5GVRA

Crystal structure of the ddx41 dead domain in an apo closed form
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
234
structure length
234
Chain Sequence
ILVEGDGIPPPIKSFKEMKFPAAILRGLKKKGIHHPTPIQIQGIPTILSGRDMIGIAFTGSGKTLVFTLPVIMFCLEQEKRLPFSKREGPYGLIICPSRELARQTHGILEYYCRLLQEDSSPLLRCALCIGGMSVKEQMETIRHGVHMMVATPGRLMDLLQKKMVSLDICRYLALDEADRMIDMGFEGDIRTIFSYFKGQRQTLLFSATMPKKIQNFAKSALVKPVTINVGRAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable ATP-dependent RNA helicase DDX41
publication title Structural and Functional Analysis of DDX41: a bispecific immune receptor for DNA and cyclic dinucleotide
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 79
structure length 234
sequence length 234
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2016-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5gvrA00
1SQ5A 2O8FB 1L8QA 3BFXA 4OHYA 1EFUA 3SJAA 2R6DA 2J7PD 3HDTA 4QGAA 1NIJA 1HEIA 3IGFA 1NJGA 2R6CA 2VHTA 3RS5A 3VHLB 2CMKA 3QXXA 3K70B 1H8EA 4JIMA 1U90A 2KBEA 3U5ZB 2ZI3A 4TMTA 2X2EA 1MO4A 5C1BA 3HJNA 5F2EA 3WYFA 1IM2A 1S8FA 3QI2A 1QVRA 3BBPA 2Z83A 4QJ4A 1DOAA 1W4AA 1W0JD 4L4UA 1XEXB 4KHZA 3MWKA 2PX3A 2ZJZA 5JWHA 4QBIA 2WJGA 3X1ZA 4TT3D 5CLQA 2LKCA 2YWHA 5FPYA 2ZYTX 2W83A 1CLUA 3BRWD 1MO3A 2QAGA 4P4TA 5JS8A 4TWZA 4V0ME 2IUSA 3HYRA 2GXQA 4XD7A 5L3RA 3MUFA 1CIPA 4DLYA 3LLMA 4M1MA 4HLUC 4B43A 2OLJA 1M7HA 2ZI5A 1GNRA 4IOMA 3BH6A 1KOFA 5SZIA 2IF2A 3DMDA 3ZZUA 3BGWA 1ZC4A 2D3WA 2IHBA 4NCIA 1ZD9A 3A58B 5EXSA 1ZBDA 2B92A 3KB1A 3QF4A 2ZYVX 2YVUA 4IKEA 4CEIB 3TRFA 4N3NA 2WJHA 4F4IA 1C1YA 3UIEA 1EGAA 1R8QA 2A5DA 3VR5A 1KJZA 2BWJA 4OK3A 1T91A 1ZCBA 3UXMA 1OHHA 1QBKC 4DVGA 3RSLA 4PSAA 3C8UA 1HT1E 4D6PA 1AM4D 1G3QA 2FPLA 1W0KD 3RS0A 3ZS9A 1MRNA 1I2MA 3BK7A 4B32A 1TQDA 2HDNB 3K53A 3V4FA 1SVKA 1GILA 1XD9A 3TSZA 4DXAA 3B1WA 3LXXA 4PPFA 2WAXA 1FTSA 2WWGA 2AX4A 1MOZA 3PR1A 2ZETA 4NMMA 4PC2A 3KKQA 4FMBB 2OCAA 1N6RA 2KBFA 3DVLA 3M6AA 3SC3A 3SU8A 1J2JA 1SVSA 3WRXC 3KDSE 4XSHA 2FGJA 5BN3A 4CW7A 1QRAA 1XTRA 221PA 3LRPA 4LJ5A 2IEZA 5JI2E 2F9MA 4AKGA 2OFWA 3L0PA 4G5SA 5UKDA 2OCPA 2XJ9A 2QSZA 3FMFA 1N6LA 1P2VA 1KO1A 2H7VA 4B48A 1UJ2A 1P9NA 4GPTA 2G6BA 3ZGXA 2YKGA 2OESA 3K9NA 3WHKA 4C7OB 1E2LA 1JR3E 2ZYUX 1E2DA 1P6XA 1E1RA 1GRQA 1Q3HA 1GKIA 1DG3A 5HR5A 3X1XA 3PJRA 4GSYA 5FUXA 2KI5A 2Z43A 3T06B 3GLGB 4HI0E 4B2PA 1X1SA 4Q4AA 1DG1G 3MFYA 4QOSA 2D7CA 1KI7A 2V1UA 3U2QA 2J9RA 5FTNA 1ZNZA 4KO8A 3THYA 1FUKA 2ORVA 3DKVA 3TH5A 4Z51A 1N3BA 4LZZA 4KFSA 5CLLA 1RFLA 3TAHA 1N6IA 1HT2E 3GLFA 1UKZA 1RE0A 2QI9C 4M22A 4NPHA 3RLFA 4F91B 3VX3A 1XU4A 3UPUA 4TL8A 2GZDA 1I2DA 4I99A 4AYTA 2REXB 2PEYA 2DY1A 3B1ZA 4QHTA 1CRPA 4R7ZA 1IONA 2OE2A 4B73A 2ZRGA 3BC1A 5JEEA 4S35A 2PZEA 1VKJA 4FIDA 2FSFA 1XRJA 4KCGA 2F9LA 2UVQA 1KMQA 1AKEA 3GLHE 2CDNA 1XJQA 1HTWA 2IYXA 5JS7A 1DEKA 2HLDA 3BXZA 2ZRNA 3CR8A 4M1TA 1N5JA 4M2LA 1G18A 3W5IA 1BS1A 1IN4A 1E0SA 2R62A 3X1WA 1XEFA 4AIIA 4DBLC 3C16C 2J0UB 3N70A 4TYYA 1PUIA 3SQXA 4R2IA 4JZKA 1RIFA 5KSPA 4NCNA 3D31A 1VPLA 1IJEA 4LJ9A 2D62A 1EXMA 3AF3A 1S4QA 5C18A 4RFSB 4YONB 3RS2A 1NBMA 1LF5A 2O8FA 3PQCA 3W8RA 3KJGA 4JLAA 4PFSA 4KFUA 4L15A 3NHAA 4FCWA 1RJ9B 1YRBA 4KXFB 2QTVB 4HLUA 1JAIA 5DH9A 3KB2A 1U94A 3Q5DA 1ZM7A 3LVRE 3G0HA 3VR3A 4Q48A 4QBGB 3OFNA 4Y0VA 1DS6A 2ZAOA 2CCGA 3DZDA 1Z6GA 5LBIA 2F43B 2RGDA 3EZFA 4D4LA 1CR1A 3LBIA 4ZKEA 3L43A 1II9A 2GJAA 1U8ZA 4UXIA 2VHUA 3QXSA 4UKDA 5E7IA 3SBDA 3KKMA 1W36D 1KZGB 4BFYA 1P73A 2X1VA 1UF9A 2AK2A 2CLDX 2AR7A 2FOLA 3I8SA 4CF7A 4HLDA 1SKYB 3TK1A 1AS2A 5J47A 4PANA 4PHFA 4Q4LA 4R2HA 3WY9A 1AQUA 1XTSA 2DFTA 5EXXA 2WOOA 1XTKA 1U9IC 2V6JA 1X8KA 4QC2A 2ODNA 4Q1CA 3TUIC 3THXB 5JJLA 1GZSA 4US2R 4R71A 4TYPA 2X77A 1VHLA 1GOTA 1ZD8A 2Q6TA 3LDAA 3HP1A 4HLCA 4JSYA 2NG1A 3X1DA 1SVOA 1B23P 4NL4H 2MSCB 4M1WA 2Y8EA 3QNUA 2O8DB 4Q21A 1H8ED 1NLYA 2RGXA 5TVKA 1QG2A 1YZGA 4FCVA 3C5HA 2EW1A 1ZNYA 2B6HA 2FFHA 1JALA 1L4YA 1R0WA 4JVNA 4DCVA 4YXWA 1ZIOA 3VMFA 1GP2A 3CBQA 1K5GA 3WYGA 4IW3B 5BYKA 3EPLA 2FDCA 4PZYA 4LPKA 2J87A 3TW4A 3GJ5A 1D8TA 2O0HA 4DSUA 1OH6A 4TYWA 2GVZC 4KFTA 1XBTA 1M6NA 2CJWB 1T0HB 1E1QD 2JA1A 2KJQA 3RNLA 4B3BA 2ZRMA 4XD7D 1E9FA 4B2LA 4EIWA 3KTAA 1R2QA 2IA5A 2FEOA 1ODFA 1G1MA 4BASA 1NL3A 1G8FA 4OI2A 2OXRA 4H1VA 4YDSA 3VR1A 1AZTA 5B2ZA 4P0TA 1LNZA 4W5HA 2RGBA 2Q9BA 1U2RA 3QG1A 2LWIA 1TUEA 2G1KA 1SZPA 4BZPA 1DVRA 4MRSA 2NTYC 5JEDA 2QUZA 5J40A 3H1TA 1KI6B 1DE0A 2AFHE 1OHHD 3LVQE 4DEYA 2PCJA 4TMVA 3KL4A 4MYUA 1UFQA 2O5VA 4HATA 1GTVA 1RYHA 2NPIA 4Z54A 3ZQJA 1XPOA 3M4YA 5DO9A 1YZLA 4LBVA 4I81A 4NYMQ 2C9YA 3NEYA 4TZ6A 1XMSA 3ASZA 3KFVA 1TQ6A 1CXZA 1N0VC 1CR0A 2AWNA 4ERNA 2C98A 2PT5A 2YHSA 4A6XA 4C0JA 4ILEA 5TB5A 3EXAA 1S2MA 1UAAA 3A6PC 3Q8XB 5FL7A 3FGNA 4P33A 3W90A 2GJSA 3ADBA 1OXVA 5K8UA 2O8EB 1E69A 2YOFA 2I1VB 3CPJB 3W6OA 4CEHB 1E1RD 2ZU6A 2G0NA 4NDZA 1U0HC 3SZRA 4FWTA 5DNYB 2J0UA 2GK7A 2OFXA 2XTMA 4MQBA 4A0RA 2D2FA 1D2NA 5GADl 1BO6A 1SULA 4U00A 2C77A 1G7SA 2ZR9A 3K0EA 2QSYA 3CX8A 3BD9A 1HV8A 2IYTA 3H4MA 3ND9A 4RFSA 5CDFA 1EFCA 4M1SA 1LTQA 3AGPA 4A92A 2JIZD 2GCNA 2J0QA 4DT1B 4P3YA 1Q21A 3MWJA 4FINA 4LYFA 4PHTA 3TLXA 2PT7A 1N2CE 4D4JA 2IWHA 4NHOA 2B7CA 3BIFA 1OF1A 1P7CA 2IXFA 1XDBA 1FP7A 1YQTA 1U9IA 3WNCA 2PZGA 2A9KA 2QENA 3NHBA 3T61A 3CF0A 4BFTA 5FH9A 4E07A 3KQNA 3FOZA 4IEEA 2BJVA 2WVJA 2LKDA 1KYIA 2O0KA 4EJSB 2IC5A 1RVDA 4DB2A 3LX5A 2W0MA 2QRZA 1F2TB 2HLDD 2XOKA 1ZD1A 2CBZA 4PO1A 3VKWA 4D25A 5CB8A 1E3MA 4JL5A 2GCOA 1GRRA 3L0IB 1MABA 2BDTA 3K0FB 5EE5B 3BFVA 2EFCB 3U7GA 4YMVA 2VQSA 2C9CA 1Q1EA 4PO8A 1VHTA 3NDBB 1KDOA 3CNOA 3FB4A 4NYIR 1KSGA 4LPSA 1NNEA 2WAYA 3BE4A 3LO5A 4Q00A 4PC1A 5FOXA 1NBMD 5EP1A 3LD9A 5LB4A 4OQLA 5KDOA 2BEJA 3C5CA 1Z06A 3TGPA 2Z6VA 4RZ3A 4Q1AA 4HEJA 1RYFA 1WP9A 5GJCA 3ICEA 2OM2A 3UG6A 1NG1A 3I3SR 2HXSA 4A9AA 4KLZA 2KE5A 3OFND 4WOPA 4OHVA 1RRCA 2GILA 3Q72A 2QT1A 3CLVA 2H5EA 5M04A 1ZC3A 4LBZA 4PQRA 1LW7A 1Z0AA 4HLQB 5FBRB 1VG1A 1KSHA 2WKPA 3D6TB 2AD5A 5HKKA 5EP3A 4JVSB 5DI3B 5TMPA 3H0KA 1F48A 4Q4JB 4C0HA 1L4UA 3AB3A 1WXQA 3T1QA 2HV8A 3CKLA 3ONWA 2GXUA 4DLWA 5KNBA 1OB2A 1S9DA 4OQMA 2ERYA 3JVUA 5DN6D 4G5OA 1WCV1 4KODA 4HAUA 2QBYB 4C30A 5B57C 3K0SA 2FPMA 2J1LA 3QJYA 3RWOA 1IQPA 3QIAA 4G5GA 2PBRA 1OJLA 2CK3A 2R44A 1A5TA 2DFKB 3HU1A 1JQLB 1QHXA 2NO9A 2WWHA 2ZROA 4OHZA 4C9BA 3EIQA 3U3OA 1ZM2A 3QVUA 1IN8A 2ZE7A 4CEIA 4IDQA 1R5BA 1KO5A 1YZQA 2BC9A 3MWLA 2W6IA 4RKEA 4URZR 1W7AA 3VTKA 1LV7A 1X3SA 2GK6A 3AVQA 3IIMA 1XTIA 5EUMA 2EQBA 2BMFA 2JLRA 5JRZA 3AKCA 1ZM9A 3R8FA 3GFTA 1G41A 1TAGA 2XXAA 5L3SB 2Z4RA 4Q7JB 1RW4A 1OFTA 1SVIA 2JJ1A 4Q9IA 1ZM3A 4TLCA 5AUNB 1ZUHA 4GOXA 2GA8A 2CVFA 3NIBA 4A6PA 1CP2A 4YXWD 4LJYA 1ZINA 4RJLA 3GPLA 3AVXA 3AKDA 3W3AA 3QEOA 4C2TA 1U8AA 3EPJA 2ATXA 2GXSA 1E9DA 1SXJB 5CM9C 3W3ZB 2FGKA 1DBSA 5DI9A 1S1CA 2A5FA 4DZZA 3AV0B 1P3JA 3AVVA 4V0LA 1G7CA 4C0AC 1JXMA 3B78A 2O8EA 4JJZA 2YV5A 3A36A 4B6FA 2I1QA 2ZJ5A 2GNOA 2JLYA 4JLJA 2OBLA 2ZUDA 5FOUA 1IBRA 1OIXA 5KNCA 3O8RA 2QY9A 4N1AA 3RS3A 1Q20A 4HAYA 5DISB 2G83A 5E4FA 2ZRJA 2A2ZA 3CNNA 3NVAA 3NKVA 3T1TA 2HF9A 4QJ3A 4DDVA 1E9BA 2ZXUA 4TMZA 4M53A 4G0NA 2PZFA 1GNQA 5FBWB 3VX4A 5CYPA 2QPAA 4GP6A 3AP3A 3U44B 5A0FA 4BFUA 1SXJC 5JSZA 3UWKA 1QHSA 4A2QA 1UDWA 1RRFA 3TUZC 3GQBA 4M9SA 3BH0A 3DEFA 3ZH9B 4OKSA 1II0A 1E96A 4OHXA 3QVVA 3TIFA 1I4DD 4I1VA 2GAOA 5J5CA 4IEIA 1G17A 4DLSA 4UNRA 5JJIA 1KK3A 2ZRPA 1UBEA 3I5YA 3U3KA 1G7TA 1JQJC 2N42A 1HQCA 2XITA 3TQCA 1OB5A 1OSNA 5FL7D 2WSSA 3WBKA 3WNDA 4CGZA 1XTQA 4FI3C 421PA 4B2IA 4CVNA 4MRPA 2G0TA 3BOSA 2BEKA 4GFDA 4Q4HA 5JECA 3IO5A 4JLMA 1OH8A 3IO3A 1SHZA 3IQXA 3NG1A 3UMRA 1IXSB 5K8IA 3K0FA 4GRAA 3RS4A 3TAUA 3GLFE 2VHJA 4B47A 2Q21A 4XWAA 4RD3A 3C4JA 1EX7A 3FWYA 2WJIA 4MRRA 1OXXK 5E3HA 4FMDB 1CJUC 5EXTA 4AKEA 1ZU5A 3F8TA 1I4LD 1FP6A 4IDHA 4ON9A 4WVFA 5DLQC 2F1JA 4HAXA 5JI3E 3E70C 2E87A 3A4MA 1DAGA 4B3DA 2KWIA 3HU3A 3AVOA 3EZ6A 3FKSA 2OT3B 3KJEA 4LHWA 1FL9A 1G8PA 4BLRA 2G77B 3T35A 1J99A 1KO4A 3A1WA 2REOA 1E2KA 1HA3A 3QKRB 2WTUA 3IDQA 1AS0A 2ZQ5A 5DI3A 2VP2A 1WQ1R 4PPGA 1UPTA 5BXQC 2ZJ2A 5AUQA 4KBFA 2GEDA 4Q1FA 3E1SA 2XOKD 3RANA 1NBME 4A8JB 4B33A 2QBYA 1AGRA 1OT3A 2CE7A 2RCNA 2ZRLA 4TSFA 1PUJA 2DPXA 2Q9AA 3LAWA 3AUXA 2W6JA 1E2MA 3NC0C 621PA 4D0LB 2ANBA 1FOEB 2D74A 1TTTA 3T5GA 2GXAA 3CF2A 1C9KA 4D80A 1NN1A 1Q1QA 5HCIA 1G5TA 2DFNA 2X8AA 4QG7A 5J4HA 3V9PA 3OE7D 2HEIA 5HZKA 3PEWA 3TR5A 1RKBA 2ZE8A 4H1UA 3G82C 1G3MA 1KTVA 3VNVA 3CRMA 3ND8A 3OIVA 5AR1A 2O8DA 3KUCA 4LUCA 1FQJA 2ZEJA 2DB3A 3FHOA 5E7JA 4I1OA 1ZRHA 3QPWA 4URYR 1G5PA 2IYUA 4G3XA 1KMHA 5EXPA 4A8JC 3I1FA 1Z8FA 4CDGA 4DEXA 5DHFA 4S2EA 5HKKD 4WAUA 1QHHB 1VIYA 2GWHA 4TQ9A 3TSWA 4HB2A 4PZZA 4F4JA 5G40A 4Q9JA 2A78A 2JLXA 2MMGA 4RCYA 2WKRA 2WPDA 3A1TA 3C41J 2J46A 4RSGA 2DBYA 2DHRA 3MMPA 2EFDB 1E2FA 2ZVQX 2GVDC 1NSFA 3UK6A 4JKIA 1FQKA 1HQYE 4AG5A 4KJZA 1KGDA 2CK3D 2GJ9A 3BWDD 3U4QB 2XSZA 4JLBA 3VR2A 3OZXA 4I1UA 1W4CA 5AJXA 3K70C 1VYUA 1N6OA 2W6ID 5FOWA 1VDZA 3ADKA 1ZNXA 4FMDF 4ESVA 2OAQ1 4FMCB 3ZVNA 1D9XA 5JCZA 1NI3A 5DSZA 5KU1A 3RRMA 2PLFA 2BMEA 4NBSA 3K8YA 3PUZA 3U44A 1DELA 3V00A 3EZ7A 2JJ1D 2G88A 3AF0A 4DDTA 4NCJA 1A82A 3K9HA 5C4MA 1UBCA 5JRJA 4LY6A 3SJZA 3FMIA 4PZLA 1U0JA 4WZBE 4MKHA 3PXGA 3IKJA 1E32A 4K8OA 3DOEA 5FTLA 4DIDA 1IN6A 3LFUA 1HYQA 4IFEA 1CR2A 1I4TD 1NVVQ 3DOFA 4O25A 4EQ6B 2VF7A 1U81A 4L5BA 4PX9A 2FZ4A 5L8VA 2HUPA 5IF9A 4AD8A 2MMCA 4U02A 2AXNA 2ZPTX 2ZITA 1XXHB 1VCNA 1LS1A 2BJWA 2VHCA 3IIJA 3OEHA 2F7SA 4BFSA 1NF3A 3EIHA 4CRWB 1OYWA 1GIAA 3O8CA 2JLVA 1FX0B 3NWJA 1O3YA 1S3GA 1LFDB 2FU5C 5GJBA 2TMKA 3KX2A 1G9XA 2ONJA 3UANA 2CL7X 3GMTA 1JB1A 3KKOA 4IOJA 5KDDA 2J5XA 2JATA 1XZQA 5G41A 5FBVB 1FNNA 121PA 1HUQA 4NYMR 4ZDWA 1CKEA 4G5QA 2GBLC 1CRQA 1VIAA 1JECA 4C0BA 1IJFA 1GKUB 1KZ7B 1AN0A 1YR6A 5D3QA 4G5RA 4W5WA 1KK0A 4HZIA 2YOGA 4C3ZA 4PQFA 5EZ5A 3OAAA 3WRYC 2P0EA 1P61B 2DCUA 4KVAA 2K5UA 1BKDR 2C8VA 1G8YA 2QQ0A 1W46A 5IRCD 1X8LA 1RPZA 1P2SA 2C96A 5J4VA 3QEJA 5FI1B 2ZRAA 2G1JA 3OIUA 2ZSDA 4M1OA 3AP1A 4M0LA 4TLEA 2WSSD 1S0UA 1SVLA 3QF7A 2H1LA 2FE4A 3VKGA 5JZVA 3CNLA 1NMYA 2IT1A 3UMSA 4NKRA 5F9FA 3CWQA 1AQYA 1Z0KA 2ZS9A 3SJBA 5CDFE 2P6RA 3EIEA 1BIFA 2GZHA 2OAP1 3HPRA 3S1AB 3QE0A 4A0GA 4DCSA 1W4BA 2XGJA 4FMCF 4M8NE 3ZD6A 4URUR 1NN3A 2ZE5A 1W44A 4BLOA 4LJ6A 4QBHA 5P21A 2R2AA 3TVTA 1KI4A 2OFOA 4TYQA 2QM8A 4C2UA 3PUVA 5L3QB 1R5OA 2NQ2C 2FSHA 1YZNA 2WJYA 1GWNA 1E0KA 4HUTA 2W2XA 5G53C 3CF6R 1KSJA 5F9HA 1D2MA 2REBA 5EUQB 1F5NA 3W9YA 4DLUA 2P5SA 2Q3FA 3HR8A 2IUTA 3FKSD 5K8LA 3AVPA 2IXEA 1F6BA 2F1RA 1R6BX 2V3CC 2IYZA 5FOTA 4V0NA 2KSQA 1N6PA 4BQSA 5BW8A 3CH4B 2NPFA 3BS4A 4D82A 4ZIRB 1QHHA 2JLWA 2IYSA 1N5IA 3UG7A 1XEXA 2C04A 2OILA 3LBNA 2NOAA 4BLTA 3LXRA 2BCJQ 2ZRDA 3ETLA 5JHGB 3ZIAA 4DCTA 3FHCB 2QPTA 2P3SA 1WBDA 4TSFD 2HF8A 2P6NA 5AUOB 4GOJA 4YMUA 2A30A 1CEEA 4XJXA 2LCFA 1Z6AA 2XNSA 3K0CC 3O47A 4JSTA 4KBGA 2EWWA 5TV2A 2IBMA 4KSCA 3OIYA 3LW8A 1DAEA 3H86A 3X1YA 2ZR0A 2D06A 3MD0A 5AK0A 5CK5A 1IY1A 4FCTA 1CS4C 4HSEA 1GUAA 3BJIC 4MKIA 2VH5R 3W6NA 2CLSA 2VP0A 1DAFA 4EPRA 2JLQA 4BE7B 2WWXA 1ZU4A 4NYJR 2JEOA 2DYKA 4EAQA 3EC2A 5BN5A 3L82B 4E09A 1GFIA 4IJMA 2BVNA 4HAZA 2BM1A 3KXKA 3JZAA 2IW3A 4QKQA 1DO0A 3I73A 5CK4A 1G6HA 1YKSA 3BB4A 2ODWA 2P65A 3CO5A 4MGZR 3SOPA 1B0UA 4IRUB 4PC7A 4Q7KA 4EQ6A 4AY2A 2GRJA 4BEJA 3MJHA 1XXHA 2RGEA 2ZE6A 3EWAA 3GEIA 1MO6A 2GHIA 4XVQA 4QM6A 4Q1BA 3R9IA 1FX0A 3KXLA 2FNAA 2XSZD 1AA9A 4C7OA 3Q9LA 1NY6A 4AYWA 2XZLA 2N46A 3EZ9A 3TE6A 3GJ8A 1WB9A 4Q7LA 1YE8A 1XCPA 1TF5A 2UKDA 1OH5A 4Z8XA 3EX7C 3GLGA 3CM0A 3DMNA 1W2HA 2QMEA 1KNXA 1NKSA 2RGCA 4PHGA 1A2BA 3EPKA 4RCZA 3P27A 3KQHA 2BBWA 1XD8A 1OYYA 4Q01A 1G8GA 1JNYA 1G7RA 3U3JA 2AN9A 4WA7A 1ESNA 3GEHA 4YMWA 2R65A 4RZXA 4WZ6A 3ZVRA 3AVYA 3SFZA 1CR4A 1LB1B 5FI0B 2ZSEA 5EE9A 4AKHA 1Y3AA 1Z3IX 4XIGS 2F6RA 4B74A 1II8B 1CJTC 1J90A 2OV2A 3DPUA 1ZCAA 2WJVA 5TXGA 4CT5A 2JJ2A 3N2EA 4A4DA 3IEUA 4BRUA 3AVTA 1JR3A 4NZYA 3GEEA 2XTNA 3ECCA 3OEHD 1YRAA 1IY0A 4QGFA 1QHGA 3LA6A 5SZJA 4TTRA 4C0KA 3HR7A 4NE2A 4DJTA 1YZTA 2A5GA 4JL8A 2GETA 3ADCA 1YZKA 2FEMA 3K0AB 3LBHA 3PVSA 3V4RA 4W9MC 2BOVA 4PAOA 1E79A 3KQUA 1TPZA 4DCUA 1BH2A 4BRWA 4JLOA 4KITB 1R8SA 1HE8B 4IVPA 2ZSFA 2D7DA 5L3QA 1Z0JA 2BIFA 1RJ9A 2ZJOA 3SS8A 3PITA 2J59A 3OAAD 2P6UA 2ECKA 2V7QA 3NC1C 3ZS8A 2QTHA 1T5IA 1W5TA 2UZ3A 2RGGA 3DM9B 3FDIA 3K0CA 4XH9B 4BFVA 1U99A 1YZUA 4E5UA 3ZQ6A 1XEWX 4CT4B 4ZDIA 4X8HA 3VR6A 1XPUA 3SYLA 3Q85A 3QKTA 1TEVA 3RABA 3GP8A 3B2EA 4TQAA 2F43A 3LY5A 1Z6XA 1KKMA 4I1SA 4YMSA 5DGXA 5FBLB 1S9HA 4B3XA 4ZIRA 3PCRB 4AI6A 4FWIB 4XVRA 4D0GA 2IF0A 3R7WB 1Z22A 3ASYA 3CRQA 4PAQA 5HCNA 1ZVQA 2DWOA 3CX6A 1E2NA 3WHLA 4A82A 2Q3MA 5G3YA 2O8CB 1E4VA 5G3ZA 3P4YA 3A1UA 2VLIA 2P67A 4A15A 4M1YA 1G5RA 4B71A 1PLKA 3SEAA 2QEQA 1FZQA 3TUJC 2VP9A 1KK2A 4KI0A 3TW8B 4PTLA 1L2TA 3A8TA 5A4JA 4MYCA 3DKPA 1A4RA 5EZ6B 4RD1A 4LYHA 4ZCLA 4LHYA 2FJUA 2QT0A 3THXA 2VF8A 1N5LA 3MG9A 3EW9A 4LHVA 2X2FA 1F2UB 3K9GA 4WW0A 2CCJA 1EX6A 1X6VA 2B21A 2DWPA 4DLZA 4TL9A 1D6JA 1KAGA 1FFHA 1WRBA 2PLRA 2Q0HA 3DM5A 4HB3A 4IXMA 4Q19A 3FFBA 4KSBA 1OE0A 2GEVA 2NO7A 2AHOA 1Z6TA 2VA8A 4EJSC 4EPTA 3K70D 4QGHA 5BQ5A 4LYAA 4F38A 721PA 1NJFA 4B3GA 4K46A 5AJZA 1QHYA 3LH5A 4M1KA 1HURA 1E2IA 3JVVA 3VAAA 1IN7A 1Z0IA 4YDHB 4B75A 4DDWA 2OUKA 1ZW6A 2V6IA 1G4AE 1FMLA 2CJWA 4TQUS 3ZZ0A 3ZIAD 3U61B 3WMFA 4JLDA 4NYJQ 2J7PA 5LB2A 3BH7A 4TL6A 4BEBA 1Z5ZA 5FUVA 3P4XA 4JL6A 4DSOA 4UNPA 5JWRA 2AKAB 3EAQA 2H8KA 4NU0A 4G1UC 4ZV4A 1D2EA 1NSTA 2OO7A 5KPJA 1R4AA 1V5WA 1Z2AA 2ERXA 2NGRA 3EZ2A 3FTQA 3NBFA 1BYIA 4IVRA 2CLCX 1TU4A 3FMOB 2RHDA 3SN6A 2ZJBA 5FTKA 3AF4A 5H70A 4ABYA 5SZHB 2ATVA 2HCBA 3A1SA 3PUYA 4AWXA 3NBXX 3K1JA 5JWOA 1W36B 1G3UA 1UEJA 3F5FA 5HTKA 1KI6A 5TARA 2N1BA 3LLUA 1KI1A 1KJWA 1CJVC 1Q44A 2Q9CA 1Q22A 3M0EA 4I4LA 4UQOA 1GL9B 1WF3A 1JJ7A 1TF7A 5EP2A 4PPQA 1Z47A 1GAJA 2B8WA 1EG7A 4MGYR 3GJ0A 1J8YF 1P2UA 2P2LA 4D4KA 1FNMA 3LWNA 5FBQB 4DWJA 2NIPA 1ZP6A 2IS2A 2H16A 2BCGY 4LJAA 1XX6A 2GAAA 4DUGA 4Q66C 4URXR 2ODBA 4Q7MB 4PXAA 2BBTA 4GNKA 4JS0A 3FKQA 3SDZA 3F0TA 3LV8A 4AG6A 1II8A 2YC4C 1E9CA 2YWGA 2BMDA 4Q03A 5CIWA 3MRSA 4PR0A 4KLNA 2VBCA 3WMGA 2AXPA 3PEVA 1Z2CA 2IYWA 1EK0A 1W36C 4YMTA 1A1VA 5KNDA 3K09C 1E0JA 4P31A 2QAJA 5GJWC 2J45A 2ORWA 4CEHA 2VIIA 3IBGA 3MJRA 4L9WA 4MYHA 4LSGA 3K0AA 4US0R 1JAHA 1GITA 1JPNA 3M1IA 1KI3A 4TL7A 2WV9A 1T4GA 2ZUBA 5AJWA 2QU8A 3AKYA 4DC9A 4ARZB 1ZJ6A 2XJ4A 1E2EA 2VP6A 1T3SA 3QOFA 2A7QA 4MRNA 3N5CA 4M21A 1R5NA 1NVVR 1NRJB 1YJ5A 1R0ZA 2F3RA 2H17A 3CONA 3GJ3A 3HU2A 3HWSA 1SHKA 1Z0DA 3PENA 3WMEA 2HJVA 4DT1A 4JLPA 2H92A 4HDOB 2ZRKA 3SE0A 4TN1A 1U0LA 5JMTA 2BM0A 1U98A 2O0JA 3FYHA 4ZO4A 1NMXA 1W48A 3D7MA 3P26A 5FL3A 2FPKA 5FUYA 3QXCA 3FMPB 4TZ0A 4DHEA 1XCGB 2YC2C 3QF4B 3T5DA 5KSYA 4WIAA 4H9GA 2P5TB 2JJ2D 2C2HA 3TNFA 5EE0A 2R6GA 2GKSA 5FOSA 3R7WA 4EPVA 2QTFA 4KVGA 4EJSA 2H18A 5IHPA 1EWRA 1OKKA 2OZEA 5A5GA 1N0UA 1ZUIA 5EE3A 2Z4SA 3W34A 1F2TA 3BB1A 4TLAA 1Q3TA 1SVWA 2MSEB 3H84A 5TY0A 1DTSA 4P4SB 2V54A 3L8ZA 2FH5B 2CL0X 1OXSC 1XF9A 1E79D 3NXSA 1KI2A 2IXGA 1NG9A 3GLIB 3KXIA 2EYUA 2QMOA 1Q0UA 5CJ2A 3KQKA 3RVBA 1MR3F 3SYNA 3I62A 3T1OA 4RY2A 4OI4A 1PLJA 3IIKA 4OJQA 1G21E 5KHOC 3AKEA 3B6EA 2GDJA 4MDFA 5JFGA 4RZ2A 4DLVA 1Q12A 1SGWA 4TMKA 1DO2A 1E6CA 4F93B 2Z0MA 3QKUA 4DIEA 3RSOA 4X8LA 4IFBA 1XMJA 1IOZA 1Z08A 4XTRA 2ZM5A 1E9AA 3QG5A 4NTZA 1UM8A 4DSNA 5JHHB 1DPFA 1OXUA 2QL6A 3A4NA 3T34A 1ETUA 1F3OA 1G20E 1M2OB 4Q4AB 2XB2A 3U7EB 4O2LA 4BZXA 1XNJA 4ESHA 4A36A 1AIPA 3NBZC 3IHWA 4XWKA 4Q4JA 4HDQB 4MH0R 2ZI9A 1N6NA 2ZRFA 3CRW1 1XB2A 1UBFA 2R9VA 2ZANA 3IUYA 2NO0A 1QVAA 1E4YA 1M8PA 5BN4A 4TTQA 2EFHB 2IS1A 4Q5IA 2F55A 2CXXA 3AGQA 2QP4A 2ANCA 1E2JA 2ONKA 1COWA 2BHRA 3WXMA 2IL1A 2JLSA 1XJ0A 4EFMA 1J70A 2ZU0C 2CHGA 3L0SA 1T8UA 4O2RA 1KI9A 2QG6A 2FN4A 4DDUA 4NONA 4V0OA 3FE2A 2QE7A 4JJKA 3SI7A 2FSGA 5J4KA 2WWYA 4Z1MA 4QGGA 4DLTA 3K09A 3LQQA 1VTKA 1KY3A 2RGNC 2FV8A 4A2PA 3T1VA 4MITA 5KYKA 5L3SA 4QNMA 2SHKA 4HZUB 3QY0A 1VCIA 4P32A 4K81B 1HE1C 1OLOA 4UNSA 3TKLA 2OCYC 2AL7A 3Q5EA 4RD6A 4EFNA 2BBOA 1E2PA 3EWSA 3RS7A 3SHWA 1Z29A 3KFXA 1S3SA 3OIWA 1ZUNB 2GESA 2WWFA 1MH1A 1OW3B 1SXJA 1DARA 1R0YA 1TQ4A 1DADA 4JBWA 4RD2A 4UXHA 4F92B 1RRPA 2W00A 4OYHA 1VMAA 1A7JA 2FSIA 2RAPA 4ASUA 2G3YA 1IXRC 4L16A 5EJEA 3C14C 4Q47A 4RD4A 2YJTD 2GF9A 4LHXA 4LOAA 3W5JA 1P62B 1KKLA 2FFAA 2HYDA 4MA4A 5F98A 4RVCA 5B64A 5IK2A 5KSOA 2XZOA 1WA5A 4N0EA 3BERA 3VFDA 4UJ5A 2IS4A 3GFPA 2NZ8A 1P60A 1WDTA 4V03A 1Z63A 1E1QA 1TX4B 2RB4A 2B7BA 3DDCA 2OHFA 4R98A 4ARZA 2AFIE 1XMIA 4DSTA 4MGKR 4P4UA 1R0XA 4Q1DA 4GP7A 4N0DA 1NIPA 2QP3A 2ZAMA 1G3IA 3QKSB 3I5XA 4PSVA 3P1JA 3GJ7A 1FW6A 2ZJAA 4JT2A 1XXHE 3AUYA 4QXAA 3BB3A 4DUGD 1Q1ZA 4Q9LA 3ZVMA 4OI0A 4EDHA 3WP1B 4CEJB 2JAQA 1E99A 2C5LA 3WP0A 1UBGA 2MSDB 3RC8A 3T15A 1FPMA 2WZQA 2BKUA 1XP8A 3QSYA 4AKIA 1XJCA 2A5YB 3GLGE 3B9PA 1KDPA 2R6AA 2CNWA 2A5JA 8OHMA 1UEIA 2B8TA 2C99A 5B58C 4HAVA 4OK5A 5LD2B 2ZI4A 1SKQA 2WSMA 4LBWA 3J81k 1TU3A 5CB6A 3FHTA 4P4SA 5CM8B 4KAXA 3R20A 4EPWA 1IXZA 1T3LA 3GLIA 3CB4A 4GT1A 1G64A 1QHNA 1MRSA 5FR2A 2DR3A 2ZI7A 1YHNA 4TYNA 3KTAB 4PQYA 4GDFA 4IHQA 1RRGA 3VNUA 2C78A 2IYQA 3U3MA 1UADA 2WHXA 5J4LA 3NTUA 2GF0A 1HY3A 3IEVA 1P4SA 2QORA 3F3YA 1OIVA 3CZQA 2NMVA 2BMJA 2PL3A 3QXJA 3FFAA 4OQXA 4B3CA 1P75A 5BWMA 1OFHA 2IS6A 5LD2C 5FFMA 5IDVA 3B1VA 2RMKA 3RRYA 1EESA 3QKRA 4LJ7A 2QP9X 1M1YE 2RGNA 2H57A 3I8XA 2WICA 2WIAA 1Z83A 4PC6A 2OXCA 3MCAA 4KFRA 2HJGA 4OQFA 1OKKD 2JIZA 1WMSA 4JVLA 1K8RA 5LPNA 1NLZA 1K5DA 2J0VA 1SVMA 1GL6A 2VO1A 1ZYUA 2ZUCA 1N5KA 3DZ8A 1CULC 4POAA 3SYKA 2D2EA 3RYTC 4BWYA 3UATA 4A8JA 4HUQB 2BV3A 1X86B 4IOKA 4MGIR 2QMUA 3CH5A 1TL7C 4QBFA 3QPVA 3PIRA 5HE9A 5SZKB 1DAIA 4US1R 1TUIA 3W6PA 5IT5A 4U7DA 2PJRA 1Y63A 2PEZA 3B13B 1RC8A 4CIDA 2AK3A 4BLPA 1ZM4A 3QBVA 4PO9A 2ZS8A 4F7WA 2ZTSA 2AKYA 3CRVA 1J8MF 1VG0B 1W47A 2F3TA 4GBMA 4GL2A 3RC3A 2WMOB 5H1YA 1AK2A 3LQRA 2V1XA 4JYBA 3SNHA 2VSXA 3AP2A 3BORA 3PEUA 1VG9B 4V02A 4IDOA 3WYAA 2OLKA 1AGPA 4LJ4A 3VQTA 1CJMA 4HZUA 2D4HA 3B82A 4TTPA 4OQNA 4BPBA 2W0SA 4JBXA 1WE2A 5ELXA 1ZNWA 3PUWA 3SJCA 5DIFA 3VR4A 2V8OA 3GLHB 2VP4A 2KB0A 3OESA 1SKYE 4HDCA 2IK8A 4DCNA 4MUBA 4YQFA 1H8HA 2X19A 4PAMA 5J4YA 3X2SA 3A4LA 2JJ8A 4R9UC 4DLRA 2YYZA 4DRZA 4QL3A 3O8BA 2FX3A 3AH8A 1Z6YA 3PFIA 4NH0A 3TJZA 2XB4A 2IYYA 2IWRA 2FMXA 2I3BA 3AF2A 2JGNA 1E98A 1TEXA 4LV6A 1U8YA 3REFA 3CW2A 4FN5A 1GM5A 1W2GA 1KHTA 1COWD 2W6JD 1YU9A 4ACAA 4EFLA 1F60A 3U4QA 3QBTA 3U7HB 1NN0A 3B7GA 1MO5A 3EA0A 4GMXA 5C2JB 1P5ZB 2VL7A 2AWOA 2QE7D 3GJ6A 4JVMA 1JPJA 1OFIA 3DO6A 4M9QA 4Z1MD 5EQTA 3WBJA 1IHUA 2HT1A 4JLVA 2VPPA 4Q02A 3AVWA 3QUSA 4A0FA 1T6NA 1TMKA 3VKHA 3B1XA 1LVGA 5DN6A 1KAOA 1NY5A 2QRNA 2GCOB 4LYJA 5KUTA 1MABB 1KDRA 4GMDA 4LDJA 1JI0A 4TMWA 2WIBA 3QKSA 2EFGA 2ZRBA 2PMDA 2XNDA 1D9ZA 4LJ8A 2WJJA 1G4UR 4GOKA 5KPDA 3MSXA 2VSOA 3EASA 3MLEA 1A2KC 4V0KA 4V0MA 2GBLA 5FOVA 3Q3JB 4C0SA 3ZVLA 3LX8A 4CEJA 1SXJD 1BMFA 4E03A 1HH4A 1FTNA 2RGAA 2WMNB 2WPDD 5L3VA 1RZ3A 4PHHA 4ZCIA 2G9NA 4ASUD 3RHFA 2IUUA 5FR1A 1WBBA 1EFRA 2JCSA 2CHVA 2ZRCA 3CR7A 3C15C 3IQWA 5CYOA 3RWMB 3UMFA 1Z0FA 2PH1A 5IK2D 2HXYA 4A0HA 1EFTA 1GKYA 2QQEA 3H2YA 1VECA 3HPQA 3ICQB 5AUPB 5C46F 2CVHA 4JT4A 2XEXA 2WOJA 1E2HA 3R9XA 2IYLD 3AQ4A 4EPYA 4OBEA 1PZNA 4W7SA 2L0XA 3GFOA 2PX0A 4UNQA 5FPHA 4C4PA 3VU9B 3I4LA 1NKTA 2IYVA 1Q57A 4UJ3A 2CEAA 5GJVC 1GRNA 2V4ZA 1TF2A 4HYYA 3U6BA 1JJVA 2CE2X 2C9OA 4ZI3A 4Z8YA 4JLNA 2QNRA 4O0MA 1VCMA 1IN5A 1GDDA 3CPEA 3IILA 3Q7PA 5H8WA 2VTKA 3DHWC 2ZRHA 4WXPA 1AKYA 4Y0AA 2RHMA 4Q9KA 4ZPXA 1KIMA 4XWOA 5D3MB 4XTCS 1LS6A 1T8TA 2XXAB 2ZREA 4J0QA 4D4MA 2CNWD 3E5HA 4L8GA 4LRWA 3SHFA 5KOYA 1Z07A 2C03A 3NH9A 3NH6A 4AYXA 3OHMA 3FPAA 1T5LA 4NCHA 4HUQA 1E9SA 4AC9A 1VYTA 1G6OA 3O8DA 1AS3A 2WKQA 2XZPA 2ZYWX 3S1AA 3ADDA 2OG2A 1N25A 2ZS7A 3KZ1E 3B1YA 3EC1A 2ZI6A 2YZ2A 1XMVA 2NO1A 2ZRIA 1X1RA 4CYMA 1OPXA 4NP6A 2WWWA 2ZVPX 4JBYA 5FPTA 5JJKA 4IVQA 1UDXA 2BKEA 3THWB 3CUEF 1P72A 4LHZA 1AZSC 1L7VC 1E2GA 3OEEA 5KSZA 2FG5A 4MYTA 4PSKA 1JBKA 4QHSA 3FVQA 3PUXA 3P32A 4B3FX 4DB4A 2J7KA 2O52A 1R10A 521PA 1XFAA 2DWQA 5EE1A 5BYJA 2J41A 1IY2A 3GLHA 3KUDA 1BOFA 2YWEA 5HPYB 2FA9A 2FZLA 2IHYA 4DLXA 4BLSA 4FXPA 4RZUA 3N2IA 2VYFA 4B44A 5JSZB 1G16A 5DYIA 1NVUQ 1JEDA 3B60A 1VYVA 4BGDA 1E9EA 2QA5A 1PVOA 4GZLA 3QXHA 3IPXA 3R8CA 3AVUA 1BYUA 3K9LA 4OK6A 1Z28A 5HZHA 3CX7A 1K6MA 5DE3A 3B9QA 3W8NA 3NDPA 3ZZTA 2A3RA 3UKDA 2VRWA 4L9SA 4YC7A 3SBEA 3PV0A 3KJHA 2FFBA 3T12A 4BFXA 1NP6A 4ZDJA 2EU8A 4MKFA 2JDIA 3TMKA 5FPKA 1OFUX 4B76A 2C95A 2W58A 1G291 3SFVA 4Q4HB 4ZDKA 4X8OA 4XSGA 4F4CA 1M34E 1N0WA 1ZAKA 5CJPA 1G8HA 4OL0A 5E95A 1KSFX 1OIWA 1S96A 1JEEA 4HAWA 1VCOA 2CHQA 2EVWX 3L0OA 4EKDA 1KJYA 1KI8A 2GJ8A 4LWZA 1ZMXA 4D2IA 2GCPA 3KJIA 4QJ5A 4KU4A 4WBSA 2E9SA 3GD7A 5CIQA 2E1RA 4PC3A 5ANRB 1H8HD 1ESMA 4A1FA 3IBYA 1MV5A 4W5JA 1P9WA 1CTQA 3LNCA 4LGMA 2O8BB 2R8RA 4E22A 3CZPA 1GNPA 1W49A 4AURA 1KO8A 4U5XA 1QF9A 4BFZA 3GCGA 1T0JB 1DAMA 1DAHA 2J3EA 1E94E 5AJVB 1YR8A 3OE7A 2ORIA 1LF0A 3E2IA 2QZ4A 3CWZA 1QHIA 3EPHA 1M7GA 2FWRA 2CL6X 3AEZA 3CIOA 1O87A 3NEJA 3D3QA 2IYRA 4UNNA 3I92A 4LC0A 2YOHA 3RAPR 5GVSA 2RKOA 2YNMA 1YR9A 2ZIAA 3QQ5A 2FF7A 4M9XA 4BZQA 3U3RA 4KYUA 1XD2B 3VHXA 3U6KA 1W0JA 1XZPA 5GVRA 2GZAA 1CU1A 4RKFA 2UZIR 3D8BA 4TT3A 1XCMA 1FUUA 3EARA 2DFLA 3SQWA 2AD1A 4LI0A 4B34A 4M4SA 3VU9A 1D5CA 1PLLA 1SXJE 1US8B 2FFQA 3QPUA 1XTJA 821PA 3KKNA 2XNDD 3P20A 3PG5A 4MDEA 2EYQA 2NO6A 1JXOA 3GJXC 4BUJA 1G3RA 1PJRA 3B85A 4QNRA 4ACBA 4DKXA 2GTPA 5FTMA 2ZSBA 3TR0A 1ZIPA 4PPNA 5LDDC 1BMFD 5AWFC 3KQLA 1EFHA 3AM1A 2QN6A 1TADA 3EG5A 4IDNA 5C4GB 4HB4A 2ASEA 5KTYA 2QROA 4TLBA 1NLFA 5D3MA 4D0NA 4ZKDA 1AJEA 4JLKA 2VP5A 4WZAE 1KO7A 4IOLA 1NMZA 1EFRD 4FD2A 2WWIA 1W0KA 2ZJYA 4X8MA 1OH7A 4JKYA 4ZCMA 1G19A 1KMHB 3RRNA 1NN5A 1N6KA 4JYCA 2J0SA 3B5JA 1CF4A 1M74A 1M7BA 3ZDQA 4BFWA 4MKGA 1IAQA 1ELOA 3PEYA 3RRZA 4QRHA 3MGCA 4Q9HA 2QAGB 5DHAA 1OV4A 4EUNA 1LY1A 3EA5A 4XOIA 4D81A 3THWA 2PCLA 1XPRA 1NVXQ 2ZR7A 2QMHA 1C4OA 1CJKC 1H65A 2IEYA 1GVNB 2OBNA 2QM7A 4RFVA 3TSOA 4EPXA 4LK2A 2V55B 4II7A 2Z5FA 3LW7A 2V9PA 4M9ZA 1MT0A 1W5SA 2JLUA 1YVDA 4IXNA 4C0LA 4TMXA 4LX0A 1X8JA 2BBSA 2ZJ8A 1NVWQ 5H68A 4A2WA 1UKYA 3RDPA 1W4RA 1JR3D 3BFKA 3C7KA 3GLIE 3TQFA 2IX3A 2O8CA 2QAGC 3G5UA 4RD0A 1FMJA 5JLJA 1E2QA 4XVUA 1JR6A 4IDPA 4CZ2A 1T3HA 2PMKA 5K8TA 4O3MA 2HYIC 3HYTA 1N6HA 3ZD7A 1ANKA 2QPOA 3AF1A 3Q7QA 4LV5B 2W2VA 3SR0A 1TQ2A 1UKVY 3THOA 2JASA 3ZYCA 3BAFA 3A37A 4OHWA 3L2OB 2EWVA 4NCKA 2RH5A 1KK1A 2WBLC 3IPYA 2WM9B 1E9RA 1F2UA 4C0QC 4WXRA 3CPHA 2YWFA 3ZLJA 3OEED 4LCBA 2R6FA 2V7QD 3I61A 1J7KA 1KY2A 2XTZA 2ZSAA 3KKPA 2HCJB 2YINC 3A1VA 3MAAC 4GI7A 4QHYA 5TDHA 3TBKA 3UWOA 4G01B 4OJKA 3ZJYA 2JLZA 2ODEA 1PV4A 5B30A 6Q21A 3NBYC 1QG4A 2OEPA 5KO2A 3WNBA 4B35A 5HE8A 2GJKA 1OXTA 4GZMA 1TNDA 1V43A 3OF5A 4HB0A 4OI1A 1QZXA 3I32A 5CITA 3U60B 2O8BA 2VSFA 3U7FB 2QGZA 1EWQA 4MUAA 3THYB 4ZI2A 3R9WA 4Q18A 4URVR 1W1WA 2I4IA 1GL7A 5FTJA 4BECA 1S1MA 1QDEA 2OSBA 1KNQA 3GLFB 1YR7A 4NYIQ 5DYGA 3JZMA 4JMPA 2XX3A 2OCBA 4Q1EA 2OBMA 1CBUA 2XAUA 2NZJA 2F1IA 1R7RA 2VEDA 2PJZA 4UXJA 4BLQA 3MWYW 2JDID 4QFMA 1XWIA 1T9HA 4URWR 3DL0A 5FPSA 5FUWA 2HT6A 1ONBA 1XD2A 5EP4A 1KDTA 4B6EA 4FW9A 1E0AA 4LBYA 4MRVA 1DAKA 3REGA 5JBQA 5KDLA 1GG2A 3L8YA 3TVDA 1XEWY 4KV9A 3I72A 2F1HA 2VHQA 3CRRA 4LC1A 4LV8B 3B8HA 4YLGA 1MKYA 1UKEA 3GJ4A 3IHLA 4QM7A 1US8A 3QENA 1P9RA 4D26A 1VG8A 2W2TA 5F3WB 1GSIA 1P2TA 1Q1BA 2CCKA 4ITRC 4AK9A 5AJYA 5JCPA 4KYIB 2Q3HA 4TLDA 5E7MA 2QGNA 2GEUA 2EFEB
chains in the Genus database with same CATH superfamily
3V55A 3VC2A 1L8QA 1VBFA 4N3CA 2EG9A 2R6DA 4UHKA 3TMAA 1ACMA 1R8JA 4P86A 1SNYA 1CRLA 3BQ9A 4KOAA 4QT0A 1YS2X 2PYZA 2PMCA 1JAYA 1W34A 4FDMA 1NJGA 3BQNB 2EP8A 3GJRA 4JP1A 4NMXB 3KYDB 3G3EA 2YHIA 1YRYE 5I3CA 1ND6A 4DG5A 5JS6A 1CIVA 2ENWA 3QXXA 4IYRA 3C3DA 3CVOA 1PTJC 1V1JA 2ZI3A 2OLEA 3N0RA 5F5XA 3SKVA 4DWWA 4NCAA 5C1BA 1MXFA 3HJNA 3MJFA 4FJ1A 4ENWA 1S8FA 3QI2A 5JUWA 3GLKA 5IC5A 1WCIA 1OU0A 4DPLA 2Z83A 1J20A 1TM2A 2EF0A 4QJ4A 4BVFA 1DIGA 1U02A 1LWOA 1ISGA 1W0JD 1YUNA 4I2VA 5SY4A 5H4GA 4JC0A 5JWHA 1D1PA 4YWHA 1HFWA 4IS3A 2LDXA 2XMBA 3G2PA 3PPIA 5DK6A 3K9BA 5AW0A 3DE3X 1ISMA 1EQUA 1SB9A 1CEQA 5JS8A 3OHSX 4TWZA 1I32A 4LK3A 3HYRA 2PUVA 1V1RA 1PWHA 3CTMA 4N6GA 4XD7A 3U56A 1WAMA 1OFVA 4QOGA 5EIXA 2O4CA 4DLYA 1V0JA 3JU3A 1KU6A 2QRVA 2IXDA 4M1MA 4B43A 1A71A 1M7HA 2ZI5A 5CDHA 4WFIA 1GNRA 3ZD9A 2VYVA 2JCBA 3CLRD 2XUJA 3UPTA 4F1KA 1COZA 2BY4A 2IF2A 6AT1A 2XCLA 3BGWA 3TG2A 2J5RA 1PNOA 4NCIA 1ZD9A 3B6MA 2B92A 3O8QA 1L7NA 4KEAA 4KGXA 3OOSA 1EMDA 1W5EA 2YVUA 5CNKA 5AI4A 3KRTA 3DBRA 2WJHA 3UIEA 2R7AA 3BG5A 3OUZA 1KJZA 2RKBA 3D59A 4JUAA 1FW8A 1HG1A 4K88A 4NEGA 5AKGA 3UXMA 1OHHA 4PSAA 4BMOB 5B1IA 1GY8A 3R3WA 1OWNA 4L3VA 3C8UA 1HT1E 2B8JA 4A0QA 1AM4D 5DM4A 1ITZA 2YQZA 1GARA 1E6WA 3IQFA 1JWAB 2EBWA 4G1EB 1MRNA 1JVNA 2M6RA 3UKJA 1EUQA 5F12A 2HDNB 3K53A 3C5WP 3DDSA 5KTKA 4DXAA 2KM1A 1A5SB 1K7EB 4X3CA 2WAXA 3WZMA 4XUGB 4JBGA 5I01A 5T41A 2AX4A 1MOZA 3F5DA 2ZETA 4C4YA 2XOEA 2NYAA 5L95A 3KKQA 1SU7A 2OCAA 4Y2PA 2KBFA 4ZO7A 4NOLA 3MTDA 2L69A 3SC3A 1LPAB 2Y99A 3L7CA 2HLPA 3RRFA 1YIDA 2OYCA 3P2JA 3ZE9A 5B12A 1M6EX 221PA 3AIOA 3M81A 4GWGA 4HG2A 4IH1A 4LJ5A 4LRTB 4M0FA 2OFWA 3L0PA 4G5SA 2OCPA 4FQ8A 2QSZA 4BXOB 3ZE8A 1P2VA 3MJVA 2CXNA 4UD2A 3ZHUA 3ZGXA 1P9NA 1WLYA 2G6BA 4YP1A 4Z4EA 2TRSB 4DZTA 1NW9B 1XZGA 4PYMA 4UFNA 1P6XA 3LYAA 1DG3A 3N2NA 4AIRA 4C2AA 2VPQA 3LKBA 3X1XA 3OICA 4IZOA 1MJGM 1YT5A 4PIPA 1T2CA 3I9KA 2ZBVA 1SBYA 1IM8A 4LDPA 3HSKA 1KMMA 3H7IA 1GV1A 4C07A 4QOSA 2D7CA 3QNWA 1KI7A 2XRFA 3H65A 2AJCA 4H6XA 3VSDA 2EIXA 4IGKA 4BX2A 3OLZA 4O8CA 2FQXA 4MV0A 3WYBA 2VSQA 2ORVA 5DNWA 3TH5A 2DHQA 2QWXA 1CJCA 2IKSA 4LZZA 2L17A 4KFSA 3C3MA 1DB3A 3OBIA 1RFLA 1JHOA 2C2KA 4UE6A 1CZKA 3C3JA 1V16B 3QP9A 4J29A 2QI9C 4A27A 3D6VA 1C8KA 1EP3B 2COUA 5A06A 2IVZA 1YBFA 4QNNA 3VX3A 3AJEA 1Y33E 3FPKA 1LZKA 1I2DA 5IS2A 2R87A 2REXB 4ZEMA 1CRPA 5LOVA 3GAAA 4R7ZA 1FXWF 1IONA 4H77A 4QOIA 4I4IA 3V8BA 2ZRGA 4PGFA 3JR3A 1XALA 2B4QA 1VKJA 4G84A 1SQ6A 1XRJA 2MYTA 1NXTA 2UVQA 2PGOA 2QNBA 5MFZA 1AKEA 5LFAA 1RWNA 4TTAA 1FRFS 5EIWA 2VNSA 3IJPA 2ID7A 1TK3A 5JS7A 2IYXA 4F2PA 1F8XA 1PR2A 2CFCA 1DEKA 3EIOA 3LX6A 2ZRNA 4EW2A 3RTBA 4QLBA 1N5JA 2HREA 5SYNA 3QFHA 3U40A 2V03A 2XDAA 5FNVB 4CCYA 2J4DA 2P79A 3C16C 4TGLA 2J0UB 5F5NA 3KOZA 3TLJA 2GEJA 3A7DA 1EK2A 1SQSA 4JZKA 5KSPA 2BR3A 2L82A 5HG0A 1EUZA 1A4XA 1ODKA 3L7BA 1VPLA 1A2OA 4NCNA 4D4GA 2Z5LA 3D2CA 1U1FA 1QDUA 3L6OO 5DTIA 1LTKA 5K0EA 5IVIA 1DSSG 1M8KA 4GHWA 5AH0A 3TOCA 1NBMA 2O8FA 3AOEC 1P39A 3PQCA 1LX7A 1E0AA 1LJLA 1YCFA 2F3UA 4CG0A 1M6VA 5LBUA 2NZVG 1JAIA 5DH9A 1U94A 2I6FA 2O54A 1ZL0A 5THXA 4KAFA 3IUSA 2VDKB 3KD2A 3S55A 4IM7A 1TT5A 3LVFO 3G0HA 3VR3A 5BWBA 3ZGNA 4BWGA 1VLHA 2A6PA 5JYBA 4TMYA 3LUFA 4PX3A 1SQ0A 2RGDA 2VZ8A 2CXTA 3DA8A 2XZTA 3ICPA 3G8AA 3WGNA 1C3EA 1GYQA 4CUJA 5IBQA 5LQCA 3LBIA 4EK9A 3RBXA 1PEKE 1JF8A 1OLUA 3V34A 1U8ZA 1RWQA 2JBAA 2BYTA 4UXIA 3QXSA 2GYUA 3G9UA 4M7WA 5E7IA 1W36D 1JDNA 1KZ6A 3KJXA 3MOSA 5C1OA 4KZKA 1MHTA 2C42A 4HMQA 3UW3A 4R84A 4HJXA 2AR7A 2XLCA 3I8SA 4NMLA 2GN0A 1NHGA 1SKYB 5FA5A 1F4LA 1QMGA 4BGEA 3DMFA 4RK4A 1J0DA 3MK31 1P7PA 3F8WA 3TI7A 3ZY5A 4OFBA 5J47A 2V6FA 2O0LA 2B2CA 3WY9A 1RAEA 1KE2A 2YMPA 4LYEA 2DFTA 4IH4A 2WOOA 5EXXA 4YUXA 4G36A 1XTKA 1WUJS 5FAXA 3OURA 8MHTA 4QC2A 4Q1CA 1WQ3A 2CFIA 3E9RA 2WMYA 4CKYA 1KJNA 5J3JA 2X77A 1ZD8A 1GOTA 4CEIA 2Q6TA 3V97A 4EYKA 4LN1A 2NG1A 1NZJA 3W7VA 4IGAA 1M5TA 3DAFA 4NL4H 3VU1A 2Y6UA 4YO7A 5AXCA 4GMGA 2CSUA 5HOQA 5TVKA 2JW5A 4M55A 3ROXA 3U26A 4WCFB 4WA8A 1FTWA 2B6HA 1EVQA 2B2XA 4M88A 1RQ7A 3VPDA 1R0WA 3RU9A 3LT5A 4DCVA 4YXWA 2P9QA 2SECE 3VUEA 3E9NA 4YYZA 1FQWA 3SMVA 2WSLA 4KWTA 2J87A 5NLLA 3T3GA 5E7QA 1DQYA 1JKXA 3KQQA 2JA1A 4GF5A 3GOHA 3KZNA 3USCS 1QRTA 2KJQA 4E46A 3C7TA 4DA6A 1UXOA 2NNLD 4GGMX 5KTRA 2R97A 1ZH0A 3ESYA 3EZGA 3PP8A 1RM0A 4AP9A 1SCJA 1WBJB 5FNVF 1DEHA 1RRVA 3OY7A 2IA5A 4JJIA 4TPKA 4DGQA 1EUCA 2QTAA 3LPDA 3HDQA 3RTGA 3FN4A 1QC5A 5JR3A 4OVKA 4FSDA 1THTA 3NAMA 2WHRA 4H1VA 4R1OA 3B1FA 1A04A 4UUAA 4AZ3A 3OZFA 1VE5A 2OHXA 1AZTA 5AOBA 2OZPA 1VIMA 3O4VA 1EHIA 1E18A 4OYYA 4QPPA 4H0FA 3UCEA 2RGBA 3VPSA 4HPJB 2ZZNA 1TUEA 2LWIA 1SZPA 4ZAZA 5KNBH 3WK7A 2FUEA 1YB4A 2O6HA 2QUZA 4KNVA 2PGDA 4RF5A 1DJQA 4BATA 1UPAA 1DE0A 2AFHE 3LVQE 1LK7A 2MSWA 3WSVA 5HGXA 5JC1A 4GP9A 1JWBB 4TMVA 4N9WA 3IPCA 4HATA 4XM0A 4ZHSA 2GFHA 1GN9A 1YDWA 2D5LA 2G06A 3AETB 4HKTA 2PGXA 4Z54A 2DPGA 2OV8A 3TEMA 1XPOA 3EMVA 3M4YA 5DO9A 2FMUA 2GB4A 1PDWA 4HQKA 2G28A 5GOTA 2ZIVB 3A3KA 3ASZA 2XE8A 1I6WA 4K2HA 1NC1A 2CDBA 3DGFC 3NV9A 2QJOA 3VYSB 1CR0A 4ND7A 3VVBA 5ITVA 4PY2A 2WE7A 2R8EA 2C98A 2IW1A 4FVTA 4MCHA 1IBSA 4LXQA 4XYEA 4E6EA 3TTUA 1Y3IA 1QCDA 1S2MA 3IALA 3A6PC 1FSZA 3Q8XB 4TQGA 5FL7A 3FGNA 3PX2A 5BWNA 4Q34A 1OXVA 3AIKA 4UDOA 4X1YA 2Y27A 2H2FA 2PUHA 3WQBA 4JLUA 3AHFA 2VQFB 1O57A 1CLEA 2IELA 4N3BA 3CPJB 3W6OA 1E1RD 1M66A 3HKEB 3C2QA 1LPSA 2ZU6A 3B52X 3GGSA 2VNIA 3R5FA 3SZRA 4C0AC 3U37A 5DNYB 3UCFA 2LVBA 2GK7A 5EIBD 3H2SA 2B7LA 3SHQA 4MQBA 1KWGA 4OP1A 4OO3A 1V1MA 1YVUA 4YQZA 1D2NA 4OV6B 4AF8A 3R0QA 4ZICA 1YULA 2ZR9A 4Y2HA 4ZZ2A 4RFSA 3INTA 3ND9A 1EFCA 1LBIA 1WXEA 3GDFA 1LTQA 4IWYA 4I8XA 1C7ZA 4M1SA 4A92A 1T4CA 3GGGA 3SVZA 4RE5A 4U63A 3BTOA 4HDKB 3VSCA 4EO4A 5BOSA 4DT1B 4P3YA 5KEIA 4LKOA 4PHTA 4XB6B 3LM8A 1QPGA 4ETNA 1V8FA 1N2CE 4UBKA 1SIOA 5CVDA 1QTNA 5C80A 3BIFA 1OF1A 2IXFA 3JD4A 3EEIA 1FP7A 4ID3A 1YQTA 2CWWA 4X93A 1U9IA 2G0AA 1L5MA 1WPGA 3D54D 4Z0PA 5GV8A 1P2FA 4QEDA 2PZGA 2A9KA 1UC5B 2QENA 4YJFA 4ZWNA 5BW6B 3Q0EA 3WWPA 5DBFA 5C3MA 2F64A 1RRKA 3OTIA 1WOMA 2LKDA 4RHUA 4X71A 4B45A 1C0LA 2D5CA 3DLCA 1E61A 2BT4A 1SCNE 3SLGA 2FF5A 2IC5A 1RVDA 2IOHA 3OZEA 4PFKA 4QYWA 5DB4A 1A98A 2WJAA 2ZVDA 3L7NA 1K5HA 4D9FA 3LX5A 3EZXA 2BKLA 3IVCA 2W0MA 1I10A 1HSZA 4H7HA 4UEOA 2AMFA 1T1RA 2CLFB 2JKYA 4P5EA 4XE5A 3ZGOA 4AJ9A 3D81A 3I64A 2RHJA 2GCOA 2WTXA 1ZWKA 2ECQA 1X9HA 2IODA 1FS5A 4BNNA 2C9CA 1X0XA 4UARA 3U9LA 1QIFA 2O48X 1XP5A 3FW1A 4XWWA 4X92A 3S2YA 2VT6A 1ISFA 3CNOA 1U8FO 3KZCA 3LO5A 1KEKA 4C6SA 5FOXA 3DZHA 3LD9A 5IJ9A 2G5CA 4ME6A 4X95A 2P41A 4OQLA 3ZWNA 1U2SA 3P4UA 3H1BA 1P0CA 4Z7NB 1Z06A 3P2KA 3HI4A 2Y71A 3AHDA 2PS3A 1J42A 1RYFA 4AX8A 1FIUA 1UJ4A 2J3HA 3UG6A 3ICEA 2HXSA 1VBKA 4KLZA 1EA5A 4RQBA 4E51A 1DHRA 4OHVA 2C2YA 2CYBA 2QT1A 1VPVA 1L8LA 3L40A 4FOOA 4LBZA 4PQRA 4ZVOA 2HA0A 2QQFA 3OJLA 1D2RA 8GPBA 1LW7A 4HX5A 4HLQB 3UVEA 5L7WA 1KSHA 4YMLA 2ID4A 4E1AA 1QH1A 1M34B 5AW7A 1WMBA 2AD5A 2D5IA 5HKKA 3JQAB 1VGRA 1CEYA 3DMHA 5JVDB 4GX5A 3AB3A 2HV8A 1O9GA 4U39A 1OB2A 1N1EA 4XJSA 1JEJA 2HRRA 2WZDA 5BN4B 4CNBA 3JVUA 4G5OA 2C1EA 3DUWA 2AUNA 3K0KA 4HAUA 4LIPD 5DYNA 5KX5A 3PRHA 4MQ5A 2I3DA 2NYRA 3K0SA 3LPAA 4D5EA 5JXJA 1RXVA 2BELA 2WT4A 1BS9A 3QIAA 3WLQA 4CN9A 3NNSA 4P2BA 3VYTB 3WL4A 4CMGA 2AN5A 1QHXA 1B8NA 3PPWA 1FUEA 4HQFA 4MKXA 3UUGA 2ZUFA 1KEUA 3U3OA 1KEPA 1C3OB 2I22A 4I6EA 4HXYA 2ZE7A 5KAMA 3FTNA 2Q4OA 2W6IA 4URZR 1GNTA 1KP9A 2V3VA 5LUAA 3V8MA 2F8SA 1GTMA 3IIMA 2FSVC 3MLAA 3E2PA 3CLSD 1HC7A 3NHPA 4BNVA 4F6CA 1JE0A 2JFVA 3LYUA 1N2BA 1ZM9A 4R1NA 4RHFA 3S2GA 1F0NA 3FZNA 2OHOA 3QYPA 1Y4UA 3AY3A 4MCIA 2NVUB 1JVBA 2Z4RA 3GPIA 3ORYA 1RW4A 3EQ9A 2JJ1A 3ZI4A 5DW0A 4Q9IA 2DKOA 3SFTA 2CJPA 4LY3A 5E6UB 3PS9A 1TYAE 1CP2A 2H7YA 4XWTA 4B5LA 1Q3KA 2I2AA 5FYQA 1XV5A 5K0TA 3IUNA 4QGSA 3QE9Y 4WSOA 3E3LA 4FNMA 1P19A 2Y0CA 2GXSA 1TVEA 2V3CC 2FGKA 1LV8A 5DI9A 1S1CA 1QR2A 1PR9A 2A5FA 2R6ZA 4RJJA 2GAIA 1P3JA 3TB6A 4ZZ1A 4V0LA 3MW8A 3OT4A 5EWMA 1SCKA 4H7FA 1SC1A 3U3DA 2Q4BA 1JXMA 3B6ZA 1KHHA 3NOVA 2O8EA 2P8SA 3A36A 3O75A 3HEMA 3JD2A 2GNOA 3N8KA 4U6SA 4EZEA 2JLYA 2WG0A 4RKQA 1QRUA 1OIXA 4J4BA 1WPRA 2QY9A 5KNCA 1JFFB 4RXMA 3S28A 1H66A 2H2WA 3T5AA 1HRDA 4B84A 5AHKA 5DISB 3RPEA 4AKSA 3OZTA 4XFDA 4ZPJA 5LA6B 4K1LA 4P35A 4DDVA 4M53A 1A4IA 1B6GA 1IBKB 5FBWB 5CYPA 5JH7B 4LDQA 4XB2A 3EVEA 4M1ZA 4XGQA 5AKLA 3RSGA 4Z5XA 1G5QA 5CEEA 2BR4A 4YCSA 4ENTA 2XKKA 2WUGA 1UDWA 2JFXA 1X9IA 1RZRA 4GMKA 4JUIA 2C7OA 4L4SA 1R27A 3BH0A 4HO1X 1E3TA 4QDZA 3NWPA 1TYEB 1PBTA 3C3KA 2CD7A 2NZYA 3NS7A 2I76A 1AUXA 3O6VA 3RARA 3GAMA 4XWGA 5DOZA 3ZH9B 2A0WA 4OKSA 1C0KA 1E96A 2ZM6B 5JVDF 3DDHA 1ZK3A 4XASA 3HKCB 3L92A 3L7KA 1RJFA 2GAOA 5J5CA 4F12A 2FMKA 4OOFA 4UNRA 5JJIA 4YUAA 2ZRPA 5JSYA 5B1SA 3U3KA 1T6ZA 3UJ6A 3TQCA 1OB5A 1GEGA 2YCBA 4J16A 2BE7A 1W8DA 4FX5A 3STVA 4LEIA 1ENOA 2JKVA 4JLWA 4R69A 1E4EB 3DMTA 5HIAA 1XZJA 5IH7A 1E7RA 1NFQA 4OY3A 2EC5A 3V6MA 2C2OA 3IO3A 2QL9A 3HGTA 4C14A 2Q50A 4O4HB 3I6MA 1FF9A 3JASB 4UEJA 2ALJA 4C05A 1G63A 3JARB 5FFFA 5K8IA 1BA3A 1IG3A 4GRAA 2RDMA 2ZT7A 1NBEA 3LY7A 1NTOA 5AW1A 4MW5A 3TAUA 3HY4A 4IMIB 3NUZA 1CY4A 4XUDA 1WY5A 4LOLA 4QJBA 1IY8A 3S8YA 2BLNA 5AI0A 2JANA 3KEOA 4XWAA 1J1ZA 4DV0B 3C4JA 1NTRA 2RK4A 1SOWA 1YGYA 3KYJB 4KE9A 3WYEA 5AESA 1JBEA 2P3OA 2QZPA 4N4AA 2H11A 3AEUA 3VRHA 4AKEA 1JAZA 1WJGA 2PGIA 1PEAA 2J9XB 2F1JA 3ZCUA 5FLKA 2GLXA 5JI3E 4E32A 4FGLA 3H05A 2R4UA 2E87A 1DAGA 4ZAVA 2FPOA 3CZ4A 2JGAA 5LIPA 5ERXA 2GZ3A 2NNWB 2IUEA 2H4YA 1B74A 1N7IA 2A1UA 1TA4A 3MFQA 5CDGA 3UH1A 5LZ8A 1W4ZA 4GOMD 4FU0A 3TTTA 1CZLA 3A1WA 4IEFB 4KL8S 4EA7A 3MJTA 3U19A 3R7LA 1HA3A 2V4MA 1LRJA 4QECA 5AIAA 5DI3A 1RAHA 4WNYA 4WV3A 3USZA 3QFFA 2C2MA 2AXEA 3AJ8A 3KM0A 2ZJ2A 5JDCC 1I3KA 5IULC 1NE2A 3V3KA 1XMXA 4Q1FA 1V37A 3O83A 1ZJWA 2BP7B 3A9TA 3M6LA 3ZD8A 3P9XA 1NBME 3DO5A 5K0LA 5E1OA 4CM9A 4MVCA 3OP4A 5LA6F 1U1GA 4N8DA 3R76A 3U9TA 1PK7A 2HA4A 3EXHC 3OG9A 4FI3F 4AZTA 621PA 1Y6RA 3JQGA 1SC4A 5HBRA 4D0LB 3RH0A 4R51A 3T5GA 4OP3A 1TTTA 5JH7F 4X85A 3CF2A 3MCUA 4MAFA 4LF5B 1Z8DA 5K4HA 1YA4A 2DFNA 2OD9A 3DW3X 4LFAB 4R3NA 5J4HA 1THMA 3V9PA 2ST1A 3UTCA 3JTEA 3NHRA 4MB0A 4WT7A 2WB2A 1XU7A 5DXAA 3TD2A 5CVCA 3M9WA 1RJGA 4LUCA 1E89A 2R86A 3FHOA 5BW4A 1F51E 2XEDA 4I1OA 1G5PA 4X1KB 3NWOA 5EXPA 2QK4A 5IM4A 7REQB 4DEXA 4CDGA 5LU8A 4R6WA 3W7AA 5GZ1A 5DHFA 4S2EA 4G5YA 4OUDA 1DFHA 4TQ9A 4B4VA 3NWBA 3OTWA 4ML3A 4H7EA 2AN1A 4PICA 4Q9JA 3EG9A 4AZWA 2YRFA 2GBGA 2MMGA 1XFDA 2WKRA 5CT8A 1QKIA 1RADA 1L5OA 1PV2A 2J46A 3GL9A 4R16A 1RC0A 3F7TA 1ESCA 3MMPA 1QG6A 1EFPB 2EFDB 3NTRA 4UEKA 3EPPA 4O4HF 1DCKA 2ZVQX 1YB5A 3PPVA 1IHPA 2D2XA 1WXIA 4BBAA 1VKHA 1P3DA 4KJZA 1RM4A 3BWDD 2ZXEA 2V5AA 4AMZA 3GNTA 5DNCA 1KH2A 4WLVA 5TGDA 3UM9A 4D3SA 1T6XA 3ZWKA 4JLBA 4LRQA 3OZXA 1UUFA 2RB5A 5FI5A 4F3YA 5DGCA 4BX8A 3D6NB 3AEQA 1DIBA 1I1HA 1VDZA 1GQRA 1ZNXA 4HDSA 3TZBA 3ZVNA 3TW6A 4QYIA 2NSJA 2DH6A 1D9XA 3W6ZA 3ONNA 5F76A 1A0OA 3BHJA 2R7MA 3N6XA 2PLFA 3M89A 4CMBA 4DPKA 3PUZA 3KOOA 1EHYA 3IXLA 1A76A 4QRIA 3V00A 1YCDA 2C94A 1S6YA 3G2MA 3V4LA 4UOZA 2G88A 1L4GA 3PQ3A 4L27A 1A82A 3K9HA 3D1LA 3O2JA 4D02A 5H80A 1TW2A 2CHEA 3D4LA 4FDLA 4GD3Q 4KSBA 3TKAA 4EJSC 4AU1A 4CLOA 1KKUA 1ULHA 2G70A 3SJZA 1L4FA 1EJ2A 3W3AD 4YV7A 2QRMA 4MKHA 1KEWA 4BTLA 1R8YA 1E32A 3O82A 5EKDA 2H1CA 1V9LA 2QZ9A 3RBVA 2NU7B 4OKNA 4XRGA 2WD7B 1W9HA 1CR2A 1GJRA 1MV8A 3OF2A 4DM3A 4IL5A 3ZDCA 2N9UA 1U81A 3GN1A 3P0HA 1SZDA 4CQMD 5JFOA 1BQ4A 4DA7A 3BXHA 3AU9A 4AD8A 2HSWA 1YZ3A 4UZEA 2J9YB 3RF7A 3WJ2A 1QK4A 2GAFA 4OJTA 2VQEB 2BJWA 3IIJA 3DE7X 2FXVA 1NF3A 3EIHA 1YMUA 3HP4A 2YH2A 3NWJA 1OI2A 1RDFA 4ND1A 1O3YA 1LPNA 5AVTA 3CZ9A 2FU5C 1HDXA 2ONJA 3OE5A 4OXIA 3EGIA 4YRNA 4J3JA 4ZI5A 5CFPA 5GMOA 3KKOA 3OMWA 2JATA 2CN1A 3K1AA 3S99A 4WK4B 3TZQA 3ZWPA 1SXHA 4DA8A 1J8QA 4I4TA 5IAJA 5ALIA 4BO1A 1GSHA 2FZVA 2HZBA 5AVJA 3PJFA 2OXEA 4RA9A 4RMIA 2P77A 4YROA 5D3QA 6NULA 4IV5A 5EPUA 5K3FB 1I0IA 3I5AA 1YO6A 1AY0A 3SC2A 1E58A 3CN9A 1D6NA 1KK0A 5ELLA 4D9GA 1R4NA 4CMEC 4GEGA 5EZ5A 3OAAA 4QVGA 1P61B 5GOZA 2DCUA 5IVHA 4KVAA 4Q3DA 1BWRA 2K5UA 1DQSA 1VJDA 1QZ3A 3L1VA 3LQFA 3LDHA 2QXYA 1I5OA 3DDZX 4QXMA 1BKDR 4FSHA 3ETGA 2O2IA 3IMCA 2CXHA 1G8YA 1Q0HA 4MRMB 2GPBA 1E5LA 4TKUB 3Q9SA 2OL4A 1X8LA 2W42A 1QGDA 1Z6ZA 1RCFA 2IHTA 4OBBA 5BUZA 3TPCA 3OIUA 1LBSA 2ZSDA 4MNTA 5CVJA 3OPYB 4X97A 1CB7A 5HF9A 4CKCA 1SCAA 3U09A 1NM5C 4GEKA 3I6ZA 3UV6A 4L2IA 1ONPA 2H1LA 1F4PA 1J5PA 1U0TA 3DQQA 4PQEA 5AVYA 1GYRA 1JT9A 3TTXA 3H5AA 5JZVA 3VKGA 2IT1A 5G1OA 1M2JA 3LFTA 1KAMA 1FBTA 1PTJA 2EGGA 4Z4QA 3ZE0B 3SJBA 1EQAA 2Y1EA 5ITWA 3EXG2 1ODIA 3ND6A 3FPHA 2GCGA 4M89A 2CXPA 2VF4X 4U7HA 3HPRA 5ALXA 4KACA 3QE0A 2GRUA 1X1TA 1EWTA 2VT3A 4XGRA 2IH4A 4JBIA 3G89A 3LCJA 2YBEA 3RK0A 1V11B 1V5FA 1NN3A 2F00A 3K4PA 3LHSA 4UBOA 4BLOA 1ZK0A 4ZV7A 4BAZA 4CM8A 4YT4A 1AV6A 3UHPA 4LJ6A 5P21A 1ECBA 5ALWA 5CB0A 1KI4A 1G5IA 1H1LB 5H4HA 1LSJA 2EP7A 3FYTA 5ER9A 1T2NA 4D0RA 2HIAA 4EL0A 3HVRA 1GWNA 4JA2A 4NOJA 1PQWA 5I8PA 2IITA 3CF6R 4WLUA 1DKMA 1E64A 4DNOA 3JW8A 4CLXA 5F9HA 2REBA 1JIXA 1TTQB 1NVMB 2GOYA 5EUQB 4DLUA 2Q3FA 5KYVA 3DZIA 4G0MA 2EGHA 5FWXB 2FW1A 3ZNOA 1XWFA 2ERCA 2LBPA 1UM9A 1LXCA 4OD0A 4TS4A 2FEKA 2M9MA 2XGOA 3ILSA 4V0NA 1G9TA 3EF3A 2HU2A 3PE4A 1CK4A 4BQSA 4EB6B 1VMIA 4IO1A 2JLWA 3J7TA 4MR9A 5IBPA 3SSAA 1JP7A 1DC6A 2PL5A 3D3WA 2ZRDA 4YXFA 2PS1A 2WTNA 1DNPA 1ZICA 1JPVA 2QTBA 3HBJA 2NM0A 3C1UA 3QQPA 4MK4A 3CEAA 2CZGA 4D97A 5KQRA 2QPTA 4HJRA 5BVGB 1YE3A 3IT2A 4TSFD 4QU8A 3VR6H 4GOJA 4EUSA 2XRYA 2A30A 1CEEA 2AOUB 4XJXA 4CIAA 3L8EA 1Z26A 2WI8A 1Z6AA 3O47A 5H0IA 1RQNA 1V48A 2BFOA 3DW1X 4JSTA 4KBGA 2DECA 3LI2A 5D1NA 2ZR0A 3X1YA 4F1WA 1J0EA 3FSGD 4DUZB 1PL6A 1XNGA 2P35A 1W5AA 2WU1A 1P1CA 4FB5A 3EZLA 2YX1A 2QUAA 2XIQA 4FCTA 1KZ1A 2AYZA 2WINI 2X6TA 4JY7A 3K9CA 4YACA 4UVDA 4XPIA 2IU4A 2HHJA 5KB3A 1LZLA 3DYIA 1C2YA 2BUAA 2C58A 2QT9A 4IHJA 3K94A 3HKDB 5EMJA 5KHLB 1SKMA 4EPRA 1ZVVA 2JLQA 4BE7B 1ZN9A 3P7MA 1FFYA 3TOVA 3LUPA 4C4XA 2JEOA 2VTDA 5HUHA 1A9TA 4ZCTA 2VJBA 3EC2A 2I67A 4MV6A 2E5FA 2NAPA 2YFYA 4HL6A 2BVNA 4IJMA 4QPZA 2IFTA 3WIBA 3KXKA 2JD0A 3SJUA 4GPEA 5MN5A 2Q8QA 3I73A 1TCCA 3CXUA 3E61A 5CK4A 1YKSA 4AO7A 2QJTA 3CO5A 4ABTA 3ANYB 3IT3A 1BVHA 1JQDA 1B0UA 4WXMA 3IB6A 2O2GA 4L51A 2SNIE 4EQ6A 4EYGA 2W8BB 4QUHA 5TQ2B 2C97A 4IR7A 3T7KA 4RZQA 4DNFA 2GRJA 3ZE2B 5DSXA 1VLLA 2ATCA 4Q93A 4BEJA 4CBVA 1AKVA 1XXHA 4BNGA 1SUDA 1RHKA 3EXIB 3G79A 2GHIA 4RVUA 5E1MA 4QM6A 4MPPA 3IAS1 3M7IA 3QPCA 2N3ZA 1NQAO 1WU8A 3G6WA 1XZCA 3U1VA 4C7OA 3L04A 1U4SA 1NY6A 1YRWA 5D87A 2EKPA 4AYWA 2XZLA 3FPJA 3TE6A 2HWXA 3P5SA 2NV6A 3ZWXA 3C85A 4GOOD 1XCPA 4Z8XA 1N2GA 4JR0A 1WNTA 4IIEA 4FGUA 5D5HA 5HX7A 3BA6A 4Z7JA 3CM0A 1O4VA 1W2HA 2PIAA 2ZWAA 2JH9A 1KNXA 2YIMA 3KB6A 3MWEA 4PHGA 2Y93A 1OA1A 3OE4A 1JLLA 3HRKA 3R2JA 3D4NA 1A2BA 1PZGA 1QLWA 1RU3A 3UJAA 5ED0A 2R96A 4Y1FA 4N82A 1Z74A 1VJCA 5F1KA 3OTHA 9GPBA 5BV2P 1HQDA 2PGJA 4NPAA 2IRWA 4XIFA 3CW8X 1ESNA 3GEHA 4HGRA 5E4TA 1Y6JA 4XEHA 5EYPA 2R65A 4D8WA 4RZXA 1VXOA 1Y0BA 3H17A 5A9SA 2FOXA 3QVSA 5FI0B 3H5WA 1A9YA 5TEVA 2VYQA 2I4LA 5EE9A 1WULS 5C5EA 3LU1A 4FMPA 4WINA 4AKHA 1Y3AA 1Z3IX 5EPOA 4B74A 4EY8A 5I6DA 3R6TA 3V33A 4XXHA 5IFKA 3D8NA 1K4MA 1ZO8A 2ADFA 5EJ2A 1IRIA 2P62A 4L73A 4A4DA 4BRUA 2RONA 5BMVB 1JR3A 1GUFA 4MO2A 3H1PA 3ECCA 5C4IA 5ER6A 1AKMA 3C3WA 3GLRA 3SM3A 5ADVA 3ZDYB 1G38A 2O5CA 1P33A 3P9SA 1VL0A 1H5NA 1X19A 1HNNA 4TTRA 5F7JA 4CWAA 1XNRB 4DJTA 2DHEA 1TA9A 1MLDA 1YZTA 2YVKA 3CCFA 4GM0A 4G37A 5FIUA 5TR9A 4P3OA 2P1DA 3MPOA 3ZNQA 4ZANA 2P4SA 5CXQA 3DE1X 4ND6A 3RUFA 3IBSA 2DFPA 3LBHA 4DXHA 4P22A 3V4RA 2AC7A 5JIBA 4MSUA 3SC6A 2Q0QA 4DV5B 3VDXA 4I46A 1BH2A 4OX9Y 1RSZA 1NW4A 4XUCA 3V32A 4REMA 2GK4A 1YE5A 4EM6A 1OC4A 4QQNA 1GPAA 5DKFA 4KITB 3HJFA 2F48A 2D7DA 2YJZA 3LUKA 4H08A 3LBAA 1Z0JA 1Z3CA 3QFCA 5KNDH 1RJ9A 3IXQA 5JLAA 4CR8A 4GYJA 2QTVA 4BNFA 3MF4A 2LDBA 3NC1C 4EMBA 2UZ3A 3G88A 1JBQA 2FW6A 2PE5A 4Q05A 3F6YA 1XEWX 4CT4B 2WF5A 1NP7A 1VLQA 2YWRA 5BWOA 1LSUA 3A2MA 3HDVA 1XPUA 1DDOA 4HD8A 3GEGA 5JY6A 3DCYA 3RABA 3GP8A 1R66A 4EY4A 1YR2A 5DGXA 4YCDA 4YMSA 4B3XA 1S9HA 3OFKA 1AGYA 3TQSA 4EBFA 3IL2A 3PCRB 4O1IA 4PSCA 4G5HA 4C1NA 4NBNA 3ASYA 5HCNA 5REQA 2P3QA 3SF0A 4YCNA 2DWOA 3LHDA 1NULA 3WHLA 1C9NA 1P18A 4JQSA 4R2MA 3PFFA 5G3YA 3U7QA 4RM3A 2C7BA 4FNAA 4OHRA 4E5VA 1NVBA 2OFPA 3EGXB 3KE9A 5JPDA 3O90A 3TGWA 1R0RE 2QEQA 2ACKA 1FZQA 3TUJC 4BQNA 2NXWA 3BXPA 2ZUVA 3QBEA 1EZ1A 4PTLA 3HCFA 5H3LA 1YNSA 3NM6B 4J4TA 4LYHA 3D4BA 1WCWA 2R4QA 1SZCA 3EOBI 3LDFA 1VBNA 1RWPA 4ID9A 2GR9A 4YT2A 2X1MA 3QVOA 2QT0A 2XYQA 1T0PA 2VF8A 4ZVRA 1K6XA 2WIJA 2W98A 1PW7A 3PLRA 2Y1XA 3K9GA 2B21A 2K7ZA 3DYVA 2NUAB 2BR5A 4TL9A 4RZSA 1GSOA 3N7TA 3H42B 3BL5A 4PGGA 2PWBA 4C76A 5JNSA 2QRHA 3P9PA 3UCXA 1XZFA 2FPPB 2W2MA 3C7AA 2GEVA 2NO7A 1NF8A 2AHOA 2AS0A 3FFBA 3GJTA 3KWFA 3L8HA 4MQ6A 4QGHA 5BQ5A 3K9FC 2BZGA 3Q4GA 4JZYA 2Z2JA 1Z4PX 1NJFA 3VGPA 721PA 3BK1A 2K2QB 4I9HA 1E2IA 1PWXA 3A3OA 4PZPA 5D85A 5EA2A 1Z0IA 1SUWA 4UHJA 5BMVF 4FFPA 5ESRA 3DTVD 4DDWA 2BW0A 1POWA 4BMZA 2QTTA 3H19A 2WE8A 1U80A 4OLJA 2BFDB 3IUQA 2YYYA 3BH7A 3COVA 1AB5A 1I30A 3CHYA 1Z5ZA 4ZODA 2A4KA 3FNFA 5LBTA 3P4XA 4F4DA 4UNPA 1Z5NA 2AKAB 1HPLA 2ORED 3OPYI 3FNIA 4EKNB 4ZV4A 4RENA 1D2EA 1NSTA 1QH8B 2PO5A 1TUBA 2P9JA 3EZ2A 3ITDA 3NBFA 5JAZA 3I3OA 2CLCX 4PYIA 3INGA 3N2ZB 4KO3S 4PCAA 1M8GA 3BRCA 3U7IA 4H27A 2FN7A 1E77A 2GEFA 3ANSA 3GFRA 4NK5A 4WUTA 2CLIB 5ALDA 5FTKA 3WR5A 4HR7A 4DDHA 5SZHB 2AZMA 3AUTA 2VOJA 4AWXA 1VLZA 2Q2VA 3N8NA 4UEWA 4JQYA 2VDJA 1OLSA 2PG3A 1UEJA 5J5AA 3HADA 5TARA 3WWYA 1KI6A 1L8XA 5DCLA 1SG6A 3T4EA 1AK1A 4M83A 4K6HA 3M0EA 3R5HA 4UQOA 2CNOA 2VQDA 4BX3A 5ICMA 1Z47A 3HCCA 4KP7A 1WXWA 1EG7A 5EJ5A 2GYWA 4XFKA 5A4IS 1FNMA 1Y3DE 4L7QA 2AN4A 4DWJA 1O97D 4WBNB 3CVXA 1D4OA 2NIPA 1P77A 1EM8A 3KBBA 4XPZA 5ALSA 4YAKA 1R6XA 3GMDA 2H16A 1I4EB 1PD1A 4HNTA 5M29A 2QVCA 4R1PA 1D4ZA 3MINA 4Q7MB 4CQLB 1QIHA 2BBTA 4YJHB 2H29A 2IIVA 1SR8A 3FKQA 4DRXA 4F3RA 3LV8A 4UM5A 1II8A 1ST2A 1TZ2A 3D6UA 5FEMA 4PYNA 4AG6A 2P9CA 3MRSA 3JYHA 4PR0A