5GXGB

High-resolution crystal structure of the electron transfer complex of cytochrome p450cam with putidaredoxin
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
106
structure length
106
Chain Sequence
SKVVYVSHDGTRRELDVADGVSLMQAAVSNGIYDIVGDCGGSASCATCHVYVNEAFTDKVPAANEREIGMLECVTAELKPNSRLCCQIIMTPELDGIVVDVPDRQW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of productive and futile encounters in an electron transfer protein complex
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase/electron transport
molecule keywords Camphor 5-monooxygenase
total genus 31
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2016-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5gxgB00
2K5PA 4N59A 1J7CA 3FC4A 1QOFA 3NRZA 1JWAD 1RWSA 2DWQA 1L0VB 4YSXB 1DGJA 2JQRB 1E9MA 2Q5WD 4IDIA 3AH7A 1XO3A 1KFYB 1N5XA 2KMMA 5AUIA 4ZOHC 3P4RB 4WWMA 1NVID 1YJJA 2WDVB 1GAQB 1WWTA 1ZXIA 3B9JA 3VRAB 4A9AA 4KX6B 1T3QA 4HRSA 5EE9A 1KF6B 1E6EB 2MH7A 3AE5B 2K22A 3DWGC 3NVZA 1YJIA 4C7ZA 1L6VA 3HVZA 3P1MA 1ZP0B 3B2GA 4JX1C 1R7SA 3NS1A 1FIQA 1FO4A 1TKYA 1V97A 2WDRB 4LTUA 1QLBB 4HROA 3EUB2 2ACZB 3AE8B 1XLNA 3AEBB 1QOAA 1RM6C 2BS4B 2H89B 3AEEB 5EE3A 3AE3B 4C80A 1E10A 3ETRA 1N63A 1SB3C 5AUKA 1A70A 1QT9A 3NVYA 3WCQA 5MPOA 1JQ4A 1TJEA 2PVGC 3CIRB 4WQMA 4YXDB 1FM0D 1OQRA 1PFDA 1NI3A 3P4QB 1FFVA 1N62A 1WXQA 1OFFA 2CJNA 3AE2B 1WYGA 2M56B 1YQ3B 3AE4B 1FRRA 1QOBA 3AE7B 1N60A 1VJKA 2WDQB 2EKIA 2QJLA 4N6EB 3LB8C 2WQYB 2WS3B 1CJEA 1TKGA 2HTME 3PO0A 5C3JB 3ABVB 1TKEA 1JW9D 2N0SB 2WU5B 5GXGB 3VR8B 4YT0B 1FXIA 3ZYYX 4YSZB 1JALA 2QIEB 1SIJA 3DWMA 4P6VF 4JWSC 5C2TB 5H92C 4C7YA 3CWIA 4USAA 5G5HA 2WU2B 1NYQA 1YQ4B 2JX5A 3AE9B 3P63A 4YTNB 1VDVA 5G5GA 2L52A 3NVVA 3AEAB 4FXCA 1N61A 1GPXA 1XLOA 2Y5CA 3AECB 3AM9A 1CZPA 1EWYC 1N5WA 2KAJA 1RYJA 3P4SB 5EE1A 2BS2B 1F0ZA 3AEFB 1J7AA 3LXFA 1JRPA 2PVOD 3AV8A 4ITKA 2H88B 2WLBA 3AN1A 1VLBA 4US9A 4YSYB 2CU3A 1NENB 1SF0A 2W3RA 1OQQA 2MJ3A 3AB5A 1AYFA 2DBYA 3SFEB 2BS3B 4YTMB 1JROA 2MJDA 1ZOYB 2AX5A 2W55A 1XLQA 2L83A 3L4PA 2BT6A 1B9RA 3NVWA 2MJEA 2W54A 3BIID 3P4PB 4N58A 1ZUD2 1DOYA 3AEGB 4JWUC 2G1EA 3RPFC 3AE6B 3AMZA 2K9XA 1QOGA 3KWLA 4YTPB 1NEKB 1NYRA 1FFUA 1J7BA 1V8CA 1E7PB 1FMAD 2M19A 2PIAA 3HRDD 3W5UB 1RFKA 1ROEA 1PDXA 1XLPA 2CJOA 1IUEA 2PKOA 3B2FA 3SFDB 3W5VB 4ZHOA 1DOXA 3W9CB 1QF6A 2W3SA 3AEDB 1FXAA 1WGKA 2B76B 3AE1B 4US8A 3SR6A 1KRHA 3VRBB 2WP9B 1L5PA 2FBWB 1DOIA 1I7HA 3HUIA 1E0ZA 1JWBD 2E3TA 5H8YE 1WRIA 1TYGB 3FAHA 1UWMA 1PUTA 2LEKA 5EE0A 2OHFA 1AWDA 4ZHPA 1FRDA 1L6UA 3VR9B
chains in the Genus database with same CATH superfamily
3IHPC 4ZYSA 2JXXA 3UQAA 3B1LX 4ANXA 3DOWA 4HCNB 2K3UA 1ZP0B 1BT0A 2KDEB 1FO4A 1YN3A 1EU3A 3ML8A 1HZ5A 2QHOA 1QOAA 4J6IA 1V1OA 3MTNB 4L1BA 2ZW0A 4OVUA 4RM9A 1MFWA 4RFBA 4C56C 4EFOA 2LD9A 1PGXA 4FHKA 4C4VB 3JW0X 4JPSA 4BOSC 3PVLA 1D5ZC 2LWPA 1QOBA 2DHZA 1A5RA 3APDA 2AYOB 3L08A 4HDQA 2MP2A 2V1YA 4GXBA 1WR6E 1TKEA 2NBUA 3DBRI 2KTRA 4JWSC 1SBBB 4USAA 2NBWB 2BPSA 4IKGA 3P63A 2MSED 2KTFA 4G50A 4KDIC 3AECB 1C77A 2K0PA 1MG4A 2O6VD 1C79A 3ZTCA 1Q1OA 4PK1A 3V60A 3KYCD 1DOYA 4HPPA 1L2NA 4GMVA 1S1QB 3T8MA 2MEKA 3AMZA 4B9KA 1SGHA 2VH2A 4HDOA 3V3XA 1WZ0A 3PZ7A 4EEWA 2INNE 1HTQA 1K8RB 4A8XC 1YN5A 2W3SA 1Y8RC 1XQQA 4TQ1A 4GDKA 1I4HA 1L5PA 4PS3A 1C4AA 5FKAC 1RRBA 4ARCA 1CMXB 3LJ3A 5EE0A 3JVZX 3VR9B 3AU5A 3PLVA 2WXFA 1P3QU 2PE9A 2UYZB 3ZJTA 4XYCA 1NVID 2KWVB 5D94A 4ZRQA 2IY0B 4C7ZA 1I35A 1HQRD 3MJ5A 3QQ8B 1ZW7A 2CU1A 3W1SA 1RM6C 1WGDA 3C0RB 3AE3B 3PRPB 1QQRA 2XK5B 1WXSA 5D3DA 1RAXA 3K9PB 1WXQA 1HE8A 2MBOA 3T9LA 3ZNID 2JXTA 3ZJVA 1TIFA 2HTME 2D10A 3VR8B 2WU5B 1SIJA 3CWIA 1NYQA 2RGFA 4MDKE 2C5LC 3P4SB 2DX5B 1RYJA 2KFKB 4NJCA 3TSSA 4MGIE 2L00B 4WJNA 3DHIC 4YTMB 5JH5C 4ICVA 3HIZA 1XLQA 1ZPSA 3L4PA 2TSSA 4BFRA 3PRMB 1I4GA 2KK8A 2XK5A 1XCTL 1ROEA 1IBXB 2PKOA 1P1AA 3AI5A 3LDZE 5LXHA 5AZHA 2WDTB 3B0AA 3KQ4A 4RH6A 3X23A 4P1CC 3L16A 3KVFB 2IDYA 2BWES 3R2IA 2K5PA 3Q8EA 4I6NB 2MP2B 3ZLZA 1WRDB 2ZW1A 1E9MA 4IDIA 3HK0A 1VR9A 3P4RB 5KHOA 1M4VA 1YJJA 2OOBB 1D5XC 4IW0A 2MH7A 2K22A 3DWGC 1HZ6A 3SU8X 2IGHA 4XWWA 5E6PA 4K1RB 5J17A 3EUB2 2O2VB 3AEBB 1VRAB 3RT3B 3DVGX 5JHAA 3H7PB 5AZFA 3CF6E 5HKHA 1R4MI 1D3ZA 1N62A 4DBGA 4JQWC 2CJNA 2M56B 2BYEA 1SE3A 1D4BA 3J9CA 4N6EB 1V9JA 5HI1A 1LQBA 3RNCC 3OJ3A 4W9DA 2JY6A 4A55A 5G5HA 3V61A 2KN5A 5TSSA 1E7UA 2QILA 2Y5CA 1N5WA 2KQSA 5EE1A 1I4PA 1I4QA 4YSYB 2H88B 3MJWA 4M0WA 4MH0E 1OQQA 2K39A 3IVFA 3QARA 1D5MC 3NZUA 3CMMB 5AEKB 4C4VA 1MHXA 2L83A 3P4PB 3JYUA 2K9XA 1QKZA 3Q8BA 2KFJA 2LHDA 2Z0DB 4BKSD 3JSVB 2ZVNA 3QA8A 4KGSA 3SR6A 4LNFA 2FBWB 4MM3A 5H8YE 5HG2A 3AU4A 4ZHPA 5E6OA 1UGJA 1K51A 4ZYNA 2G4SA 4M02A 1L0VB 1EM7A 4GOCA 3V6EB 1UBIA 4DK5A 4HKZE 3FKYA 3ENEA 3ZKJC 1ZDVA 3RMKC 1UD7A 2KX3A 2G4DB 4FADA 5BYQA 4C80A 4EZJA 4IC7B 1UGMA 3A4SC 2QEJC 1QT9A 3U30A 3DVNU 5JHBA 1KM7A 5D3IB 3QC8B 3DBHI 4HCPB 1C78A 4EZLA 1FD6A 2K1FA 1WYGA 3I5JC 3A33B 5BMGA 3BYYB 3URYA 2N7JA 4WJOA 1F2RC 1KTKA 1FXIA 2WWZA 4HWIB 3AULA 2WXIA 4KKJA 1LO5D 1UWXA 4BKTA 2KACA 1Y56A 1NI2A 5LLIA 3RNBC 3AEAB 4FXCA 2MRPA 3AM9A 3RNFC 4F7ZA 1JRPA 3PSEB 3PREA 2L8JA 1TZ1A 2BB6A 2LGYA 2WXQA 3DPDA 2J7QB 3KUZA 4B0EA 2VZKB 2GRIA 2W82A 4ZDVA 4NJ6A 2ON8A 3RZWC 3BWUD 3W9CB 2LVOA 2NR2A 4RMAA 4EUTA 2WP9B 3IT4B 1WM3A 1WE7A 1WRIA 2R2OA 1UWMA 3HVDA 4K7UA 3R2TA 4GDKB 2MX2A 1SJED 1WMHA 3V62A 3NRZA 3TMPB 1EF1A 1WGYA 5KHQA 4ZOHC 2N4FA 4BOZB 4RNAA 2NS5A 4ANVA 1M94A 4FJZA 2NPTB 1J8CA 2BW2A 4RGOS 1V5TA 1VZ6A 4FA6A 3O13A 2ASQA 1GJZA 1KH0A 2K6DB 4OZAA 4ICUA 2PVGC 2JWUA 4JGHB 3PRZA 3I3TB 1L0XB 2WXJA 4WWPA 3R7QA 1GG3A 4HK2A 1VZ8A 2KWCA 3LB8C 3EA6A 2DZMA 1KOTA 1YD8U 3MFGA 5H92C 2WU2B 1YIWA 3RI7C 2G3QB 4REZA 5G5GA 4M8NA 4P7IA 1EWYC 2L05A 2ZPNA 4NY0A 1P98A 4TMAB 3ZJUA 4GGQA 3AB5A 2UWQA 3SFEB 3RYTA 3QHTA 2L0TA 3SDLC 1LM8B 4H2AA 5HFYA 2DYOA 2AQ2B 3NVWA 2HJ1A 1YMHE 3Q8FA 4TSSA 2KKCA 3BZDB 4S17A 1E7PB 4TQ0A 2GLSA 3SFDB 1WJUA 2LXAA 3P42A 1V5OA 2B76B 1UH6A 1XF5L 2L0FA 3CSTA 5BYSA 3Q3MC 2GBRA 2WX1A 2JPHA 3A9JB 3FAHA 1EU4A 3W2DA 5AZGA 1FCLA 2LGSA 4HVBA 2QCZA 4AQ7A 2ZJDA 2KMMA 4DXFA 3RNEC 2MBQA 1GAQB 4XWTA 1YJIA 1E5WA 2C60A 4MEMA 5C1ZA 2ACZB 2LGXA 3DBLB 2KWUB 3H9DA 2JU6X 4HJKA 1E7VA 3CSFA 3TL5A 1CK1A 1PGAA 1KLGD 2KTRB 2NMQA 5TR5A 2IYDB 1V1PB 3ZW3A 2WQYB 4HPLB 3UINB 2GBJA 3ECIA 4YT0B 3PLUA 2KMCA 2MCNB 1FNWA 1DYQA 2KAJA 2L32A 2WLBA 2XEWA 3AN1A 4LJOB 2MBEA 4AUQC 5DPRA 4GLSC 2KVZA 5D6JB 2M17A 4BBNF 1GB4A 1UZXB 2W55A 4FJVB 3SD5A 4A20A 2NTTA 3M95A 4IWPA 2G1EA 1YX5B 3U7ZA 2JT4B 3W5VB 3N20C 4YL8A 1WGKA 2J0JA 2REXA 3AE1B 2J53A 4IM2A 4KZCA 3ZNHB 1IGCA 3Q2AC 2RPVA 3ZXRA 4KSKC 2KC1A 1IPGA 5CTRC 2N9XA 4BVUC 1STEA 1QOFA 1GOZA 3PTFC 4YSXB 4DXGA 3BVGA 1C1YB 3EECA 2PEAA 4O1NA 3KYDD 3NJTA 2MW5A 3PHWB 4C00A 3AEEB 1T0QC 3N30A 3ZVVA 5AUKA 1JWMD 4LDTB 3DHGC 1XD3B 3NOBA 3M63B 4W9FA 1L0YB 3ZRCA 4GSWA 2YVCA 2FAZA 3GB1A 1N60A 4I6LB 2MWSB 5C3JB 4GIVA 2D07B 2BGFA 2FNJB 4NAWB 2IGGA 3QWZB 3EGRA 3E56A 2IZVB 3QK0A 4ACFA 2PVOD 2WHIA 2ZCBA 3PGEA 5DCNA 3H7PA 1FNUA 2LMCA 4RGTA 3UI3A 2MJDA 1K50A 3R66C 2AX5A 4XX5A 2CKHB 5L83A 2GBKA 3DBHB 3VAWA 1QOGA 3KWLA 2M19A 1J7BA 3R3MA 3QJZA 4NAWA 1NDDA 4BKSA 3QCAA 2LJIA 4MELA 1TGZB 1YN4A 2KFKA 4MT5A 2KHWB 1DOIA 1I7HA 4ARIA 4DWFA 1JRUA 3WAPA 1LFDA 2K8CA 2BB5A 4K3BA 3GS2A 2EMSA 4A3PA 3R7RA 2N9LA 3PT2B 4FLHA 4EE2A 3ZIMA 1EO6A 4JL9A 4WWMA 1YJ1A 4OVZA 2IPKD 4KX6B 4W9JA 3AE5B 2GB1A 4NPNA 2RDGA 2Z8LA 1FIQA 1ACCA 2Y5PA 2DZKA 3MP9A 3IAM1 2JYTA 2CR5A 2NVUI 2WYQA 3MC9A 4JE3B 3DVGY 3WAMA 2WXNA 4OW0A 2LGIA 1N6ZA 4IM0A 2D3GA 5BYRA 2DYBA 4FN2A 2CS4A 1F2RI 1V6EA 3U7DA 1KJTA 4J3OD 1FRRA 3MHSD 4GB9A 3TEZA 2JUOA 2W9NA 2N1WA 3TEWA 3VUWA 5GXGB 2V4IB 2LRUA 1T5XD 2V3NA 3Q3FA 2KLCA 1ET9A 3S2AA 3OG5A 3PHXB 3VXWA 1ZDXA 2AWTA 1SJHD 2IO3B 2N9KA 3WALA 1E8WA 1F0ZA 4W9LA 4L23A 1B1ZA 2C7NB 4WIPA 1NENB 3AXCA 3UIPB 1VZ7A 2IBIB 3JSVA 3K9OB 4PYZA 2IJ0A 1JCKB 2INDC 1TS4A 3W1SC 4HEA1 3X0WA 4B95A 3ZO5B 1YOVB 1C3TA 3L13A 1SE9A 1UUPA 3BVMA 2V3SA 1MI0A 3TBLD 1R4NB 4HXDA 1RLFA 2V4LA 2KANA 4A3OA 2BWFA 3APCA 3N1ZC 1WH3A 4WWOA 3VTVA 3Q6BA 3TEXA 1WFYA 2LEKA 2RPQA 4DHZE 4E71A 1I42A 1FRDA 3VQIA 1X1MA 3ZGZA 1DGJA 2JQRB 3ZTDA 1XO3A 1N5XA 1ZXIA 5EE9A 3RZFA 1KF6B 1L4ZB 3NVZA 4KDLB 1R4MB 4JX1C 2C7MB 2M0XA 4HROA 2I2YA 2WNMA 2BS4B 2JSVX 2KWDA 2E6XA 1E10A 1SB3C 4BAXA 1JQ4A 1F77A 2INPE 1JMLA 3CIRB 4YXDB 1C4PA 3GZNI 4HLEA 2JVCA 2LRWA 2YLMA 5DPTA 1YQ3B 4KVGB 2WXRA 1ZKHA 4DHJD 4WJQA 1UNSA 2SAKA 4JLCA 2FCQA 3EHVA 1UELA 3HM6X 3VUYA 4P6VF 2WXLA 4A6QA 4C7YA 2OJRA 3HHMA 3DHHC 3MC8A 3NVVA 1N61A 1H4RA 5FK9C 3VH3B 2BS2B 3AEFB 3ZNZB 4IM3A 1YX6B 5IA7A 4US9A 2W3RA 1LGRA 4RF0A 3UGBB 4EKUA 4CQNA 4E74A 5CX3A 2HE7A 3WA0A 2IGDA 2J0MA 2N7DA 2BT6A 1HTOA 2KVRA 3M3JA 1F9JA 3W1YA 1FFUA 2D3CA 2MQJA 1QZEA 1PDXA 2LFIA 4WAAA 4N9F4 2Z59B 3DBSA 2M8SA 1I4XA 2JRHA 1EUVB 3BINA 1JWBD 3ZDMC 5J18A 2KDIA 2WXPA 3A9KA 3APFA 2QSDA 1IBXA 2FE8A 3RCZA 2DWQA 5J2RA 3Q3NC 1U4AA 5AUIA 4LNNA 4HRSA 4PYUA 1WXAA 4TUUA 1L6VA 3U4EG 2YEPF 1R7SA 3KUCB 2KD0A 3N9YC 4X57B 3ZNGC 2RR9A 1WJNA 2N9EB 4ANUA 1N63A 1OTRB 3A1QA 1MJDA 3DQVA 3GZNB 1T0YA 3IT6B 2WXOA 2MLBA 1V81A 2I38A 3UQBA 4KKIA 3QIJA 2PPHA 2QJLA 3VHTC 3IG3A 1EWCA 1V80A 2V0GA 2Y5BB 2KN4A 4KGTA 1XEEA 2GOWA 1YQ4B 3Q8CA 4W9HA 3PZDA 2LHEA 4MGYE 4KV2A 3KLSX 1Z5SB 2KNBA 1WXVA 1PYWD 2GMIC 2KJRA 2ZZPB 4WWNA 3ZQ4A 1J19A 4N58A 1AN8A 1UBQA 1JWUD 2FCMA 3BY4B 2DLBA 2RSUA 4YTPB 4DDID 4G0NB 1V8CA 1Z2MA 4NQKE 4PT5A 2O6VB 2KDFB 2B3AA 2NBVB 1KRHA 5CHFA 4IUMB 1E0ZA 4RF1A 2KMAA 4G11A 3ZUNA 3H1UA 1PUTA 2MHJA 4RGMA 1L6UA 3ZDTA 1BMLC 4KGRA 1PGBA 2Q5WD 3AH7A 3FILA 3SEBA 1WJ6A 2PTLA 4LDTD 4K81A 4JIOU 3RUIB 3VRAB 3RULA 3OAWA 5BMHA 1TKYA 2WDRB 3L0WB 4LTUA 1QLBB 4DHJB 4MSMB 1R4NI 2KJ6A 4XGAB 5MPOA 2NPTA 4IWQA 3V05A 3P4QB 2R2QA 2R61A 4K7SA 4LLGM 1OFFA 2ZVOA 1TBEA 4QAYA 1SEBD 2G9HD 2WS3B 4M0WB 3U52E 2L1AA 2ZEQA 3ABVB 2C9WB 4P16A 2ICIA 2J52A 3NUHB 2ZNVB 2JRIB 4ZRJA 4HJGE 2K6QA 3OLMD 1VDVA 3BVZA 4RM8A 1CZPA 4W9CA 1TY2A 4MGZE 2A4ZA 3LXFA 2M4NA 3AV8A 2XBBC 3PPAA 2PW9A 3ONSA 4OHJA 4L2YA 3V6CB 3DBRB 2WXKA 1AYFA 1JROA 2FUG1 1UF0A 2YEPB 2BTEA 2MJEA 4TV3A 1ZUD2 3EFUA 4Q2JA 1SSNA 3M62B 1C9FA 5LXIB 3U8ZA 3T3NA 1IYFA 1S3SG 3VVWB 1F52A 2LVQA 1P0RA 5D7GA 3C8YA 1P7FA 1XT9B 2KX0A 3QAQA 1SXTA 2JF5A 2IO2B 2D11A 1WSPA 1FMAD 1ZXHA 1LXDA 2ONQA 2BYVE 4ZRPA 1GC7A 1V1PA 3SHQA 1D6EC 5FR3A 3H8HA 2VH1A 2FUHB 4FHJA 3A9JA 3I63C 1GB1A 1FEHA 4KSLC 1E90A 3LYYA 2KO3A 2PJHA 4MM3B 2RDHA 3P1MA 3OJ4B 3NS1A 2AL6A 3UIOB 3ML9A 4UDUC 1KLUD 1L7YA 1WYWB 4K7WA 5IO9A 3PV1A 3GE3C 2D3BA 5L95C 4NZLB 2GBMA 5IOIA 3RN9C 3WCQA 4A90A 3BK2A 4CO7A 2DENB 1FXTB 1VCBA 3PZ8A 3VFKA 5BO4B 2V3PA 5CHWA 2AQ3B 2FIDA 2BBCA 3NHEB 2FIFA 2DYMA 2LJ5A 4YSZB 3DWMA 2KDBA 4YTNB 4ASWC 2L52A 3VH4B 4R3DA 3KW5B 2Y3AA 1L4DB 4PS7A 2DAFA 2CU3A 1SF0A 2RDBC 3E9SA 3N1YC 3IFWB 1ZOYB 2BKRB 5E6NA 2KYWA 2PE6B 1XCQL 2X8XX 1B9RA 2JZPA 3TUOA 3DBLI 5IKCM 3AE6B 4MJSB 3HRDD 2KXJA 1XLPA 4RCOA 1TS3A 2O2VA 1ZGUB 4MACA 3AEDB 1FXAA 4EOYA 1FPYA 4K3CA 3IBEA 4F1SA 2WGSA 5LNK1 2WXHA 4DDGD 2LVPA 1TYGB 1OGWA 4LNKA 2EKEC 4MSQB 2K8HA 3RD2A 2KQ4X 2VRRB 4M8MA 1P7EA 4FULA 3NY5A 3T3OA 4A9AA 3B08A 3VTWA 3GP7A 2DAJA 5GMVA 3L54A 5DPWA 2DZIA 4RGNA 4YWGG 2KOXA 3Q69A 1IGDA 1GC6A 2MBBB 2IO1B 2BVCA 1F1HA 1JWSD 4AJYB 4BZAA 4W9GA 2DZJA 3ETRA 1NBFC 2PLPA 2WXMA 5JZEB 4D2KA 2FCSA 4IG7B 2BYFA 1FM0D 3OWEB 4LJPB 2G45B 2KLGA 1MPEA 1WIAA 3AE7B 4ANWA 1OEYA 3H7SA 4NNJB 4AOFA 2LUEA 3QX1A 2OEDA 1TKGA 4FBJB 2CHZA 2N0SB 2GBNA 4LNIA 2GI9A 1J0GA 3NZSA 1V2YA 1RFAA 2KT7A 4B6WA 3N1XC 1VD2A 2JZ3B 2L76A 1V49A 1WR1A 1P9DU 2XNAC 4XDDA 3NZ3A 2EMTA 1TY0A 3H6NA 2V9HA 1TS5A 1T0SC 4MJSA 4WQOB 3EFCA 4AWJA 2X38A 2HDEA 3BIID 2KDMA 2DNFA 2XN9C 3Q8AA 3AEGB 4JWUC 1NEKB 1NYRA 3W5UB 2LASA 5T8IA 1CQVA 4WH4A 1WX9A 4AP4C 1MG8A 2HTHA 4DHZB 3Q3JA 1KLVA 2NTSA 1J7CA 4GN1A 3FC4A 1BUIC 1JWAD 2KJHB 1HEZE 2AEHA 1FCCC 3TIXA 1WE6A 1GNUA 2D3AA 4M00A 5C23A 1T3QA 1E6EB 3GE8C 1WY8A 3HVZA 1OEYJ 1SE4A 4FJYA 1XLNA 4BKGA 1TT5B 2H89B 3EC8A 4TKNA 1SE2A 4II2B 5D2MB 2N7EA 4I6PA 3NG0A 3KWVA 3MC0B 3RFZB 4AS1A 2BQQA 1WJ4A 3IXSA 2LUMA 1EF5A 4II3B 1NI3A 3TEYA 3WIMA 2M0AA 4OZBA 3AE2B 3FILB 3AE4B 3ZRFA 2CHWA 2EKIA 4MGKE 2LZ6A 2WX0A 1CJEA 1JW9D 5G55A 5IAAC 1ZE3D 1SIFA 3AE9B 3VDZA 4KZ0A 1ESFA 1V86A 2JYEA 4OVVA 2O6VA 1YNTE 4IWOA 1WI0A 5IP4D 4LK0M 4XE0A 2MJ3A 4ZRKA 3C19A 3RNAC 2AQ1B 4B0MA 2OJWA 2I1KA 2LGDA 1ISNA 2NCNA 2Z0EB 2MBHA 4GU2A 3RNGC 1WX8A 1GUAB 2PIAA 1RFKA 2CJOA 3B2FA 4AJWA 1HA5A 3BYTB 2KQ7A 1WMHB 4F8CB 3VRBB 4KIKA 2KZRA 1E8YA 3PS6A 3GOEA 2PMVA 3TCAA 2OHFA 1AWDA 4N59A 1QILA 4HPMB 3WANA 1RWSA 1YQBA 1TZOA 2K8BA 2WDVB 3B9JA 5CHVC 4OZCA 3VTUA 1K52A 3B2GA 4M01A 2MA9B 3MHZA 1V97A 4W9KA 2LI5A 5G2NA 3Q3OC 4NAMA 1K53A 3A1QB 3KUDB 4IOIE 4WAFA 1A70A 3BK1A 3NVYA 1TS2A 2ZPYA 2FCNA 1TJEA 2JWZA 1MVKA 3ALBA 4WQMA 4XZ4A 2EELA 1PFDA 3KH0A 2ZNVC 1E8XA 5BMIA 4GDLA 3N3KB 2ZCCA 4DXAB 4EZKA 4GDLB 1H8CA 4NJ7A 2N1VA 1JALA 2QIEB 1AARA 4MH8A 2J42A 5E6JA 2RMMA 2J0KA 2HJ8A 1Q5WB 1ET6A 2JZZA 1VLBA 5IN7A 1XXGA 3UF8A 1E8ZA 2BS3B 5FR6A 4CYEA 5JXVA 4PS8A 1WGRA 2D2QA 2L3ZA 1HXYD 2QDFA 2W54A 3N32A 1FNVA 2I1JA 3TJPA 1IUEA 4ZHOA 4LNOA 1QF6A 2IO0B 4W9EA 4G3XB 4US8A 4P1BC 2KC2A 3NS8A 3A4RA 3HUIA 3IAS1 3I57A 2K25A 2BKFA 4CHKA 4NQLB 3R8BA 4E3CA 1KFYB 2A5UA 1MHHE 1WWTA 1WM2A 1ENFA 3L17A 1C4CA 3HM3A 1Q10A 4XDCA 4DQOC 3DDCB 3AE8B 1T0RC 1AW7A 1C76A 5EE3A 2WXGA 5I4DA 3VUXA 3ZXVA 2QC8A 2HD5B 3A9KB 2SEBD 1I4RA 1OQRA 4W9IA 1G6JA 1FFVA 5DPSA 4KIKB 1WZ3A 4HKQA 1VJKA 2D5GA 2WDQB 3PO0A 3DCGA 3I9V1 3ZYYX 3DVNV 5HHDG 1WX7A 5C2TB 2CHXA 2BYTA 2BF8B 2JX5A 1Q0WB 1GPXA 1XLOA 3P2BA 2L7RA 1J7AA 1T6BX 3U2SC 4ITKA 4WURA 2C7HA 3L10B 2J4XA 2M1MA 2DBYA 3Q14C 1BXTA 4ZRIA 2IY1B 4URKA 1WF9A 2N9PC 2RD0A 3O65B 3RPFC 4WJPA 2AL3A 1WGHA 1WXMA 1DOXA 4BBNC 1WGGA 2INCC 2LXCA 4S0RA 4LCDE 1OQYA 2E3TA 1PQSA 2QMTA 3D32A 5EDSA 1TTNA 2VZKD 3WAOA 2UU7A 4XC2A 1IP9A
chains in the Genus database with same CATH topology
1SJED 3NRZA 3ZGZA 1DGJA 2JQRB 2KQ4X 4ZYSA 1XO3A 1P7EA 1N5XA 4ZOHC 4RNAA 3T3OA 1ZXIA 4A9AA 3GP7A 5EE9A 1KF6B 1L4ZB 4YWGG 4RGNA 3NVZA 2K3UA 4JX1C 1ZP0B 3Q69A 1IGDA 1FO4A 2BW2A 1YN3A 1EU3A 4HROA 1HZ5A 2I2YA 1JWSD 4RGOS 1QOAA 2WNMA 2BS4B 1V1OA 1VZ6A 2JSVX 3O13A 2KWDA 2E6XA 2ZW0A 4L1BA 3ETRA 1E10A 1KH0A 1SB3C 2PLPA 2WXMA 1JQ4A 1F77A 4OZAA 4RFBA 4C56C 2INPE 1JMLA 2PVGC 2JWUA 3CIRB 4D2KA 4YXDB 1C4PA 1FM0D 3OWEB 1PGXA 4JPSA 1L0XB 2WXJA 1D5ZC 1YQ3B 1MPEA 1QOBA 3AE7B 2WXRA 1VZ8A 1UNSA 3LB8C 2OEDA 1TKGA 2SAKA 3EA6A 1TKEA 2N0SB 4P6VF 2WXLA 4JWSC 4A6QA 3MFGA 1SBBB 5H92C 2GI9A 4USAA 4C7YA 2WU2B 4REZA 4IKGA 3P63A 5G5GA 3NVVA 1N61A 3AECB 1C77A 5FK9C 1EWYC 2K0PA 2BS2B 3AEFB 4TMAB 4US9A 2XNAC 2W3RA 3ZJUA 4XDDA 3NZ3A 4RF0A 3AB5A 1TY0A 4CQNA 1C79A 3SFEB 1TS5A 4H2AA 5HFYA 2DYOA 2X38A 2IGDA 2HDEA 2AQ2B 2BT6A 3NVWA 3BIID 2KDMA 1YMHE 1DOYA 2XN9C 3Q8AA 3AEGB 4JWUC 2MEKA 3AMZA 3Q8FA 4TSSA 1NEKB 1NYRA 1FFUA 3BZDB 3W5UB 1E7PB 4TQ0A 3V3XA 3PZ7A 1PDXA 2INNE 2LFIA 3SFDB 4A8XC 1YN5A 5T8IA 3P42A 1CQVA 2W3SA 4WH4A 2B76B 4TQ1A 1I4XA 1I4HA 1XF5L 1L5PA 5BYSA 1JWBD 1C4AA 5FKAC 4ARCA 2WXPA 3FAHA 1EU4A 5EE0A 3W2DA 2QSDA 1IBXA 3VR9B 1FCLA 2FE8A 1J7CA 2NTSA 3FC4A 1BUIC 1JWAD 2WXFA 2DWQA 1HEZE 4AQ7A 1FCCC 3ZJTA 2KMMA 5AUIA 1NVID 4DXFA 1GAQB 4ZRQA 1T3QA 4HRSA 4XWTA 1E6EB 1YJIA 4C7ZA 1L6VA 3HVZA 3U4EG 2YEPF 1HQRD 1R7SA 3MJ5A 1SE4A 2ACZB 3N9YC 1XLNA 3W1SA 1RM6C 2H89B 3AE3B 1SE2A 1QQRA 2JU6X 1N63A 5D3DA 3KWVA 3MC0B 3RFZB 4AS1A 3IT6B 3IXSA 1CK1A 2WXOA 2LUMA 1KLGD 1PGAA 1NI3A 3TEYA 2NMQA 1WXQA 2M0AA 2I38A 4OZBA 3AE2B 4KKIA 3FILB 3AE4B 2JXTA 3ZJVA 1V1PB 2EKIA 2QJLA 2WQYB 1CJEA 2HTME 1EWCA 2V0GA 1JW9D 3VR8B 2WU5B 2KN4A 4YT0B 1SIJA 4KGTA 1FNWA 1XEEA 3CWIA 1NYQA 1YQ4B 1ZE3D 3AE9B 3Q8CA 1DYQA 3P4SB 2KAJA 1RYJA 3TSSA 1ESFA 4NJCA 2L32A 2JYEA 2LHEA 1YNTE 2WLBA 3AN1A 4LK0M 4XE0A 2MJ3A 4YTMB 3KLSX 4GLSC 2AQ1B 4B0MA 1GB4A 1PYWD 2W55A 1XLQA 1ZPSA 3L4PA 3ZQ4A 2TSSA 2NTTA 1AN8A 4N58A 1JWUD 2G1EA 1I4GA 2DLBA 4YTPB 1V8CA 4PT5A 2PIAA 3U7ZA 1XCTL 1RFKA 1ROEA 1IBXB 2CJOA 2PKOA 3B2FA 3W5VB 1HA5A 3BYTB 1WGKA 3AE1B 2J53A 1KRHA 3KQ4A 3VRBB 4RH6A 1IGCA 2RPVA 1E0ZA 4RF1A 2PMVA 1PUTA 2IDYA 2OHFA 1AWDA 4RGMA 1L6UA 1STEA 3R2IA 2K5PA 1BMLC 3Q8EA 4N59A 1QILA 1QOFA 4KGRA 1PGBA 1RWSA 1GOZA 2ZW1A 4YSXB 1E9MA 2Q5WD 4IDIA 3AH7A 4DXGA 3FILA 3SEBA 2PTLA 1VR9A 3BVGA 3P4RB 1M4VA 1TZOA 1YJJA 2WDVB 4O1NA 3B9JA 3VRAB 1D5XC 2MH7A 2K22A 3DWGC 1HZ6A 5BMHA 4OZCA 1K52A 2IGHA 3B2GA 4XWWA 3MHZA 1TKYA 1V97A 2WDRB 4LTUA 1QLBB 3EUB2 3AEBB 3AEEB 4NAMA 1K53A 1VRAB 4IOIE 4WAFA 5AUKA 1JWMD 1A70A 3BK1A 3NVYA 1TS2A 5MPOA 1TJEA 4WQMA 1MVKA 2EELA 1PFDA 1L0YB 3V05A 3P4QB 1N62A 2R61A 4LLGM 1OFFA 2CJNA 2M56B 5BMIA 3GB1A 1SE3A 1N60A 1SEBD 1D4BA 2G9HD 3J9CA 4N6EB 2WS3B 5C3JB 3U52E 5HI1A 2L1AA 4GDLB 3ABVB 4NAWB 4P16A 2ICIA 2J52A 3NUHB 1JALA 2QIEB 4A55A 4MH8A 2IGGA 5G5HA 3EGRA 2J42A 3E56A 5E6JA 5TSSA 2RMMA 4HJGE 1VDVA 3BVZA 2QILA 2Y5CA 1CZPA 1N5WA 1TY2A 5EE1A 1I4PA 1I4QA 3LXFA 1ET6A 2PVOD 3AV8A 2H88B 4YSYB 1VLBA 2PW9A 4OHJA 4M0WA 1XXGA 4L2YA 1OQQA 1FNUA 1AYFA 2LMCA 2WXKA 4RGTA 2BS3B 3UI3A 5JXVA 1D5MC 1JROA 2MJDA 1K50A 2FUG1 1MHXA 2AX5A 2L83A 1HXYD 2YEPB 2BTEA 2MJEA 2W54A 3P4PB 1FNVA 1ZUD2 4Q2JA 1SSNA 1QKZA 1QOGA 2K9XA 3KWLA 3Q8BA 1C9FA 2M19A 1J7BA 2LHDA 1IUEA 3T3NA 2LJIA 4ZHOA 1YN4A 1QF6A 4KGSA 4US8A 3SR6A 4MT5A 5D7GA 3C8YA 1P7FA 2FBWB 1DOIA 1I7HA 3HUIA 4ARIA 1SXTA 2BB5A 5H8YE 5HG2A 3IAS1 1WSPA 3I57A 3GS2A 4ZHPA 1FMAD 1ZXHA 1UGJA 1K51A 2ONQA 4ZRPA 1L0VB 1EM7A 2N9LA 1V1PA 1D6EC 3R8BA 1KFYB 4EE2A 5FR3A 3H8HA 4WWMA 4HKZE 1MHHE 1WWTA 4OVZA 1GB1A 1FEHA 2IPKD 4KX6B 3AE5B 1ENFA 1C4CA 2GB1A 3LYYA 4MM3B 1Q10A 2RDHA 3P1MA 4XDCA 2RDGA 2Z8LA 4DQOC 1ZDVA 3NS1A 1FIQA 1ACCA 2Y5PA 3MP9A 3IAM1 3AE8B 2JYTA 1AW7A 1C76A 1KLUD 4UDUC 5EE3A 5BYQA 4C80A 4JE3B 2WXGA 4NZLB 2WXNA 4OW0A 5I4DA 2LGIA 2QEJC 1QT9A 3WCQA 4A90A 3BK2A 5BYRA 2SEBD 5D3IB 1I4RA 1OQRA 1F2RI 1FFVA 1C78A 3PZ8A 1FD6A 2V3PA 4J3OD 1WYGA 4HKQA 1FRRA 5BMGA 3TEZA 1VJKA 2D5GA 2WDQB 3BYYB 3URYA 2AQ3B 2N7JA 3PO0A 2BBCA 1F2RC 3TEWA 1KTKA 2DYMA 5GXGB 3I9V1 1FXIA 3ZYYX 2V4IB 4YSZB 3DWMA 5HHDG 1T5XD 5C2TB 2V3NA 2BYTA 2WXIA 1ET9A 4KKJA 1LO5D 1UWXA 2JX5A 2KACA 4YTNB 1Y56A 2L52A 3AEAB 1ZDXA 4FXCA 1GPXA 1XLOA 1SJHD 4R3DA 3AM9A 2N9KA 1F0ZA 2Y3AA 1J7AA 1L4DB 1T6BX 4L23A 3U2SC 1JRPA 4ITKA 1B1ZA 4WURA 2CU3A 4WIPA 1NENB 1SF0A 2BB6A 2J4XA 2DBYA 3E9SA 2WXQA 1VZ7A 1BXTA 2IJ0A 1JCKB 1ZOYB 1TS4A 4HEA1 4B0EA 1XCQL 1B9RA 2JZPA 3TUOA 2VZKB 2GRIA 2W82A 3RPFC 3AE6B 3HRDD 2ON8A 1UUPA 1XLPA 3BVMA 4RCOA 3BWUD 1TS3A 1DOXA 3W9CB 1MI0A 4MACA 3AEDB 1FXAA 2WP9B 2E3TA 2QMTA 3IT4B 5LNK1 2VZKD 2WXHA 1WRIA 3TEXA 1TYGB 1UWMA 2LEKA 3HVDA 1FRDA 3R2TA 4GDKB 3VQIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K5P A;  4N59 A;  1J7C A;  3FC4 A;  1QOF A;  3NRZ A;  1JWA D;  1RWS A;  2DWQ A;  1L0V B;  4YSX B;  1DGJ A;  2JQR B;  1E9M A;  2Q5W D;  4IDI A;  3AH7 A;  1XO3 A;  1KFY B;  1N5X A;  2KMM A;  5AUI A;  4ZOH C;  3P4R B;  4WWM A;  1NVI D;  1YJJ A;  2WDV B;  1GAQ B;  1WWT A;  1ZXI A;  3B9J A;  3VRA B;  4A9A A;  4KX6 B;  1T3Q A;  4HRS A;  5EE9 A;  1KF6 B;  1E6E B;  2MH7 A;  3AE5 B;  2K22 A;  3DWG C;  3NVZ A;  1YJI A;  4C7Z A;  1L6V A;  3HVZ A;  3P1M A;  1ZP0 B;  3B2G A;  4JX1 C;  1R7S A;  3NS1 A;  1FIQ A;  1FO4 A;  1TKY A;  1V97 A;  2WDR B;  4LTU A;  1QLB B;  4HRO A;  3EUB 2;  2ACZ B;  3AE8 B;  1XLN A;  3AEB B;  1QOA A;  1RM6 C;  2BS4 B;  2H89 B;  3AEE B;  5EE3 A;  3AE3 B;  4C80 A;  1E10 A;  3ETR A;  1N63 A;  1SB3 C;  5AUK A;  1A70 A;  1QT9 A;  3NVY A;  3WCQ A;  5MPO A;  1JQ4 A;  1TJE A;  2PVG C;  3CIR B;  4WQM A;  4YXD B;  1FM0 D;  1OQR A;  1PFD A;  1NI3 A;  3P4Q B;  1FFV A;  1N62 A;  1WXQ A;  1OFF A;  2CJN A;  3AE2 B;  1WYG A;  2M56 B;  1YQ3 B;  3AE4 B;  1FRR A;  1QOB A;  3AE7 B;  1N60 A;  1VJK A;  2WDQ B;  2EKI A;  2QJL A;  4N6E B;  3LB8 C;  2WQY B;  2WS3 B;  1CJE A;  1TKG A;  2HTM E;  3PO0 A;  5C3J B;  3ABV B;  1TKE A;  1JW9 D;  2N0S B;  2WU5 B;  5GXG B;  3VR8 B;  4YT0 B;  1FXI A;  3ZYY X;  4YSZ B;  1JAL A;  2QIE B;  1SIJ A;  3DWM A;  4P6V F;  4JWS C;  5C2T B;  5H92 C;  4C7Y A;  3CWI A;  4USA A;  5G5H A;  2WU2 B;  1NYQ A;  1YQ4 B;  2JX5 A;  3AE9 B;  3P63 A;  4YTN B;  1VDV A;  5G5G A;  2L52 A;  3NVV A;  3AEA B;  4FXC A;  1N61 A;  1GPX A;  1XLO A;  2Y5C A;  3AEC B;  3AM9 A;  1CZP A;  1EWY C;  1N5W A;  2KAJ A;  1RYJ A;  3P4S B;  5EE1 A;  2BS2 B;  1F0Z A;  3AEF B;  1J7A A;  3LXF A;  1JRP A;  2PVO D;  3AV8 A;  4ITK A;  2H88 B;  2WLB A;  3AN1 A;  1VLB A;  4US9 A;  4YSY B;  2CU3 A;  1NEN B;  1SF0 A;  2W3R A;  1OQQ A;  2MJ3 A;  3AB5 A;  1AYF A;  2DBY A;  3SFE B;  2BS3 B;  4YTM B;  1JRO A;  2MJD A;  1ZOY B;  2AX5 A;  2W55 A;  1XLQ A;  2L83 A;  3L4P A;  2BT6 A;  1B9R A;  3NVW A;  2MJE A;  2W54 A;  3BII D;  3P4P B;  4N58 A;  1ZUD 2;  1DOY A;  3AEG B;  4JWU C;  2G1E A;  3RPF C;  3AE6 B;  3AMZ A;  2K9X A;  1QOG A;  3KWL A;  4YTP B;  1NEK B;  1NYR A;  1FFU A;  1J7B A;  1V8C A;  1E7P B;  1FMA D;  2M19 A;  2PIA A;  3HRD D;  3W5U B;  1RFK A;  1ROE A;  1PDX A;  1XLP A;  2CJO A;  1IUE A;  2PKO A;  3B2F A;  3SFD B;  3W5V B;  4ZHO A;  1DOX A;  3W9C B;  1QF6 A;  2W3S A;  3AED B;  1FXA A;  1WGK A;  2B76 B;  3AE1 B;  4US8 A;  3SR6 A;  1KRH A;  3VRB B;  2WP9 B;  1L5P A;  2FBW B;  1DOI A;  1I7H A;  3HUI A;  1E0Z A;  1JWB D;  2E3T A;  5H8Y E;  1WRI A;  1TYG B;  3FAH A;  1UWM A;  1PUT A;  2LEK A;  5EE0 A;  2OHF A;  1AWD A;  4ZHP A;  1FRD A;  1L6U A;  3VR9 B; 
#chains in the Genus database with same CATH topology
 3IHP C;  4ZYS A;  2JXX A;  3UQA A;  3B1L X;  4ANX A;  3DOW A;  4HCN B;  2K3U A;  1ZP0 B;  1BT0 A;  2KDE B;  1FO4 A;  1YN3 A;  1EU3 A;  3ML8 A;  1HZ5 A;  2QHO A;  1QOA A;  4J6I A;  1V1O A;  3MTN B;  4L1B A;  2ZW0 A;  4OVU A;  4RM9 A;  1MFW A;  4RFB A;  4C56 C;  4EFO A;  2LD9 A;  1PGX A;  4FHK A;  4C4V B;  3JW0 X;  4JPS A;  4BOS C;  3PVL A;  1D5Z C;  2LWP A;  1QOB A;  2DHZ A;  1A5R A;  3APD A;  2AYO B;  3L08 A;  4HDQ A;  2MP2 A;  2V1Y A;  4GXB A;  1WR6 E;  1TKE A;  2NBU A;  3DBR I;  2KTR A;  4JWS C;  1SBB B;  4USA A;  2NBW B;  2BPS A;  4IKG A;  3P63 A;  2MSE D;  2KTF A;  4G50 A;  4KDI C;  3AEC B;  1C77 A;  2K0P A;  1MG4 A;  2O6V D;  1C79 A;  3ZTC A;  1Q1O A;  4PK1 A;  3V60 A;  3KYC D;  1DOY A;  4HPP A;  1L2N A;  4GMV A;  1S1Q B;  3T8M A;  2MEK A;  3AMZ A;  4B9K A;  1SGH A;  2VH2 A;  4HDO A;  3V3X A;  1WZ0 A;  3PZ7 A;  4EEW A;  2INN E;  1HTQ A;  1K8R B;  4A8X C;  1YN5 A;  2W3S A;  1Y8R C;  1XQQ A;  4TQ1 A;  4GDK A;  1I4H A;  1L5P A;  4PS3 A;  1C4A A;  5FKA C;  1RRB A;  4ARC A;  1CMX B;  3LJ3 A;  5EE0 A;  3JVZ X;  3VR9 B;  3AU5 A;  3PLV A;  2WXF A;  1P3Q U;  2PE9 A;  2UYZ B;  3ZJT A;  4XYC A;  1NVI D;  2KWV B;  5D94 A;  4ZRQ A;  2IY0 B;  4C7Z A;  1I35 A;  1HQR D;  3MJ5 A;  3QQ8 B;  1ZW7 A;  2CU1 A;  3W1S A;  1RM6 C;  1WGD A;  3C0R B;  3AE3 B;  3PRP B;  1QQR A;  2XK5 B;  1WXS A;  5D3D A;  1RAX A;  3K9P B;  1WXQ A;  1HE8 A;  2MBO A;  3T9L A;  3ZNI D;  2JXT A;  3ZJV A;  1TIF A;  2HTM E;  2D10 A;  3VR8 B;  2WU5 B;  1SIJ A;  3CWI A;  1NYQ A;  2RGF A;  4MDK E;  2C5L C;  3P4S B;  2DX5 B;  1RYJ A;  2KFK B;  4NJC A;  3TSS A;  4MGI E;  2L00 B;  4WJN A;  3DHI C;  4YTM B;  5JH5 C;  4ICV A;  3HIZ A;  1XLQ A;  1ZPS A;  3L4P A;  2TSS A;  4BFR A;  3PRM B;  1I4G A;  2KK8 A;  2XK5 A;  1XCT L;  1ROE A;  1IBX B;  2PKO A;  1P1A A;  3AI5 A;  3LDZ E;  5LXH A;  5AZH A;  2WDT B;  3B0A A;  3KQ4 A;  4RH6 A;  3X23 A;  4P1C C;  3L16 A;  3KVF B;  2IDY A;  2BWE S;  3R2I A;  2K5P A;  3Q8E A;  4I6N B;  2MP2 B;  3ZLZ A;  1WRD B;  2ZW1 A;  1E9M A;  4IDI A;  3HK0 A;  1VR9 A;  3P4R B;  5KHO A;  1M4V A;  1YJJ A;  2OOB B;  1D5X C;  4IW0 A;  2MH7 A;  2K22 A;  3DWG C;  1HZ6 A;  3SU8 X;  2IGH A;  4XWW A;  5E6P A;  4K1R B;  5J17 A;  3EUB 2;  2O2V B;  3AEB B;  1VRA B;  3RT3 B;  3DVG X;  5JHA A;  3H7P B;  5AZF A;  3CF6 E;  5HKH A;  1R4M I;  1D3Z A;  1N62 A;  4DBG A;  4JQW C;  2CJN A;  2M56 B;  2BYE A;  1SE3 A;  1D4B A;  3J9C A;  4N6E B;  1V9J A;  5HI1 A;  1LQB A;  3RNC C;  3OJ3 A;  4W9D A;  2JY6 A;  4A55 A;  5G5H A;  3V61 A;  2KN5 A;  5TSS A;  1E7U A;  2QIL A;  2Y5C A;  1N5W A;  2KQS A;  5EE1 A;  1I4P A;  1I4Q A;  4YSY B;  2H88 B;  3MJW A;  4M0W A;  4MH0 E;  1OQQ A;  2K39 A;  3IVF A;  3QAR A;  1D5M C;  3NZU A;  3CMM B;  5AEK B;  4C4V A;  1MHX A;  2L83 A;  3P4P B;  3JYU A;  2K9X A;  1QKZ A;  3Q8B A;  2KFJ A;  2LHD A;  2Z0D B;  4BKS D;  3JSV B;  2ZVN A;  3QA8 A;  4KGS A;  3SR6 A;  4LNF A;  2FBW B;  4MM3 A;  5H8Y E;  5HG2 A;  3AU4 A;  4ZHP A;  5E6O A;  1UGJ A;  1K51 A;  4ZYN A;  2G4S A;  4M02 A;  1L0V B;  1EM7 A;  4GOC A;  3V6E B;  1UBI A;  4DK5 A;  4HKZ E;  3FKY A;  3ENE A;  3ZKJ C;  1ZDV A;  3RMK C;  1UD7 A;  2KX3 A;  2G4D B;  4FAD A;  5BYQ A;  4C80 A;  4EZJ A;  4IC7 B;  1UGM A;  3A4S C;  2QEJ C;  1QT9 A;  3U30 A;  3DVN U;  5JHB A;  1KM7 A;  5D3I B;  3QC8 B;  3DBH I;  4HCP B;  1C78 A;  4EZL A;  1FD6 A;  2K1F A;  1WYG A;  3I5J C;  3A33 B;  5BMG A;  3BYY B;  3URY A;  2N7J A;  4WJO A;  1F2R C;  1KTK A;  1FXI A;  2WWZ A;  4HWI B;  3AUL A;  2WXI A;  4KKJ A;  1LO5 D;  1UWX A;  4BKT A;  2KAC A;  1Y56 A;  1NI2 A;  5LLI A;  3RNB C;  3AEA B;  4FXC A;  2MRP A;  3AM9 A;  3RNF C;  4F7Z A;  1JRP A;  3PSE B;  3PRE A;  2L8J A;  1TZ1 A;  2BB6 A;  2LGY A;  2WXQ A;  3DPD A;  2J7Q B;  3KUZ A;  4B0E A;  2VZK B;  2GRI A;  2W82 A;  4ZDV A;  4NJ6 A;  2ON8 A;  3RZW C;  3BWU D;  3W9C B;  2LVO A;  2NR2 A;  4RMA A;  4EUT A;  2WP9 B;  3IT4 B;  1WM3 A;  1WE7 A;  1WRI A;  2R2O A;  1UWM A;  3HVD A;  4K7U A;  3R2T A;  4GDK B;  2MX2 A;  1SJE D;  1WMH A;  3V62 A;  3NRZ A;  3TMP B;  1EF1 A;  1WGY A;  5KHQ A;  4ZOH C;  2N4F A;  4BOZ B;  4RNA A;  2NS5 A;  4ANV A;  1M94 A;  4FJZ A;  2NPT B;  1J8C A;  2BW2 A;  4RGO S;  1V5T A;  1VZ6 A;  4FA6 A;  3O13 A;  2ASQ A;  1GJZ A;  1KH0 A;  2K6D B;  4OZA A;  4ICU A;  2PVG C;  2JWU A;  4JGH B;  3PRZ A;  3I3T B;  1L0X B;  2WXJ A;  4WWP A;  3R7Q A;  1GG3 A;  4HK2 A;  1VZ8 A;  2KWC A;  3LB8 C;  3EA6 A;  2DZM A;  1KOT A;  1YD8 U;  3MFG A;  5H92 C;  2WU2 B;  1YIW A;  3RI7 C;  2G3Q B;  4REZ A;  5G5G A;  4M8N A;  4P7I A;  1EWY C;  2L05 A;  2ZPN A;  4NY0 A;  1P98 A;  4TMA B;  3ZJU A;  4GGQ A;  3AB5 A;  2UWQ A;  3SFE B;  3RYT A;  3QHT A;  2L0T A;  3SDL C;  1LM8 B;  4H2A A;  5HFY A;  2DYO A;  2AQ2 B;  3NVW A;  2HJ1 A;  1YMH E;  3Q8F A;  4TSS A;  2KKC A;  3BZD B;  4S17 A;  1E7P B;  4TQ0 A;  2GLS A;  3SFD B;  1WJU A;  2LXA A;  3P42 A;  1V5O A;  2B76 B;  1UH6 A;  1XF5 L;  2L0F A;  3CST A;  5BYS A;  3Q3M C;  2GBR A;  2WX1 A;  2JPH A;  3A9J B;  3FAH A;  1EU4 A;  3W2D A;  5AZG A;  1FCL A;  2LGS A;  4HVB A;  2QCZ A;  4AQ7 A;  2ZJD A;  2KMM A;  4DXF A;  3RNE C;  2MBQ A;  1GAQ B;  4XWT A;  1YJI A;  1E5W A;  2C60 A;  4MEM A;  5C1Z A;  2ACZ B;  2LGX A;  3DBL B;  2KWU B;  3H9D A;  2JU6 X;  4HJK A;  1E7V A;  3CSF A;  3TL5 A;  1CK1 A;  1PGA A;  1KLG D;  2KTR B;  2NMQ A;  5TR5 A;  2IYD B;  1V1P B;  3ZW3 A;  2WQY B;  4HPL B;  3UIN B;  2GBJ A;  3ECI A;  4YT0 B;  3PLU A;  2KMC A;  2MCN B;  1FNW A;  1DYQ A;  2KAJ A;  2L32 A;  2WLB A;  2XEW A;  3AN1 A;  4LJO B;  2MBE A;  4AUQ C;  5DPR A;  4GLS C;  2KVZ A;  5D6J B;  2M17 A;  4BBN F;  1GB4 A;  1UZX B;  2W55 A;  4FJV B;  3SD5 A;  4A20 A;  2NTT A;  3M95 A;  4IWP A;  2G1E A;  1YX5 B;  3U7Z A;  2JT4 B;  3W5V B;  3N20 C;  4YL8 A;  1WGK A;  2J0J A;  2REX A;  3AE1 B;  2J53 A;  4IM2 A;  4KZC A;  3ZNH B;  1IGC A;  3Q2A C;  2RPV A;  3ZXR A;  4KSK C;  2KC1 A;  1IPG A;  5CTR C;  2N9X A;  4BVU C;  1STE A;  1QOF A;  1GOZ A;  3PTF C;  4YSX B;  4DXG A;  3BVG A;  1C1Y B;  3EEC A;  2PEA A;  4O1N A;  3KYD D;  3NJT A;  2MW5 A;  3PHW B;  4C00 A;  3AEE B;  1T0Q C;  3N30 A;  3ZVV A;  5AUK A;  1JWM D;  4LDT B;  3DHG C;  1XD3 B;  3NOB A;  3M63 B;  4W9F A;  1L0Y B;  3ZRC A;  4GSW A;  2YVC A;  2FAZ A;  3GB1 A;  1N60 A;  4I6L B;  2MWS B;  5C3J B;  4GIV A;  2D07 B;  2BGF A;  2FNJ B;  4NAW B;  2IGG A;  3QWZ B;  3EGR A;  3E56 A;  2IZV B;  3QK0 A;  4ACF A;  2PVO D;  2WHI A;  2ZCB A;  3PGE A;  5DCN A;  3H7P A;  1FNU A;  2LMC A;  4RGT A;  3UI3 A;  2MJD A;  1K50 A;  3R66 C;  2AX5 A;  4XX5 A;  2CKH B;  5L83 A;  2GBK A;  3DBH B;  3VAW A;  1QOG A;  3KWL A;  2M19 A;  1J7B A;  3R3M A;  3QJZ A;  4NAW A;  1NDD A;  4BKS A;  3QCA A;  2LJI A;  4MEL A;  1TGZ B;  1YN4 A;  2KFK A;  4MT5 A;  2KHW B;  1DOI A;  1I7H A;  4ARI A;  4DWF A;  1JRU A;  3WAP A;  1LFD A;  2K8C A;  2BB5 A;  4K3B A;  3GS2 A;  2EMS A;  4A3P A;  3R7R A;  2N9L A;  3PT2 B;  4FLH A;  4EE2 A;  3ZIM A;  1EO6 A;  4JL9 A;  4WWM A;  1YJ1 A;  4OVZ A;  2IPK D;  4KX6 B;  4W9J A;  3AE5 B;  2GB1 A;  4NPN A;  2RDG A;  2Z8L A;  1FIQ A;  1ACC A;  2Y5P A;  2DZK A;  3MP9 A;  3IAM 1;  2JYT A;  2CR5 A;  2NVU I;  2WYQ A;  3MC9 A;  4JE3 B;  3DVG Y;  3WAM A;  2WXN A;  4OW0 A;  2LGI A;  1N6Z A;  4IM0 A;  2D3G A;  5BYR A;  2DYB A;  4FN2 A;  2CS4 A;  1F2R I;  1V6E A;  3U7D A;  1KJT A;  4J3O D;  1FRR A;  3MHS D;  4GB9 A;  3TEZ A;  2JUO A;  2W9N A;  2N1W A;  3TEW A;  3VUW A;  5GXG B;  2V4I B;  2LRU A;  1T5X D;  2V3N A;  3Q3F A;  2KLC A;  1ET9 A;  3S2A A;  3OG5 A;  3PHX B;  3VXW A;  1ZDX A;  2AWT A;  1SJH D;  2IO3 B;  2N9K A;  3WAL A;  1E8W A;  1F0Z A;  4W9L A;  4L23 A;  1B1Z A;  2C7N B;  4WIP A;  1NEN B;  3AXC A;  3UIP B;  1VZ7 A;  2IBI B;  3JSV A;  3K9O B;  4PYZ A;  2IJ0 A;  1JCK B;  2IND C;  1TS4 A;  3W1S C;  4HEA 1;  3X0W A;  4B95 A;  3ZO5 B;  1YOV B;  1C3T A;  3L13 A;  1SE9 A;  1UUP A;  3BVM A;  2V3S A;  1MI0 A;  3TBL D;  1R4N B;  4HXD A;  1RLF A;  2V4L A;  2KAN A;  4A3O A;  2BWF A;  3APC A;  3N1Z C;  1WH3 A;  4WWO A;  3VTV A;  3Q6B A;  3TEX A;  1WFY A;  2LEK A;  2RPQ A;  4DHZ E;  4E71 A;  1I42 A;  1FRD A;  3VQI A;  1X1M A;  3ZGZ A;  1DGJ A;  2JQR B;  3ZTD A;  1XO3 A;  1N5X A;  1ZXI A;  5EE9 A;  3RZF A;  1KF6 B;  1L4Z B;  3NVZ A;  4KDL B;  1R4M B;  4JX1 C;  2C7M B;  2M0X A;  4HRO A;  2I2Y A;  2WNM A;  2BS4 B;  2JSV X;  2KWD A;  2E6X A;  1E10 A;  1SB3 C;  4BAX A;  1JQ4 A;  1F77 A;  2INP E;  1JML A;  3CIR B;  4YXD B;  1C4P A;  3GZN I;  4HLE A;  2JVC A;  2LRW A;  2YLM A;  5DPT A;  1YQ3 B;  4KVG B;  2WXR A;  1ZKH A;  4DHJ D;  4WJQ A;  1UNS A;  2SAK A;  4JLC A;  2FCQ A;  3EHV A;  1UEL A;  3HM6 X;  3VUY A;  4P6V F;  2WXL A;  4A6Q A;  4C7Y A;  2OJR A;  3HHM A;  3DHH C;  3MC8 A;  3NVV A;  1N61 A;  1H4R A;  5FK9 C;  3VH3 B;  2BS2 B;  3AEF B;  3ZNZ B;  4IM3 A;  1YX6 B;  5IA7 A;  4US9 A;  2W3R A;  1LGR A;  4RF0 A;  3UGB B;  4EKU A;  4CQN A;  4E74 A;  5CX3 A;  2HE7 A;  3WA0 A;  2IGD A;  2J0M A;  2N7D A;  2BT6 A;  1HTO A;  2KVR A;  3M3J A;  1F9J A;  3W1Y A;  1FFU A;  2D3C A;  2MQJ A;  1QZE A;  1PDX A;  2LFI A;  4WAA A;  4N9F 4;  2Z59 B;  3DBS A;  2M8S A;  1I4X A;  2JRH A;  1EUV B;  3BIN A;  1JWB D;  3ZDM C;  5J18 A;  2KDI A;  2WXP A;  3A9K A;  3APF A;  2QSD A;  1IBX A;  2FE8 A;  3RCZ A;  2DWQ A;  5J2R A;  3Q3N C;  1U4A A;  5AUI A;  4LNN A;  4HRS A;  4PYU A;  1WXA A;  4TUU A;  1L6V A;  3U4E G;  2YEP F;  1R7S A;  3KUC B;  2KD0 A;  3N9Y C;  4X57 B;  3ZNG C;  2RR9 A;  1WJN A;  2N9E B;  4ANU A;  1N63 A;  1OTR B;  3A1Q A;  1MJD A;  3DQV A;  3GZN B;  1T0Y A;  3IT6 B;  2WXO A;  2MLB A;  1V81 A;  2I38 A;  3UQB A;  4KKI A;  3QIJ A;  2PPH A;  2QJL A;  3VHT C;  3IG3 A;  1EWC A;  1V80 A;  2V0G A;  2Y5B B;  2KN4 A;  4KGT A;  1XEE A;  2GOW A;  1YQ4 B;  3Q8C A;  4W9H A;  3PZD A;  2LHE A;  4MGY E;  4KV2 A;  3KLS X;  1Z5S B;  2KNB A;  1WXV A;  1PYW D;  2GMI C;  2KJR A;  2ZZP B;  4WWN A;  3ZQ4 A;  1J19 A;  4N58 A;  1AN8 A;  1UBQ A;  1JWU D;  2FCM A;  3BY4 B;  2DLB A;  2RSU A;  4YTP B;  4DDI D;  4G0N B;  1V8C A;  1Z2M A;  4NQK E;  4PT5 A;  2O6V B;  2KDF B;  2B3A A;  2NBV B;  1KRH A;  5CHF A;  4IUM B;  1E0Z A;  4RF1 A;  2KMA A;  4G11 A;  3ZUN A;  3H1U A;  1PUT A;  2MHJ A;  4RGM A;  1L6U A;  3ZDT A;  1BML C;  4KGR A;  1PGB A;  2Q5W D;  3AH7 A;  3FIL A;  3SEB A;  1WJ6 A;  2PTL A;  4LDT D;  4K81 A;  4JIO U;  3RUI B;  3VRA B;  3RUL A;  3OAW A;  5BMH A;  1TKY A;  2WDR B;  3L0W B;  4LTU A;  1QLB B;  4DHJ B;  4MSM B;  1R4N I;  2KJ6 A;  4XGA B;  5MPO A;  2NPT A;  4IWQ A;  3V05 A;  3P4Q B;  2R2Q A;  2R61 A;  4K7S A;  4LLG M;  1OFF A;  2ZVO A;  1TBE A;  4QAY A;  1SEB D;  2G9H D;  2WS3 B;  4M0W B;  3U52 E;  2L1A A;  2ZEQ A;  3ABV B;  2C9W B;  4P16 A;  2ICI A;  2J52 A;  3NUH B;  2ZNV B;  2JRI B;  4ZRJ A;  4HJG E;  2K6Q A;  3OLM D;  1VDV A;  3BVZ A;  4RM8 A;  1CZP A;  4W9C A;  1TY2 A;  4MGZ E;  2A4Z A;  3LXF A;  2M4N A;  3AV8 A;  2XBB C;  3PPA A;  2PW9 A;  3ONS A;  4OHJ A;  4L2Y A;  3V6C B;  3DBR B;  2WXK A;  1AYF A;  1JRO A;  2FUG 1;  1UF0 A;  2YEP B;  2BTE A;  2MJE A;  4TV3 A;  1ZUD 2;  3EFU A;  4Q2J A;  1SSN A;  3M62 B;  1C9F A;  5LXI B;  3U8Z A;  3T3N A;  1IYF A;  1S3S G;  3VVW B;  1F52 A;  2LVQ A;  1P0R A;  5D7G A;  3C8Y A;  1P7F A;  1XT9 B;  2KX0 A;  3QAQ A;  1SXT A;  2JF5 A;  2IO2 B;  2D11 A;  1WSP A;  1FMA D;  1ZXH A;  1LXD A;  2ONQ A;  2BYV E;  4ZRP A;  1GC7 A;  1V1P A;  3SHQ A;  1D6E C;  5FR3 A;  3H8H A;  2VH1 A;  2FUH B;  4FHJ A;  3A9J A;  3I63 C;  1GB1 A;  1FEH A;  4KSL C;  1E90 A;  3LYY A;  2KO3 A;  2PJH A;  4MM3 B;  2RDH A;  3P1M A;  3OJ4 B;  3NS1 A;  2AL6 A;  3UIO B;  3ML9 A;  4UDU C;  1KLU D;  1L7Y A;  1WYW B;  4K7W A;  5IO9 A;  3PV1 A;  3GE3 C;  2D3B A;  5L95 C;  4NZL B;  2GBM A;  5IOI A;  3RN9 C;  3WCQ A;  4A90 A;  3BK2 A;  4CO7 A;  2DEN B;  1FXT B;  1VCB A;  3PZ8 A;  3VFK A;  5BO4 B;  2V3P A;  5CHW A;  2AQ3 B;  2FID A;  2BBC A;  3NHE B;  2FIF A;  2DYM A;  2LJ5 A;  4YSZ B;  3DWM A;  2KDB A;  4YTN B;  4ASW C;  2L52 A;  3VH4 B;  4R3D A;  3KW5 B;  2Y3A A;  1L4D B;  4PS7 A;  2DAF A;  2CU3 A;  1SF0 A;  2RDB C;  3E9S A;  3N1Y C;  3IFW B;  1ZOY B;  2BKR B;  5E6N A;  2KYW A;  2PE6 B;  1XCQ L;  2X8X X;  1B9R A;  2JZP A;  3TUO A;  3DBL I;  5IKC M;  3AE6 B;  4MJS B;  3HRD D;  2KXJ A;  1XLP A;  4RCO A;  1TS3 A;  2O2V A;  1ZGU B;  4MAC A;  3AED B;  1FXA A;  4EOY A;  1FPY A;  4K3C A;  3IBE A;  4F1S A;  2WGS A;  5LNK 1;  2WXH A;  4DDG D;  2LVP A;  1TYG B;  1OGW A;  4LNK A;  2EKE C;  4MSQ B;  2K8H A;  3RD2 A;  2KQ4 X;  2VRR B;  4M8M A;  1P7E A;  4FUL A;  3NY5 A;  3T3O A;  4A9A A;  3B08 A;  3VTW A;  3GP7 A;  2DAJ A;  5GMV A;  3L54 A;  5DPW A;  2DZI A;  4RGN A;  4YWG G;  2KOX A;  3Q69 A;  1IGD A;  1GC6 A;  2MBB B;  2IO1 B;  2BVC A;  1F1H A;  1JWS D;  4AJY B;  4BZA A;  4W9G A;  2DZJ A;  3ETR A;  1NBF C;  2PLP A;  2WXM A;  5JZE B;  4D2K A;  2FCS A;  4IG7 B;  2BYF A;  1FM0 D;  3OWE B;  4LJP B;  2G45 B;  2KLG A;  1MPE A;  1WIA A;  3AE7 B;  4ANW A;  1OEY A;  3H7S A;  4NNJ B;  4AOF A;  2LUE A;  3QX1 A;  2OED A;  1TKG A;  4FBJ B;  2CHZ A;  2N0S B;  2GBN A;  4LNI A;  2GI9 A;  1J0G A;  3NZS A;  1V2Y A;  1RFA A;  2KT7 A;  4B6W A;  3N1X C;  1VD2 A;  2JZ3 B;  2L76 A;  1V49 A;  1WR1 A;  1P9D U;  2XNA C;  4XDD A;  3NZ3 A;  2EMT A;  1TY0 A;  3H6N A;  2V9H A;  1TS5 A;  1T0S C;  4MJS A;  4WQO B;  3EFC A;  4AWJ A;  2X38 A;  2HDE A;  3BII D;  2KDM A;  2DNF A;  2XN9 C;  3Q8A A;  3AEG B;  4JWU C;  1NEK B;  1NYR A;  3W5U B;  2LAS A;  5T8I A;  1CQV A;  4WH4 A;  1WX9 A;  4AP4 C;  1MG8 A;  2HTH A;  4DHZ B;  3Q3J A;  1KLV A;  2NTS A;  1J7C A;  4GN1 A;  3FC4 A;  1BUI C;  1JWA D;  2KJH B;  1HEZ E;  2AEH A;  1FCC C;  3TIX A;  1WE6 A;  1GNU A;  2D3A A;  4M00 A;  5C23 A;  1T3Q A;  1E6E B;  3GE8 C;  1WY8 A;  3HVZ A;  1OEY J;  1SE4 A;  4FJY A;  1XLN A;  4BKG A;  1TT5 B;  2H89 B;  3EC8 A;  4TKN A;  1SE2 A;  4II2 B;  5D2M B;  2N7E A;  4I6P A;  3NG0 A;  3KWV A;  3MC0 B;  3RFZ B;  4AS1 A;  2BQQ A;  1WJ4 A;  3IXS A;  2LUM A;  1EF5 A;  4II3 B;  1NI3 A;  3TEY A;  3WIM A;  2M0A A;  4OZB A;  3AE2 B;  3FIL B;  3AE4 B;  3ZRF A;  2CHW A;  2EKI A;  4MGK E;  2LZ6 A;  2WX0 A;  1CJE A;  1JW9 D;  5G55 A;  5IAA C;  1ZE3 D;  1SIF A;  3AE9 B;  3VDZ A;  4KZ0 A;  1ESF A;  1V86 A;  2JYE A;  4OVV A;  2O6V A;  1YNT E;  4IWO A;  1WI0 A;  5IP4 D;  4LK0 M;  4XE0 A;  2MJ3 A;  4ZRK A;  3C19 A;  3RNA C;  2AQ1 B;  4B0M A;  2OJW A;  2I1K A;  2LGD A;  1ISN A;  2NCN A;  2Z0E B;  2MBH A;  4GU2 A;  3RNG C;  1WX8 A;  1GUA B;  2PIA A;  1RFK A;  2CJO A;  3B2F A;  4AJW A;  1HA5 A;  3BYT B;  2KQ7 A;  1WMH B;  4F8C B;  3VRB B;  4KIK A;  2KZR A;  1E8Y A;  3PS6 A;  3GOE A;  2PMV A;  3TCA A;  2OHF A;  1AWD A;  4N59 A;  1QIL A;  4HPM B;  3WAN A;  1RWS A;  1YQB A;  1TZO A;  2K8B A;  2WDV B;  3B9J A;  5CHV C;  4OZC A;  3VTU A;  1K52 A;  3B2G A;  4M01 A;  2MA9 B;  3MHZ A;  1V97 A;  4W9K A;  2LI5 A;  5G2N A;  3Q3O C;  4NAM A;  1K53 A;  3A1Q B;  3KUD B;  4IOI E;  4WAF A;  1A70 A;  3BK1 A;  3NVY A;  1TS2 A;  2ZPY A;  2FCN A;  1TJE A;  2JWZ A;  1MVK A;  3ALB A;  4WQM A;  4XZ4 A;  2EEL A;  1PFD A;  3KH0 A;  2ZNV C;  1E8X A;  5BMI A;  4GDL A;  3N3K B;  2ZCC A;  4DXA B;  4EZK A;  4GDL B;  1H8C A;  4NJ7 A;  2N1V A;  1JAL A;  2QIE B;  1AAR A;  4MH8 A;  2J42 A;  5E6J A;  2RMM A;  2J0K A;  2HJ8 A;  1Q5W B;  1ET6 A;  2JZZ A;  1VLB A;  5IN7 A;  1XXG A;  3UF8 A;  1E8Z A;  2BS3 B;  5FR6 A;  4CYE A;  5JXV A;  4PS8 A;  1WGR A;  2D2Q A;  2L3Z A;  1HXY D;  2QDF A;  2W54 A;  3N32 A;  1FNV A;  2I1J A;  3TJP A;  1IUE A;  4ZHO A;  4LNO A;  1QF6 A;  2IO0 B;  4W9E A;  4G3X B;  4US8 A;  4P1B C;  2KC2 A;  3NS8 A;  3A4R A;  3HUI A;  3IAS 1;  3I57 A;  2K25 A;  2BKF A;  4CHK A;  4NQL B;  3R8B A;  4E3C A;  1KFY B;  2A5U A;  1MHH E;  1WWT A;  1WM2 A;  1ENF A;  3L17 A;  1C4C A;  3HM3 A;  1Q10 A;  4XDC A;  4DQO C;  3DDC B;  3AE8 B;  1T0R C;  1AW7 A;  1C76 A;  5EE3 A;  2WXG A;  5I4D A;  3VUX A;  3ZXV A;  2QC8 A;  2HD5 B;  3A9K B;  2SEB D;  1I4R A;  1OQR A;  4W9I A;  1G6J A;  1FFV A;  5DPS A;  4KIK B;  1WZ3 A;  4HKQ A;  1VJK A;  2D5G A;  2WDQ B;  3PO0 A;  3DCG A;  3I9V 1;  3ZYY X;  3DVN V;  5HHD G;  1WX7 A;  5C2T B;  2CHX A;  2BYT A;  2BF8 B;  2JX5 A;  1Q0W B;  1GPX A;  1XLO A;  3P2B A;  2L7R A;  1J7A A;  1T6B X;  3U2S C;  4ITK A;  4WUR A;  2C7H A;  3L10 B;  2J4X A;  2M1M A;  2DBY A;  3Q14 C;  1BXT A;  4ZRI A;  2IY1 B;  4URK A;  1WF9 A;  2N9P C;  2RD0 A;  3O65 B;  3RPF C;  4WJP A;  2AL3 A;  1WGH A;  1WXM A;  1DOX A;  4BBN C;  1WGG A;  2INC C;  2LXC A;  4S0R A;  4LCD E;  1OQY A;  2E3T A;  1PQS A;  2QMT A;  3D32 A;  5EDS A;  1TTN A;  2VZK D;  3WAO A;  2UU7 A;  4XC2 A;  1IP9 A; 
#chains in the Genus database with same CATH homology
 1SJE D;  3NRZ A;  3ZGZ A;  1DGJ A;  2JQR B;  2KQ4 X;  4ZYS A;  1XO3 A;  1P7E A;  1N5X A;  4ZOH C;  4RNA A;  3T3O A;  1ZXI A;  4A9A A;  3GP7 A;  5EE9 A;  1KF6 B;  1L4Z B;  4YWG G;  4RGN A;  3NVZ A;  2K3U A;  4JX1 C;  1ZP0 B;  3Q69 A;  1IGD A;  1FO4 A;  2BW2 A;  1YN3 A;  1EU3 A;  4HRO A;  1HZ5 A;  2I2Y A;  1JWS D;  4RGO S;  1QOA A;  2WNM A;  2BS4 B;  1V1O A;  1VZ6 A;  2JSV X;  3O13 A;  2KWD A;  2E6X A;  2ZW0 A;  4L1B A;  3ETR A;  1E10 A;  1KH0 A;  1SB3 C;  2PLP A;  2WXM A;  1JQ4 A;  1F77 A;  4OZA A;  4RFB A;  4C56 C;  2INP E;  1JML A;  2PVG C;  2JWU A;  3CIR B;  4D2K A;  4YXD B;  1C4P A;  1FM0 D;  3OWE B;  1PGX A;  4JPS A;  1L0X B;  2WXJ A;  1D5Z C;  1YQ3 B;  1MPE A;  1QOB A;  3AE7 B;  2WXR A;  1VZ8 A;  1UNS A;  3LB8 C;  2OED A;  1TKG A;  2SAK A;  3EA6 A;  1TKE A;  2N0S B;  4P6V F;  2WXL A;  4JWS C;  4A6Q A;  3MFG A;  1SBB B;  5H92 C;  2GI9 A;  4USA A;  4C7Y A;  2WU2 B;  4REZ A;  4IKG A;  3P63 A;  5G5G A;  3NVV A;  1N61 A;  3AEC B;  1C77 A;  5FK9 C;  1EWY C;  2K0P A;  2BS2 B;  3AEF B;  4TMA B;  4US9 A;  2XNA C;  2W3R A;  3ZJU A;  4XDD A;  3NZ3 A;  4RF0 A;  3AB5 A;  1TY0 A;  4CQN A;  1C79 A;  3SFE B;  1TS5 A;  4H2A A;  5HFY A;  2DYO A;  2X38 A;  2IGD A;  2HDE A;  2AQ2 B;  2BT6 A;  3NVW A;  3BII D;  2KDM A;  1YMH E;  1DOY A;  2XN9 C;  3Q8A A;  3AEG B;  4JWU C;  2MEK A;  3AMZ A;  3Q8F A;  4TSS A;  1NEK B;  1NYR A;  1FFU A;  3BZD B;  3W5U B;  1E7P B;  4TQ0 A;  3V3X A;  3PZ7 A;  1PDX A;  2INN E;  2LFI A;  3SFD B;  4A8X C;  1YN5 A;  5T8I A;  3P42 A;  1CQV A;  2W3S A;  4WH4 A;  2B76 B;  4TQ1 A;  1I4X A;  1I4H A;  1XF5 L;  1L5P A;  5BYS A;  1JWB D;  1C4A A;  5FKA C;  4ARC A;  2WXP A;  3FAH A;  1EU4 A;  5EE0 A;  3W2D A;  2QSD A;  1IBX A;  3VR9 B;  1FCL A;  2FE8 A;  1J7C A;  2NTS A;  3FC4 A;  1BUI C;  1JWA D;  2WXF A;  2DWQ A;  1HEZ E;  4AQ7 A;  1FCC C;  3ZJT A;  2KMM A;  5AUI A;  1NVI D;  4DXF A;  1GAQ B;  4ZRQ A;  1T3Q A;  4HRS A;  4XWT A;  1E6E B;  1YJI A;  4C7Z A;  1L6V A;  3HVZ A;  3U4E G;  2YEP F;  1HQR D;  1R7S A;  3MJ5 A;  1SE4 A;  2ACZ B;  3N9Y C;  1XLN A;  3W1S A;  1RM6 C;  2H89 B;  3AE3 B;  1SE2 A;  1QQR A;  2JU6 X;  1N63 A;  5D3D A;  3KWV A;  3MC0 B;  3RFZ B;  4AS1 A;  3IT6 B;  3IXS A;  1CK1 A;  2WXO A;  2LUM A;  1KLG D;  1PGA A;  1NI3 A;  3TEY A;  2NMQ A;  1WXQ A;  2M0A A;  2I38 A;  4OZB A;  3AE2 B;  4KKI A;  3FIL B;  3AE4 B;  2JXT A;  3ZJV A;  1V1P B;  2EKI A;  2QJL A;  2WQY B;  1CJE A;  2HTM E;  1EWC A;  2V0G A;  1JW9 D;  3VR8 B;  2WU5 B;  2KN4 A;  4YT0 B;  1SIJ A;  4KGT A;  1FNW A;  1XEE A;  3CWI A;  1NYQ A;  1YQ4 B;  1ZE3 D;  3AE9 B;  3Q8C A;  1DYQ A;  3P4S B;  2KAJ A;  1RYJ A;  3TSS A;  1ESF A;  4NJC A;  2L32 A;  2JYE A;  2LHE A;  1YNT E;  2WLB A;  3AN1 A;  4LK0 M;  4XE0 A;  2MJ3 A;  4YTM B;  3KLS X;  4GLS C;  2AQ1 B;  4B0M A;  1GB4 A;  1PYW D;  2W55 A;  1XLQ A;  1ZPS A;  3L4P A;  3ZQ4 A;  2TSS A;  2NTT A;  1AN8 A;  4N58 A;  1JWU D;  2G1E A;  1I4G A;  2DLB A;  4YTP B;  1V8C A;  4PT5 A;  2PIA A;  3U7Z A;  1XCT L;  1RFK A;  1ROE A;  1IBX B;  2CJO A;  2PKO A;  3B2F A;  3W5V B;  1HA5 A;  3BYT B;  1WGK A;  3AE1 B;  2J53 A;  1KRH A;  3KQ4 A;  3VRB B;  4RH6 A;  1IGC A;  2RPV A;  1E0Z A;  4RF1 A;  2PMV A;  1PUT A;  2IDY A;  2OHF A;  1AWD A;  4RGM A;  1L6U A;  1STE A;  3R2I A;  2K5P A;  1BML C;  3Q8E A;  4N59 A;  1QIL A;  1QOF A;  4KGR A;  1PGB A;  1RWS A;  1GOZ A;  2ZW1 A;  4YSX B;  1E9M A;  2Q5W D;  4IDI A;  3AH7 A;  4DXG A;  3FIL A;  3SEB A;  2PTL A;  1VR9 A;  3BVG A;  3P4R B;  1M4V A;  1TZO A;  1YJJ A;  2WDV B;  4O1N A;  3B9J A;  3VRA B;  1D5X C;  2MH7 A;  2K22 A;  3DWG C;  1HZ6 A;  5BMH A;  4OZC A;  1K52 A;  2IGH A;  3B2G A;  4XWW A;  3MHZ A;  1TKY A;  1V97 A;  2WDR B;  4LTU A;  1QLB B;  3EUB 2;  3AEB B;  3AEE B;  4NAM A;  1K53 A;  1VRA B;  4IOI E;  4WAF A;  5AUK A;  1JWM D;  1A70 A;  3BK1 A;  3NVY A;  1TS2 A;  5MPO A;  1TJE A;  4WQM A;  1MVK A;  2EEL A;  1PFD A;  1L0Y B;  3V05 A;  3P4Q B;  1N62 A;  2R61 A;  4LLG M;  1OFF A;  2CJN A;  2M56 B;  5BMI A;  3GB1 A;  1SE3 A;  1N60 A;  1SEB D;  1D4B A;  2G9H D;  3J9C A;  4N6E B;  2WS3 B;  5C3J B;  3U52 E;  5HI1 A;  2L1A A;  4GDL B;  3ABV B;  4NAW B;  4P16 A;  2ICI A;  2J52 A;  3NUH B;  1JAL A;  2QIE B;  4A55 A;  4MH8 A;  2IGG A;  5G5H A;  3EGR A;  2J42 A;  3E56 A;  5E6J A;  5TSS A;  2RMM A;  4HJG E;  1VDV A;  3BVZ A;  2QIL A;  2Y5C A;  1CZP A;  1N5W A;  1TY2 A;  5EE1 A;  1I4P A;  1I4Q A;  3LXF A;  1ET6 A;  2PVO D;  3AV8 A;  2H88 B;  4YSY B;  1VLB A;  2PW9 A;  4OHJ A;  4M0W A;  1XXG A;  4L2Y A;  1OQQ A;  1FNU A;  1AYF A;  2LMC A;  2WXK A;  4RGT A;  2BS3 B;  3UI3 A;  5JXV A;  1D5M C;  1JRO A;  2MJD A;  1K50 A;  2FUG 1;  1MHX A;  2AX5 A;  2L83 A;  1HXY D;  2YEP B;  2BTE A;  2MJE A;  2W54 A;  3P4P B;  1FNV A;  1ZUD 2;  4Q2J A;  1SSN A;  1QKZ A;  1QOG A;  2K9X A;  3KWL A;  3Q8B A;  1C9F A;  2M19 A;  1J7B A;  2LHD A;  1IUE A;  3T3N A;  2LJI A;  4ZHO A;  1YN4 A;  1QF6 A;  4KGS A;  4US8 A;  3SR6 A;  4MT5 A;  5D7G A;  3C8Y A;  1P7F A;  2FBW B;  1DOI A;  1I7H A;  3HUI A;  4ARI A;  1SXT A;  2BB5 A;  5H8Y E;  5HG2 A;  3IAS 1;  1WSP A;  3I57 A;  3GS2 A;  4ZHP A;  1FMA D;  1ZXH A;  1UGJ A;  1K51 A;  2ONQ A;  4ZRP A;  1L0V B;  1EM7 A;  2N9L A;  1V1P A;  1D6E C;  3R8B A;  1KFY B;  4EE2 A;  5FR3 A;  3H8H A;  4WWM A;  4HKZ E;  1MHH E;  1WWT A;  4OVZ A;  1GB1 A;  1FEH A;  2IPK D;  4KX6 B;  3AE5 B;  1ENF A;  1C4C A;  2GB1 A;  3LYY A;  4MM3 B;  1Q10 A;  2RDH A;  3P1M A;  4XDC A;  2RDG A;  2Z8L A;  4DQO C;  1ZDV A;  3NS1 A;  1FIQ A;  1ACC A;  2Y5P A;  3MP9 A;  3IAM 1;  3AE8 B;  2JYT A;  1AW7 A;  1C76 A;  1KLU D;  4UDU C;  5EE3 A;  5BYQ A;  4C80 A;  4JE3 B;  2WXG A;  4NZL B;  2WXN A;  4OW0 A;  5I4D A;  2LGI A;  2QEJ C;  1QT9 A;  3WCQ A;  4A90 A;  3BK2 A;  5BYR A;  2SEB D;  5D3I B;  1I4R A;  1OQR A;  1F2R I;  1FFV A;  1C78 A;  3PZ8 A;  1FD6 A;  2V3P A;  4J3O D;  1WYG A;  4HKQ A;  1FRR A;  5BMG A;  3TEZ A;  1VJK A;  2D5G A;  2WDQ B;  3BYY B;  3URY A;  2AQ3 B;  2N7J A;  3PO0 A;  2BBC A;  1F2R C;  3TEW A;  1KTK A;  2DYM A;  5GXG B;  3I9V 1;  1FXI A;  3ZYY X;  2V4I B;  4YSZ B;  3DWM A;  5HHD G;  1T5X D;  5C2T B;  2V3N A;  2BYT A;  2WXI A;  1ET9 A;  4KKJ A;  1LO5 D;  1UWX A;  2JX5 A;  2KAC A;  4YTN B;  1Y56 A;  2L52 A;  3AEA B;  1ZDX A;  4FXC A;  1GPX A;  1XLO A;  1SJH D;  4R3D A;  3AM9 A;  2N9K A;  1F0Z A;  2Y3A A;  1J7A A;  1L4D B;  1T6B X;  4L23 A;  3U2S C;  1JRP A;  4ITK A;  1B1Z A;  4WUR A;  2CU3 A;  4WIP A;  1NEN B;  1SF0 A;  2BB6 A;  2J4X A;  2DBY A;  3E9S A;  2WXQ A;  1VZ7 A;  1BXT A;  2IJ0 A;  1JCK B;  1ZOY B;  1TS4 A;  4HEA 1;  4B0E A;  1XCQ L;  1B9R A;  2JZP A;  3TUO A;  2VZK B;  2GRI A;  2W82 A;  3RPF C;  3AE6 B;  3HRD D;  2ON8 A;  1UUP A;  1XLP A;  3BVM A;  4RCO A;  3BWU D;  1TS3 A;  1DOX A;  3W9C B;  1MI0 A;  4MAC A;  3AED B;  1FXA A;  2WP9 B;  2E3T A;  2QMT A;  3IT4 B;  5LNK 1;  2VZK D;  2WXH A;  1WRI A;  3TEX A;  1TYG B;  1UWM A;  2LEK A;  3HVD A;  1FRD A;  3R2T A;  4GDK B;  3VQI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...