5GXGB

High-resolution crystal structure of the electron transfer complex of cytochrome p450cam with putidaredoxin
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
106
structure length
106
Chain Sequence
SKVVYVSHDGTRRELDVADGVSLMQAAVSNGIYDIVGDCGGSASCATCHVYVNEAFTDKVPAANEREIGMLECVTAELKPNSRLCCQIIMTPELDGIVVDVPDRQW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of productive and futile encounters in an electron transfer protein complex
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase/electron transport
molecule keywords Camphor 5-monooxygenase
total genus 31
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2016-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5gxgB00
1AWDA 3AM9A 3EUB2 1WRIA 2BS3B 2BT6A 3NRZA 3AE6B 4ZHOA 1QT9A 1NVID 1PFDA 1FMAD 1CJEA 5EE3A 1EWYC 2DBYA 1J7AA 3AV8A 3ETRA 1R7SA 2PVGC 1IUEA 5C3JB 3HRDD 2DWQA 4HROA 3AE5B 1DOYA 2N0SB 1N62A 1QLBB 1WYGA 3AECB 1QOFA 3AE2B 3HVZA 4KX6B 1GPXA 2B76B 1OFFA 3BIID 3AE9B 4HRSA 4WWMA 1WGKA 2BS2B 4US9A 2PIAA 4N58A 1JWAD 2Q5WD 5AUKA 3NVWA 2G1EA 3L4PA 5H8YE 2FBWB 1JROA 2HTME 2W3SA 3AEGB 3NS1A 3AH7A 2H88B 2WU5B 2MH7A 1F0ZA 2MJDA 1FFUA 3B9JA 2H89B 3P63A 3SR6A 1QOAA 1KRHA 1L6VA 3NVVA 1YQ4B 1TYGB 1L0VB 4YSYB 5C2TB 4ZHPA 1QF6A 1FRDA 2WDRB 5EE9A 3WCQA 4N59A 3RPFC 2CJOA 2KMMA 1DOIA 1JALA 2W3RA 4JWUC 1J7CA 2JQRB 4YT0B 1NEKB 3AE8B 1NENB 2K5PA 1KF6B 1XLNA 2WP9B 1JWBD 1V97A 2W54A 3AE7B 3FAHA 3P4SB 1JRPA 1XLQA 1PUTA 5G5HA 5EE0A 2CU3A 3VR8B 1WWTA 3VR9B 3DWGC 1A70A 2E3TA 2MJEA 1ZXIA 1V8CA 3PO0A 4N6EB 1L6UA 2OHFA 3AN1A 1YJIA 4ITKA 3W5UB 3AMZA 4YTMB 1ZUD2 2JX5A 1SB3C 3P4PB 1WXQA 3AEDB 2WS3B 3ZYYX 1N5WA 1N5XA 1XLPA 1YQ3B 3KWLA 2Y5CA 5G5GA 2K9XA 1ZOYB 2L83A 1E10A 3B2GA 1E7PB 2LEKA 4P6VF 3W9CB 1E9MA 1VLBA 1NI3A 5MPOA 1DOXA 1E0ZA 2EKIA 3NVZA 3SFEB 1FO4A 3SFDB 2WLBA 1FXAA 1TKEA 1GAQB 1XO3A 3B2FA 4C80A 3AEAB 3AEBB 3AB5A 4YSZB 1I7HA 1FXIA 1NYRA 5H92C 4C7ZA 4C7YA 1L5PA 1AYFA 3P4QB 1TKYA 2KAJA 1FM0D 2BS4B 5EE1A 5AUIA 1UWMA 1RYJA 4USAA 2WDVB 1CZPA 3HUIA 5GXGB 2QJLA 3DWMA 3LXFA 2WDQB 4ZOHC 1RWSA 1FRRA 1YJJA 1VJKA 1RFKA 2AX5A 3AEFB 3AE4B 4IDIA 2W55A 3NVYA 2CJNA 3VRAB 1SIJA 1TKGA 3LB8C 4LTUA 4US8A 1B9RA 1SF0A 1QOGA 2MJ3A 3W5VB 3AE1B 3AEEB 4JWSC 2ACZB 1N63A 1NYQA 1QOBA 4YTNB 4YXDB 1JQ4A 1FIQA 1N60A 1PDXA 1TJEA 3FC4A 2L52A 1VDVA 4WQMA 1ROEA 4JX1C 1FFVA 1DGJA 3AE3B 4A9AA 2PVOD 2QIEB 1E6EB 1J7BA 3P1MA 1T3QA 3ABVB 2WQYB 4FXCA 2M19A 2PKOA 2K22A 3P4RB 1KFYB 2M56B 3CWIA 2WU2B 4YSXB 4YTPB 3VRBB 1ZP0B 1XLOA 1JW9D 3CIRB 1N61A 1OQQA 1OQRA 1RM6C
chains in the Genus database with same CATH superfamily
1YOVB 3TEYA 3DHIC 1T0RC 3AE6B 1MFWA 5T8IA 4HJGE 1J7AA 4M00A 4ASWC 4FA6A 1WZ0A 5BYQA 1I35A 3RULA 4WAFA 4DK5A 2B76B 3RNBC 2V0GA 4XE0A 1TT5B 2K8HA 2G1EA 3DQVA 4S17A 1WM2A 2MA9B 3GOEA 2UU7A 1PYWD 4W9DA 4ZHPA 1WYWB 3WCQA 1ESFA 3RPFC 1WJUA 4LJPB 2KQ7A 2Z0DB 3DOWA 2JYTA 1KF6B 3AE7B 2LJIA 3Q8EA 1HA5A 4LNIA 3KW5B 3DWGC 1R4MI 4W9CA 2CS4A 1GC6A 2I1JA 2WDTB 3Q2AC 1EUVB 4HDOA 4PYZA 2M17A 2Y5CA 5G5GA 1E10A 3ZNHB 4EEWA 2CU1A 2MP2A 2EKIA 3DVNV 1UWXA 2FCSA 2BYEA 2MEKA 3N20C 2C5LC 4DHZB 3DDCB 3VTUA 1UWMA 2V4IB 2UYZB 4YWGG 4ZRKA 4IWPA 2CJNA 3VRAB 1WX9A 2DX5B 2IGDA 2KTRA 4M0WB 3QK0A 2QCZA 4MACA 3RMKC 4A90A 1SE2A 5TSSA 3AXCA 1NI2A 2PKOA 4WH4A 1KFYB 3U7ZA 1S3SG 3GS2A 3OJ3A 1PGAA 2DZMA 1YMHE 2WHIA 2ZCBA 3JSVB 2DAJA 1UF0A 2LI5A 3RUIB 3QC8B 1IP9A 2CHZA 1C1YB 2K1FA 5DCNA 2DWQA 2LUEA 4JLCA 1H4RA 2PIAA 4P16A 2Q5WD 2N1VA 2AL3A 2Y5BB 4IWOA 2MP2B 2IPKD 3DVGY 3ZUNA 4GDKA 3B9JA 4DHJD 1L4DB 3IT4B 5C2TB 1BMLC 2DYOA 5BYSA 4H2AA 2YLMA 3PVLA 3L0WB 4ACFA 3VUXA 4RH6A 3ZO5B 5HFYA 2KJHB 1QQRA 3E56A 1LO5D 1VZ8A 2KQSA 2O6VA 1YJIA 3WAMA 1D6EC 4HPPA 1T5XD 2GRIA 3QHTA 4GXBA 1VLBA 2IO0B 4HPMB 2KANA 2WXHA 5H92C 5C23A 2DYMA 5EE1A 1FPYA 2M1MA 4A3OA 4MH0E 4KDLB 4JQWC 1FRRA 2N7DA 4KKJA 2QILA 3L08A 3U7DA 1N63A 4KDIC 3ZDTA 1STEA 4DDID 2PMVA 4ICVA 3VQIA 2ZCCA 3CWIA 4HJKA 4YTPB 4C4VB 4P1BC 2L1AA 4AS1A 3EUB2 2BS3B 3QWZB 3NRZA 4W9HA 2DNFA 1NVID 2QEJC 2Y3AA 2JYEA 3AV8A 4GMVA 1IUEA 4FHJA 4HROA 4MGZE 3BIID 1SJED 3ALBA 5AUKA 3HM6X 1MVKA 5C1ZA 2FBWB 3I5JC 3M3JA 3A4SC 3SR6A 2XEWA 3BVZA 3TUOA 1HTOA 3IAS1 4MJSB 4JWUC 2BGFA 2J53A 2DHZA 1J0GA 2WP9B 3FAHA 1SBBB 2BVCA 2WXNA 1OEYA 1PUTA 2QC8A 3E9SA 1KTKA 3VUWA 2I38A 3PO0A 4HCPB 4FLHA 2W9NA 1E7VA 1TBEA 2D10A 1I4QA 1D5MC 2V9HA 1PGXA 2PPHA 1ENFA 3RFZB 4M8NA 4RNAA 3DHHC 4YSZB 2KAJA 1ZW7A 1E8ZA 1IPGA 2W55A 4RFBA 4KZCA 1SIJA 2I1KA 3TJPA 3PLUA 4RGTA 4R3DA 1VDVA 1ROEA 1FFVA 2LGDA 1F77A 3RI7C 1WXSA 2DZKA 1CK1A 1FXTB 4FXCA 3RNCC 4EOYA 3N1XC 2KX3A 5CHFA 2KO3A 1XT9B 1UNSA 4TUUA 2IZVB 2TSSA 3Q3NC 1JW9D 1UH6A 3IHPC 3UF8A 2JPHA 1IBXB 2M0XA 2FIDA 3AM9A 1WRIA 5IA7A 3Q6BA 4ZRQA 3ZVVA 3VTVA 4E74A 3KH0A 5DPWA 3QAQA 1P3QU 3DBSA 4O1NA 4W9JA 5C3JB 3KWVA 3ZRCA 2D2QA 2C7NB 1WF9A 2R2OA 1UELA 2MBQA 2BS2B 4EE2A 1WE6A 3PHWB 3JSVA 2G45B 3L4PA 2IYDB 3B1LX 3ZW3A 1K8RB 3ZTDA 3AI5A 2ZPNA 4MEMA 3VUYA 1J19A 3DPDA 1YQ4B 1YD8U 3C8YA 1UBQA 2LXAA 2L32A 3VH3B 3CMMB 1CQVA 4KGTA 1WJ4A 1XLQA 1K50A 3UGBB 2FCMA 4HPLB 1V86A 5G2NA 4HKZE 2MJEA 3PRMB 4J3OD 2O2VB 2PE9A 2KLCA 2DZIA 3I9V1 1N5XA 2EELA 2C7HA 2LXCA 1E90A 4MH8A 4HKQA 3W9CB 5FR6A 1FO4A 4DXAB 3IBEA 2DYBA 1I7HA 2LGYA 3W1SA 1L7YA 1EF5A 4J6IA 1WMHB 3R3MA 1V81A 4RGMA 4NJ6A 2JF5A 1GG3A 3A9KA 4LDTD 3NG0A 3KUDB 1JQ4A 1E8WA 3FKYA 3EECA 2BF8B 4BKTA 2KDIA 1ZE3D 2V1YA 3ABVB 1UGJA 1I42A 2K3UA 1XLOA 2AQ3B 2LHDA 2KC2A 3Q8CA 2B3AA 3RNFC 3RNAC 4K1RB 1UBIA 3OG5A 1V80A 3CF6E 5EE3A 2WWZA 2HJ1A 3VH4B 1C79A 3PRZA 3T3NA 4OVUA 1A5RA 3KVFB 3MHZA 1T0QC 2KLGA 3V60A 2PEAA 1EF1A 2K8BA 4BZAA 5G55A 2JRIB 2MJDA 2CHWA 1UZXB 1XEEA 2Z8LA 3R2TA 1QF6A 4W9EA 5IN7A 3U4EG 4BFRA 2IO2B 3H6NA 2W3RA 3QARA 2G9HD 3ZJUA 4DXGA 1WXVA 1SEBD 1XLNA 1R4MB 1C76A 2DENB 3V6EB 3VVWB 1XQQA 1UUPA 1L0YB 4BBNC 1ZUD2 3AULA 3BVGA 4WJPA 2JWZA 1LM8B 1R4NB 3ZXVA 2N1WA 5JHBA 4WWNA 3IFWB 2LEKA 2SEBD 4P6VF 2RSUA 2ZW1A 2FNJB 3B08A 5E6OA 2LMCA 2KTFA 2NTSA 4MJSA 2C9WB 4IUMB 2OJWA 1QKZA 5CHVC 3NOBA 4XGAB 2ONQA 2RGFA 3PSEB 1FNUA 3IVFA 1MI0A 3GP7A 2INCC 2GBKA 4RF1A 4PK1A 2GI9A 2KT7A 3DCGA 1WGDA 4AWJA 1WGRA 1WFYA 3C19A 1MPEA 3OWEB 4LJOB 2EMTA 2DBYA 4G0NB 2PJHA 3M95A 4II3B 1SIFA 1BUIC 4XWTA 3ZRFA 4HRSA 4QAYA 1P0RA 2WXPA 3QX1A 2KMAA 2V3SA 3TMPB 2HTME 4GSWA 2ZNVB 1JCKB 4BAXA 3QJZA 4GOCA 4BKGA 3V62A 1U4AA 2X8XX 1L0VB 5FK9C 4JE3B 2WDRB 4RMAA 2O2VA 3MC8A 3MP9A 2KMMA 3PLVA 5HG2A 1NEKB 4ANUA 1KM7A 3P4SB 2WXGA 2CU3A 3ENEA 3APFA 3RZFA 4N6EB 4IM3A 2AQ2B 2LVQA 2BB6A 3A9KB 3VTWA 4KV2A 2K6DB 1IYFA 1KLUD 4M01A 1D4BA 2WLBA 3HIZA 1T6BX 3KYDD 3OJ4B 2N4FA 4NNJB 3VAWA 2C7MB 2WDVB 4ZOHC 5HI1A 1YJJA 2AX5A 5IOIA 5AEKB 2HTHA 2D07B 3AU4A 3Q8BA 3W5VB 1V5OA 5AZFA 1OQYA 1F2RC 1FIQA 5L95C 3MC9A 4HDQA 2N9EB 4LLGM 3DBHI 3P1MA 4DXFA 4ZRJA 2GBRA 3CIRB 4NQLB 2LZ6A 2KN5A 1WJNA 1K52A 3KUZA 2KTRB 4M0WA 3NZUA 3N1ZC 2RDGA 2CR5A 3IXSA 2ZNVC 2JXTA 1HE8A 1QLBB 2XK5A 2KNBA 1OFFA 3Q3MC 1P7EA 4RGNA 1P1AA 4JPSA 3ZGZA 4RF0A 3URYA 1XCQL 2R61A 1YIWA 3C0RB 2L0TA 4C00A 2N9PC 2WX1A 2ZW0A 1DOIA 1MJDA 2DZJA 2WNMA 2MBBB 3ZTCA 1E7UA 4LNNA 3CSTA 5G5HA 3WIMA 4E3CA 3QCAA 2ZJDA 1Q0WB 4YTMB 4ITKA 4GDLB 2D11A 3LJ3A 3ZQ4A 2PW9A 1MHHE 4K7SA 4KSKC 1X1MA 1BXTA 3SFDB 1DYQA 3TEXA 1NYRA 2Z59B 2V4LA 2ASQA 4WAAA 5GMVA 2BS4B 1WY8A 3NZSA 1RWSA 1EWCA 3TCAA 3NVYA 2HDEA 4GB9A 2ACZB 2AYOB 2KD0A 1TTNA 3O13A 3KUCB 1J7BA 2LUMA 2M19A 3UQAA 4OHJA 2QHOA 1N61A 2GBMA 3U52E 3PTFC 3L10B 2IO3B 2JUOA 4K3BA 2AEHA 3PZ7A 2BBCA 1V1PA 3JYUA 1WR6E 3TL5A 3AE5B 2INDC 3QIJA 3AECB 3SDLC 4C4VA 1WGKA 2KFJA 2ICIA 3A4RA 2MBEA 2W3SA 4ICUA 2WXJA 3V3XA 4X57B 3DVNU 4IM0A 3T3OA 4W9GA 2H89B 3PT2B 4TSSA 1SXTA 1XCTL 2PTLA 3ZLZA 1F9JA 3MHSD 3EGRA 1TS3A 5EE9A 3NJTA 4MGKE 2JWUA 3R7RA 1LXDA 3HHMA 4I6PA 3L17A 2K5PA 3UQBA 3V61A 4WJQA 3M62B 1A70A 2LRWA 1JRUA 3SHQA 3AEDB 2WS3B 3ZYYX 2L83A 1SE9A 3BVMA 1C78A 5D7GA 1MHXA 4HEA1 4NQKE 1GAQB 1TS2A 4GLSC 3UIPB 2D3AA 2J0MA 5L83A 1HQRD 5AUIA 1LGRA 2J42A 1C3TA 2WXLA 3DWMA 1KLGD 2A4ZA 3Q14C 1E5WA 4IW0A 3AE4B 2MJ3A 2C60A 5CHWA 3X0WA 1FD6A 1YNTE 2LWPA 4IC7B 4A20A 2L05A 2MBHA 2PLPA 3K9PB 4MSQB 3APCA 3WAOA 1Y56A 1P7FA 2NPTB 1UGMA 1I4XA 2BB5A 1RM6C 2M4NA 2VRRB 2REXA 4DHZE 4GN1A 1ZDVA 1B1ZA 3UINB 2KYWA 2JSVX 2VH2A 3BK1A 2L3ZA 3ETRA 3GB1A 4GIVA 4II2B 4IWQA 5DPTA 1GC7A 2WXMA 3BYYB 3QA8A 1GJZA 4EFOA 1P9DU 2N9KA 3EFUA 3DVGX 3NS1A 4OVZA 1WRDB 3HM3A 2DLBA 5D2MB 2EKEC 1TYGB 2O6VB 2CJOA 2AL6A 4CQNA 4XWWA 4XZ4A 3H7PA 5EDSA 4AJWA 4YT0B 3N3KB 3ZIMA 1NENB 4PS3A 1WGGA 1JWBD 3VHTC 3WAPA 4ANWA 3R66C 4OVVA 2VH1A 4OW0A 4FN2A 4AQ7A 3PZDA 2D5GA 1WMHA 2FIFA 1S1QB 2WXQA 3KLSX 3JVZX 1ACCA 1ZOYB 3MFGA 1TY0A 2MSED 1RRBA 1E9MA 1QILA 1E0ZA 4LNOA 2XN9C 3B0AA 3B2FA 1FXAA 4L2YA 2LFIA 4WURA 4C7ZA 2L76A 1FNVA 4WJOA 1RYJA 3ECIA 1CZPA 3HUIA 3VDZA 1SE3A 5CX3A 2G4DB 5FKAC 4LTUA 3LB8C 3H9DA 2N9LA 2JRHA 1EU4A 2L0FA 1N60A 4W9KA 1WZ3A 5D94A 4RGOS 4ZRPA 2KFKB 1DGJA 2PVOD 4XX5A 1Q5WB 2K22A 3T8MA 1C4PA 2M56B 2JXXA 4ZYSA 2GLSA 1YX6B 3IG3A 1F2RI 3H7PB 4TKNA 2K39A 1Z5SB 3O65B 2RPVA 1EO6A 2YEPF 1JMLA 3Q3OC 3EA6A 3VFKA 4FBJB 5E6PA 3W2DA 3BYTB 2W82A 1ISNA 3TEZA 4B95A 1TS5A 1C4CA 3GZNI 4DDGD 4W9LA 4K7WA 3W1SC 1D3ZA 1M4VA 1VR9A 1Z2MA 1T0SC 4F1SA 5IP4D 4CYEA 1YN4A 4IG7B 1C4AA 2AQ1B 2JQRB 1ZKHA 1WSPA 1V97A 3PGEA 2K6QA 3Q69A 3VR8B 4GDKB 1LFDA 2D3GA 2KACA 2OEDA 2OHFA 5CTRC 4C56C 2BYFA 2J7QB 4RM8A 4KIKA 1IGDA 3L13A 4EZLA 3BWUD 2KZRA 2NBWB 2VZKD 5AZGA 4B9KA 3P4QB 3Q8AA 5BO4B 2HE7A 3RNEC 3P2BA 2WGSA 1ET6A 4HXDA 2HD5B 4FULA 5J18A 2WYQA 3DBRI 1IBXA 4A55A 5DPSA 2IJ0A 3CSFA 3H8HA 1T3QA 3DBHB 4DWFA 1MG8A 4ARCA 3R7QA 2NVUI 3I57A 3RT3B 1CJEA 1L0XB 2N0SB 4F8CB 2ZVOA 2JY6A 4GGQA 4PS8A 1GPXA 1VZ7A 1G6JA 2RD0A 3NY5A 1V9JA 4A3PA 4REZA 2KK8A 1FCLA 4JL9A 3GE8C 3ZJVA 1NDDA 1VRAB 2AWTA 2IBIB 2K25A 2KMCA 2WU5B 4XDDA 1TZ1A 3MC0B 1Q10A 4MDKE 5IKCM 2QDFA 2MBOA 1KRHA 1L6VA 2BPSA 3MJWA 2FCQA 4N59A 3RD2A 2YVCA 3FILA 4M8MA 2IY1B 1OGWA 1V8CA 4MSMB 3BINA 1L6UA 1XXGA 2NR2A 2MWSB 3TSSA 3V05A 1WE7A 3KWLA 4OZAA 4ZYNA 5IO9A 3ML8A 4EZKA 4CO7A 3RYTA 2KKCA 1J8CA 1WH3A 4WIPA 3SFEB 3OLMD 2D3CA 3MJ5A 2J4XA 3AEBB 5JZEB 2WXOA 1H8CA 1K51A 5KHQA 1KH0A 3LYYA 1RFKA 2OJRA 3AEFB 4AP4C 1TKGA 1B9RA 4Q2JA 1GB4A 2ZVNA 3AEEB 3ONSA 1M94A 1WX8A 3FC4A 4NJCA 5LNK1 1EU3A 3A9JA 2WXKA 5AZHA 2LGIA 2KDFB 4BBNF 2LJ5A 5D3DA 1OQRA 3S2AA 1JWSD 5E6JA 2NTTA 2LVPA 3Q3FA 4OZCA 5BYRA 2ZPYA 4P1CC 1FMAD 1YJ1A 4LNFA 2KN4A 2RR9A 1R7SA 2PVGC 3A1QB 1DOYA 3N32A 1N62A 1WYGA 2NBVB 3HVZA 1QOFA 4ARIA 2Z0EB 2XBBC 4WWMA 1WR1A 4HVBA 1SE4A 4TQ0A 3AEGB 4DBGA 3AH7A 2KWVB 2G3QB 2BKFA 1E8YA 1QOAA 1WI0A 2LGXA 4YSYB 3N30A 1F52A 2VZKB 2KC1A 3BZDB 4LK0M 3KYCD 2GOWA 1GUAB 3V6CB 2E6XA 3U30A 1NBFC 4XYCA 4FHKA 2O6VD 4EZJA 3VR9B 2RMMA 4NAWA 1RAXA 3AN1A 3APDA 2ZZPB 3DBLB 4I6LB 2K9XA 2R2QA 3ZNZB 2NCNA 1DOXA 1ZPSA 3NVZA 2I2YA 1XO3A 4A6QA 4B0EA 1ET9A 2D3BA 4ZDVA 3BY4B 1L5PA 4NY0A 1FM0D 1IGCA 2KDEB 5GXGB 3IAM1 2WDQB 1VJKA 3T9LA 1HTQA 4BOZB 2BWES 3PPAA 3AE1B 1QOBA 1VD2A 4G11A 4MELA 1PDXA 4A8XC 3KQ4A 2FAZA 3AE3B 2BYVE 4KIKB 2ZEQA 3VRBB 4OZBA 1OQQA 4EUTA 1AWDA 1XF5L 2WXRA 2J52A 1D5XC 1PFDA 3N9YC 2M0AA 2LASA 4WWOA 4W9IA 1E8XA 2JZZA 2BTEA 2V3PA 3AE2B 1YX5B 2SAKA 3K9OB 2OOBB 2A5UA 4M02A 2G4SA 4MT5A 2L7RA 2EMSA 5LXHA 2KVRA 3A9JB 3X23A 2KHWB 1F0ZA 2V3NA 3LDZE 3P63A 3GE3C 4E71A 1JWMD 2DAFA 4IKGA 2NPTA 5JXVA 2M8SA 4KZ0A 1I4GA 1JALA 1ZDXA 4TV3A 4FJVB 3TBLD 4B0MA 1V1PB 1LQBA 3D32A 2CKHB 1K53A 3SU8X 1GNUA 2KWDA 1D5ZC 2KDMA 1ZXIA 3W1YA 3A33B 1KJTA 2FCNA 2LGSA 1L4ZB 3AMZA 3FILB 1WXQA 1XLPA 1TIFA 1YQ3B 2KXJA 2XNAC 1NI3A 3DBRB 2NS5A 4NZLB 4DHJB 4C80A 1OTRB 3AEAB 4KVGB 3AB5A 3L16A 4CHKA 4USAA 4KKIA 2QJLA 4EKUA 5LXIB 1CMXB 1P98A 1C9FA 3PRPB 2J0JA 4AUQC 2BW2A 3TIXA 4IDIA 4PYUA 2KOXA 1QOGA 4KSLC 3EFCA 5D3IB 4YXDB 1NYQA 4BKSA 1N6ZA 2UWQA 1TJEA 1YN5A 2KJRA 2L52A 1AN8A 4FJYA 1I4RA 1WXAA 1PGBA 3R2IA 4YSXB 3PREA 2N7JA 3EHVA 2MRPA 2IGHA 1WXMA 2KVZA 1QT9A 2MW5A 4BOSC 5BMIA 2GMIC 2YEPB 3HRDD 2KX0A 2BQQA 3ZDMC 2IDYA 2IGGA 2BKRB 1KOTA 3AE9B 4US9A 4L23A 3NVWA 2NMQA 1RLFA 2J0KA 5I4DA 1JWUD 3I63C 1YQBA 4NPNA 4W9FA 3GZNB 1FFUA 3ZNID 1XD3B 3ZKJC 3L54A 1FRDA 2KQ4X 4MGIE 2JZPA 2W54A 3I3TB 2WXFA 5EE0A 2KJ6A 3A1QA 3OAWA 2E3TA 1VCBA 3WA0A 2LD9A 3W5UB 3U2SC 1V49A 2JX5A 3DHGC 1SB3C 3P4PB 1N5WA 4G3XB 3NS8A 4LDTB 3B2GA 2Y5PA 2KWUB 4URKA 5MPOA 3ZNGC 4XC2A 3SD5A 2INPE 2L00B 1AYFA 1TY2A 1WIAA 2K8CA 3LXFA 2FE8A 2JZ3B 4HK2A 4I6NB 4TQ1A 3BK2A 3HVDA 1V2YA 5DPRA 4NAWB 1YN3A 2INNE 1SGHA 4JX1C 5D6JB 4A9AA 4K81A 1E6EB 4YL8A 2WQYB 1OEYJ 2GBNA 1ZP0B 1PQSA 4XDCA 5HHDG 1T0YA 1VZ6A 3J9CA 1C77A 1TS4A 5J17A 2BT6A 4TMAB 1V6EA 1TGZB 2PE6B 4ANVA 1AARA 5FR3A 4N58A 2RDHA 4FADA 4MM3B 4HLEA 1RFAA 5H8YE 2MLBA 2MH7A 3Q3JA 4RCOA 3R8BA 2MX2A 4KGRA 2IO1B 1WX7A 1J7CA 3DBLI 4IOIE 2JT4B 3PHXB 3AE8B 5BMGA 2NBUA 1JRPA 4NAMA 3N1YC 5J2RA 1WWTA 1HEZE 1I4PA 3P42A 2QSDA 4GU2A 3PV1A 4L1BA 3HK0A 5E6NA 2IY0B 2LHEA 2GB1A 4BKSD 4JIOU 3RN9C 4RM9A 2LVOA 1E7PB 3PS6A 2WXIA 2N7EA 4IM2A 4K7UA 1TZOA 4P7IA 4NJ7A 3Q8FA 5JH5C 1FXIA 4HWIB 2L8JA 3WANA 2N9XA 1GB1A 3NHEB 1HZ5A 1UD7A 4US8A 1FEHA 3ML9A 4JWSC 1FNWA 4YTNB 2FUG1 1WM3A 1V1OA 2KDBA 4WQMA 2FUHB 4WJNA 2QIEB 2LRUA 3PZ8A 3UIOB 3P4RB 5LLIA 2ON8A 4HCNB 5JHAA 1HXYD 4ZHOA 3NUHB 1F1HA 4LCDE 1EWYC 3JW0X 4F7ZA 4PS7A 3U8ZA 4ANXA 1V5TA 3H1UA 1GOZA 4ZRIA 4LNKA 3RZWC 4KX6B 3IT6B 5HKHA 3ZJTA 1JWAD 1WGHA 2BWFA 4UDUC 3NZ3A 1HZ6A 4D2KA 1JROA 4PT5A 1ZXHA 2H88B 1L2NA 1BT0A 1Y8RC 3NVVA 2XK5B 1Q1OA 1MG4A 2GBJA 2MQJA 4G50A 1R4NI 3EC8A 1WJ6A 2HJ8A 3M63B 4WQOB 3AU5A 3WALA 2RDBC 4K3CA 5IAAC 2RPQA 3QQ8B 1SSNA 2X38A 1SJHD 2MCNB 4B6WA 3UI3A 4MM3A 3MTNB 3RCZA 1ZGUB 2JVCA 4BVUC 2JU6X 1QZEA 2QMTA 2WX0A 3SEBA 1TKEA 5TR5A 4MGYE 4AJYB 4N9F4 4C7YA 1TKYA 2KFKA 4GDLA 2KWCA 4FJZA 1AW7A 4AOFA 3H7SA 4DQOC 1FCCC 4S0RA 4JGHB 1SF0A 3VXWA 2K0PA 2CHXA 1I4HA 2MHJA 1WGYA 1KLVA 3ZXRA 3TEWA 2WU2B 5KHOA 5BMHA 2BYTA 1EM7A 3RNGC 4WWPA 4KGSA
chains in the Genus database with same CATH topology
1AWDA 3TEYA 1XF5L 2WXRA 1ZDVA 2J52A 3AE6B 1D5XC 5T8IA 1PFDA 1B1ZA 2M0AA 3N9YC 2JSVX 3BK1A 5EE3A 4HJGE 1J7AA 3ETRA 3GB1A 1C79A 3T3NA 2BTEA 5BYQA 2WXMA 2V3PA 3AE2B 3BYYB 4WAFA 2B76B 2SAKA 2V0GA 3MHZA 4XE0A 4MT5A 2G1EA 2N9KA 3NS1A 4OVZA 1F0ZA 2V3NA 2MJDA 3P63A 2Z8LA 1XEEA 1JWMD 1PYWD 3R2TA 4IKGA 5JXVA 2DLBA 1TYGB 4ZHPA 1QF6A 3WCQA 1ESFA 1I4GA 3U4EG 3RPFC 2CJOA 4CQNA 1JALA 2W3RA 4XWWA 1ZDXA 2G9HD 3ZJUA 4DXGA 4YT0B 1NENB 2JYTA 1KF6B 1SEBD 1XLNA 1JWBD 1V1PB 1HA5A 2LJIA 3AE7B 3Q8EA 1C76A 1K53A 2KWDA 1D5ZC 3DWGC 1UUPA 2KDMA 1ZXIA 1L0YB 4OW0A 4AQ7A 2D5GA 1L4ZB 3AMZA 1ZUD2 3FILB 3BVGA 1WXQA 2WXQA 1XLPA 3KLSX 1YQ3B 2XNAC 2Y5CA 5G5GA 1ACCA 1ZOYB 1E10A 3MFGA 1TY0A 2LEKA 2SEBD 4P6VF 1E9MA 1QILA 1NI3A 1E0ZA 2EKIA 2XN9C 2ZW1A 1FXAA 1UWXA 3B2FA 4L2YA 4NZLB 4C80A 3AEAB 3AB5A 2LFIA 2MEKA 4WURA 4C7ZA 2LMCA 1FNVA 1UWMA 1RYJA 2V4IB 4KKIA 1CZPA 3HUIA 4USAA 2QJLA 2NTSA 1SE3A 1C9FA 4YWGG 1QKZA 2BW2A 4IDIA 5FKAC 2CJNA 3VRAB 4LTUA 3LB8C 1QOGA 2N9LA 5D3IB 4YXDB 1NYQA 1EU4A 2ONQA 1N60A 1TJEA 1YN5A 4ZRPA 4RGOS 2IGDA 2L52A 1FNUA 1AN8A 1I4RA 1MI0A 3GP7A 4MACA 1DGJA 2PVOD 4A90A 1SE2A 5TSSA 4RF1A 1PGBA 3R2IA 2PKOA 2K22A 4WH4A 1KFYB 1C4PA 2M56B 2N7JA 3U7ZA 4YSXB 4ZYSA 2IGHA 2GI9A 1F2RI 3GS2A 1PGAA 1YMHE 1MPEA 3OWEB 1QT9A 2DBYA 2RPVA 5BMIA 2YEPB 2YEPF 3HRDD 2DWQA 1JMLA 2IDYA 3EA6A 1BUIC 2IGGA 4XWTA 4HRSA 3W2DA 3BYTB 2W82A 3AE9B 4US9A 2PIAA 4P16A 2Q5WD 4L23A 3NVWA 3TEZA 2NMQA 2WXPA 1TS5A 1C4CA 2HTME 5I4DA 1JWUD 2IPKD 1JCKB 1FFUA 3B9JA 1L4DB 1M4VA 3IT4B 1VR9A 5C2TB 1BMLC 1L0VB 5FK9C 4JE3B 1FRDA 2KQ4X 2WDRB 2DYOA 3MP9A 5BYSA 1YN4A 2KMMA 4H2AA 1C4AA 5HG2A 2AQ1B 2JQRB 2JZPA 1NEKB 1WSPA 1V97A 2W54A 3P4SB 4RH6A 2WXFA 3Q69A 2WXGA 2CU3A 5EE0A 3VR8B 4GDKB 5HFYA 2E3TA 1QQRA 4B0MA 3E56A 1LO5D 1VZ8A 2KACA 2OEDA 4N6EB 2OHFA 4C56C 1YJIA 3W5UB 3U2SC 2JX5A 1SB3C 1D6EC 3P4PB 2AQ2B 1IGDA 1N5WA 2BB6A 3BWUD 1T5XD 3B2GA 2GRIA 2Y5PA 1VLBA 5MPOA 1KLUD 2VZKD 1D4BA 2WLBA 1T6BX 2INPE 2WXHA 5H92C 3P4QB 1AYFA 3Q8AA 2DYMA 1TY2A 5EE1A 2WDVB 3LXFA 2FE8A 4ZOHC 1ET6A 1FRRA 1YJJA 5HI1A 4KKJA 2AX5A 2QILA 1IBXA 4TQ1A 3Q8BA 3W5VB 3BK2A 4A55A 1N63A 3HVDA 1F2RC 1FIQA 4NAWB 1YN3A 2INNE 2IJ0A 3H8HA 1STEA 4JX1C 4LLGM 2PMVA 4A9AA 3VQIA 1E6EB 3P1MA 1T3QA 4DXFA 2WQYB 3CWIA 4YTPB 1ZP0B 3CIRB 4XDCA 2L1AA 4AS1A 1K52A 1VZ6A 4ARCA 3J9CA 3EUB2 1C77A 1TS4A 2BS3B 2BT6A 3I57A 3NRZA 4TMAB 4M0WA 1NVID 2QEJC 1CJEA 2RDGA 2Y3AA 2JYEA 3AV8A 3IXSA 1IUEA 1L0XB 4HROA 2N0SB 2JXTA 1QLBB 1GPXA 1VZ7A 1OFFA 1SJED 3BIID 5FR3A 4REZA 4N58A 2RDHA 1FCLA 1P7EA 5AUKA 4RGNA 4MM3B 1MVKA 5H8YE 2FBWB 3ZJVA 1VRAB 2WU5B 2MH7A 4XDDA 4JPSA 4RCOA 3ZGZA 3R8BA 4RF0A 3URYA 3MC0B 1XCQL 4KGRA 1Q10A 3SR6A 2R61A 1KRHA 1L6VA 3BVZA 3TUOA 3IAS1 4N59A 3FILA 2ZW0A 1DOIA 4JWUC 1J7CA 2WNMA 4IOIE 2J53A 3AE8B 2WP9B 5BMGA 3FAHA 1SBBB 2WXNA 1JRPA 1PUTA 4NAMA 5G5HA 1WWTA 1HEZE 1I4PA 3E9SA 1KTKA 3P42A 2QSDA 2I38A 3PO0A 1V8CA 4L1BA 1L6UA 1XXGA 4ITKA 4YTMB 4GDLB 3ZQ4A 3TSSA 2LHEA 2GB1A 3V05A 3KWLA 4OZAA 2PW9A 1I4QA 1D5MC 1MHHE 1E7PB 1PGXA 2WXIA 1BXTA 4WIPA 3SFEB 1ENFA 1TZOA 3SFDB 3RFZB 3MJ5A 3Q8FA 4RNAA 2J4XA 3AEBB 1DYQA 4YSZB 1FXIA 3TEXA 1NYRA 2WXOA 1K51A 2KAJA 2BS4B 1KH0A 3LYYA 1RWSA 1GB1A 1HZ5A 1RFKA 3AEFB 1EWCA 2W55A 3NVYA 4RFBA 1SIJA 1TKGA 1B9RA 4US8A 2HDEA 1FEHA 4Q2JA 1GB4A 3AEEB 4JWSC 1FNWA 2ACZB 4YTNB 4RGTA 4R3DA 2FUG1 3O13A 3FC4A 1V1OA 4NJCA 5LNK1 1VDVA 4WQMA 1EU3A 1ROEA 1FFVA 1F77A 2QIEB 2WXKA 1J7BA 3PZ8A 2LUMA 1CK1A 4FXCA 2M19A 3P4RB 2LGIA 4OHJA 1UNSA 2TSSA 1JW9D 1N61A 3U52E 5D3DA 1IBXB 1OQRA 2ON8A 1JWSD 3AM9A 2NTTA 5E6JA 1WRIA 4OZCA 3PZ7A 5BYRA 1HXYD 4ZHOA 4ZRQA 3NUHB 1FMAD 2BBCA 1V1PA 1EWYC 4O1NA 2KN4A 1R7SA 2PVGC 5C3JB 1DOYA 3KWVA 3AE5B 1GOZA 1N62A 1WYGA 3AECB 3HVZA 1QOFA 4ARIA 4KX6B 4WWMA 1WGKA 2BS2B 1SE4A 3IT6B 4EE2A 3ZJTA 1JWAD 2ICIA 4UDUC 3NZ3A 1HZ6A 3L4PA 4D2KA 4TQ0A 3AEGB 1JROA 2W3SA 4PT5A 1ZXHA 3AH7A 2H88B 2WXJA 3V3XA 3T3OA 2H89B 4TSSA 1SXTA 1QOAA 1XCTL 2PTLA 3NVVA 1YQ4B 4YSYB 3EGRA 2VZKB 1TS3A 5EE9A 3C8YA 3BZDB 4LK0M 2L32A 1CQVA 2JWUA 4KGTA 2E6XA 2K5PA 1XLQA 1K50A 3VR9B 2RMMA 1A70A 4HKZE 2MJEA 4J3OD 1SSNA 2X38A 3AN1A 1SJHD 3AEDB 3UI3A 3I9V1 2WS3B 3ZYYX 1N5XA 2EELA 2K9XA 2L83A 3BVMA 1C78A 4MH8A 4HKQA 3W9CB 1DOXA 2JU6X 1ZPSA 3NVZA 5D7GA 1FO4A 1MHXA 2QMTA 2I2YA 4HEA1 1TKEA 3SEBA 1GAQB 1XO3A 1TS2A 4A6QA 4GLSC 1I7HA 4B0EA 1ET9A 3W1SA 4C7YA 1L5PA 1TKYA 1HQRD 1FM0D 5AUIA 1IGCA 2J42A 4RGMA 5GXGB 2WXLA 3IAM1 3DWMA 1AW7A 1KLGD 2WDQB 1VJKA 3AE4B 4DQOC 1FCCC 1SF0A 2MJ3A 2K0PA 3AE1B 1QOBA 1JQ4A 1PDXA 4A8XC 3KQ4A 1FD6A 1I4HA 1YNTE 3AE3B 1ZE3D 3ABVB 2PLPA 1UGJA 3TEWA 1Y56A 2WU2B 1P7FA 3VRBB 2K3UA 5BMHA 1XLOA 2AQ3B 2LHDA 4OZBA 2BYTA 1I4XA 1OQQA 2BB5A 1EM7A 1RM6C 3Q8CA 5HHDG 4KGSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AWD A;  3AM9 A;  3EUB 2;  1WRI A;  2BS3 B;  2BT6 A;  3NRZ A;  3AE6 B;  4ZHO A;  1QT9 A;  1NVI D;  1PFD A;  1FMA D;  1CJE A;  5EE3 A;  1EWY C;  2DBY A;  1J7A A;  3AV8 A;  3ETR A;  1R7S A;  2PVG C;  1IUE A;  5C3J B;  3HRD D;  2DWQ A;  4HRO A;  3AE5 B;  1DOY A;  2N0S B;  1N62 A;  1QLB B;  1WYG A;  3AEC B;  1QOF A;  3AE2 B;  3HVZ A;  4KX6 B;  1GPX A;  2B76 B;  1OFF A;  3BII D;  3AE9 B;  4HRS A;  4WWM A;  1WGK A;  2BS2 B;  4US9 A;  2PIA A;  4N58 A;  1JWA D;  2Q5W D;  5AUK A;  3NVW A;  2G1E A;  3L4P A;  5H8Y E;  2FBW B;  1JRO A;  2HTM E;  2W3S A;  3AEG B;  3NS1 A;  3AH7 A;  2H88 B;  2WU5 B;  2MH7 A;  1F0Z A;  2MJD A;  1FFU A;  3B9J A;  2H89 B;  3P63 A;  3SR6 A;  1QOA A;  1KRH A;  1L6V A;  3NVV A;  1YQ4 B;  1TYG B;  1L0V B;  4YSY B;  5C2T B;  4ZHP A;  1QF6 A;  1FRD A;  2WDR B;  5EE9 A;  3WCQ A;  4N59 A;  3RPF C;  2CJO A;  2KMM A;  1DOI A;  1JAL A;  2W3R A;  4JWU C;  1J7C A;  2JQR B;  4YT0 B;  1NEK B;  3AE8 B;  1NEN B;  2K5P A;  1KF6 B;  1XLN A;  2WP9 B;  1JWB D;  1V97 A;  2W54 A;  3AE7 B;  3FAH A;  3P4S B;  1JRP A;  1XLQ A;  1PUT A;  5G5H A;  5EE0 A;  2CU3 A;  3VR8 B;  1WWT A;  3VR9 B;  3DWG C;  1A70 A;  2E3T A;  2MJE A;  1ZXI A;  1V8C A;  3PO0 A;  4N6E B;  1L6U A;  2OHF A;  3AN1 A;  1YJI A;  4ITK A;  3W5U B;  3AMZ A;  4YTM B;  1ZUD 2;  2JX5 A;  1SB3 C;  3P4P B;  1WXQ A;  3AED B;  2WS3 B;  3ZYY X;  1N5W A;  1N5X A;  1XLP A;  1YQ3 B;  3KWL A;  2Y5C A;  5G5G A;  2K9X A;  1ZOY B;  2L83 A;  1E10 A;  3B2G A;  1E7P B;  2LEK A;  4P6V F;  3W9C B;  1E9M A;  1VLB A;  1NI3 A;  5MPO A;  1DOX A;  1E0Z A;  2EKI A;  3NVZ A;  3SFE B;  1FO4 A;  3SFD B;  2WLB A;  1FXA A;  1TKE A;  1GAQ B;  1XO3 A;  3B2F A;  4C80 A;  3AEA B;  3AEB B;  3AB5 A;  4YSZ B;  1I7H A;  1FXI A;  1NYR A;  5H92 C;  4C7Z A;  4C7Y A;  1L5P A;  1AYF A;  3P4Q B;  1TKY A;  2KAJ A;  1FM0 D;  2BS4 B;  5EE1 A;  5AUI A;  1UWM A;  1RYJ A;  4USA A;  2WDV B;  1CZP A;  3HUI A;  5GXG B;  2QJL A;  3DWM A;  3LXF A;  2WDQ B;  4ZOH C;  1RWS A;  1FRR A;  1YJJ A;  1VJK A;  1RFK A;  2AX5 A;  3AEF B;  3AE4 B;  4IDI A;  2W55 A;  3NVY A;  2CJN A;  3VRA B;  1SIJ A;  1TKG A;  3LB8 C;  4LTU A;  4US8 A;  1B9R A;  1SF0 A;  1QOG A;  2MJ3 A;  3W5V B;  3AE1 B;  3AEE B;  4JWS C;  2ACZ B;  1N63 A;  1NYQ A;  1QOB A;  4YTN B;  4YXD B;  1JQ4 A;  1FIQ A;  1N60 A;  1PDX A;  1TJE A;  3FC4 A;  2L52 A;  1VDV A;  4WQM A;  1ROE A;  4JX1 C;  1FFV A;  1DGJ A;  3AE3 B;  4A9A A;  2PVO D;  2QIE B;  1E6E B;  1J7B A;  3P1M A;  1T3Q A;  3ABV B;  2WQY B;  4FXC A;  2M19 A;  2PKO A;  2K22 A;  3P4R B;  1KFY B;  2M56 B;  3CWI A;  2WU2 B;  4YSX B;  4YTP B;  3VRB B;  1ZP0 B;  1XLO A;  1JW9 D;  3CIR B;  1N61 A;  1OQQ A;  1OQR A;  1RM6 C; 
#chains in the Genus database with same CATH topology
 1YOV B;  3TEY A;  3DHI C;  1T0R C;  3AE6 B;  1MFW A;  5T8I A;  4HJG E;  1J7A A;  4M00 A;  4ASW C;  4FA6 A;  1WZ0 A;  5BYQ A;  1I35 A;  3RUL A;  4WAF A;  4DK5 A;  2B76 B;  3RNB C;  2V0G A;  4XE0 A;  1TT5 B;  2K8H A;  2G1E A;  3DQV A;  4S17 A;  1WM2 A;  2MA9 B;  3GOE A;  2UU7 A;  1PYW D;  4W9D A;  4ZHP A;  1WYW B;  3WCQ A;  1ESF A;  3RPF C;  1WJU A;  4LJP B;  2KQ7 A;  2Z0D B;  3DOW A;  2JYT A;  1KF6 B;  3AE7 B;  2LJI A;  3Q8E A;  1HA5 A;  4LNI A;  3KW5 B;  3DWG C;  1R4M I;  4W9C A;  2CS4 A;  1GC6 A;  2I1J A;  2WDT B;  3Q2A C;  1EUV B;  4HDO A;  4PYZ A;  2M17 A;  2Y5C A;  5G5G A;  1E10 A;  3ZNH B;  4EEW A;  2CU1 A;  2MP2 A;  2EKI A;  3DVN V;  1UWX A;  2FCS A;  2BYE A;  2MEK A;  3N20 C;  2C5L C;  4DHZ B;  3DDC B;  3VTU A;  1UWM A;  2V4I B;  2UYZ B;  4YWG G;  4ZRK A;  4IWP A;  2CJN A;  3VRA B;  1WX9 A;  2DX5 B;  2IGD A;  2KTR A;  4M0W B;  3QK0 A;  2QCZ A;  4MAC A;  3RMK C;  4A90 A;  1SE2 A;  5TSS A;  3AXC A;  1NI2 A;  2PKO A;  4WH4 A;  1KFY B;  3U7Z A;  1S3S G;  3GS2 A;  3OJ3 A;  1PGA A;  2DZM A;  1YMH E;  2WHI A;  2ZCB A;  3JSV B;  2DAJ A;  1UF0 A;  2LI5 A;  3RUI B;  3QC8 B;  1IP9 A;  2CHZ A;  1C1Y B;  2K1F A;  5DCN A;  2DWQ A;  2LUE A;  4JLC A;  1H4R A;  2PIA A;  4P16 A;  2Q5W D;  2N1V A;  2AL3 A;  2Y5B B;  4IWO A;  2MP2 B;  2IPK D;  3DVG Y;  3ZUN A;  4GDK A;  3B9J A;  4DHJ D;  1L4D B;  3IT4 B;  5C2T B;  1BML C;  2DYO A;  5BYS A;  4H2A A;  2YLM A;  3PVL A;  3L0W B;  4ACF A;  3VUX A;  4RH6 A;  3ZO5 B;  5HFY A;  2KJH B;  1QQR A;  3E56 A;  1LO5 D;  1VZ8 A;  2KQS A;  2O6V A;  1YJI A;  3WAM A;  1D6E C;  4HPP A;  1T5X D;  2GRI A;  3QHT A;  4GXB A;  1VLB A;  2IO0 B;  4HPM B;  2KAN A;  2WXH A;  5H92 C;  5C23 A;  2DYM A;  5EE1 A;  1FPY A;  2M1M A;  4A3O A;  4MH0 E;  4KDL B;  4JQW C;  1FRR A;  2N7D A;  4KKJ A;  2QIL A;  3L08 A;  3U7D A;  1N63 A;  4KDI C;  3ZDT A;  1STE A;  4DDI D;  2PMV A;  4ICV A;  3VQI A;  2ZCC A;  3CWI A;  4HJK A;  4YTP B;  4C4V B;  4P1B C;  2L1A A;  4AS1 A;  3EUB 2;  2BS3 B;  3QWZ B;  3NRZ A;  4W9H A;  2DNF A;  1NVI D;  2QEJ C;  2Y3A A;  2JYE A;  3AV8 A;  4GMV A;  1IUE A;  4FHJ A;  4HRO A;  4MGZ E;  3BII D;  1SJE D;  3ALB A;  5AUK A;  3HM6 X;  1MVK A;  5C1Z A;  2FBW B;  3I5J C;  3M3J A;  3A4S C;  3SR6 A;  2XEW A;  3BVZ A;  3TUO A;  1HTO A;  3IAS 1;  4MJS B;  4JWU C;  2BGF A;  2J53 A;  2DHZ A;  1J0G A;  2WP9 B;  3FAH A;  1SBB B;  2BVC A;  2WXN A;  1OEY A;  1PUT A;  2QC8 A;  3E9S A;  1KTK A;  3VUW A;  2I38 A;  3PO0 A;  4HCP B;  4FLH A;  2W9N A;  1E7V A;  1TBE A;  2D10 A;  1I4Q A;  1D5M C;  2V9H A;  1PGX A;  2PPH A;  1ENF A;  3RFZ B;  4M8N A;  4RNA A;  3DHH C;  4YSZ B;  2KAJ A;  1ZW7 A;  1E8Z A;  1IPG A;  2W55 A;  4RFB A;  4KZC A;  1SIJ A;  2I1K A;  3TJP A;  3PLU A;  4RGT A;  4R3D A;  1VDV A;  1ROE A;  1FFV A;  2LGD A;  1F77 A;  3RI7 C;  1WXS A;  2DZK A;  1CK1 A;  1FXT B;  4FXC A;  3RNC C;  4EOY A;  3N1X C;  2KX3 A;  5CHF A;  2KO3 A;  1XT9 B;  1UNS A;  4TUU A;  2IZV B;  2TSS A;  3Q3N C;  1JW9 D;  1UH6 A;  3IHP C;  3UF8 A;  2JPH A;  1IBX B;  2M0X A;  2FID A;  3AM9 A;  1WRI A;  5IA7 A;  3Q6B A;  4ZRQ A;  3ZVV A;  3VTV A;  4E74 A;  3KH0 A;  5DPW A;  3QAQ A;  1P3Q U;  3DBS A;  4O1N A;  4W9J A;  5C3J B;  3KWV A;  3ZRC A;  2D2Q A;  2C7N B;  1WF9 A;  2R2O A;  1UEL A;  2MBQ A;  2BS2 B;  4EE2 A;  1WE6 A;  3PHW B;  3JSV A;  2G45 B;  3L4P A;  2IYD B;  3B1L X;  3ZW3 A;  1K8R B;  3ZTD A;  3AI5 A;  2ZPN A;  4MEM A;  3VUY A;  1J19 A;  3DPD A;  1YQ4 B;  1YD8 U;  3C8Y A;  1UBQ A;  2LXA A;  2L32 A;  3VH3 B;  3CMM B;  1CQV A;  4KGT A;  1WJ4 A;  1XLQ A;  1K50 A;  3UGB B;  2FCM A;  4HPL B;  1V86 A;  5G2N A;  4HKZ E;  2MJE A;  3PRM B;  4J3O D;  2O2V B;  2PE9 A;  2KLC A;  2DZI A;  3I9V 1;  1N5X A;  2EEL A;  2C7H A;  2LXC A;  1E90 A;  4MH8 A;  4HKQ A;  3W9C B;  5FR6 A;  1FO4 A;  4DXA B;  3IBE A;  2DYB A;  1I7H A;  2LGY A;  3W1S A;  1L7Y A;  1EF5 A;  4J6I A;  1WMH B;  3R3M A;  1V81 A;  4RGM A;  4NJ6 A;  2JF5 A;  1GG3 A;  3A9K A;  4LDT D;  3NG0 A;  3KUD B;  1JQ4 A;  1E8W A;  3FKY A;  3EEC A;  2BF8 B;  4BKT A;  2KDI A;  1ZE3 D;  2V1Y A;  3ABV B;  1UGJ A;  1I42 A;  2K3U A;  1XLO A;  2AQ3 B;  2LHD A;  2KC2 A;  3Q8C A;  2B3A A;  3RNF C;  3RNA C;  4K1R B;  1UBI A;  3OG5 A;  1V80 A;  3CF6 E;  5EE3 A;  2WWZ A;  2HJ1 A;  3VH4 B;  1C79 A;  3PRZ A;  3T3N A;  4OVU A;  1A5R A;  3KVF B;  3MHZ A;  1T0Q C;  2KLG A;  3V60 A;  2PEA A;  1EF1 A;  2K8B A;  4BZA A;  5G55 A;  2JRI B;  2MJD A;  2CHW A;  1UZX B;  1XEE A;  2Z8L A;  3R2T A;  1QF6 A;  4W9E A;  5IN7 A;  3U4E G;  4BFR A;  2IO2 B;  3H6N A;  2W3R A;  3QAR A;  2G9H D;  3ZJU A;  4DXG A;  1WXV A;  1SEB D;  1XLN A;  1R4M B;  1C76 A;  2DEN B;  3V6E B;  3VVW B;  1XQQ A;  1UUP A;  1L0Y B;  4BBN C;  1ZUD 2;  3AUL A;  3BVG A;  4WJP A;  2JWZ A;  1LM8 B;  1R4N B;  3ZXV A;  2N1W A;  5JHB A;  4WWN A;  3IFW B;  2LEK A;  2SEB D;  4P6V F;  2RSU A;  2ZW1 A;  2FNJ B;  3B08 A;  5E6O A;  2LMC A;  2KTF A;  2NTS A;  4MJS A;  2C9W B;  4IUM B;  2OJW A;  1QKZ A;  5CHV C;  3NOB A;  4XGA B;  2ONQ A;  2RGF A;  3PSE B;  1FNU A;  3IVF A;  1MI0 A;  3GP7 A;  2INC C;  2GBK A;  4RF1 A;  4PK1 A;  2GI9 A;  2KT7 A;  3DCG A;  1WGD A;  4AWJ A;  1WGR A;  1WFY A;  3C19 A;  1MPE A;  3OWE B;  4LJO B;  2EMT A;  2DBY A;  4G0N B;  2PJH A;  3M95 A;  4II3 B;  1SIF A;  1BUI C;  4XWT A;  3ZRF A;  4HRS A;  4QAY A;  1P0R A;  2WXP A;  3QX1 A;  2KMA A;  2V3S A;  3TMP B;  2HTM E;  4GSW A;  2ZNV B;  1JCK B;  4BAX A;  3QJZ A;  4GOC A;  4BKG A;  3V62 A;  1U4A A;  2X8X X;  1L0V B;  5FK9 C;  4JE3 B;  2WDR B;  4RMA A;  2O2V A;  3MC8 A;  3MP9 A;  2KMM A;  3PLV A;  5HG2 A;  1NEK B;  4ANU A;  1KM7 A;  3P4S B;  2WXG A;  2CU3 A;  3ENE A;  3APF A;  3RZF A;  4N6E B;  4IM3 A;  2AQ2 B;  2LVQ A;  2BB6 A;  3A9K B;  3VTW A;  4KV2 A;  2K6D B;  1IYF A;  1KLU D;  4M01 A;  1D4B A;  2WLB A;  3HIZ A;  1T6B X;  3KYD D;  3OJ4 B;  2N4F A;  4NNJ B;  3VAW A;  2C7M B;  2WDV B;  4ZOH C;  5HI1 A;  1YJJ A;  2AX5 A;  5IOI A;  5AEK B;  2HTH A;  2D07 B;  3AU4 A;  3Q8B A;  3W5V B;  1V5O A;  5AZF A;  1OQY A;  1F2R C;  1FIQ A;  5L95 C;  3MC9 A;  4HDQ A;  2N9E B;  4LLG M;  3DBH I;  3P1M A;  4DXF A;  4ZRJ A;  2GBR A;  3CIR B;  4NQL B;  2LZ6 A;  2KN5 A;  1WJN A;  1K52 A;  3KUZ A;  2KTR B;  4M0W A;  3NZU A;  3N1Z C;  2RDG A;  2CR5 A;  3IXS A;  2ZNV C;  2JXT A;  1HE8 A;  1QLB B;  2XK5 A;  2KNB A;  1OFF A;  3Q3M C;  1P7E A;  4RGN A;  1P1A A;  4JPS A;  3ZGZ A;  4RF0 A;  3URY A;  1XCQ L;  2R61 A;  1YIW A;  3C0R B;  2L0T A;  4C00 A;  2N9P C;  2WX1 A;  2ZW0 A;  1DOI A;  1MJD A;  2DZJ A;  2WNM A;  2MBB B;  3ZTC A;  1E7U A;  4LNN A;  3CST A;  5G5H A;  3WIM A;  4E3C A;  3QCA A;  2ZJD A;  1Q0W B;  4YTM B;  4ITK A;  4GDL B;  2D11 A;  3LJ3 A;  3ZQ4 A;  2PW9 A;  1MHH E;  4K7S A;  4KSK C;  1X1M A;  1BXT A;  3SFD B;  1DYQ A;  3TEX A;  1NYR A;  2Z59 B;  2V4L A;  2ASQ A;  4WAA A;  5GMV A;  2BS4 B;  1WY8 A;  3NZS A;  1RWS A;  1EWC A;  3TCA A;  3NVY A;  2HDE A;  4GB9 A;  2ACZ B;  2AYO B;  2KD0 A;  1TTN A;  3O13 A;  3KUC B;  1J7B A;  2LUM A;  2M19 A;  3UQA A;  4OHJ A;  2QHO A;  1N61 A;  2GBM A;  3U52 E;  3PTF C;  3L10 B;  2IO3 B;  2JUO A;  4K3B A;  2AEH A;  3PZ7 A;  2BBC A;  1V1P A;  3JYU A;  1WR6 E;  3TL5 A;  3AE5 B;  2IND C;  3QIJ A;  3AEC B;  3SDL C;  4C4V A;  1WGK A;  2KFJ A;  2ICI A;  3A4R A;  2MBE A;  2W3S A;  4ICU A;  2WXJ A;  3V3X A;  4X57 B;  3DVN U;  4IM0 A;  3T3O A;  4W9G A;  2H89 B;  3PT2 B;  4TSS A;  1SXT A;  1XCT L;  2PTL A;  3ZLZ A;  1F9J A;  3MHS D;  3EGR A;  1TS3 A;  5EE9 A;  3NJT A;  4MGK E;  2JWU A;  3R7R A;  1LXD A;  3HHM A;  4I6P A;  3L17 A;  2K5P A;  3UQB A;  3V61 A;  4WJQ A;  3M62 B;  1A70 A;  2LRW A;  1JRU A;  3SHQ A;  3AED B;  2WS3 B;  3ZYY X;  2L83 A;  1SE9 A;  3BVM A;  1C78 A;  5D7G A;  1MHX A;  4HEA 1;  4NQK E;  1GAQ B;  1TS2 A;  4GLS C;  3UIP B;  2D3A A;  2J0M A;  5L83 A;  1HQR D;  5AUI A;  1LGR A;  2J42 A;  1C3T A;  2WXL A;  3DWM A;  1KLG D;  2A4Z A;  3Q14 C;  1E5W A;  4IW0 A;  3AE4 B;  2MJ3 A;  2C60 A;  5CHW A;  3X0W A;  1FD6 A;  1YNT E;  2LWP A;  4IC7 B;  4A20 A;  2L05 A;  2MBH A;  2PLP A;  3K9P B;  4MSQ B;  3APC A;  3WAO A;  1Y56 A;  1P7F A;  2NPT B;  1UGM A;  1I4X A;  2BB5 A;  1RM6 C;  2M4N A;  2VRR B;  2REX A;  4DHZ E;  4GN1 A;  1ZDV A;  1B1Z A;  3UIN B;  2KYW A;  2JSV X;  2VH2 A;  3BK1 A;  2L3Z A;  3ETR A;  3GB1 A;  4GIV A;  4II2 B;  4IWQ A;  5DPT A;  1GC7 A;  2WXM A;  3BYY B;  3QA8 A;  1GJZ A;  4EFO A;  1P9D U;  2N9K A;  3EFU A;  3DVG X;  3NS1 A;  4OVZ A;  1WRD B;  3HM3 A;  2DLB A;  5D2M B;  2EKE C;  1TYG B;  2O6V B;  2CJO A;  2AL6 A;  4CQN A;  4XWW A;  4XZ4 A;  3H7P A;  5EDS A;  4AJW A;  4YT0 B;  3N3K B;  3ZIM A;  1NEN B;  4PS3 A;  1WGG A;  1JWB D;  3VHT C;  3WAP A;  4ANW A;  3R66 C;  4OVV A;  2VH1 A;  4OW0 A;  4FN2 A;  4AQ7 A;  3PZD A;  2D5G A;  1WMH A;  2FIF A;  1S1Q B;  2WXQ A;  3KLS X;  3JVZ X;  1ACC A;  1ZOY B;  3MFG A;  1TY0 A;  2MSE D;  1RRB A;  1E9M A;  1QIL A;  1E0Z A;  4LNO A;  2XN9 C;  3B0A A;  3B2F A;  1FXA A;  4L2Y A;  2LFI A;  4WUR A;  4C7Z A;  2L76 A;  1FNV A;  4WJO A;  1RYJ A;  3ECI A;  1CZP A;  3HUI A;  3VDZ A;  1SE3 A;  5CX3 A;  2G4D B;  5FKA C;  4LTU A;  3LB8 C;  3H9D A;  2N9L A;  2JRH A;  1EU4 A;  2L0F A;  1N60 A;  4W9K A;  1WZ3 A;  5D94 A;  4RGO S;  4ZRP A;  2KFK B;  1DGJ A;  2PVO D;  4XX5 A;  1Q5W B;  2K22 A;  3T8M A;  1C4P A;  2M56 B;  2JXX A;  4ZYS A;  2GLS A;  1YX6 B;  3IG3 A;  1F2R I;  3H7P B;  4TKN A;  2K39 A;  1Z5S B;  3O65 B;  2RPV A;  1EO6 A;  2YEP F;  1JML A;  3Q3O C;  3EA6 A;  3VFK A;  4FBJ B;  5E6P A;  3W2D A;  3BYT B;  2W82 A;  1ISN A;  3TEZ A;  4B95 A;  1TS5 A;  1C4C A;  3GZN I;  4DDG D;  4W9L A;  4K7W A;  3W1S C;  1D3Z A;  1M4V A;  1VR9 A;  1Z2M A;  1T0S C;  4F1S A;  5IP4 D;  4CYE A;  1YN4 A;  4IG7 B;  1C4A A;  2AQ1 B;  2JQR B;  1ZKH A;  1WSP A;  1V97 A;  3PGE A;  2K6Q A;  3Q69 A;  3VR8 B;  4GDK B;  1LFD A;  2D3G A;  2KAC A;  2OED A;  2OHF A;  5CTR C;  4C56 C;  2BYF A;  2J7Q B;  4RM8 A;  4KIK A;  1IGD A;  3L13 A;  4EZL A;  3BWU D;  2KZR A;  2NBW B;  2VZK D;  5AZG A;  4B9K A;  3P4Q B;  3Q8A A;  5BO4 B;  2HE7 A;  3RNE C;  3P2B A;  2WGS A;  1ET6 A;  4HXD A;  2HD5 B;  4FUL A;  5J18 A;  2WYQ A;  3DBR I;  1IBX A;  4A55 A;  5DPS A;  2IJ0 A;  3CSF A;  3H8H A;  1T3Q A;  3DBH B;  4DWF A;  1MG8 A;  4ARC A;  3R7Q A;  2NVU I;  3I57 A;  3RT3 B;  1CJE A;  1L0X B;  2N0S B;  4F8C B;  2ZVO A;  2JY6 A;  4GGQ A;  4PS8 A;  1GPX A;  1VZ7 A;  1G6J A;  2RD0 A;  3NY5 A;  1V9J A;  4A3P A;  4REZ A;  2KK8 A;  1FCL A;  4JL9 A;  3GE8 C;  3ZJV A;  1NDD A;  1VRA B;  2AWT A;  2IBI B;  2K25 A;  2KMC A;  2WU5 B;  4XDD A;  1TZ1 A;  3MC0 B;  1Q10 A;  4MDK E;  5IKC M;  2QDF A;  2MBO A;  1KRH A;  1L6V A;  2BPS A;  3MJW A;  2FCQ A;  4N59 A;  3RD2 A;  2YVC A;  3FIL A;  4M8M A;  2IY1 B;  1OGW A;  1V8C A;  4MSM B;  3BIN A;  1L6U A;  1XXG A;  2NR2 A;  2MWS B;  3TSS A;  3V05 A;  1WE7 A;  3KWL A;  4OZA A;  4ZYN A;  5IO9 A;  3ML8 A;  4EZK A;  4CO7 A;  3RYT A;  2KKC A;  1J8C A;  1WH3 A;  4WIP A;  3SFE B;  3OLM D;  2D3C A;  3MJ5 A;  2J4X A;  3AEB B;  5JZE B;  2WXO A;  1H8C A;  1K51 A;  5KHQ A;  1KH0 A;  3LYY A;  1RFK A;  2OJR A;  3AEF B;  4AP4 C;  1TKG A;  1B9R A;  4Q2J A;  1GB4 A;  2ZVN A;  3AEE B;  3ONS A;  1M94 A;  1WX8 A;  3FC4 A;  4NJC A;  5LNK 1;  1EU3 A;  3A9J A;  2WXK A;  5AZH A;  2LGI A;  2KDF B;  4BBN F;  2LJ5 A;  5D3D A;  1OQR A;  3S2A A;  1JWS D;  5E6J A;  2NTT A;  2LVP A;  3Q3F A;  4OZC A;  5BYR A;  2ZPY A;  4P1C C;  1FMA D;  1YJ1 A;  4LNF A;  2KN4 A;  2RR9 A;  1R7S A;  2PVG C;  3A1Q B;  1DOY A;  3N32 A;  1N62 A;  1WYG A;  2NBV B;  3HVZ A;  1QOF A;  4ARI A;  2Z0E B;  2XBB C;  4WWM A;  1WR1 A;  4HVB A;  1SE4 A;  4TQ0 A;  3AEG B;  4DBG A;  3AH7 A;  2KWV B;  2G3Q B;  2BKF A;  1E8Y A;  1QOA A;  1WI0 A;  2LGX A;  4YSY B;  3N30 A;  1F52 A;  2VZK B;  2KC1 A;  3BZD B;  4LK0 M;  3KYC D;  2GOW A;  1GUA B;  3V6C B;  2E6X A;  3U30 A;  1NBF C;  4XYC A;  4FHK A;  2O6V D;  4EZJ A;  3VR9 B;  2RMM A;  4NAW A;  1RAX A;  3AN1 A;  3APD A;  2ZZP B;  3DBL B;  4I6L B;  2K9X A;  2R2Q A;  3ZNZ B;  2NCN A;  1DOX A;  1ZPS A;  3NVZ A;  2I2Y A;  1XO3 A;  4A6Q A;  4B0E A;  1ET9 A;  2D3B A;  4ZDV A;  3BY4 B;  1L5P A;  4NY0 A;  1FM0 D;  1IGC A;  2KDE B;  5GXG B;  3IAM 1;  2WDQ B;  1VJK A;  3T9L A;  1HTQ A;  4BOZ B;  2BWE S;  3PPA A;  3AE1 B;  1QOB A;  1VD2 A;  4G11 A;  4MEL A;  1PDX A;  4A8X C;  3KQ4 A;  2FAZ A;  3AE3 B;  2BYV E;  4KIK B;  2ZEQ A;  3VRB B;  4OZB A;  1OQQ A;  4EUT A;  1AWD A;  1XF5 L;  2WXR A;  2J52 A;  1D5X C;  1PFD A;  3N9Y C;  2M0A A;  2LAS A;  4WWO A;  4W9I A;  1E8X A;  2JZZ A;  2BTE A;  2V3P A;  3AE2 B;  1YX5 B;  2SAK A;  3K9O B;  2OOB B;  2A5U A;  4M02 A;  2G4S A;  4MT5 A;  2L7R A;  2EMS A;  5LXH A;  2KVR A;  3A9J B;  3X23 A;  2KHW B;  1F0Z A;  2V3N A;  3LDZ E;  3P63 A;  3GE3 C;  4E71 A;  1JWM D;  2DAF A;  4IKG A;  2NPT A;  5JXV A;  2M8S A;  4KZ0 A;  1I4G A;  1JAL A;  1ZDX A;  4TV3 A;  4FJV B;  3TBL D;  4B0M A;  1V1P B;  1LQB A;  3D32 A;  2CKH B;  1K53 A;  3SU8 X;  1GNU A;  2KWD A;  1D5Z C;  2KDM A;  1ZXI A;  3W1Y A;  3A33 B;  1KJT A;  2FCN A;  2LGS A;  1L4Z B;  3AMZ A;  3FIL B;  1WXQ A;  1XLP A;  1TIF A;  1YQ3 B;  2KXJ A;  2XNA C;  1NI3 A;  3DBR B;  2NS5 A;  4NZL B;  4DHJ B;  4C80 A;  1OTR B;  3AEA B;  4KVG B;  3AB5 A;  3L16 A;  4CHK A;  4USA A;  4KKI A;  2QJL A;  4EKU A;  5LXI B;  1CMX B;  1P98 A;  1C9F A;  3PRP B;  2J0J A;  4AUQ C;  2BW2 A;  3TIX A;  4IDI A;  4PYU A;  2KOX A;  1QOG A;  4KSL C;  3EFC A;  5D3I B;  4YXD B;  1NYQ A;  4BKS A;  1N6Z A;  2UWQ A;  1TJE A;  1YN5 A;  2KJR A;  2L52 A;  1AN8 A;  4FJY A;  1I4R A;  1WXA A;  1PGB A;  3R2I A;  4YSX B;  3PRE A;  2N7J A;  3EHV A;  2MRP A;  2IGH A;  1WXM A;  2KVZ A;  1QT9 A;  2MW5 A;  4BOS C;  5BMI A;  2GMI C;  2YEP B;  3HRD D;  2KX0 A;  2BQQ A;  3ZDM C;  2IDY A;  2IGG A;  2BKR B;  1KOT A;  3AE9 B;  4US9 A;  4L23 A;  3NVW A;  2NMQ A;  1RLF A;  2J0K A;  5I4D A;  1JWU D;  3I63 C;  1YQB A;  4NPN A;  4W9F A;  3GZN B;  1FFU A;  3ZNI D;  1XD3 B;  3ZKJ C;  3L54 A;  1FRD A;  2KQ4 X;  4MGI E;  2JZP A;  2W54 A;  3I3T B;  2WXF A;  5EE0 A;  2KJ6 A;  3A1Q A;  3OAW A;  2E3T A;  1VCB A;  3WA0 A;  2LD9 A;  3W5U B;  3U2S C;  1V49 A;  2JX5 A;  3DHG C;  1SB3 C;  3P4P B;  1N5W A;  4G3X B;  3NS8 A;  4LDT B;  3B2G A;  2Y5P A;  2KWU B;  4URK A;  5MPO A;  3ZNG C;  4XC2 A;  3SD5 A;  2INP E;  2L00 B;  1AYF A;  1TY2 A;  1WIA A;  2K8C A;  3LXF A;  2FE8 A;  2JZ3 B;  4HK2 A;  4I6N B;  4TQ1 A;  3BK2 A;  3HVD A;  1V2Y A;  5DPR A;  4NAW B;  1YN3 A;  2INN E;  1SGH A;  4JX1 C;  5D6J B;  4A9A A;  4K81 A;  1E6E B;  4YL8 A;  2WQY B;  1OEY J;  2GBN A;  1ZP0 B;  1PQS A;  4XDC A;  5HHD G;  1T0Y A;  1VZ6 A;  3J9C A;  1C77 A;  1TS4 A;  5J17 A;  2BT6 A;  4TMA B;  1V6E A;  1TGZ B;  2PE6 B;  4ANV A;  1AAR A;  5FR3 A;  4N58 A;  2RDH A;  4FAD A;  4MM3 B;  4HLE A;  1RFA A;  5H8Y E;  2MLB A;  2MH7 A;  3Q3J A;  4RCO A;  3R8B A;  2MX2 A;  4KGR A;  2IO1 B;  1WX7 A;  1J7C A;  3DBL I;  4IOI E;  2JT4 B;  3PHX B;  3AE8 B;  5BMG A;  2NBU A;  1JRP A;  4NAM A;  3N1Y C;  5J2R A;  1WWT A;  1HEZ E;  1I4P A;  3P42 A;  2QSD A;  4GU2 A;  3PV1 A;  4L1B A;  3HK0 A;  5E6N A;  2IY0 B;  2LHE A;  2GB1 A;  4BKS D;  4JIO U;  3RN9 C;  4RM9 A;  2LVO A;  1E7P B;  3PS6 A;  2WXI A;  2N7E A;  4IM2 A;  4K7U A;  1TZO A;  4P7I A;  4NJ7 A;  3Q8F A;  5JH5 C;  1FXI A;  4HWI B;  2L8J A;  3WAN A;  2N9X A;  1GB1 A;  3NHE B;  1HZ5 A;  1UD7 A;  4US8 A;  1FEH A;  3ML9 A;  4JWS C;  1FNW A;  4YTN B;  2FUG 1;  1WM3 A;  1V1O A;  2KDB A;  4WQM A;  2FUH B;  4WJN A;  2QIE B;  2LRU A;  3PZ8 A;  3UIO B;  3P4R B;  5LLI A;  2ON8 A;  4HCN B;  5JHA A;  1HXY D;  4ZHO A;  3NUH B;  1F1H A;  4LCD E;  1EWY C;  3JW0 X;  4F7Z A;  4PS7 A;  3U8Z A;  4ANX A;  1V5T A;  3H1U A;  1GOZ A;  4ZRI A;  4LNK A;  3RZW C;  4KX6 B;  3IT6 B;  5HKH A;  3ZJT A;  1JWA D;  1WGH A;  2BWF A;  4UDU C;  3NZ3 A;  1HZ6 A;  4D2K A;  1JRO A;  4PT5 A;  1ZXH A;  2H88 B;  1L2N A;  1BT0 A;  1Y8R C;  3NVV A;  2XK5 B;  1Q1O A;  1MG4 A;  2GBJ A;  2MQJ A;  4G50 A;  1R4N I;  3EC8 A;  1WJ6 A;  2HJ8 A;  3M63 B;  4WQO B;  3AU5 A;  3WAL A;  2RDB C;  4K3C A;  5IAA C;  2RPQ A;  3QQ8 B;  1SSN A;  2X38 A;  1SJH D;  2MCN B;  4B6W A;  3UI3 A;  4MM3 A;  3MTN B;  3RCZ A;  1ZGU B;  2JVC A;  4BVU C;  2JU6 X;  1QZE A;  2QMT A;  2WX0 A;  3SEB A;  1TKE A;  5TR5 A;  4MGY E;  4AJY B;  4N9F 4;  4C7Y A;  1TKY A;  2KFK A;  4GDL A;  2KWC A;  4FJZ A;  1AW7 A;  4AOF A;  3H7S A;  4DQO C;  1FCC C;  4S0R A;  4JGH B;  1SF0 A;  3VXW A;  2K0P A;  2CHX A;  1I4H A;  2MHJ A;  1WGY A;  1KLV A;  3ZXR A;  3TEW A;  2WU2 B;  5KHO A;  5BMH A;  2BYT A;  1EM7 A;  3RNG C;  4WWP A;  4KGS A; 
#chains in the Genus database with same CATH homology
 1AWD A;  3TEY A;  1XF5 L;  2WXR A;  1ZDV A;  2J52 A;  3AE6 B;  1D5X C;  5T8I A;  1PFD A;  1B1Z A;  2M0A A;  3N9Y C;  2JSV X;  3BK1 A;  5EE3 A;  4HJG E;  1J7A A;  3ETR A;  3GB1 A;  1C79 A;  3T3N A;  2BTE A;  5BYQ A;  2WXM A;  2V3P A;  3AE2 B;  3BYY B;  4WAF A;  2B76 B;  2SAK A;  2V0G A;  3MHZ A;  4XE0 A;  4MT5 A;  2G1E A;  2N9K A;  3NS1 A;  4OVZ A;  1F0Z A;  2V3N A;  2MJD A;  3P63 A;  2Z8L A;  1XEE A;  1JWM D;  1PYW D;  3R2T A;  4IKG A;  5JXV A;  2DLB A;  1TYG B;  4ZHP A;  1QF6 A;  3WCQ A;  1ESF A;  1I4G A;  3U4E G;  3RPF C;  2CJO A;  4CQN A;  1JAL A;  2W3R A;  4XWW A;  1ZDX A;  2G9H D;  3ZJU A;  4DXG A;  4YT0 B;  1NEN B;  2JYT A;  1KF6 B;  1SEB D;  1XLN A;  1JWB D;  1V1P B;  1HA5 A;  2LJI A;  3AE7 B;  3Q8E A;  1C76 A;  1K53 A;  2KWD A;  1D5Z C;  3DWG C;  1UUP A;  2KDM A;  1ZXI A;  1L0Y B;  4OW0 A;  4AQ7 A;  2D5G A;  1L4Z B;  3AMZ A;  1ZUD 2;  3FIL B;  3BVG A;  1WXQ A;  2WXQ A;  1XLP A;  3KLS X;  1YQ3 B;  2XNA C;  2Y5C A;  5G5G A;  1ACC A;  1ZOY B;  1E10 A;  3MFG A;  1TY0 A;  2LEK A;  2SEB D;  4P6V F;  1E9M A;  1QIL A;  1NI3 A;  1E0Z A;  2EKI A;  2XN9 C;  2ZW1 A;  1FXA A;  1UWX A;  3B2F A;  4L2Y A;  4NZL B;  4C80 A;  3AEA B;  3AB5 A;  2LFI A;  2MEK A;  4WUR A;  4C7Z A;  2LMC A;  1FNV A;  1UWM A;  1RYJ A;  2V4I B;  4KKI A;  1CZP A;  3HUI A;  4USA A;  2QJL A;  2NTS A;  1SE3 A;  1C9F A;  4YWG G;  1QKZ A;  2BW2 A;  4IDI A;  5FKA C;  2CJN A;  3VRA B;  4LTU A;  3LB8 C;  1QOG A;  2N9L A;  5D3I B;  4YXD B;  1NYQ A;  1EU4 A;  2ONQ A;  1N60 A;  1TJE A;  1YN5 A;  4ZRP A;  4RGO S;  2IGD A;  2L52 A;  1FNU A;  1AN8 A;  1I4R A;  1MI0 A;  3GP7 A;  4MAC A;  1DGJ A;  2PVO D;  4A90 A;  1SE2 A;  5TSS A;  4RF1 A;  1PGB A;  3R2I A;  2PKO A;  2K22 A;  4WH4 A;  1KFY B;  1C4P A;  2M56 B;  2N7J A;  3U7Z A;  4YSX B;  4ZYS A;  2IGH A;  2GI9 A;  1F2R I;  3GS2 A;  1PGA A;  1YMH E;  1MPE A;  3OWE B;  1QT9 A;  2DBY A;  2RPV A;  5BMI A;  2YEP B;  2YEP F;  3HRD D;  2DWQ A;  1JML A;  2IDY A;  3EA6 A;  1BUI C;  2IGG A;  4XWT A;  4HRS A;  3W2D A;  3BYT B;  2W82 A;  3AE9 B;  4US9 A;  2PIA A;  4P16 A;  2Q5W D;  4L23 A;  3NVW A;  3TEZ A;  2NMQ A;  2WXP A;  1TS5 A;  1C4C A;  2HTM E;  5I4D A;  1JWU D;  2IPK D;  1JCK B;  1FFU A;  3B9J A;  1L4D B;  1M4V A;  3IT4 B;  1VR9 A;  5C2T B;  1BML C;  1L0V B;  5FK9 C;  4JE3 B;  1FRD A;  2KQ4 X;  2WDR B;  2DYO A;  3MP9 A;  5BYS A;  1YN4 A;  2KMM A;  4H2A A;  1C4A A;  5HG2 A;  2AQ1 B;  2JQR B;  2JZP A;  1NEK B;  1WSP A;  1V97 A;  2W54 A;  3P4S B;  4RH6 A;  2WXF A;  3Q69 A;  2WXG A;  2CU3 A;  5EE0 A;  3VR8 B;  4GDK B;  5HFY A;  2E3T A;  1QQR A;  4B0M A;  3E56 A;  1LO5 D;  1VZ8 A;  2KAC A;  2OED A;  4N6E B;  2OHF A;  4C56 C;  1YJI A;  3W5U B;  3U2S C;  2JX5 A;  1SB3 C;  1D6E C;  3P4P B;  2AQ2 B;  1IGD A;  1N5W A;  2BB6 A;  3BWU D;  1T5X D;  3B2G A;  2GRI A;  2Y5P A;  1VLB A;  5MPO A;  1KLU D;  2VZK D;  1D4B A;  2WLB A;  1T6B X;  2INP E;  2WXH A;  5H92 C;  3P4Q B;  1AYF A;  3Q8A A;  2DYM A;  1TY2 A;  5EE1 A;  2WDV B;  3LXF A;  2FE8 A;  4ZOH C;  1ET6 A;  1FRR A;  1YJJ A;  5HI1 A;  4KKJ A;  2AX5 A;  2QIL A;  1IBX A;  4TQ1 A;  3Q8B A;  3W5V B;  3BK2 A;  4A55 A;  1N63 A;  3HVD A;  1F2R C;  1FIQ A;  4NAW B;  1YN3 A;  2INN E;  2IJ0 A;  3H8H A;  1STE A;  4JX1 C;  4LLG M;  2PMV A;  4A9A A;  3VQI A;  1E6E B;  3P1M A;  1T3Q A;  4DXF A;  2WQY B;  3CWI A;  4YTP B;  1ZP0 B;  3CIR B;  4XDC A;  2L1A A;  4AS1 A;  1K52 A;  1VZ6 A;  4ARC A;  3J9C A;  3EUB 2;  1C77 A;  1TS4 A;  2BS3 B;  2BT6 A;  3I57 A;  3NRZ A;  4TMA B;  4M0W A;  1NVI D;  2QEJ C;  1CJE A;  2RDG A;  2Y3A A;  2JYE A;  3AV8 A;  3IXS A;  1IUE A;  1L0X B;  4HRO A;  2N0S B;  2JXT A;  1QLB B;  1GPX A;  1VZ7 A;  1OFF A;  1SJE D;  3BII D;  5FR3 A;  4REZ A;  4N58 A;  2RDH A;  1FCL A;  1P7E A;  5AUK A;  4RGN A;  4MM3 B;  1MVK A;  5H8Y E;  2FBW B;  3ZJV A;  1VRA B;  2WU5 B;  2MH7 A;  4XDD A;  4JPS A;  4RCO A;  3ZGZ A;  3R8B A;  4RF0 A;  3URY A;  3MC0 B;  1XCQ L;  4KGR A;  1Q10 A;  3SR6 A;  2R61 A;  1KRH A;  1L6V A;  3BVZ A;  3TUO A;  3IAS 1;  4N59 A;  3FIL A;  2ZW0 A;  1DOI A;  4JWU C;  1J7C A;  2WNM A;  4IOI E;  2J53 A;  3AE8 B;  2WP9 B;  5BMG A;  3FAH A;  1SBB B;  2WXN A;  1JRP A;  1PUT A;  4NAM A;  5G5H A;  1WWT A;  1HEZ E;  1I4P A;  3E9S A;  1KTK A;  3P42 A;  2QSD A;  2I38 A;  3PO0 A;  1V8C A;  4L1B A;  1L6U A;  1XXG A;  4ITK A;  4YTM B;  4GDL B;  3ZQ4 A;  3TSS A;  2LHE A;  2GB1 A;  3V05 A;  3KWL A;  4OZA A;  2PW9 A;  1I4Q A;  1D5M C;  1MHH E;  1E7P B;  1PGX A;  2WXI A;  1BXT A;  4WIP A;  3SFE B;  1ENF A;  1TZO A;  3SFD B;  3RFZ B;  3MJ5 A;  3Q8F A;  4RNA A;  2J4X A;  3AEB B;  1DYQ A;  4YSZ B;  1FXI A;  3TEX A;  1NYR A;  2WXO A;  1K51 A;  2KAJ A;  2BS4 B;  1KH0 A;  3LYY A;  1RWS A;  1GB1 A;  1HZ5 A;  1RFK A;  3AEF B;  1EWC A;  2W55 A;  3NVY A;  4RFB A;  1SIJ A;  1TKG A;  1B9R A;  4US8 A;  2HDE A;  1FEH A;  4Q2J A;  1GB4 A;  3AEE B;  4JWS C;  1FNW A;  2ACZ B;  4YTN B;  4RGT A;  4R3D A;  2FUG 1;  3O13 A;  3FC4 A;  1V1O A;  4NJC A;  5LNK 1;  1VDV A;  4WQM A;  1EU3 A;  1ROE A;  1FFV A;  1F77 A;  2QIE B;  2WXK A;  1J7B A;  3PZ8 A;  2LUM A;  1CK1 A;  4FXC A;  2M19 A;  3P4R B;  2LGI A;  4OHJ A;  1UNS A;  2TSS A;  1JW9 D;  1N61 A;  3U52 E;  5D3D A;  1IBX B;  1OQR A;  2ON8 A;  1JWS D;  3AM9 A;  2NTT A;  5E6J A;  1WRI A;  4OZC A;  3PZ7 A;  5BYR A;  1HXY D;  4ZHO A;  4ZRQ A;  3NUH B;  1FMA D;  2BBC A;  1V1P A;  1EWY C;  4O1N A;  2KN4 A;  1R7S A;  2PVG C;  5C3J B;  1DOY A;  3KWV A;  3AE5 B;  1GOZ A;  1N62 A;  1WYG A;  3AEC B;  3HVZ A;  1QOF A;  4ARI A;  4KX6 B;  4WWM A;  1WGK A;  2BS2 B;  1SE4 A;  3IT6 B;  4EE2 A;  3ZJT A;  1JWA D;  2ICI A;  4UDU C;  3NZ3 A;  1HZ6 A;  3L4P A;  4D2K A;  4TQ0 A;  3AEG B;  1JRO A;  2W3S A;  4PT5 A;  1ZXH A;  3AH7 A;  2H88 B;  2WXJ A;  3V3X A;  3T3O A;  2H89 B;  4TSS A;  1SXT A;  1QOA A;  1XCT L;  2PTL A;  3NVV A;  1YQ4 B;  4YSY B;  3EGR A;  2VZK B;  1TS3 A;  5EE9 A;  3C8Y A;  3BZD B;  4LK0 M;  2L32 A;  1CQV A;  2JWU A;  4KGT A;  2E6X A;  2K5P A;  1XLQ A;  1K50 A;  3VR9 B;  2RMM A;  1A70 A;  4HKZ E;  2MJE A;  4J3O D;  1SSN A;  2X38 A;  3AN1 A;  1SJH D;  3AED B;  3UI3 A;  3I9V 1;  2WS3 B;  3ZYY X;  1N5X A;  2EEL A;  2K9X A;  2L83 A;  3BVM A;  1C78 A;  4MH8 A;  4HKQ A;  3W9C B;  1DOX A;  2JU6 X;  1ZPS A;  3NVZ A;  5D7G A;  1FO4 A;  1MHX A;  2QMT A;  2I2Y A;  4HEA 1;  1TKE A;  3SEB A;  1GAQ B;  1XO3 A;  1TS2 A;  4A6Q A;  4GLS C;  1I7H A;  4B0E A;  1ET9 A;  3W1S A;  4C7Y A;  1L5P A;  1TKY A;  1HQR D;  1FM0 D;  5AUI A;  1IGC A;  2J42 A;  4RGM A;  5GXG B;  2WXL A;  3IAM 1;  3DWM A;  1AW7 A;  1KLG D;  2WDQ B;  1VJK A;  3AE4 B;  4DQO C;  1FCC C;  1SF0 A;  2MJ3 A;  2K0P A;  3AE1 B;  1QOB A;  1JQ4 A;  1PDX A;  4A8X C;  3KQ4 A;  1FD6 A;  1I4H A;  1YNT E;  3AE3 B;  1ZE3 D;  3ABV B;  2PLP A;  1UGJ A;  3TEW A;  1Y56 A;  2WU2 B;  1P7F A;  3VRB B;  2K3U A;  5BMH A;  1XLO A;  2AQ3 B;  2LHD A;  4OZB A;  2BYT A;  1I4X A;  1OQQ A;  2BB5 A;  1EM7 A;  1RM6 C;  3Q8C A;  5HHD G;  4KGS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...