0BA 1BFKA 1OOEA 1VCHA 2QORA 1X87A 1G59A 5DSXA 3A04A 3GAFA 2C2HA 2FN8A 2OL4A 5CA0B 4B87A 3UJBA 1IFXA 2VDVE 2Q2QA 1SRQA 1FL9A 3BYZA 3HR8A 3JQPA 1NPTO 4MUGA 4AWXA 1DTEA 3FDFA 4O59O 4O2BB 1E6CA 3BL8A 3D4OA 3DXXA 2PMKA 3F6YA 1N8TA 2Z57A 3I6MA 4BEBA 1XRSB 4BO8A 5ALGA 4C87A 1Y4DE 3SBOA 3A32A 3AF3A 3LHSA 4A6PA 4UHEA 2ZYSA 1AO3A 2W11A 2JVIA 2Z43A 4N3BA 3B9RA 4LGCA 3IEVA 4GYKA 4N47A 4NYMR 3TOVA 1K5GA 3ZE7A 4LOJA 3H1EA 5B12A 4N5LA 2VF8A 3HCAA 5KI6A 3FUCA 3TLGB 3HR7A 3MW8A 2H16A 3A2LA 1KAMA 4DMCA 4Z4HA 4LQCA 1PS9A 2CL5A 5EWLA 3E0QA 3P1JA 1Y6QA 1KR2A 1MZVA 1T1IA 5KVSA 4WLEA 5CM2Z 3H0EA 1ZX1A 1ZM3A 5BPHA 5BSKA 2Z6VA 3EXAA 1TM3E 4YMWA 2OZPA 3VUFA 1DNPA 4US0R 2JI9A 4C3UA 1XMJA 4HBGA 4QOIA 1AC5A 4GT1A 1FJHA 3I3OA 4O2LA 3OKPA 5H70A 1GSAA 1S2NA 3FI0A 3SEZA 5LZ2A 2YZNA 4BPBA 3K4QA 1II8A 1OILA 1SC3A 2SKDA 4PFQA 4MP3A 3VMMA 3GLGE 1GLNA 4HDKA 1BRTA 1SIUA 5EGSA 5FUXA 3UM9A 4DVGA 4A15A 4OX9Y 1SXJD 3SLRA 3LXMA 1ORWA 2JDID 1SCDA 1TJ4A 2OXRA 2RG7A 1MRNA 2ZJOA 1CZOA 3EA4A 3ISVA 3PXBA 4MVJF 5IBPA 3LCCA 2Q6KA 3KEGA 3MUEA 1CE8A 1E1RA 2FUKA 4AJKA 4AUKA 1CQZA 1ZU4A 3JQQA 4ZARA 2QSJA 3WI7A 3EZ2A 2JASA 2H5JA 5HZKA 1IVSA 1KO8A 3EUAA 1LPPA 1ZH6A 1O5TA 2J45A 4EJSB 3OAAD 1NI5A 2P9GA 1PJ2A 5K3AA 3OZSA 2VNSA 4RK5A 3U5ZB 1G3MA 3KLPX 3AG5A 3FPEA 5EXTA 1XMVA 3KX2A 3UTDA 3HKDA 4DC0A 1ZVJA 3BBLA 3GO4A 1D4FA 4CQNA 3PUZA 5JPDA 1GNRA 3HXKA 4QTXA 2NU6A 3KD3A 3OEWA 1NUPA 3M4JA 2XHEA 4M86A 4XOUA 3TS1A 2XXAA 1DOAA 3CCFA 4I1VA 1KWKA 1RZRA 2W90A 1WPXA 2VPYA 1V9SA 2ZVDA 1ZA2A 4MWTA 3IT3A 2PA0A 3VNAA 5JEDA 4CDMA 3OLCX 2RGYA 1IXYA 2Q8QA 2YINC 1C5KA 5EMLA 2PUBA 3QE9Y 3GB9A 2J85A 3EZGA 3DL4A 3D6FA 4P54A 4URFA 3MWEA 1E7MA 1N9GA 4FNMA 4M88A 3E3NA 4OSPA 1T1GA 4QU9A 3FNQA 2XNKA 4TVBA 4PYJA 5B4TA 4M1OA 3GJ0A 1GZVA 2RSLA 2YY5A 4DY6A 1MABA 3O1LA 4EX6A 1E9BA 3OJEA 2DPHA 1X1RA 2JAOA 2KYRA 4ZC1A 3HWWA 4PC6A 3ICOA 3GJYA 4F06A 5HRAA 1G0NA 2P91A 3HZRA 1G9SA 2JH9A 2UKDA 2WOJA 3PKZA 4MS1A 1YQUA 3I4CA 2LIVA 1I2AA 1CQXA 2WG2A 3KQSA 1P3JA 2O7RA 1JSRA 3IH5A 3GLRA 2O19A 4IXDA 1SUBA 1TMYA 4UVGA 3JWGA 1P80A 5CX4A 1DZIA 1U0BB 2DUWA 5ESRA 4RH3A 3K30A 3M9XA 4NATA 3X1DA 2XVXA 5AOBA 1LRKA 4URWR 4JGBA 1JXMA 1CZRA 4R5MA 3VHRA 5K8IA 8AT1A 5CB4A 1P4SA 1R5OA 4I3FA 1CIJA 2B2CA 5JC8A 2JLQA 3W5CA 2MSNA 3JW8A 1CJVC 1XD2A 3UUGA 2ZZNA 1VI5A 3IP7A 2VCEA 3KJQA 2P79A 4EKIA 4MVJA 5T4EA 3MJDA 4O2RA 4XUDA 1P5JA 3TNFA 4DA6A 3D3WA 1AHNA 3P2IA 1M34B 3BXFA 3R7WA 2OVBA 4QUGA 5EIBD 3P4XA 5B7PA 1Z8DA 2J08A 4JUDX 1TW2A 1C7ZA 2PZJA 1BMDA 2PVPA 3SC3A 3GVPA 4JLVA 4CQMD 1EE2A 4KVZA 1ZOIA 3Q8KA 4ME6A 3D7MA 5KYTA 1NVUQ 4ESOA 2RK6A 1Z9BA 1AB5A 3SSNA 1J2RA 4J7UA 1A8HA 4WN3A 3DXFA 4YRCA 5JDIA 1DWPA 4BYMA 2OPBA 1SUSA 2X7HA 4FYPA 3KTDA 2G4CA 4YUYA 1YRHA 1W85B 2M1ZA 2AH5A 3UXHA 3M0EA 3IT0A 3TQCA 4D5EA 3Q0EA 3K8QA 4RHYA 2VF4X 3IIIA 1AQIA 2WUWE 5DHTA 1NDUA 4UDXX 4X3OA 5HG0A 5KKNB 3U4QA 3OU2A 3WL7A 3H5WA 5LC1A 3HUFA 3IXQA 2ZJ4A 4NV0A 1Z37A 5HKOA 4MKIA 2EJVA 3K94A 2FJ0A 5FI0B 3AYZB 3N2GA 4W6ZA 1U2RA 4C43A 3TEMA 1P9LA 1SC1A 1WB9A 3BDIA 5H16A 2HJRA 4PXYA 1ZH0A 2E48A 1RQ2A 4B47A 4LOLA 2WV9A 1YWGO 4JB2A 1H85A 3TFOA 4PYNA 5HFNA 1FSSA 3H7AA 2AFHA 2B8WA 5YASA 4PLVA 3EG9A 2EQBA 3EY4A 2GEBA 1BCRB 1KYTA 3A0RB 3H5NA 2IVFA 3HO8A 4OHOA 4TM8A 3QE3A 3GA7A 1WKCA 2QU7A 3TXYA 5L3QA 5BW6B 4IXWA 1CU1A 4EKYA 3M5CA 1MEEA 3K31A 5HF9A 4DXDA 3VR4A 5LNK6 2EYUA 4BX2A 1OT5A 4IICA 2N9UA 1YHZA 4TZ0A 3ZHQA 1KRXA 1U7PA 3ENQA 4A8JC 2IS6A 3GZ4A 2A59A 3WE7A 3ZDAA 4PZCA 2P4EA 3BWBA 1GFWA 3R41A 4KXQA 4TMZA 4UZEA 1UJ6A 2JGJA 5B57C 3ELWA 2QT0A 5L40A 1KZGB 1FTSA 1JHDA 1T2FA 2BMEA 3LCMA 4FX5A 3TIFA 2I7XA 6LDHA 5K8TA 3QU2A 3I4FA 2GHIA 4HRAA 4EYKA 2NZWA 1MOSA 1BYUA 1EFKA 1C50A 3NW9A 2UUCB 3G5MA 2JIZD 2VDOB 3MELA 3GLGA 2P9TA 1QWOA 4YDHB 4B4VA 4NMMA 4RMNA 4Q6WA 1FK8A 3GG2A 4I55F 1T3LA 1EZ4A 1IHYA 4ZVLA 1JDBB 3H5AA 1O5IA 3HP7A 4MINA 1NF9A 1Y9AA 4PWZA 4KNWA 5ALOA 3UK0A 4CV0A 3JYOA 1SB8A 1JDNA 5DK6A 5DCLA 4QLBA 1T5OA 2DPYA 4IILA 1AU9A 1XDDA 3CNNA 3OM0A 3TTUA 3CKYA 4L1KA 4FOOA 5C5IA 3PCXA 1YS1X 3C2QA 1EVLA 2DFVA 1OWLA 1BHSA 3C6KA 4U3JA 1XZLA 2G4VA 1DKLA 1EDOA 2Q3LA 4DQVA 5CT8A 4DCSA 1U7XA 1TJ3A 3LHKA 3TG2A 1DXHA 1DAOA 1CVIA 1P0CA 2A94A 3EEBA 2BC9A 4I4IA 4V0OA 2I2CA 3I2HA 3PU6A 2XQJA 3QMMA 2HPHA 2FKAA 3OZFA 4KO4S 3INYA 1KVUA 1RWVA 1VKHA 3DOHA 4JX8A 4KITB 1IN6A 1SKUA 3ZTWA 3WG9A 4ETMA 2Q7OE 5AUOB 1EFPA 2GWRA 1OXMA 4DT1B 4LX0A 2TMKA 4UU0A 4KP7A 4E4TA 5CA1F 2E5WA 5HCIA 2CNOA 2NO7A 4M0FA 1OVGA 1A8IA 1E66A 3GBPA 1K06A 2BFFA 3BWYA 3CLUD 3C4VA 4MVJP 3HFJA 1QDUA 1CERA 4WCFC 1L5WA 1U28A 3PQCA 4ESHA 4RVOA 4OA8A 1BXKA 2XEDA 4GLBA 3U37A 3WIVA 1NZJA 1RQXA 2ADMA 4B17A 1RTTA 2FWPA 4J0DA 2ZCJA 2XUFA 1A7UA 3PPYA 3L6DA 1LC0A 1P31A 4WNAB 1U81A 3OESA 2D2IA 2FEXA 1AQUA 2E21A 4U4AA 4JI1B 3SJCA 5KEIA 1QX4A 1ZI8A 1TVKB 1M8FA 2X5OA 3EQ9A 4E5VA 2IHBA 1M7HA 1SG6A 2EIXA 2FK7A 4MROA 4NECA 1RM4A 4TZ6A 1WNFA 2RGWA 1U5AA 2V3WA 3TGPA 4QQKA 1SCUA 1YR2A 5A7FA 1FMCA 1GQFA 3FPSA 3L1UA 3PWZA 2IZ6A 4QNRA 2O52A 2WNHA 5IJ9B 5CHYA 2VNHA 4TX1A 1YL6A 3G82C 1GGJA 2LW7A 2VJQA 3QEMA 4OYYA 4HQ6A 3TKLA 1IATA 4QE3A 3OLQA 3RS7A 4GRIA 2I3GA 3UK2A 4LSMA 4HAZA 1R27A 4W1QA 1E69A 3UMFA 3VSCA 3VVMA 4BMSA 4R7ZA 4ZMBA 4NV3A 2CNKA 1JYSA 2VSFA 4Z2YA 4XWKA 3QW4B 1C8KA 3GR6A 3IIJA 4B43A 3VU1A 2WC1A 4HYYA 3RAFC 1I2BA 2D3WA 2EBUA 1SU7A 3SJUA 3JQ8A 4U00A 1QSGA 2FI1A 1C8VB 1GILA 3GDGA 3MCUA 3HB9A 3VH4A 1R8YA 3T7RA 2VPXA 4II2A 3JVVA 2R66A 4BAGA 4QLAA 3LX8A 3FTQA 4RXMA 5KHAA 2G63A 2VDWB 5AXBA 5FYQA 1RJDA 4LNUA 4RH1A 2WWWA 2P75A 4F7WA 2AR9A 3H05A 4R16A 4J8PA 3F67A 1SN7A 2FPXA 3L6CA 3W4KA 3ACCA 4DA4A 2EEPA 4J16C 4KMSA 3H0KA 3CV3A 1EAMA 2FSIA 3PC6A 4EUSA 5JSFA 4KWTA 1PR5A 1TYCA 5LNK1 1MGPA 1TOAA 4DTIA 3EH1A 3RV4A 1ILWA 3THSA 2CNWA 5U1PA 3DV0B 3HEBA 1V25A 1JA0A 2QRNA 4HAXA 1KMIY 4G85A 1UPTA 4RCVA 1SVKA 3F7NA 4RESA 3RU3A 3WGVA 5EJ4A 2NUPA 4CV1A 1VHTA 1TKRA 4LBWA 4LQLA 4AF6A 3QTBA 1P4AA 4HGYA 4FLEA 5EHNA 3SS8A 4DLLA 1BGWA 3L8DA 1FP6A 2JKZA 3FNEA 5LA6F 4AZWA 4BZZA 1T2VA 5LFAA 2NMVA 4EA6A 1HPLA 4KOEC 1GN9A 5CYOA 2ZSIA 4R1LA 5A04A 1T4CB 5JJLA 1NY5A 2PR7A 3TQRA 4AF8A 1XTRA 1RIFA 1F8YA 3TBKA 1J24A 1G8SA 1GTZA 2ZR9A 2ZTLA 4MW5A 5K45A 2XE7A 8ATCA 3AJDA 4UUQA 3ZGYA 1FDVA 3V33A 1QHHB 3K9HA 3UO8B 1JQAA 1IQPA 4PG7A 4QJ4A 1EUDB 1E3MA 3MSXA 1I7QB 2D3TA 4MUEA 2XWQA 3GLFA 1H42A 3QJYA 5KSOA 2QYOA 4GZ3A 3DQZA 1VPLA 1W5AA 2XGMA 3QPAA 4IH1A 2Z58A 4A27A 4BQFA 1OFUX 3BMQA 3DUFB 4BLSA 4UM9B 5FWDA 2QNIA 3PC7A 3SLGA 3TLYA 2FMIA 3GGDA 3THXB 2R6JA 4UNRA 2GBFA 1YDMA 2B5VA 5DP1A 1B42A 3B1FA 4GIBA 3R5XA 5BYJA 4D74A 4M1SA 4ENVA 1NYLA 3IQWA 4K6MA 1G42A 1XLVA 2KW5A 4FE7A 1Z33A 3EGVA 1VCMA 1VIAA 1YZYA 4KU4A 1U3DA 4OOEA 3DEJA 3KQPA 1YACA 4XZ3A 4QBKA 1P3Y1 3O75A 2L82A 2ZYGA 3DPIA 3X3HA 4G0QA 5CT9A 4QECA 4ASUA 1X0VA 4TUYB 2G1JA 2DLNA 3T1TA 3TI7A 3ODPA 2WMDA 2ZP1A 2QJWA 4AY4A 2A0XA 3U13A 1HYEA 4L3VA 3S55A 1B41A 5C80A 3E61A 3SC6A 4Y6RA 3DWGA 4IF6A 4PLYA 4ZOBA 3UMJA 4J07A 4ARZB 2QPTA 3IP5A 1KY3A 2ZE6A 2NV2B 2EFHB 1XO1A 4NR0A 2RBKA 1NJGA 4PIMA 2JCYA 2HMSA 2XEXA 2C9DA 2I71A 3ZXIA 4CUZA 4K3VA 1PWXA 4HNTA 5JYCA 4U7DA 1QAQA 2RHWA 4L9WA 1X1QA 2HM7A 4YJFA 4CM6A 1LPNA 3JATA 1SCIA 1XQ6A 1QG6A 1XVIA 3IYLW 2PGDA 2DKNA 1MB3A 1REQB 3FCAA 3OZWA 3U26A 1YJQA 4NCXA 3DOEA 3OQ1A 2C5FA 5T57A 1UBTS 2DGDA 3A14A 2QVBA 4PSVA 2CYCA 5ARCA 4X64B 1ONPA 1XEWX 1Q95A 3BC1A 4B3IA 2OQVA 1C30B 1ZVQA 2HEIA 1JLKA 3A9CA 5C5DA 3SEAA 3GJSA 3S1AB 1JVBA 5EZYF 1WZIA 5B6IA 3G9ZA 1MXFA 2V9ZA 4UQPA 3OJ0A 2QJFA 4WY8A 3TD6A 2YXPX 3E2MA 4YBZA 1LBQA 2C7BA 5GJVC 5FUQA 5KVAA 1DRUA 4LDPA 3VV2A 5DYGA 5K7SA 4R2XA 1S3SA 2LXNA 4B73A 4G63A 2NP6A 1H2FA 3RVJA 4DBZA 5CHEA 5A4KA 6ADHA 2VAMA 2QY6A 3JRNA 1VZ3A 2OENG 5EWMB 2AZDA 4JP3A 2OC9A 2H06A 3AK4A 4RZ3A 2Y1LA 4AD8A 3LG2A 4B3FX 2MYNA 1P5ZB 3H6KA 2ADOA 1V8ZA 3IOEA 1F48A 3KDAA 1JI3A 1U2TA 3W5IA 5T41A 4ZKEA 1YR8A 2IUFA 3HSYA 2PAFA 2J7PD 3QQPA 3LQYA 3I6YA 4GGPA 5C8YB 3OIYA 4KX3A 1UMCB 1I36A 2QL7A 3WBKA 3Q41A 3U17A 3BB1A 3QUBA 1JFLA 2YVKA 4GP6A 5CXUA 5EJ5A 5DT9A 1K5PA 4PC2A 1CDZA 4WZAE 4WNCA 1RMQA 5H4GA 4BP1A 1Z4JA 3F5DA 1ZGBA 5K0BA 1F5NA 4L7QA 4RVGA 4DQUA 3ESCA 3LNTA 3MB8A 3NM4A 2WYOA 3E7PA 2JI8A 1VPTA 2NQ8A 2HNAA 4NLLA 3TZEA 4B46A 2UYCA 1A2BA 2GDJA 3KT8A 4IIEA 3X0DA 1L3CA 2UV8A 121PA 3IIMA 3PR1A 1XCLA 5BN3A 1DQZA 4PPQA 5T5QA 4BATA 4PCUA 4D56A 3U31A 1QKIA 5M3BA 3HI4A 1FFYA 4B2IA 2IIPA 3VU0A 4IM7A 5CXQA 1XV5A 3TWOA 4J0CA 1FXWF 4PWYA 2I34A 2QF7A 2J9FB 2VQDA 1T91A 1Z4NA 1S96A 2KS6A 2ZRNA 1QHGA 1XKTA 3QFTA 3LL4A 3U3XA 4TVOA 5D7BA 1RMYA 5JAHA 2GEJA 3ETHA 2RHTA 3ZWVA 1Z47A 5K3CA 3R3JA 4K26A 3KCNA 1C9KA 5ENVA 2AOVA 1U2SA 3KZVA 2O7SA 4E0BA 4OHYA 2ZRMA 5E2AA 4RGBA 3FVRA 3WS7A 3ZJVA 2FWMX 1K8QA 1GL7A 3HZZA 3OSZA 3CUYA 3VPSA 4C0HA 3SHFA 3FJ1A 1U7WA 2BI8A 3O7WA 4LWQA 2H2IA 3E70C 4RS4A 4F5DA 2FMFA 4LF5B 3EXHB 2C78A 1X42A 5H83A 5SZKB 3M4XA 4DG9A 1B8UA 3MCZA 1JH8A 1MVNA 4B7UA 1TTQB 1WAMA 5KAMA 3STYA 1EK1A 2JFGA 5IC4A 3FCXA 1LEHA 1U28C 4WZAB 3ZDXB 4YRSA 1NI4B 4RULA 1G5RA 2G1UA 3L8ZA 5FPHA 3ME5A 1FVOA 3S40A 4CIAA 2R1ZA 3GJ8A 1FDUA 1GSOA 4NMLA 1I6LA 2YXNA 1ZNYA 4FOSA 5CJPA 4WK6A 1F2UA 5ALEA 2AEMA 3THYA 4CG2A 1H0HA 2H2WA 2YVAA 1GPLA 3CUUA 1N5OX 1SIBE 2CDNA 5LZ4A 2VWHA 2VL7A 4LV5B 4OB7A 4BZXA 1I2MA 4NL4H 2J09A 1VSQA 4CZ2A 4EB6B 1TAHA 2CVQA 3DMTC 5EHZA 3LCRA 2EFYA 1P60A 4F1WA 7AT1A 4RZIA 1BAPA 4KRFA 1P91A 2IWHA 2Q5IA 5D8DA 1YU9A 3DZIA 4DF3A 1U3GA 1V8PA 2IYEA 4NPAA 1TQ4A 3INTA 2FG5A 4MKZA 1IB0A 5DHFA 1ZESA 3ZGXA 3HLTA 4UFNA 3SU8A 2A30A 3A9UA 4CMHA 4YCNA 2XB4A 2QRQA 4WCVA 1ACMA 2H1FA 2QROA 2NO4A 1AHIA 2OMKA 3K8OE 3K9GA 3MWLA 4TWBA 2Q1XA 3UTCA 3CVVA 2XT0A 5CYGA 3FPFA 3FB1A 3ULKA 4D82A 3GOHA 4LYDA 1HR0B 4LSZA 1CNEA 4L50A 1ZEMA 1QF7A 1XEFA 4C1BA 1Y80A 3HJAA 1WPRA 2C9ZA 2XRYA 4B34A 2HIGA 3DZKA 3JATB 5F21A 4BRUA 2O8EB 1S2DA 1WA5A 1TADA 3IEKA 3DTNA 2ZVJA 3ZWMA 1XTZA 3ICPA 4MARA 2PRIA 5KS2A 5B5SA 2Q21A 2VF2A 1OZHA 4E5KA 4ZQHA 3LA8A 4B3MB 3M82A 4L16A 3SFTA 1M2OA 3V6MA 2WD9A 3FKQA 4IVPA 3MMNA 5K03A 3LGAA 4E32A 3DYBA 2ZE7A 3ZD6A 1MQSA 4UAVA 2IXTA 1N34B 1CHNA 1YJCA 4QDUA 2JJ2A 5B7GA 2PNJA 1Q0HA 1SHKA 2VHCA 5U4QA 4FT2A 2ZJFA 1LBIA 3DAGA 3KB8A 5E1DA 3GLSA 3UAOA 1JFTA 1QOZA 1FMLA 3JZDA 2ZS8A 3GQBA 3RU2A 5LIRA 4JWKA 2PY6A 1XCJA 1RADA 3IUMA 2WVGA 5CLQA 1K4YA 5L4LA 4HX5A 1CJMA 4ARAA 1E3TA 2XYGA 4LZAA 3GT3A 1PD0A 1G55A 3A6HA 3HPRA 4P4GA 5DO9A 5JMTA 2W37A 1YIAA 4N65A 1G3UA 2W8BA 4JLOA 4FILA 5T64A 1PZNA 1K3FA 4ZVRA 4YRBA 2CB0A 2B0CA 4ZOCA 2C2GA 4FUQA 3KB1A 5ELLA 3VR4D 2YJ4A 2HRCA 2ZJ8A 3DMYA 3ZD9A 1F8XA 1G20E 1P4RA 2BLNA 1XZPA 2OG1A 1J8FA 2UYGA 2P6NA 1ZUNA 4HB2A 4J9UE 4FB4A 1NMEA 3KKZA 4H6PA 4HBZA 4M8IA 4XARA 3HADA 1SCBA 4RKFA 1KZHA 3S70A 1U63A 3GLIE 4W9NA 4EFNA 2LR0A 4D25A 3ROMA 1O94D 5HKBA 2VHYA 3PNSA 5A5VA 4OI0A 3D5TA 2FH5B 1C0LA 1NXWA 1ZLYA 3L01A 4M83A 2JCVA 4CF7A 2BPOA 3LRPA 2UUBB 2FZLA 4L75A 1BWPA 4Q1FA 3KUDA 2PZGA 4RFVA 1QYCA 4ID3A 1H23A 2CE2X 4QULA 5CNMA 1TD1A 5FT9A 3NIDB 4GX0A 3TIIA 2FSHA 2ETVA 4WBNF 2H4YA 5BVGB 4WBXC 1J06A 4OI2A 4AW9A 3WAGA 4LE1A 1F12A 2HSJA 1PJCA 2OXTA 1MJGA 4TM7A 4J03A 1JE1A 3PDWA 2H52A 2VYVD 221PA 2ZB4A 1C4XA 1ESCA 4GI1A 1H9AA 4M8NE 3S44A 1CUHA 5I47A 3LBHA 1TECE 5HGJA 4YBRA 2FQYA 1JB9A 2AOWA 3SGLA 1DG9A 4A8JB 1M6EX 2GXAA 1V0JA 2DZDA 2L17A 4B82A 2W4MA 4JLPA 1HL3A 4OREX 4UBJA 3U44B 1X7GA 3FSGA 3E9NA 1G2OA 1USIA 1YJ8A 1N2CB 4X66B 1YRWA 1YSCA 4BNIA 2VH1A 4X71A 3QBDA 4WRRA 3I1FA 1RVV1 3KKEA 5B6JA 1TZKA 3DVQX 5L4NA 4AECA 2Y1XA 3PD0A 4FHEA 2E0IA 2PH1A 1N2OA 4L51A 1ENYA 3EE6A 5HILA 4FC6A 4C9BA 1RIIA 4KEAA 4J75A 4J91A 4EY7A 5JXGA 1JWLA 5H68A 4PICA 2B83A 1KA9H 5AM1A 3D6JA 3AW9A 1AIPA 4WK4B 1M2FA 1M1YA 5LLDA 1YXMA 1DJQA 3FVWA 3FR8A