5GVRA

Crystal structure of the ddx41 dead domain in an apo closed form
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
234
structure length
234
Chain Sequence
ILVEGDGIPPPIKSFKEMKFPAAILRGLKKKGIHHPTPIQIQGIPTILSGRDMIGIAFTGSGKTLVFTLPVIMFCLEQEKRLPFSKREGPYGLIICPSRELARQTHGILEYYCRLLQEDSSPLLRCALCIGGMSVKEQMETIRHGVHMMVATPGRLMDLLQKKMVSLDICRYLALDEADRMIDMGFEGDIRTIFSYFKGQRQTLLFSATMPKKIQNFAKSALVKPVTINVGRAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable ATP-dependent RNA helicase DDX41
publication title Structural and Functional Analysis of DDX41: a bispecific immune receptor for DNA and cyclic dinucleotide
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 79
structure length 234
sequence length 234
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2016-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5gvrA00
2R8RA 1YVDA 3GP8A 3EPKA 3TUIC 4PO1A 2F6RA 2AK2A 4PZZA 4O25A 4NZYA 3R7WA 1R10A 1G3IA 4Q21A 1CJTC 5EE5B 3OEEA 2VP4A 2NOAA 2X19A 4OI2A 2ZM5A 3SC3A 2ZJ8A 1GKUB 1XTJA 4Q4AB 4DEXA 5JI3E 5G41A 3ZVRA 5F9FA 4LRWA 1HUQA 4LUCA 2FFBA 4E5UA 1Z08A 4HUQB 4N1AA 1VKJA 1J2JA 3L0IB 2QQ0A 2BEKA 2ZETA 2JCSA 2G77B 3CUEF 1WF3A 2NPFA 1HYQA 1DAIA 2BMJA 3K9HA 3QXHA 1COWD 2IYWA 1KKMA 2C78A 4LBYA 5SZKB 1P61B 3TNFA 2VPPA 4JT4A 4X8OA 1Z0DA 1E1QA 4MITA 4YMWA 5FBWB 4CGZA 1GWNA 4M1MA 4KBGA 5J4YA 3K0SA 1YZNA 2VSFA 1M34E 2FDCA 5AJXA 5BWMA 2EQBA 2CNWD 2AKAB 3CIOA 3KXLA 2ORIA 4JS0A 4X8LA 4TLEA 5F2EA 1XXHB 1DEKA 1KO7A 5FTLA 1T3SA 1KK1A 2V3CC 4ZCMA 2F1RA 1QRAA 3T34A 3TVDA 2ZS7A 4I1VA 3IIMA 2VHQA 1SKYB 5EE3A 1W0KD 4KVAA 3SBDA 3LQQA 3BS4A 3ADBA 1TQ6A 3K9GA 4L16A 4YMVA 1WB9A 3G0HA 2AFHE 3KQKA 2QZ4A 4MRVA 2NO1A 2XXAB 2GZHA 4D0NA 1HURA 2RGCA 3UMRA 4FWIB 4KXFB 1Q3HA 1C1YA 2RGNC 4M8NE 2V8OA 3AM1A 1XEXB 3B13B 3BERA 2Q21A 4Q1FA 5DHFA 1XNJA 2HV8A 4IRUB 4ESVA 3QNUA 1NLZA 2GXAA 1U81A 1KMHA 1CTQA 1Z6AA 4KO8A 4WA7A 4HDOB 2XGJA 1IN5A 1OT3A 1NBME 1R8SA 1S3SA 2C8VA 1ZRHA 3QKTA 1IY2A 2HXYA 2FG5A 3GJ0A 2WM9B 1UKEA 1U8YA 3EXAA 2GETA 2HCJB 1AN0A 2PT5A 2ZROA 4FXPA 1MO3A 1E1RA 5D3MB 5B58C 4IKEA 5KPDA 3EPLA 2QMHA 3NBYC 3U3RA 4Z1MD 1SXJC 2J7PD 4GP6A 1E4VA 1XX6A 2QNRA 5DYIA 1HT2E 1H65A 3GLHA 4Y0AA 3N2IA 3W3ZB 2FGJA 1A5TA 1IQPA 1KDOA 4N0DA 4QHYA 4DXAA 2CK3D 2IK8A 4XSGA 1GL7A 1BIFA 3KUDA 3WMGA 1Q22A 3AVWA 1RJ9B 4B3CA 3IHWA 5TDHA 1QHYA 4NL4H 4M9QA 1F3OA 1XCPA 5FOVA 4OI4A 3LQRA 3SI7A 4PHFA 2IYLD 4NCHA 4O2LA 1CJKC 1YR8A 4Q48A 2F43B 2XNDA 2ERXA 5FTJA 2BJWA 4UNRA 4TSFA 3RWMB 1Z8FA 1Z6TA 3VMFA 5CIWA 4AKGA 1OIVA 2BV3A 4N0EA 3QKRB 4A8JC 1RKBA 4RD4A 2BDTA 1ONBA 2J41A 4HB0A 3HU2A 1OFUX 3OIUA 4QJ3A 2EFHB 2WIBA 3MWYW 1KY3A 2BHRA 1D9XA 3BD9A 1RYFA 2JDIA 3LDAA 4P3YA 1GKYA 1HQYE 1M74A 5TARA 1XTSA 4NYMQ 3BGWA 3F8TA 4QGFA 3RS7A 1ANKA 1DAEA 1Q20A 2A7QA 4CEHA 1N3BA 4UJ3A 5HKKD 3EG5A 5TXGA 2ZRMA 3H0KA 3HJNA 1U9IA 2VYFA 4YMTA 4BLPA 2MSCB 2F1IA 5JS7A 1JJ7A 1I4TD 2C2HA 1VIYA 1UKYA 3VHLB 4OK5A 2QI9C 5AJWA 3SN6A 3N2EA 5JRJA 4NTZA 1DAHA 2GK6A 2JIZA 4Q9HA 1LF5A 4XIGS 4MRRA 3V9PA 2DB3A 1LY1A 1UKVY 2ZRNA 1OSNA 3QPUA 1CRQA 2DYKA 2DWPA 3Q9LA 3WYAA 1NY5A 2GZDA 2PZFA 4Z8XA 2O0HA 4PSKA 2GEDA 4GPTA 4GT1A 4F4IA 3X1DA 1IJFA 1IXZA 2IBMA 4QGAA 2EFCB 1AS3A 1MRSA 1Z29A 1T4GA 2QMEA 521PA 1P75A 1AS0A 3WNDA 5KSYA 5JJIA 1NSTA 3IKJA 4BEJA 2K5UA 3GCGA 4LCBA 1EWQA 2C95A 4HAUA 2I1QA 4XWKA 1KY2A 3QI2A 1G8GA 421PA 3RC8A 3A1TA 3FKSA 1G8YA 4TL7A 1KI6B 2WOOA 3CPEA 2WPDD 2ZJYA 3AP1A 3MFYA 3QUSA 1E79D 3FYHA 1HE1C 3CZQA 1FQKA 2IHYA 2YVUA 4IOKA 5J5CA 4PX9A 4LJ7A 2N42A 1M6NA 3EZ6A 1RRPA 4I1SA 1NF3A 3B82A 3LLMA 3Q72A 1DS6A 3JVUA 4EUNA 4P4TA 3FHTA 3CX6A 3A37A 5JEEA 3K70D 1AIPA 3AP3A 2B8TA 1NSFA 2G6BA 3OAAA 3X1ZA 2OSBA 3AGQA 3OEHA 2A5JA 1E9FA 3IQXA 4BLSA 3U5ZB 4TLDA 3GLGE 2ZJZA 3ASZA 5TB5A 5HZKA 4HSEA 4RFSB 1OB5A 3W6OA 1KI7A 4WZAE 4BLTA 3SYKA 1PZNA 1FMJA 1WE2A 3J81k 3B5JA 1C4OA 2ZREA 5C18A 3BH7A 2ZSBA 4FMDB 2DFNA 1TUEA 2HYDA 4A0GA 3LA6A 2WAYA 3SJBA 3MMPA 1UEIA 3U2QA 3SQWA 4IFEA 4FCVA 3Q5DA 2G3YA 3RDPA 1S3GA 1TAGA 2P5SA 4QBHA 1VCNA 4NYJR 2ONKA 1WQ1R 2QGZA 1RFLA 3IGFA 2IUUA 5HCIA 4DIEA 3CKLA 5A0FA 3V00A 2EWWA 2OLJA 2QM7A 3QKSB 1DO2A 2C9YA 3A1VA 4F4CA 5DYGA 3CF6R 4ZKEA 5M04A 4MKHA 4JZKA 4V02A 4NCNA 4FD2A 1A1VA 4TYYA 4XWOA 4HUTA 1E2QA 3LV8A 2A78A 1X8LA 1TU3A 3OFND 1NVWQ 2OFXA 3GLHE 1X6VA 2H5EA 1NVXQ 4EQ6B 3RS3A 4TYWA 3O47A 5JFGA 4FCWA 2J7KA 4JVNA 3K09C 2O8FA 1F2UB 3QBTA 2WMOB 3SOPA 4TMTA 1SVWA 2H1LA 2ATXA 2MSEB 221PA 3KXIA 3NHAA 5AUOB 1Z63A 2ORVA 3NDBB 1RC8A 1UDWA 4B47A 3P1JA 4LBZA 4LDJA 5FL7D 2A30A 2QENA 4M4SA 5BW8A 3NC1C 4RZ2A 1WXQA 4IOLA 4JLKA 4TYQA 3RLFA 4G3XA 5BN3A 4OQNA 3DL0A 2WWHA 4DB4A 2ZE7A 1DE0A 2Z4RA 4EPTA 2VBCA 4GDFA 2L0XA 4PXAA 3MSXA 2JEOA 4LC0A 1W0JD 2IYRA 4DBLC 3QF4B 1Z0FA 2WWWA 4PC1A 4W5JA 1CP2A 4MRPA 2REBA 3QG5A 4MUBA 3THXA 1R7RA 4KITB 1TQ2A 2BBWA 4EFLA 5KU1A 1CXZA 1CBUA 2AX4A 3CX7A 4M1YA 4UQOA 1MABA 4URVR 2AXNA 1KSFX 2IUSA 4Z51A 4DSTA 3K9NA 3LVRE 3QF7A 4CVNA 2ZR7A 3SHFA 5E3HA 1OXXK 1K6MA 1N6KA 4KFTA 3W34A 3PENA 4JMPA 1XD2A 2LKDA 2H92A 5IK2A 3K53A 1NBMD 3QEOA 4Q1CA 2O52A 5JS8A 3WRXC 1GNPA 3CPJB 1N6OA 2GCOA 2GZAA 2UVQA 3PG5A 4NPHA 4Q9KA 4A2QA 1G5PA 2Q9CA 1RVDA 1W4CA 2F3TA 2ZRPA 4KYUA 4IDQA 5KHOC 2O8BA 3F3YA 4DEYA 3NWJA 3WRYC 4XD7A 3A4LA 2IW3A 2AD1A 4QJ5A 4CT5A 1YRBA 2FMXA 1XTIA 3LH5A 4X8HA 4O3MA 1EK0A 2R9VA 1RZ3A 4FW9A 4LBVA 4II7A 4Q1BA 2ZE6A 1LS6A 3EZ7A 4Q4JB 3VX4A 2OCYC 2WPDA 4D0LB 3UWOA 4PO8A 4H1VA 3RC3A 4MH0R 3VR3A 2HYIC 2R6AA 4M1KA 4JYCA 1E9SA 1CF4A 2JLQA 1H8EA 3I8SA 2HLDA 2D4HA 1CKEA 1II8B 4M9ZA 4FN5A 3DMDA 4W5HA 2DFTA 5CM8B 1GG2A 2CL0X 3CF0A 1AKEA 4XSHA 3R20A 3DDCA 1TL7C 2JJ2D 1E99A 4YXWD 4NONA 4G5GA 3LVQE 3ZS9A 2LWIA 1MO6A 3KJGA 4L9SA 1D5CA 2AD5A 2V4ZA 3GLFA 4Y0VA 2YNMA 2QM8A 3OIVA 3T06B 1EG7A 1Q0UA 1ZD8A 4B32A 1DO0A 2PJZA 3MWJA 1N6NA 3SYNA 1W4BA 2XOKA 2P0EA 3IILA 1YJ5A 1J8YF 2J0UB 1S8FA 3VAAA 3ICQB 3E1SA 2WMNB 1N0VC 1P72A 2VEDA 3DMNA 5JEDA 1XZPA 3QJYA 4BECA 1FOEB 3CRMA 4ZO4A 4EPRA 5CB8A 5FTKA 3L2OB 5GVSA 3S1AA 2QORA 3KTAB 4KSBA 4I4LA 4PANA 1EESA 2F3RA 3A58B 2ZRJA 3AVQA 3Q7QA 3MRSA 4RCZA 3CX8A 4RJLA 5DH9A 5EP4A 5G3ZA 4P0TA 1US8B 1P7CA 2XNSA 2ZE8A 3D6TB 1FP7A 1MR3F 5KSPA 2PX0A 3LBIA 1UDXA 1E96A 3G5UA 2GTPA 5J47A 3RANA 5JBQA 4FIDA 1BOFA 4IDHA 3CWZA 2ZI6A 2OHFA 5KOYA 1NVVQ 2YKGA 4GZLA 2IX3A 1S2MA 1ZUHA 3I3SR 5BYJA 1ZM9A 1VHLA 3IUYA 4HZIA 5CLQA 4G0NA 1YE8A 3SR0A 5C2JB 1XPOA 3OEED 4U00A 4WIAA 3LBHA 1XRJA 1M1YE 6Q21A 3CNNA 2GJAA 4FINA 4D4MA 1KZ7B 1NY6A 1JJVA 3AP2A 4Q7KA 5TVKA 2BMDA 3AH8A 4TZ6A 2CEAA 3FGNA 5EJEA 1GFIA 4C7OB 1LW7A 5LBIA 5KDLA 1FX0B 3TQCA 3OF5A 2OG2A 1RRGA 4JLMA 3N5CA 2JLZA 3UMFA 4BEBA 2IYYA 3BB4A 3TBKA 3RRYA 2ZAMA 1KDTA 1IONA 2BBOA 1E1QD 3C8UA 4OKSA 3RNLA 5A5GA 2P5TB 1D2NA 1XZQA 1OKKA 4IVRA 4UJ5A 4MDFA 5FL7A 2O8DB 3LW7A 4DKXA 1PV4A 1ZU4A 1O3YA 4HB3A 2J87A 3R8CA 1DARA 2C9OA 1OW3B 2LCFA 4LV8B 2X1VA 4US0R 3TSZA 2AFIE 3PUYA 3TR0A 1ZINA 2VHUA 1M7GA 1KI9A 4R2HA 2DHRA 5H68A 1EX6A 3KJIA 4TQUS 2HJGA 2RGBA 2W2VA 1K8RA 4JLNA 1U0HC 1W0JA 3MJHA 1YZUA 4D25A 1Z06A 4OHYA 1HEIA 1NMXA 2NO6A 2ASEA 3I5XA 3ETLA 1OH8A 1SVSA 1VYUA 4GP7A 3BE4A 4V0KA 4WAUA 1QVAA 4RFVA 1IOZA 3DM5A 3H2YA 3K0AB 2W6JD 1GDDA 3A8TA 4OHZA 2WTUA 1C9KA 4DCNA 2RH5A 1W47A 2QE7D 1E2PA 1VCOA 2AN9A 2OUKA 4OI0A 4D6PA 2QSYA 2ZRDA 1Z2AA 1AK2A 4P32A 4CIDA 2GBLC 3GJXC 4D26A 1JXMA 4OQLA 1AZSC 4AY2A 1BYIA 4B3XA 2OT3B 1QVRA 1TUIA 2CE2X 3TUJC 2CBZA 4PSAA 5J4KA 2CMKA 3R9WA 1N5JA 2NIPA 2XSZA 3JZAA 3QY0A 4UXIA 2ZS9A 4I1OA 5G53C 5DSZA 1CJMA 3VTKA 2IXEA 4A8JB 1ODFA 5EP2A 2VF8A 4AYXA 1G6HA 4DCVA 1ZM2A 1P4SA 4DLWA 5L3SA 3C5CA 1KK3A 2TMKA 1E9DA 3M0EA 4KFRA 3TGPA 2F9LA 3AUXA 2XAUA 3KQLA 4LK2A 1ZD1A 1FZQA 2FOLA 3NKVA 2IYZA 2R44A 1O87A 3TUZC 2GJ9A 4PPGA 5DN6A 3GEEA 3BXZA 4PAMA 1G8FA 2ZYWX 2Q3HA 3UKDA 4B35A 4ON9A 2P2LA 3BK7A 2HF8A 3CB4A 2XNDD 5DI9A 4TSFD 3U7HB 4W9MC 1GZSA 1XJ0A 4BFZA 1KOFA 5C1BA 2QTFA 4M1WA 2OFOA 2OE2A 4DLVA 1JPNA 4AWXA 2GESA 4URYR 3AKDA 3GLFE 1KMHB 2OBNA 5FBVB 2QQEA 2OEPA 5EXPA 1P62B 4ILEA 1JQJC 1XMSA 2G0NA 4Q47A 1TQ4A 2ZI3A 5DHAA 3ZIAA 2JDID 4P4UA 4IJMA 3RRNA 2BJVA 1W5SA 3FMFA 1SVKA 5B64A 4AK9A 3WYGA 2QAGA 4X8MA 2ZRHA 2GHIA 4TQ9A 1AA9A 2JLXA 1KNQA 3C14C 4L8GA 1BKDR 2YWEA 5DIFA 3RYTC 4CYMA 2QBYB 3KKPA 1NNEA 1SVMA 4QL3A 3B85A 5JJKA 3UK6A 3HPQA 3D3QA 1BO6A 2BMFA 4KCGA 4IFBA 5LB2A 1MT0A 1NRJB 2KWIA 5H70A 5GVRA 3RAPR 4Q18A 2YV5A 5KPJA 4DCTA 1CIPA 2RCNA 1R5NA 4NBSA 3VFDA 1N6IA 4OK3A 1QG2A 2BMEA 4MGZR 4B33A 1KNXA 3U44B 2OXRA 1LTQA 3ZZ0A 4IDOA 4IDNA 4M22A 3A1SA 2R6GA 2G83A 3KJEA 1SKQA 4NHOA 1JAHA 3VNUA 3AB3A 4G5OA 3PJRA 3EPJA 1SHKA 3IPXA 3I62A 1IN7A 3H1TA 4QOSA 3FKSD 3AKCA 3B1WA 4PHGA 2WICA 2QUZA 4A2WA 1S1CA 1E0SA 4HAWA 4D80A 3U6BA 1T5IA 1AQYA 1Q1BA 3P32A 4BRUA 2PMDA 1ZC3A 2PCLA 3SU8A 4URXR 3DKPA 5K8TA 5L3QA 4MYTA 4C0SA 2C03A 4P33A 2ZSAA 2F9MA 4XTCS 1W49A 2WJVA 1XCMA 3DPUA 3GJ6A 4QBIA 5HR5A 4L9WA 4U02A 3L0SA 5EZ6B 2ZRAA 2Z5FA 3VR2A 3OAAD 4JLPA 3OEHD 5L3RA 2BM0A 2AKYA 5FBRB 4Q03A 1N6HA 2B92A 3CWQA 5UKDA 3GLGA 3Q3JB 1ZP6A 1ZM4A 2W00A 4ERNA 3O8CA 1K5DA 2BWJA 3B8HA 3TLXA 4M0LA 2EFGA 3WNCA 1E2FA 3UATA 5GJBA 4A36A 4V0NA 3JZMA 1KZGB 4BGDA 4MYCA 1EWRA 4HZUB 3VU9A 4QXAA 4B3DA 5IT5A 4KBFA 5KTYA 2W58A 2VHCA 4TL6A 3L0OA 3K1JA 4OBEA 1F2TA 3M1IA 5FPTA 2B21A 1EFTA 2W6JA 3ZZUA 2IEYA 3GJ7A 1W4AA 4IVQA 2QL6A 4MGIR 4BFWA 2G1JA 2QE7A 2E1RA 4LI0A 3LAWA 3ZS8A 1DBSA 1XB2A 3GJ8A 1FTNA 3B1YA 2I1VB 1P3JA 3QXSA 1T3LA 4KU4A 3T1OA 4U5XA 1T3HA 4DHEA 2GWHA 4QGGA 4LJ4A 4A0FA 4MYUA 3EZ9A 3AVTA 4MYHA 2FA9A 1D2EA 3PUWA 2WJHA 3CPHA 4DT1A 1ZAKA 4TMWA 3F0TA 3KB1A 2V7QA 3LX5A 5CJPA 2GVDC 3P27A 2ZE5A 4HAYA 4AYWA 1XD9A 2ZRKA 1E2IA 3TRFA 5EUMA 3MLEA 1JR3D 1XBTA 1OXTA 3T35A 4RD3A 3EWAA 3U61B 1E0KA 2BVNA 1E2DA 3FPAA 3IIKA 3EA5A 3SEAA 3TE6A 3WBKA 4Q4LA 3U7EB 1KK0A 1OH6A 3CH5A 2O5VA 4RKEA 1G3QA 3LD9A 1FNNA 2JLWA 2GJ8A 1VTKA 4XTRA 5FI1B 3C4JA 1RW4A 3GJ5A 5CDFA 721PA 1P2VA 2A5GA 1G20E 3RWOA 1G8HA 2QP3A 3MJRA 4LYAA 5JZVA 2WKQA 3THWB 2VH5R 4JBXA 1VG8A 4M2LA 2Q3FA 1ZW6A 3VKWA 3UG7A 5DI3A 5AR1A 1OLOA 3FHOA 2FSGA 1P73A 3C16C 4EPVA 2W2XA 4CF7A 3HPRA 1QHGA 2CHQA 2O0KA 3NBZC 4PQYA 3I5YA 2ERYA 1Q12A 1S96A 3OESA 4IHQA 1PLKA 3AF0A 4Z54A 5K8IA 1W5TA 3A4NA 2ZSEA 5FPHA 3PEVA 2ZAOA 4FMBB 2X8AA 2YOHA 5JSZB 1SHZA 3W3AA 4URWR 3VQTA 4NU0A 2YC4C 4WW0A 1N0WA 3VR1A 4ZIRA 1VG9B 1G4AE 3TMKA 3TW4A 4Q4AA 1WRBA 4HI0E 1A7JA 4P4SA 2ZJ2A 1XMVA 1Z0JA 1P9NA 2GK7A 4M1OA 2O8FB 5IK2D 3U4QB 5HZHA 5HE8A 1CR2A 1YR7A 3AKYA 2D2EA 1S0UA 5FUXA 2IYTA 1AS2A 2VTKA 4R71A 2QEQA 2V6JA 4IEEA 2QA5A 2VP5A 3BB3A 2FZ4A 2QRNA 4OJQA 4BFVA 4HYYA 3OE7A 3QG1A 1NMZA 2GCNA 4XD7D 2ZVPX 4BLRA 2GEVA 4NYIR 5KSOA 1F6BA 4F7WA 3T1TA 2ZU6A 3LRPA 3IO3A 1NI3A 1E98A 2ECKA 2ZRCA 2O8EA 4AIIA 1AGRA 1FPMA 1JEEA 1VYTA 4NYJQ 2VHTA 4ACAA 1G41A 2ORWA 1GITA 2QPAA 1A82A 3IQWA 4JLJA 1T8TA 3DEFA 1KSGA 4AC9A 1H8ED 2IA5A 2HLDD 5FUWA 1QHXA 4G5SA 4A1FA 2NMVA 2ZUDA 4MA4A 1NLYA 2V54A 3FOZA 3EAQA 1TQDA 2W6IA 4V03A 2X2EA 4US2R 2IS6A 5DGXA 2XXAA 2GAAA 2DWQA 4BLOA 2EFDB 4LJYA 3BH6A 2G88A 3RS4A 4ZKDA 2WWXA 4MKGA 1GRRA 1KSHA 1XEXA 1XEFA 3NEJA 3WYFA 2C04A 4Q4HA 3AQ4A 4RD0A 4BE7B 1F5NA 1FNMA 2JATA 3MWLA 1M8PA 1ZMXA 2ODBA 2V1XA 2DFKB 3SE0A 4EJSB 4B2PA 1MOZA 2XOKD 3IBGA 5FR2A 3CH4B 2O8BB 1MKYA 2ZRLA 821PA 1JXOA 5EP3A 5C4MA 3FVQA 1D8TA 2P67A 3DZDA 2JJ8A 3GJ4A 5IDVA 4CEJB 4IXNA 2IYXA 2JLRA 2OBLA 4JLDA 4NCJA 4B75A 3CO5A 3NH9A 2ZJBA 3KKQA 5E7IA 3ZH9B 1R8QA 5DNYB 1QF9A 2BKEA 5FPYA 3DO6A 2G0TA 3TQFA 4Q9IA 1NL3A 1AJEA 3C7KA 3KQHA 2AR7A 5KSZA 2VLIA 4LJAA 3BORA 5LB4A 3U3OA 4TYNA 4HLUA 1D2MA 5JHHB 1DG1G 4RZ3A 3IO5A 1N5LA 3LNCA 2QY9A 3CLVA 4FMDF 4KFSA 3L0PA 3NDPA 5C46F 2VQSA 3T15A 2KSQA 3MAAC 2OZEA 3K70B 2F43A 1LFDB 1DAMA 1KAOA 1XJQA 5EXXA 2Q3MA 3FE2A 2CL7X 1QZXA 2J46A 3UXMA 4H1UA 4PQRA 3BFKA 1YZLA 2ZEJA 4D4LA 2JASA 2WAXA 1JR3A 4TLAA 4DVGA 4ARZA 2BEJA 2ZITA 2WJIA 3ZYCA 4GOJA 3EASA 4LPSA 1E69A 2ZRFA 5ANRB 1U8AA 1NN0A 1QHHA 2XZLA 4F4JA 1N25A 1EXMA 2XJ4A 1OH7A 3IHLA 2FNAA 1HQCA 4AG5A 3ADDA 5CDFE 3W8RA 1OKKD 1Z5ZA 2F1HA 1R4AA 2FE4A 2ZJOA 1EFRA 1PLJA 2VP2A 2EVWX 3GLIB 3VR6A 1G17A 1Z28A 1B23P 4K46A 5SZJA 2VO1A 2EU8A 2YWFA 4JL5A 2JGNA 4NP6A 1G7RA 2FSHA 3NTUA 4OHXA 3AUYA 3CZPA 3RSLA 3HR8A 2ZXUA 1ELOA 4QGHA 4JJKA 2PMKA 5JWHA 2UZ3A 1AQUA 1VMAA 3NVAA 1S4QA 1Z07A 4L4UA 1YU9A 1QG4A 1G7CA 2NO7A 1N6RA 2WIAA 4XJXA 1XDBA 1IY1A 5D3QA 3KFVA 3LFUA 4JYBA 3R8FA 5L3VA 2FJUA 1U0JA 2KE5A 5AUNB 5G3YA 2GAOA 1DADA 3K0EA 1G7TA 5FOWA 5TY0A 3B7GA 1X3SA 2N1BA 4E03A 3PEYA 3VKHA 1OB2A 4PC6A 1B0UA 3P20A 2O8CB 1Z0IA 3PFIA 4G5QA 1KKLA 2WJJA 1LB1B 1N0UA 3IDQA 1KSJA 3RS0A 2GNOA 4ESHA 2FX3A 3FMIA 2OAQ1 3CW2A 1A4RA 1PVOA 2VP6A 3HYTA 3P4YA 4GOXA 4JVLA 4W5WA 4F38A 2RB4A 3WMEA 4WXPA 3WHKA 1GTVA 2NZJA 3BH0A 1OFTA 2FU5C 4A6PA 1R0YA 4M1TA 1OFIA 2XSZD 4FI3C 5EXSA 5LPNA 1VECA 2ZI4A 3CR8A 3QENA 4QBFA 3SFZA 4LOAA 1GL6A 1DOAA 3QEJA 4PZYA 1OFHA 5BXQC 2ZR0A 3AEZA 3I4LA 1NN1A 1XXHE 2C98A 1Q3TA 4DLRA 3U7GA 2H7VA 1G8PA 1II9A 1RIFA 4YMUA 1ESNA 3THYB 4LZZA 3VX3A 1Z0AA 2MMGA 4RFSA 1SKYE 4I1UA 3W5JA 1PJRA 5DN6D 3ADCA 4Q1DA 4NKRA 2VHJA 2ZUCA 3D8BA 3WY9A 2WWYA 2IS4A 1ZNXA 4IOMA 4LHWA 1MH1A 2V9PA 2JJ1A 4TT3A 3BB1A 2BC9A 3SHWA 3SYLA 3C41J 4WXRA 1LNZA 1KO4A 3DOEA 3PXGA 3DZ8A 4HLDA 3QVUA 4KYIB 1E2MA 4C4PA 3I61A 4EKDA 5IHPA 2ZIAA 1OHHD 3EZFA 4PHHA 3UPUA 2I3BA 3ZIAD 2BCJQ 2CJWA 3SZRA 1YZTA 4LYJA 1ETUA 1FFHA 3NG1A 3CBQA 4JSYA 5FR1A 3PCRB 2R6CA 4PR0A 4E22A 1E3MA 3B1VA 4D4JA 4H9GA 1II0A 3CONA 4D81A 2HT6A 3X1YA 4DLSA 1U8ZA 1Q1ZA 2HDNB 1KI4A 4KJZA 5LD2B 3FMOB 3V4FA 1XJCA 3LXXA 1E0JA 4YLGA 3VNVA 3CF2A 121PA 1WMSA 2FGKA 4MKIA 5E4FA 1XTQA 5SZHB 4HDQB 1F60A 4IVPA 5B30A 1YRAA 4CEIB 1Z83A 1N2CE 2QN6A 1ZNZA 5B2ZA 4EQ6A 5ELXA 2ANBA 3QQ5A 5K8UA 1Z47A 2NG1A 4EJSC 3JVVA 2OV2A 4ZCLA 4Q7MB 4EPXA 2AWOA 4RD6A 2XB2A 4KVGA 4Q5IA 4W7SA 1XEWY 4C0LA 3NBXX 3FKQA 4C0AC 2GF0A 1ZM3A 2FPMA 2WSSA 3HU3A 1L2TA 4NDZA 2N46A 3K0FB 3KKOA 2XTZA 2CLSA 4URUR 3SJAA 5HCNA 4TWZA 1UPTA 2VSXA 2WJGA 1L4UA 2WJYA 4RY2A 4P31A 4EFMA 3RS5A 2ZI5A 3Q85A 5FPKA 1GL9B 2GCPA 3I32A 4OHWA 1YR9A 1BH2A 1UBFA 1JR3E 2WWIA 1BS1A 4JL6A 4TL9A 1X1SA 3EC2A 3IPYA 4XH9B 2J0VA 2Z6VA 2QAGB 2V55B 1GNQA 1KGDA 4XOIA 3QF4A 4RVCA 3ZGXA 4QNRA 1DPFA 5JCPA 3LLUA 1SVIA 4L5BA 3B6EA 4QM7A 1E2GA 3K70C 2OILA 1GNRA 1J90A 3FFBA 2QT1A 1D6JA 3U3JA 2RGAA 2YINC 4TMKA 1BYUA 2GJSA 1I2DA 2OM2A 4PZLA 3CR7A 1KK2A 4A82A 2PLRA 1CJUC 3T1VA 2JLSA 3Q7PA 1KJWA 1R0XA 3TH5A 3VHXA 1JR6A 3FMPB 3H4MA 3R7WB 3TVTA 5FTMA 2C77A 2NO9A 1L4YA 2WWGA 3SJCA 3SQXA 2IYVA 1E2NA 5FL3A 4ZCIA 2E9SA 2B7CA 2P6UA 1R0WA 1OYYA 1G64A 2A5DA 1RRFA 4AKEA 2WZQA 4Q4JA 3I72A 2IEZA 3T5GA 2J3EA 3SFVA 4YDHB 4PSVA 2OO7A 3GD7A 1GM5A 1ESMA 2H16A 5P21A 4OI1A 3QXCA 1JAIA 5CITA 1W2GA 2NQ2C 4RSGA 2P65A 1H8HA 3B2EA 1II8A 3BAFA 3QXXA 4MQBA 4QJ4A 1ZYUA 2ODWA 2BKUA 4CRWB 2H17A 3O8BA 4XVRA 2WHXA 1TADA 1Q1QA 1NIPA 1CULC 2V7QD 4NMMA 1NG9A 1TU4A 1LF0A 3ECCA 3GLGB 4DLUA 1HT1E 1TEVA 1P6XA 4AURA 1N5KA 2CHVA 5KDOA 3KZ1E 2D2FA 3U3KA 3DOFA 2ZJ5A 3KJHA 1FP6A 2QPOA 2MMCA 2CCJA 1EFCA 1E9RA 1I4LD 2GRJA 5H1YA 3ZVMA 1ZIPA 2J0UA 1VG1A 3GEHA 2VP0A 1S9HA 3GFPA 5AUQA 1TEXA 1KI8A 2Z4SA 2ATVA 1OPXA 2QU8A 1X1RA 3KTAA 3LBNA 4MKFA 1QHIA 4KLNA 5JECA 4ACBA 1N6LA 5FI0B 5F98A 1GILA 1KI2A 1WDTA 1CEEA 4AD8A 3TSOA 1US8A 4CT4B 2HXSA 1OHHA 5FUYA 1JI0A 2PZEA 2PEYA 2WBLC 5EZ5A 1ZM7A 2YWHA 2AWNA 3CRRA 1G9XA 4WVFA 4PPQA 4C3ZA 2FFAA 3QVVA 2A5FA 4ZPXA 2VIIA 4R7ZA 2V1UA 2IF0A 2YHSA 4BRWA 5JRZA 1NVUQ 1J99A 4BFSA 3GLHB 4JLOA 3GFTA 2FV8A 4A6XA 1R5OA 2WVJA 3T12A 3ZD6A 1TF7A 3L82B 1RRCA 3B60A 3BBPA 2OBMA 4HATA 2DBYA 2IS1A 1NKSA 2HJVA 4HAVA 4C7OA 4QKQA 1S9DA 4BFUA 1FX0A 1TPZA 2FH5B 1WCV1 1T9HA 3TR5A 4C2UA 1SVOA 3MD0A 4LYHA 4KI0A 4B3FX 4DLTA 4PFSA 3OE7D 4YDSA 4JIMA 1HTWA 5EE9A 3EX7C 1E2KA 1GOTA 2RGNA 1FUUA 5LD2C 1JQLB 4JLBA 3RHFA 1WBBA 4TMVA 1OXSC 2O8DA 1FMLA 1ZD9A 2GEUA 1Y63A 5TMPA 3UIEA 2F1JA 4YC7A 2XTMA 1YQTA 1P2UA 1SQ5A 2WKPA 3HYRA 5FOUA 2NGRA 1NIJA 3L43A 4DCUA 4JBYA 2AHOA 2IWHA 4CEHB 5J4LA 1DVRA 2P6RA 3LY5A 3KL4A 4BPBA 4TLBA 4WZBE 2W6ID 2VSOA 5BYKA 4ZIRB 4BZQA 4KFUA 5L8VA 4Z8YA 2XB4A 1V5WA 2V6IA 1UBGA 4P4SB 3K0AA 1KTVA 1SXJA 4GZMA 5GADl 1N6PA 2AL7A 3W90A 4QFMA 2Q9BA 1OIXA 4M1SA 1TMKA 1KDRA 5TV2A 4Q66C 1J70A 2Y8EA 2ZR9A 1G4UR 1K5GA 3GFOA 2ZQ5A 3K0CC 3PV0A 1XMIA 1XU4A 2P3SA 1UKZA 3DM9B 3Q8XB 4Q19A 4DJTA 3ONWA 1YKSA 4C0HA 4Q7LA 5FBQB 2QAGC 1PLLA 2A2ZA 2VL7A 4ASUD 1G16A 3SDZA 4B44A 2XITA 5HTKA 3TJZA 4WBSA 3AVOA 4DRZA 2IHBA 3PR1A 2RAPA 2F55A 1X8JA 2O8EB 4A8JA 1E6CA 1KI1A 1UADA 2FSFA 2P6NA 2YYZA 1MO5A 1ZCAA 3BWDD 3P4XA 4WZ6A 2G9NA 3KB2A 2QRZA 4HB2A 1FW6A 2OCPA 2ZI9A 2JAQA 2ZTSA 2ZSDA 4B71A 3C5HA 2GXQA 3ZZTA 1XTKA 2ZVQX 3KUCA 1IBRA 1Z3IX 1NJFA 3PIRA 3CNLA 4KLZA 2YWGA 3KQNA 4DB2A 1R6BX 3U60B 2NPIA 1DAKA 1EX7A 1P5ZB 3KXKA 3AVUA 2PL3A 2ODEA 3A1UA 4Q4HB 4DZZA 4DDVA 5FBLB 4B2IA 2GXUA 4FCTA 4K81B 1VCIA 3H86A 5FOTA 4A0RA 1FUKA 2D74A 2UZIR 3CRVA 4OQXA 3LX8A 4G5RA 4DCSA 1DAFA 1U2RA 2C99A 2RHMA 1Z6GA 3W8NA 2DWOA 1NKTA 1CR0A 3QE0A 1XTRA 1ZU5A 4GBMA 1IJEA 1UBCA 4XWAA 2FFQA 3CRW1 1FL9A 1LS1A 2VRWA 4C30A 4A15A 4NYIQ 4UNPA 5HE9A 3U7FB 5BQ5A 1W46A 1ZCBA 3BFVA 2RKOA 4LHVA 2ANCA 2HCBA 2VF7A 3AGPA 5CIQA 1EFRD 5DO9A 5FFMA 1RPZA 1GRQA 5FPSA 2QBYA 3WNBA 4QNMA 4DLYA 3ZJYA 3EZ2A 4A9AA 3I73A 3LXRA 2J45A 3EIHA 4FMCB 3EWSA 4UXHA 1DTSA 1IXRC 5EP1A 4RD1A 1KO8A 2H8KA 4LYFA 4RZUA 2OCAA 3E70C 3WP0A 1NN3A 4AKHA 4B73A 3IEVA 4LJ9A 4DDUA 4LHYA 3U44A 2ZYTX 3B78A 3Q5EA 3X1WA 2EYQA 3SBEA 3ND8A 4M9SA 3SJZA 5J40A 4LY6A 1EGAA 4MRNA 4PAQA 5F9HA 2J1LA 2FEOA 4FMCF 4TZ0A 4LHZA 3BRWD 1ZNWA 1DELA 2OESA 4JVSB 4B48A 3PITA 4KSCA 2BM1A 4NH0A 4ARZB 4TYPA 3NXSA 4YONB 2H57A 4HUQA 4DUGA 5KNBA 4GNKA 3DKVA 3L8YA 3ZVNA 3AVYA 5IF9A 1QHHB 4IW3B 1YZKA 4MUAA 1NLFA 2FPKA 4PO9A 1VCMA 1A2BA 4LJ5A 3MCAA 3VR5A 1FTSA 2YC2C 2QMUA 3AF3A 4Q1AA 4B2LA 1TF2A 5CB6A 1OXUA 2GF9A 5AK0A 2FFHA 3TAUA 1T8UA 1W48A 4LX0A 5JHGB 1OYWA 3QPVA 4RZXA 5GJVC 1IN4A 3SS8A 2O0JA 2PCJA 2QMOA 4LGMA 1AZTA 2OFWA 1XXHA 4HEJA 2NO0A 2Q9AA 5GJCA 2OLKA 2EYUA 4V0LA 4OQMA 5EXTA 3WBJA 4V0MA 4GFDA 2DCUA 2A9KA 4BASA 2YZ2A 5BN5A 4I99A 1NJGA 2QAJA 1X8KA 5AWFC 1GSIA 4HB4A 1W44A 3V4RA 3ZQ6A 3THXB 1E9CA 2YOGA 1MABB 3D31A 2J59A 4HZUA 3R9XA 2QP4A 4HLQB 1KIMA 3BIFA 2D3WA 2J5XA 3LWNA 1CU1A 2JJ1D 2REXB 1IXSB 3EW9A 4TT3D 5KDDA 5KNCA 5DLQC 1OE0A 1L7VC 2DY1A 5LDDC 2KJQA 1PUJA 1P2SA 4PTLA 1SXJE 2H18A 3M6AA 3GPLA 2WSMA 3CNOA 4B6EA 1M7BA 4BLQA 4TQAA 1XPRA 1XD2B 4QM6A 2RGXA 1X86B 2GCOB 2J0SA 5GJWC 5JWRA 2QSZA 2IC5A 3K09A 1COWA 3A36A 1G3MA 3W9YA 2C5LA 5AJVB 1U99A 4LWZA 4JKYA 4NYMR 4B3GA 3PEUA 3ND9A 4ASUA 4TTRA 3O8RA 4EPWA 2YOFA 3KKNA 3RVBA 1E4YA 1U9IC 5E7MA 2RMKA 2ZRGA 4BWYA 4QHSA 3QIAA 5B57C 3CM0A 2CNWA 4Q1EA 2ZS8A 1G1MA 3QOFA 4Q01A 5D3MA 2XJ9A 3ICEA 4IDPA 3NC0C 4R9UC 4PAOA 4D82A 2UKDA 4ZI2A 1W36D 4NCKA 4EIWA 5SZIA 2IXGA 4LSGA 3ZQJA 2B7BA 5CK5A 4EAQA 3HP1A 2CL6X 1W0KA 2VP9A 1WP9A 1WA5A 2J0QA 1RJ9A 2NZ8A 4WOPA 3PUVA 2HEIA 1U90A 2WSSD 1LV7A 2BCGY 2PBRA 2ODNA 2CXXA 1IN8A 2XEXA 1E2LA 3GLFB 3THWA 1CR4A 1UFQA 1U0LA 1XCGB 3QKRA 2ONJA 2IUTA 2C9CA 2IF2A 4B3BA 3NBFA 4CW7A 4HAXA 2KBFA 4BUJA 3AVVA 2CJWB 4TLCA 1ZUNB 1EFUA 4DSNA 4ITRC 1IM2A 4QC2A 2R65A 3QSYA 3M4YA 2BOVA 1M7HA 1ZC4A 1U94A 3AF1A 2D62A 3X1XA 1YHNA 4MRSA 2IYSA 4XVUA 2HUPA 1Q57A 3HR7A 2GVZC 3S1AB 5AJZA 3OIWA 2ZYVX 4I81A 4B43A 2PH1A 3ADKA 5JSZA 3RRZA 4QRHA 1Q21A 2CLCX 4Z1MA 2J7PA 1E0AA 3TW8B 1MV5A 4KODA 2Q6TA 1R0ZA 1W36B 4D2IA 4B34A 1TX4B 4BZPA 3FHCB 1VYVA 2CK3A 5KUTA 3AF4A 2OAP1 2ZPTX 3BJIC 4JT2A 3U4QA 1JEDA 1GRNA 4EDHA 5F3WB 3TAHA 4C0BA 2W2TA 5KO2A 1TNDA 1W1WA 1Y3AA 3I8XA 2FWRA 5DE3A 2X2FA 1Z22A 4HLCA 3P26A 3U6KA 3KX2A 2IL1A 1P60A 4ZDIA 4V0OA 2WOJA 1UJ2A 4FWTA 4POAA 1VG0B 4DSUA 1XD8A 4MGKR 1XF9A 3PVSA 1W2HA 1KI6A 3U3MA 3B1XA 1T0JB 3DHWC 1UF9A 1E9BA 3LO5A 4LV5B 4NE2A 5BN4A 2EFEB 3UANA 2FN4A 2FSIA 4HLUC 2GILA 1HH4A 4HDCA 5KYKA 1Z6XA 4GOKA 2A3RA 3ASYA 4OL0A 4Q02A 1H8HD 1W4RA 3T61A 1GUAA 4ABYA 4ZI3A 3G82C 5HKKA 1Z2CA 2XZOA 1JALA 3AVXA 1G5RA 1BMFD 1JECA 2KBEA 2R6FA 1XMJA 4ZV4A 5IRCD 2FZLA 1G21E 2J9RA 1NP6A 5FH9A 1T0HB 2R62A 4OK6A 1D9ZA 1LVGA 1ZIOA 5EQTA 3VR4A 1RE0A 2B8WA 1Q1EA 4L15A 2AXPA 1QDEA 4A0HA 2WKRA 3GEIA 2DFLA 4D4KA 1YZGA 2A5YB 1OV4A 1KJZA 1XEWX 2OCBA 3MG9A 2R6DA 1HA3A 2CVFA 4EPYA 4YQFA 5AUPB 5AJYA 2CVHA 5JMTA 1SVLA 4EJSA 3B9QA 3REFA 1JNYA 2GDJA 2E87A 4V0ME 2RHDA 5E95A 2QGNA 2SHKA 4YMSA 4OHVA 1IAQA 5CLLA 4KAXA 3EIQA 4IXMA 1KHTA 4C9BA 1OH5A 2AK3A 2D06A 4JVMA 5CM9C 3TKLA 4TMZA 4N3NA 2LKCA 4CEJA 4LJ8A 2XX3A 3N70A 1SZPA 2PEZA 3RABA 4DDTA 1CRPA 4TTPA 4DSOA 5JCZA 2CLDX 2HT1A 4UXJA 3L8ZA 4B74A 4ZDJA 1MRNA 1E79A 2CHGA 2ZSFA 4S2EA 3ZVLA 3ZLJA 1AGPA 2JLUA 4JL8A 2ZUBA 2ZANA 4F91B 1MO4A 4GMXA 3I1FA 1CS4C 2RGGA 3DVLA 4JLAA 3UG6A 4C2TA 2Q0HA 4S35A 4Q9JA 3B9PA 1T5LA 1KJYA 5KNDA 3QKSA 3A6PC 3BFXA 5CK4A 2IWRA 4LHXA 2JLYA 2ZJAA 4LPKA 1R5BA 4XVQA 2IS2A 3T1QA 3MUFA 5JI2E 4AKIA 4Q7JB 2PX3A 3QXJA 3X2SA 1NG1A 1L8QA 4BFYA 3NH6A 3QPWA 2I4IA 4IEIA 5L3SB 1AKYA 3UWKA 2IYQA 4DLXA 3GMTA 4DWJA 1G291 2GKSA 1GKIA 4LC1A 2IYUA 2IXFA 2RGDA 2PLFA 4TL8A 1OJLA 1PUIA 2EW1A 3C15C 3LW8A 1NMYA 2ZRBA 4AG6A 1F2UA 4AI6A 1G3UA 3EC1A 4UNNA 1G18A 1G19A 2WWFA 1NN5A 3AF2A 1P2TA 3CRQA 2JA1A 3SNHA 4JJZA 4R98A 4GI7A 1ZNYA 2IT1A 2QROA 1UBEA 4DDWA 3GLIA 3BC1A 3TK1A 1J7KA 1G5TA 2PZGA 3PUXA 1KO1A 4JSTA 4KHZA 1HV8A 4RKFA 2QT0A 4F93B 1OXVA 2NTYC 3RRMA 2GBLA 4QBGB 1A2KC 4JKIA 5J4VA 2OXCA 1SGWA 2XZPA 3IBYA 4Q00A 4TTQA 1RYHA 1S1MA 3TSWA 4QHTA 5FTNA 3THOA 2KI5A 1AM4D 4F92B 3EARA 4M9XA 4R2IA 5EE0A 1XWIA 3R9IA 2WV9A 3HU1A 1G6OA 4LJ6A 4MGYR 2QTHA 3HWSA 3OFNA 1SXJD 3WMFA 3AV0B 3OHMA 3H84A 3GJ3A 4G01B 4TMXA 4U7DA 3FDIA 2O8CA 4BZXA 1OF1A 1ZVQA 3W6NA 5JLJA 4PQFA 4ZDKA 1G7SA 3WHLA 4UNSA 4MDEA 1GIAA 4O0MA 4KV9A 1JPJA 3AKEA 4DLZA 1WBDA 3E5HA 1Z6YA 1ZJ6A 3EPHA 1HY3A 3D7MA 2XTNA 4GRAA 2X77A 3OZXA 5CYPA 2PJRA 4US1R 5E7JA 1JBKA 1UM8A 3NIBA 1DAGA 1QBKC 3ZDQA 1KMQA 2CDNA 2G1KA 4O2RA 2Z83A 5CYOA 3AVPA 1U98A 1E2HA 1W36C 3UMSA 2DPXA 2D7CA 2REOA 3WP1B 1EFHA 2W83A 4IOJA 1QHSA 4M21A 5J4HA 4GMDA 5K8LA 5L3QB 1KAGA 2GXSA 4GL2A 4K8OA 5JJLA 3KDSE 3THYA 1NVVR 1SULA 4C0QC 1XPUA 3TIFA 4UKDA 4B6FA 1UEJA 1JB1A 3KQUA 1BMFA 4LV6A 5FOXA 1KI3A 4TN1A 1SXJB 1CJVC 2DR3A 1UAAA 2BBSA 4BQSA 1KO5A 3FB4A 4HAZA 3NHBA 3FWYA 4ZDWA 3KFXA 1M2OB 1E2EA 1Q44A 4GSYA 4A2PA 4A92A 4DC9A 5H8WA 1KYIA 1E9AA 4NCIA 4URZR 1XFAA 5FOSA 3EA0A 2FF7A 3K9LA 4UNQA 2CCGA 2QP9X 1NBMA 2ZYUX 4A4DA 4B76A 1VIAA 5DISB 1KDPA 3IEUA 3RSOA 1VHTA 1CLUA 3K8YA 4EFNA 1E2JA 1T6NA 4LBWA 2FEMA 1QHNA 4M53A 3VU9B 1IHUA 3E2IA 4Q9LA 3RS2A 2R2AA 1YR6A 2JLVA 4PPFA 1E1RD 4C0KA 4D0GA 5HPYB 2B6HA 1F2TB 3MWKA 2QG6A 2PT7A 3WXMA 3A1WA 3I92A 1GVNB 4C0JA 1XP8A 1ZBDA 2GJKA 4E09A 1VDZA 3KKMA 4OQFA 2MSDB 4E07A 1F48A 4AYTA 3W5IA 2Z0MA 4QG7A 2QTVB 3F5FA 3O8DA 1J8MF 4CEIA 2W0SA 4G1UC 3NEYA 5CJ2A 1IN6A 2Z43A 5C4GB 3PEWA 1TF5A 2VA8A 3W6PA 4PC3A 2ZI7A 4RCYA 2KB0A 2BIFA 3QBVA 1GP2A 1HE8B 1T91A 4DT1B 2F7SA 8OHMA 1IY0A 2JJ2A 3K0FA 2ZRIA 3BOSA 4YXWA 4OJKA 1E32A 1P9WA 1P9RA 1YZQA 4DIDA 1OIWA 4JLVA 5EE1A 1I2MA 3IIJA 3B1ZA 4PC7A 4CDGA 1ZUIA 3FFAA 5FUVA 1I4DD 2C96A 3EIEA 5G40A 2FPLA 3OIYA 4DUGD 3K0CA 4JBWA 5A4JA 3MGCA 3PQCA 2CE7A 2ZU0C 1GAJA 4PHTA 3T5DA 3A4MA 4RD2A 4J0QA 1G3RA 3REGA 2D7DA 2W0MA 3VKGA 1V43A 3HDTA 4PPNA 2RGEA 4CZ2A 5EUQB 3FTQA 1E94E 2GA8A 1N5IA 4OYHA 2CCKA 1W7AA 1Z0KA 3ZD7A 2BBTA 2HF9A 1E9EA 3PUZA 4BFTA 1CR1A 5DI3B 1TTTA 4BFXA 3GLIE 1DG3A 2EWVA 2JIZD 1VPLA 1FQJA 621PA 2QPTA 3QKUA 4PC2A 1R2QA 3GQBA 2YJTD 5JWOA
chains in the Genus database with same CATH superfamily
4MVCA 2XYPA 1KDZA 3GP8A 1HGXA 3D6MA 2I7TA 4IYRA 4MPDA 2FUEA 4ND2A 2AK2A 4PZZA 4O25A 3ZWBA 4C7XA 3CRZA 4FR5A 3R7WA 1SIBE 1TM1E 4I1RA 5EE5B 1NFFA 3MILA 2QD4A 4HX2A 3SC3A 3BDVA 2OVBA 1KE2A 4DEXA 3H16A 5G41A 2PUBA 1NRWA 1W19A 3FFTA 1KF0A 1PZEA 3A11A 3ZVRA 3ZBQA 5AK6A 2JIBA 3MIZA 3ZUPA 3OU6A 5AW1A 1CDEA 1J2JA 4JBHA 9LDBA 4PPFA 4E5MA 2ZETA 4EYQA 4C43A 2G77B 3CISA 3STWA 1YQXA 1CQJA 4KLAA 1TKCA 3R0JA 1IEXA 1TQHA 4LRYA 5FQOA 3QYFA 2PH7A 3GGJA 4KYVA 2R6JA 1JHZA 2IYWA 1KKMA 2C78A 4M76B 5EHIA 4JI3B 1UWVA 2ZCUA 4TVKA 2H4XA 2G80A 2VPPA 2VWGA 2PMFA 4X8OA 5EC8A 5FBWB 2XQJA 3ZNNA 4BTVA 1ZR4A 1TYDE 4IAOA 4KBGA 4R0NA 5J4YA 4YRKA 1IWOA 3E3LA 1WKBA 2E6UX 2IDZA 1LJ8A 1PDVA 4IJ5A 4YRQA 5JVDB 5ARBA 2HZBA 2QKYA 2R4QA 3E8SA 3PT5A 4FC6A 5CVCA 1NUHA 2DUUA 2BF7A 4TLEA 4LSMA 1ORTA 4N8SA 4OXIA 4D98A 1KO7A 2GTIA 3ESYA 3P9PA 1S7GA 1UMDA 4NRDA 1PG5A 4P1ZA 3OOWA 1K9VF 4KR3A 4QUIA 2F1RA 1QRAA 1KXJA 3GDFA 3TXXA 5IDWA 1KC1A 2ZS7A 4I1VA 3HH8A 5M34A 4U3JA 1GZ5A 1GR1A 2GKOA 4C21A 4DJEC 1VL8A 4WZAA 5JXWA 1CR6A 1ZL2A 4NK5A 3SBDA 1WPGA 3B52X 4XLZA 3PSAA 3BS4A 3FPGA 5E3IA 2OHIA 2AFHE 1TZJA 1E77A 4H08A 1EBFA 2XXAB 2NUTA 1HURA 1TJPB 3PDIB 2FSUA 4FWIB 2RGNC 3U09A 2Y0EA 4TM7A 4F8JA 4QYIA 1TM3E 1XEXB 3F7NA 3V2HA 2DT5A 2GFHA 3C7AA 2PVSA 5DHFA 1EX9A 3LUAA 1ZMBA 4IV0A 1I51A 3JAKB 2WFLB 1NLZA 1W85A 2AEMA 2CMHA 5CVVA 4AKSA 1I3LA 1KMHA 1MQAA 2CNKA 2BEWB 4WA7A 3ZXYA 1U5AA 1M72A 1ZO8A 5G4KA 4DBVO 1S3SA 1ZRHA 2F8LA 3HO6A 3L6BA 3QKTA 1IY2A 1ZR2A 2FG5A 4XWYA 1RPJA 1SB9A 5JE8A 1J5XA 2XRFA 4GI3A 5JPDA 4LYEA 5BNFA 2PT5A 2SCUA 4JP1A 2ZROA 3ZKAA 1MQ8B 4XASA 4FXPA 5LDHA 1IZZA 4LF9B 3VSAA 2CXSA 5D3MB 3EPLA 5C8DA 5ILQA 3NBYC 4Z1MD 1SXJC 2JD2A 3G8DA 4O2BF 5DYIA 3SKVA 1HT2E 3BMOB 4KWEA 2P6PA 5L40A 4QDZA 4EP1A 5EHQA 4P80A 2RB5A 1O97D 3KV1A 1NVFA 4MB2A 2MSWA 2EJWA 1IQPA 3IB3A 3DQPA 3EVZA 4JHLA 1SU6A 4ZP1A 4N0DA 1I4OA 3BXFA 3IQHX 4Q4CA 1MDBA 4WKGA 1BC5A 3SVTA 1NNI1 2WUDA 3OLCX 1YFKA 4P82A 5GONF 5IDYA 1Q22A 1QAQA 3WMGA 3AVWA 3EEFA 4ZK6A 3HXPA 1GG8A 1HYHA 4IJVA 5FOVA 3M4NA 1UPXA 1LA2A 1F12A 3SI7A 4QVKA 4NCHA 1NBOA 1T3ZA 1XELA 3B3GA 5FTJA 5YASA 3RWMB 3N9IA 3SMVA 5DYNA 2PQ6A 1IHPA 2DOKA 3BWEA 1FDIA 4U7TB 3TB6A 5KI6A 3VMFA 4V1CI 1Z0SA 4N0EA 2BV3A 1TRKA 5GQSA 4YP5A 1ISJA 1XP5A 3ABQB 5FYDA 4HB0A 2J41A 2MOKA 2HQRA 4QASA 4RVHA 2ZZMA 2WIBA 1ZVMA 3MWYW 2OQVA 1YR2A 3WGVA 2AG5A 5TQ0A 4AQDA 2D2XA 5LXTA 3QHQA 3BD9A 3LYLA 1M2NA 5KYVA 3CEAA 1GKYA 1HQYE 3EWNA 2YXLA 1W0CA 2FJ0A 1ZK2A 4V3BA 3DDWA 3BGWA 3F8TA 4KVFA 4XI9A 4YJ3A 2ZOSA 1ANKA 1D6NA 1FXUA 1QDUA 2A7QA 4ALLA 3CS3A 1SCKA 4M0CA 4UJ3A 1C2TA 5HKKD 2ZRMA 3NTXA 2Q4OA 1PK8A 4KRYA 1P3Y1 1JBEA 2MSCB 3BTOA 4QYSA 5JS7A 2QD3A 1CE8A 3DBRA 3TIGA 5M7EA 1I4TD 2IIBA 2C2HA 1N7GA 1R9GA 2M9MA 4OK5A 1CRZA 4DTIA 3TRIA 2QI9C 3J7TA 1XZDA 1P33A 1JA0A 3GPBA 3N2EA 4LXQA 1EFKA 1FP2A 2JIZA 4Q9HA 4XIGS 4YLEA 4CMEC 1DX4A 1XNRB 1KS2A 2ZRNA 3C45A 4KNWA 4XB6B 3E9QA 1B42A 3Q9LA 1NY5A 3HXKA 5SY6A 5JSHA 4E94A 2O0HA 3K6RA 4M7WA 4PSKA 4Y6GB 5KKNB 5CCEA 4GT1A 4RTNA 1RPZA 4OLAA 3X1DA 3JASB 2XGOA 4OGWA 5CYOA 4WKBA 5L51A 4QODA 3ONFA 5ARDA 4R51A 1Z29A 1YL5A 2BH9A 3LKDA 521PA 1U3FA 5LJIA 1SCBA 1ZI6A 5JJIA 4Y6PA 1MU0A 4BEJA 3UMGA 2I55A 4LCBA 5CNJA 3IVCA 4MYDA 2WYHA 4HAUA 2FSVA 2I1QA 3TB4A 3A3PA 4XWKA 1G8GA 1KFJB 2ET6A 2UV8A 1E60A 4TS1A 3CEHA 3EGXB 2WPDD 4I1IA 2GOYA 5BUSA 2GASA 4Q3NA 1SCAA 3G88A 4YAGA 2GBFA 3A10A 5AVWA 5KVSA 3FETA 3OZVA 3RVLA 4DQXA 3AYXB 1DJLA 1ZQ9A 3IHKA 2X15A 2PUGA 2X7XA 4PX9A 2XUZA 1EGMB 3QX9A 1ECGA 5CMLA 3BX1A 1J1ZA 5FYQA 3EZ6A 2QLJA 1Q91A 3B82A 1XG5A 3EWIA 5KJ6A 3HABA 1B76A 4FJ0A 1EDZA 4OMUA 1UWKA 5AVOA 1K7XB 2QGFA 1GVHA 4NSNA 1YRQA 2VYVD 5C52B 1QGUB 3RGGA 1KEWA 3R7FA 1BA2A 5I4CA 2R25B 3BVPA 1MIHA 2Z8ZA 2WG2A 3RFUA 4HWGA 5DB4A 1MQ9A 1ZIDA 4GX2A 4LNUA 2H08A 1NATA 3LOPA 4A0SA 4BLSA 4EA7A 2C9BA 2ZPUA 2XWQA 3HM2A 4H3HB 3GLGE 2ZJZA 3SIWA 2A1TS 1SQGA 2OV3A 3ASZA 4UU0A 5TB5A 5HZKA 2RE8A 4CKWA 2DECA 2ROQA 5FD8A 4CLHA 3HK2A 4BLTA 1T2CA 1WE2A 1ZH4A 1I2AA 3CX4A 3CVUA 3OPVA 4JNCA 4YV1A 1C4OA 1PJ4A 1EUQA 4YAOA 1Y8QA 3W2HA 4FMDB 4TMFA 4U2FA 2HYDA 2WAYA 3HNPA 3KRTA 1AX9A 1NF8A 2C5SA 3MMPA 1ZITA 1TM2A 3NRBA 3STYA 3L8EA 1GCAA 1GPDG 2P8JA 1AO0A 2IH5A 3WMRA 5KNCH 4YRPA 2G3YA 3RDPA 1WXDA 2IBSA 1TAGA 1NT4A 2P5SA 4QBHA 4ZO7A 2LPMA 2ONKA 5FA6A 5K4AA 4EF5A 2XDWA 1RFLA 2FMHA 3HBNA 1TAQA 3M33A 3PA8A 3AZPA 3CKLA 5KWVA 3BIOA 5A0FA 3V00A 4X41A 2OLJA 2QM7A 3RS8A 2VATA 4Y6OA 2C9YA 3A1VA 3I0NA 2XUQA 5HDQA 1UBRS 4D8VA 5CA0F 1RMTA 2AG6A 4JZKA 4DQ0A 4V02A 4NCNA 1WP4A 4FD2A 1ZX1A 1XLVA 1Q95A 4CHTA 4PO3X 3PQ4A 2CMDA 1PFUA 4IIXA 4O1IA 4BV2A 5FPPA 3EEOA 3KT6A 1P5FA 3QVXA 1G2QA 3L46A 1T9ZA 2Q5LA 2VXYA 2GM4A 2YR0A 4HEQA 4MV8A 3FTCA 3QLUA 3WQSB 3AJAA 3M70A 4ENVA 1JN0A 2GPWA 4QQNA 1U3UA 5B6JA 5AJHA 1AXRA 4MVJH 4JVNA 2BFDA 3K09C 5HRUA 1F2UB 3QBTA 4XPIA 1RS0A 1T4MA 3BEDA 4TMTA 5CA1B 3GUZA 1A8PA 4F9EA 1MIOB 1QNLA 2IUFA 221PA 2JZCA 2MSEB 3G0IA 4PRLA 1O7JA 4WKCA 3TR6A 4BUZA 2ORVA 3KOMA 3NDBB 4U4AA 5IM4F 3LA8A 4K40A 4F7DA 2FVYA 1CQXA 2HM7A 2QENA 3DH0A 5BW8A 3O3CA 2YZKA 3ZE6A 4RZ2A 4PEVA 1TJ3A 1YOBA 2HF7A 5BN3A 2F1OA 2AFIA 1KH2A 4Z9XA 1C2YA 3TO5A 2ZBQA 1PKXA 2ZE7A 3TJMA 2KM1A 1JSLA 3B48A 3UW1A 1MBZA 3T5BA 4PXAA 4XGNA 4FHFA 4KHPB 1C7QA 4TS9A 1W0JD 3B3JA 4YJ2B 1W6UA 1C3EA 1TGVA 4DBLC 1Z0FA 4PC1A 4WZBB 2JFZA 4W5JA 4F4UA 2ZK7A 3JYQA 4JP3A 4ZZ2A 4OHPA 4ARVA 2NT3A 2REBA 3DMTC 2YWRA 4MUBA 3BXOA 4XYMA 4YRGA 4MOWA 4EFLA 2FOXA 4M1YA 1CBUA 1LPOA 1MABA 2ID7A 3HGTA 3I2IA 3ZDFA 2AXNA 1KSFX 1A7UA 4DSTA 3QF7A 1OOEA 1KVRA 2JF0A 3O2SB 1Z8DA 2ZR7A 4AXBA 1LLUA 1YSCA 1MH9A 2DBVO 1DBIA 4O1HA 4BX3A 3GZ4A 5JD4A 2JCBA 4HFMA 2R84A 4IS2A 2OVFA 5LZ2A 3W34A 2ZTMA 3PENA 3HP4A 4XQ9A 2SICE 5FBVB 2HK9A 3HEMA 4DLAA 1Q15A 4NPHA 3SVZA 4PZ0A 5CHEA 1M0SA 2I03A 1G5PA 4MA0A 3IDZA 1O94C 1N2GA 1RVDA 2LP4Y 3NXKA 1S89A 4UEOA 5KHOC 2KHZA 3F3YA 4PRZA 5DTRA 5ARCA 2Y99A 2H5JA 3NWJA 4JD5A 3T9AA 3VPCA 4RPGA 3SDBA 2AD1A 1Q0QA 2I8AA 3HA3A 2FMXA 4NE9A 2PL5A 4X8HA 3IT1A 3JWEA 6REQA 3OTOB 4X6YA 2R9VA 4BFLA 4D9EA 1RZ3A 1K2VN 2OCYC 1P1KA 5KTPA 1YI0A 4WX2B 4D0LB 4WNIA 4F56A 4H1VA 1KYWA 1PFYA 1VE9A 1NHGA 2LE0A 2JVIA 1CQIB 4YHHB 4J9UE 3GAZA 1NJ8A 1PN3A 2OR3A 2PX6A 2VTBB 1XQXA 2QSJA 4IHJB 4Z9BA 1NR7A 3AFIA 2M2IA 1PJ8A 3TG8A 4LXIA 3S0JA 1L6RA 5KTOA 5FWYB 2DFTA 4R2WA 5CM8B 3KLMX 2CL0X 5CXUA 2PUDA 5SICE 4RA6A 1AKEA 3DDCA 3ONNA 3WNVA 1AC5A 5D3KA 4MHTA 2HB6A 1GFSA 2G06A 1QYWA 2FYTA 1V5IA 5AI4A 2FWJA 2FW0A 2Y1CA 3ZS9A 1K7CA 3BHJA 4B4KA 5AMXA 2V4ZA 4I9UA 5J1TB 4DV0B 1O95C 2HU7A 3GRZA 4GPBA 2O6LA 4FYIA 4PG5A 4B32A 1PJAA 2PJZA 4QTYA 2V7TA 4MVJE 2OCGA 1N6NA 3F5QA 5AXCA 1BD3A 4EF4A 2Y9MB 1AOXA 5I7OA 3V8PA 1YJ5A 1J8YF 2WTEA 2OYCA 3VAAA 3ZTTA 3E1SA 4D9MA 3ICQB 2VEDA 3U26A 2FW1A 1LX7A 2JL1A 3C3WA 3QJYA 5BUQA 5JEDA 1QP4A 3BSWA 5CB8A 5HK8A 4BWGA 5GVSA 3PQ3A 4KSBA 3NOXA 4MA5A 4FS8A 4XGKA 5FT9A 1QF7A 1SBIA 2HFKA 4QPCA 5K9ZA 2ZRJA 2CJPA 2NAPA 2Q6IA 1EB9A 1QH1A 2HIAA 4RCZA 4J7AA 5IARA 4KQIA 4P0TA 1TA0A 1US8B 3CLTD 2CFSA 1XOIA 3D6TB 1FP7A 3G2HA 3OZSA 2OQIA 2LBPA 3AHGA 2ZZKA 3LBIA 3O4JA 1QTQA 1E96A 1UT8A 2O3RA 2Z9BA 3AO0B 1U7DA 3G8YA 3RANA 4ZT7A 5C8VA 1TTHA 3OTHA 5TPWB 3CWZA 4XM0A 2ZI6A 4TS3A 1N5DA 4I55A 4B81A 2OHFA 5JAUA 5KOYA 1JEOA 5H5JA 1AO3A 5ALXA 5CFOA 3H5WA 3I3SR 4G37A 4R84A 4GL4A 2IZ5A 3IUYA 5K6AC 4EHHA 1YE8A 4DZRA 3A4IA 3DP9A 1C9EA 4MUJA 1VE3A 4DJDC 5KREA 3CEPB 2GJAA 3UUWA 1JJVA 3MWDB 1JLKA 5KX5A 2Z9DA 1ARZA 4TZ6A 5HGJA 3DW3X 3IFSA 3UHOA 1X7DA 1REQB 4MS4B 4C7OB 5KDLA 1XRSB 3D6JA 3GOQA 1RRGA 2P9YA 3UMFA 1C81A 3BB4A 2W6PA 3TBKA 2VWPA 4X3PA 2A0WA 3OBIA 2GRUA 3F4KA 3C97A 1KDVA 1PQ4A 3GYGA 5B12A 1ID1A 3GEPA 1EJ0A 1KDTA 1THTA 2X8JA 3AW8A 3ST7A 1TCUA 5GV7A 3PNKA 2JI8A 3RNLA 3ZCTA 2P5TB 4LX8A 4AFNA 2SNIE 2BHLA 2BMWA 4L5AA 2DQ4A 4MW2A 1N7JA 2PNJA 1Z3CA 4C7MA 4P3XA 1QOZA 2ZZNA 5DHUA 1LSOA 1ZU4A 2F64A 1A9ZA 5H3HA 5KYWA 3D5TA 2J9GA 4HB3A 4BRSA 1WD7A 2C9OA 4Y0NA 3WIOA 2GZ1A 4PZEA 3WLOA 3F9IA 5ALLA 4US0R 4CLXA 4BFSA 1Q74A 2BISA 4JI5B 3SY8A 1M7GA 1UKAA 2GD6A 2ICAA 3QUBA 1ESZA 2Q2NA 4GVLA 5H68A 4Z3KA 3U7IA 1UFKA 3KJIA 4G8DA 2XMGA 4TQUS 3D1LA 3M4JA 3DPIA 5IC5A 4LFBB 5HOQA 1Z06A 3G6WA 1DKPA 2B1GA 4E7OA 4OHYA 2AFHA 2NO6A 1P1IA 4LGYA 4IYJA 5F52A 1OH8A 2OBYA 3GP5A 4V0KA 4WAUA 1QVAA 3KZXA 1G8KA 1DV2A 2RHWA 4PYNA 1W29A 2OV4A 3DM5A 3DMYA 4H6VA 1J33A 4H7IA 3AWIA 4QARA 1OAAA 2W11A 3C98A 4BNUA 5JV5A 2WTUA 1W47A 2QE7D 2NYUA 1QH9A 3HMQA 1VCOA 3IAS1 3OMXA 3O3OB 2HSEA 4A03A 2J6HA 2PX2A 5B3AA 5I7EA 5K0ZA 4H7JA 4G4SO 1O08A 3V8NA 2GBLC 2IPXA 4FIZA 1JXMA 2C4UA 1SCQA 4DIBA 4AY2A 3KWFA 1PSWA 4DLPA 1GEEA 2Y2UA 5DRTA 4C7VA 2CBZA 3K8OE 5I4KA 1RHJA 1T4CB 3NTQA 5L7YA 2XSZA 4ZT2A 2QJFA 5IH3A 5IJXA 5CDUA 5K20A 5G53C 3LT0A 2IXEA 4MCAA 2Q2WA 3W8FA 1INLA 3BJZA 2QLLA 4ZCPA 1P7YA 2EKPA 2J3QA 4NQRA 5FWNA 1JJFA 4RPCA 2YHBA 2A0UA 5IKMA 1EUCB 1KFEB 2JEYA 2R1VB 3OOSA 4I4NA 3WWCA 4FSXA 5L3SA 3TGPA 1E9DA 2PBLA 4KFRA 2F9LA 4EUFA 2FDXA 1MB0A 3KQLA 5DSXA 5DT9A 4OU4A 2Q3DA 1LNQA 1O87A 2R44A 1WXFA 5I8WA 4PPGA 3O74A 3MJVA 2JD1A 1XU9A 2CYBA 4C05A 1G8FA 4Z4GA 3U9SA 3UBTA 2QR5A 1G20A 5DBFA 2P2LA 4H1HA 2HF8A 4K3VA 3CB4A 3T7JA 3UPDA 4BLUA 4E33A 1M8FA 2OQ2A 4J07A 4L4SA 4H6WA 1TZMA 2H3HA 4CR8A 1Y1LA 4CCYA 1J2RA 1ZKDA 3MBOA 2QTFA 2W2MA 3LGSA 3R09A 1EK5A 3OX1A 3X44A 4DV4B 3P2IA 4R2JA 2WJAA 1DAPA 3KT0A 2QQEA 2OEPA 4JENA 3WSWA 5TR9A 3K0KA 4H3SA 4PICA 3HYCA 5HF8A 3GRFA 3V1LA 3S70A 3ISTA 1YRYE 2BGWA 1RAEA 3QMVA 3Q6NA 4FMPA 4F6CA 4AY6A 3OJLA 1W5SA 1C7JA 3FMFA 1SVKA 3CRNA 2DJ5A 1SUIA 2I7VA 1I5RA 1FTQA 1HFJA 3CLUD 4ISBA 3WYGA 3T5PA 2GHIA 3KBOA 1AA9A 3OCWA 1KNQA 4WCFB 2Z2YA 4J7UA 3D9QX 3AV3A 3RW9A 4X7PA 1HDEA 3LYAA 2O3TA 2HK6A 3VNSA 5DIFA 2QBYB 1C3JA 5K8CA 2CUZA 2I1WA 2RJOA 4WZZA 1BW9B 3B85A 1UXOA 4G56A 3VDQA 3NJ4A 1PBTA 4YRAA 2XLCA 5LB2A 1H2AS 4IFBA 3A28A 4I7EA 3IULA 3NGLA 3T54A 2I2FA 1H1LA 3H5IA 1FC0A 1CIPA 3I9JA 2RHHA 3R5TA 4DCTA 1R5NA 5A3JA 1N6IA 4OK3A 1RQLA 1XVTA 2RBKA 3SIRA 2BMEA 3UHJA 2OMKA 2HO4A 1WEHA 2IPNA 4IDOA 3UHFA 3CZ4A 3IE1A 5EMLA 1B2RA 3A1SA 5B1DA 3D0QA 2FZVA 1J5EB 4FFRA 1ZVJA 1P0IA 1EIZA 1ZBQA 4BNJA 4CTNA 5FUBA 4NATA 3CU5A 1UK7A 2WU0A 2I4OA 3CO0S 1GAXA 3OKFA 4AF7A 1QZZA 2ZG6A 3BFPA 3I62A 3S68A 2CD9A 1HLDA 2IVZA 3E5MA 2H4ZA 4C6HA 3B1WA 4PHGA 4OSOA 5LYYA 1UDBA 1S1CA 2PQ2A 5A9TA 5LBTA 1I6LA 1OYOA 1Q1BA 3R6LA 1LWOA 4ZK2A 4DDHA 4UZSA 1ZXXA 1PJCA 3MJCA 1N2IA 1C9DB 2AW5A 2FPGB 3LLVA 3DKPA 4BNIA 3LBFA 1YRHA 4MYTA 2C03A 1KOGA 4J9VA 3MOGA 4ZYVA 1GEGA 4H6XA 1NMEA 2ZB4A 5ADUS 1W49A 2WJVA 2HPVA 3IAXA 3UB4A 4QBIA 4MP3A 3ETEA 4QFBA 4GGMX 3EF1A 1KYXA 3FYUA 2GAJA 2IHZA 3VR2A 4K0RA 3L4SO 3OG9A 1XDSA 3NM6B 1ENZA 5DW3A 1RMYA 4K9PA 5ALDA 5HDBB 3BF8A 4FKMA 3O8QB 3RK4A 3V8VA 2P40A 4MB0A 2VKTA 5L3RA 2V7VA 3E4CA 3IBFA 8ADHA 5UKDA 3GLGA 3TINA 8LDHA 2BSQA 1UBJS 1CIVA 1T2EA 2BWJA 2VZ8A 3MCUA 2O8NA 3D0KA 2O2XA 5F51A 3D8NA 4DMRA 4A36A 2FK7A 4ZVUA 3ZHRA 4BQPA 1FFWA 2QN8A 3RH0A 1ZJWA 1N75A 5H7XA 3S2EA 2WLTA 4MYCA 1ZONA 3R9XB 3E23A 3QBDA 5KTYA 3BIXA 4PLWA 5IUKC 4YS6A 2D5IA 2XCTB 4TL6A 1BHSA 5C51B 4UZFA 3BGSA 1W4AA 1FYFA 2OGWA 3DE3X 2QL6A 1CF9A 3JQBC 4OYRA 1V2HE 4UOQA 3H2GA 2HA6A 3PXAA 1JE1A 1DIOB 2YJGA 1YS2X 2E1RA 4NMHA 4R54A 4DIKA 2JFWA 4GQAA 3MTDA 1YDEA 1P31A 1EGQA 3DJFA 1WSBA 5FTWA 3B1YA 3VKFA 2I1VB 5A4MS 1TK9A 1CZRA 3EC7A 4KU4A 3T1OA 5IANA 2BFBB 2IX9A 4HH1A 2RHBA 3C43A 1ESEA 1PK7A 1Y4DE 4LJ4A 3EZ9A 3R0QA 4GZ6A 2YRXA 2CNOA 3HZHA 3PUWA 4ENPA 2P1RA 3ZE7A 1CQWA 3MFQA 5A4KA 2HOQA 2XB6A 5DNAA 1GNVA 5NULA 4DT1A 2OM6A 5CJPA 3KB1A 3MJ4A 3FHLA 1M6VA 1VPWA 4W1QA 5C81A 1WWKA 2GYVA 2EFYA 1OI4A 2QVCA 4XGQA 4AYWA 4S1WA 2HO5A 5BSGA 3LHDA 2VJQA 2O2HA 3FNBA 1YNOA 5FFFA 1KWGA 3DDHA 3MLEA 3WO0A 4ZVNA 2ZVJA 4N47A 3V2IA 1VLLA 2O3SA 1P7VA 8AT1A 3PGJA 4M87A 4OL9A 4R7GA 3FI0A 3FPAA 5C4IA 3U61B 3PEEA 3WBKA 2YV2A 1KK0A 4GU5A 1RBYA 3JQFA 1PYGA 3LD9A 1FNNA 3DAPA 2GJ8A 2B8NA 1QGOA 5E0OA 3GJ5A 2AMJA 3AFOA 3Q8WA 6ABPA 3F67A 3IPLA 2VH5R 1OYVA 2Y1WA 1P4HA 1U1DA 3ZE1B 4UTRA 4DMFA 2KQUA 3HCAA 5D1NA 5TEVA 5AR1A 4EK9A 2VPQA 1QKIA 2FSGA 3LHKA 4EPVA 4CF7A 4KH1A 4EG6A 2PLNA 1U2GC 2JFQA 2AN4A 2CHQA 3SS9X 1PVDA 1M6EX 2O0KA 3NBZC 4N5MA 5JCOA 2BE9A 3OESA 1PLKA 3N8GA 4HY3A 4KI7A 4MAAA 2ZDHA 2OSVA 4N6GA 4BUCA 5K8IA 1XZCA 3PEVA 2C2YA 3E1KA 2C5FA 4FMBB 2YOHA 1SHZA 2FAXA 2NXCA 3L1VA 3W3AA 5T57A 3PPWA 1CS0A 2YC4C 4NU0A 1VE5A 1KVQA 3VR1A 4RHTA 2GEBA 1DUIA 3TMKA 3V8RA 1OAKA 2FSPA 2ZJ6A 1P1BA 1EK2A 1Y6FA 1WRBA 4HV4A 3H6HA 1E63A 2WVAA 3RFCA 5KVCA 1NQXA 2A0FA 2ZJ2A 3LCJA 4HDKB 1N8KA 1RHRA 1Z0JA 4D97A 4DG5A 1SUFA 1SXPA 3ANXA 5JR3A 3R3SA 2P78A 4Y1EA 1ECLA 5IK2D 3U4QB 4HGQA 3AKYA 4P58A 2D2EA 5FUXA 2IYTA 1I4WA 2VTKA 5HQJA 2WWVD 4EHFA 1EM8B 1LQUA 4MP8A 1EWTA 1SKUA 2GKGA 3R6DA 4BVKA 4BZZA 4YPVA 1U8UA 1L4EA 2NTNA 3HY6A 4HYYA 3OE7A 2GNPA 3TCXB 4HLNA 4ENRA 1LCIA 3BZUA 4H6PA 1ULBA 4XD7D 2PWPA 2ZVPX 4OQZA 2VEOA 1B00A 5GMOA 1F6BA 1DO8A 2C8JA 3CKMA 4HXEB 4PCUA 3SLRA 4E15A 5HK9A 3LRPA 2FX2A 1SHUX 4KQXA 3IO3A 2GO7A 2PU7A 3TG2A 3WLMA 1MAAA 1VYTA 4G26A 4WY8A 5AI5A 1UK9A 1ODJA 3DD5A 3OZBA 3NGMA 4PIPA 3PNSA 3S27A 2X40A 3VISA 2PT6A 3VSBA 5C5EA 4JLJA 3QNMA 3VR3D 1JFFA 2DUWA 1EWKA 1OA1A 1PQPA 2BZ1A 5ALUA 4RHXA 4FVTA 1KSGA 4AC9A 2DY0A 4G5SA 4TKMA 3NHMA 2P2NA 4QVGA 3FCSB 1NLYA 2V54A 4G23A 3TRDA 2WD7A 4A8TA 4YT2A 2IS6A 2X2EA 3O93A 3MPUA 1WXHA 4U2BA 5ICGA 4N5HX 3J80A 2XDAA 3OZDA 1J2UA 4NF2A 3I39X 3C4QA 1KSHA 1K66A 4I4TF 3AOEC 3RTCA 3TSYA 5JALA 3RIGA 3AQ4A 5KJEA 3WGOA 2FQQA 1FNMA 2HMVA 1Y9EA 3MWLA 4B3IA 1JNXX 1LGYA 1Y8RB 1FBTA 2ODBA 2V1XA 4WBNB 3T99A 3OLVA 1JQEA 2DFKB 3SE0A 2XYHA 4AP5A 4B3HA 4K9DA 3LO8A 1MOZA 2D59A 2DLDA 4EUKA 2XOKD 1SQSA 1X19A 3O4FA 4IXDA 4X6LA 4XCVA 4ZVQA 2IXBA 2O8BB 5F7XA 1TU0A 3MK31 1EDDA 3CLHA 3FY4A 5EP3A 3UAYA 3OOHA 4R8VA 4KDRA 3WWYA 5JS6A 4DPLA 3DZDA 3A6FA 3JSXA 1N7IA 1MMFB 2JJ8A 3GJ4A 3ITDA 3K6JA 4D0RA 2HHHB 2GTHA 3KZMA 1XHLA 2JLRA 1FIUA 2BGUA 1A9YA 3K5HA 2GPNA 3GOHA 3NH9A 4B75A 1NGSA 2G71A 4EW3A 2Z57A 4RL6A 4Q6BA 3GO4A 2HMTA 1NJ2A 2BKEA 2PA0A 5AI6A 5FPYA 1SO8A 2G0TA 4P9NA 3Q15C 4Q9IA 5IAJA 4XOUA 3TQFA 5K0JA 1HE5A 1AJEA 3CFYA 4TTSA 5EJ7A 1NUSA 2G4VA 2P11A 2RBEA 1BQ4A 1TOAA 2FZGA 3DV0A 3H2HA 1JIUA 4I9FA 4M9UA 4P53A 4WLNA 4YFVA 4S12A 4ZVKA 3SX0A 1T13A 1ATIA 4AN1A 1HI9A 3OUZA 4MGHA 4NNOA 4MHSA 1I1OA 3ZXIA 2DHCA 1V39A 5KC9A 3D1VA 3IO5A 4OCZA 1RJGA 3CLVA 4KFSA 4F2WA 3C2QA 3I53A 4MMXB 4X6UA 3NDPA 2VJMA 2VQSA 5BXYA 3T15A 2KSQA 3NOOA 1JX6A 2F43A 3Q0EA 4FE4A 4KL8S 4NBNA 1A1SA 2RAFA 2X9NA 3N0XA 1IIRA 5ENZA 4EEZA 1QO0D 1GUZA 2H2AA 3FRHA 3G2PA 1DCTA 2J46A 1D1PA 2YWBA 3H5VA 4P2GA 1FYVA 1LX6A 3BFKA 4ZEMA 3DO5A 1V8DA 5C8YA 3VO2A 2QN1A 2VRBA 2JASA 1AGNA 2WAXA 2HHLA 1JR3A 2JBAB 1T9GR 2E55A 4ARZA 2QTNA 4QUEA 1ZGAA 4ZOCA 4DWVA 3BHIA 4U7PB 4W82A 1O8CA 1E69A 1VZ2A 2LD4A 3ROTA 1V1RA 1O5OA 3SP1A 2WTNA 4KQ1A 4MI9A 5SYNA 1ODTC 4CKCB 2Z8XA 3KLPX 5A3RA 1RXCA 1PE0A 2VNKA 3IHLA 4LKRA 5F35A 3SMQA 4DSAA 5HW0A 1QG0A 4AG5A 1KU6A 3ADDA 5CDFE 1DKQA 2FP3A 1YBHA 4I6EA 1Z5ZA 3QTBA 3M5DA 4DNXA 2FE4A 4OM7A 1EFRA 1PLJA 4BDTA 2EVWX 3NCHA 1UC5B 1G17A 1Z28A 2K7FA 5SZJA 4A2CA 3U7RA 3LC1O 1NXQA 1TKBA 4HQLA 1EM6A 2YWFA 4JL5A 5ER9A 4YLYA 3ZI7A 5KTMA 2B1QA 4OHXA 2CY0A 1Z5NA 4LXGA 5JWHA 1I30A 1AQUA 3UT5B 1Z25A 1S4QA 4FBLA 4MS1B 3NBKA 4L4UA 4G1CA 3OJOA 2Z58A 1G7CA 1TZBA 1IG3A 3H18A 1IY1A 3O7MA 3OJFA 1U2TA 3KYCA 4IIJA 4RK7A 4R2KA 1QZ3A 1B2LA 3GFGA 3I4CA 3HJFA 5L3VA 5LLDA 2FJUA 1U0JA 2Y68A 3MXTA 4JX8A 5ALSA 5AUNB 5FUQA 1BCSA 2GAOA 1J8VA 5GPBA 3WDMA 4WK0B 3B7GA 2I2WA 2XQVA 1DMSA 3LFHA 1M76A 3G0OA 4MAFA 4OQYA 4L5IA 3VJLA 1YACA 2X7JA 1U8CB 4PC6A 1B0UA 2ECPA 2YY5A 4JP2A 4LXYA 5BSKA 1RMQA 1FNDA 3P20A 1FU7A 2AJBA 4CIYA 3NVDA 3ZQKA 1KKLA 1L5YA 5KVAA 3EH1A 4RHUA 4WNAB 1WDWB 2FLWA 1CDDA 2WC1A 2OAQ1 3JPWA 2RDMA 1ZA2A 3DCJA 3FWNA 3S44A 4MVJP 2XKJE 4GOXA 3EXHA 4MS3B 4UMVA 5MDHA 2BEVB 3S2GA 5CPFA 1ZS9A 4MW0A 2D1RA 3CW8X 4R0VA 2X9GA 2MCFA 1OFTA 1OZFA 1YB5A 3NLLA 3C1AA 4M1TA 2H4FA 5ELMA 5A1JA 2BAGA 2IXDA 3GEMA 4RVUA 5D5PA 3SEZA 2E5LB 3QITA 3CVOA 1VECA 2ZI4A 3LU1A 4NS4A 1F2DA 3VTAA 1H69A 3H8VA 1DOAA 5K0EA 4KIJA 1ZD3A 5JH7B 2E18A 3DHVA 4JVOA 1GU7A 3RAGA 3L05A 1VJ5A 4E6PA 2ZR0A 4FGJA 5BXQC 3AEZA 1CY4A 4MUGA 2WYVA 2EBHX 1KRHA 3U7GA 1ITZA 3ZGVA 1G8PA 1THMA 2PXHA 2YIDA 1VHJA 2QM0A 2CDBA 1RIFA 1RZUA 1Z37A 4O8ZA 1H1TA 4R1PA 4LZZA 1Z0AA 3L4JA 2TMYA 1RXEA 3CLSD 3F5SA 1Y3DE 3W5JA 3ADCA 2HMAA 3C8MA 2EKZA 4HHEA 5HF6A 2WWYA 1MHPA 5IVDA 5JNTA 1ZNXA 1GYRA 5EGSA 3B53X 3DEZA 4TT3A 3ZLTA 3SHWA 1XZNA 4ZCSA 1LNZA 3Q9SA 3DZ8A 3HVUA 4KYIB 2HU2A 4C4PA 5IPFA 2ZIAA 1E1MA 2ZFUA 3V7YA 1XTUA 1WHTA 1DBPA 1F0YA 1HDRA 1T5HX 3C87A 2HH9A 2DH5A 2WA2A 1L5RA 4FHCA 2BP7A 4OQPA 4WI1A 3H4IA 3SZRA 2CJWA 3M4XA 2ZTVA 3O84A 3HBFA 4HNHA 3W6UA 3BFJA 4CQMA 1V3UA 1WVGA 3PCRB 5FR1A 2AQHA 4PR0A 4RPHA 3SDSA 3JCZA 4D4JA 3FOFC 3C3XA 1II0A 2HT6A 3IVAA 2VDMB 1U8ZA 1Q1ZA 1V26A 2HDNB 2XUIA 4GICA 3AR8A 3AEUB 2AOTA 3LXXA 4UMEA 2VVTA 1DJMA 4KRGA 4DKJA 4MJLA 4YLGA 5B3LA 1MX5A 3CW9A 3HWX1 2ZWOA 1RC1A 3GVIA 3DZBA 2H4WA 4MKIA 1EAYA 3ZN2A 3KEOA 1F60A 3DWIA 4MINA 2X8WA 5B30A 4P3OA 4P8RA 5CB4A 1BWPA 1XCBA 2WI8A 2QN6A 3AY6A 5B2ZA 4EH1A 4JV5B 5DOVA 3QQ5A 2PRZA 2VH2A 2I34A 5K8UA 1Z47A 5E8JA 2ZYIA 2G5TA 2OV2A 4F9GA 4O4IA 3KNZA 4KVGA 2C9ZA 2D0OB 4Q5IA 4FNOA 4W7SA 1CNEA 1XEWY 3RE1A 5EWMA 4C0LA 4DANA 4G0WA 1X42A 2DBQA 1FB5A 1R0RE 2P0YA 2FPMA 4PQGA 1L2TA 3DW1X 3ZLBA 3EMVA 1RAFA 3IOMA 3K0FB 2QN2A 2CLSA 4N54A 3SJAA 4TTVA 1UPTA 1J25A 2VSXA 1L4UA 1XNGA 3TE7A 3ZDZB 3S3TA 2WJYA 3JQGB 4LDAA 4EFMA 2WUWE 2FWAA 2ZI5A 1RWWA 1D2CA 3TCKA 1ECPA 1Q7EA 3BDAA 4E5VA 5BQXA 3AM3A 1I9CA 3HUFA 1BH2A 3GJQA 4V2UA 5ER6A 1PR5A 3EC2A 1OJ7A 3GRPA 1L5LA 2NU9B 4F46A 3T4EA 2Z6VA 1T8PA 4Z9YA 1PFQA 3LOQA 1J23A 3LZDA 5IJ9B 4OMDA 1U7XA 3QF4A 5H59A 3H5OA 1VE6A 4ZEWA 3RF7A 2AJCA 3VVCA 3BJRA 1XWWA 2HQBA 4YUVA 3MA0A 3UGQA 4L5BA 3SKXA 3B6EA 2P4QA 2J5BA 4MCJA 3OKPA 3ANSA 2XKAA 5CP8A 2BTOA 1JWLA 2O0MA 1T2VA 3AB8A 4LZAA 2C7QA 1P1HA 2OECA 2XIJA 1ISSA 1D6JA 2CJXA 5JSUA 7REQB 3K9FC 5IF3A 1D2AA 2GJSA 2WG1A 4QU9A 3E9EA 4R0MA 1YONA 3IQFA