5GXGB

High-resolution crystal structure of the electron transfer complex of cytochrome p450cam with putidaredoxin
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
106
structure length
106
Chain Sequence
b'SKVVYVSHDGTRRELDVADGVSLMQAAVSNGIYDIVGDCGGSASCATCHVYVNEAFTDKVPAANEREIGMLECVTAELKPNSRLCCQIIMTPELDGIVVDVPDRQW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Camphor 5-monooxygenase
publication title Identification of productive and futile encounters in an electron transfer protein complex
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase/electron transport
total genus 31
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2016-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5gxgB00
1OQQA 3P4SB 1RWSA 4LTUA 1WWTA 1JWAD 1DOYA 2W3SA 2K22A 1L5PA 1R7SA 2Y5CA 3LB8C 4YTMB 1QF6A 1J7BA 1PUTA 2PVGC 4WQMA 3WCQA 3EUB2 1J7AA 2CJOA 4N58A 4YTPB 1KFYB 2G1EA 2JX5A 2WP9B 3AMZA 3HUIA 1KF6B 1WXQA 1YJJA 2M56B 3AEBB 3AEEB 5C3JB 1SIJA 1SB3C 1NEKB 2EKIA 2H89B 3P1MA 3AB5A 1E10A 2DWQA 1GPXA 4ZHPA 1RYJA 1TJEA 1XLOA 4IDIA 4YTNB 1UWMA 3AN1A 1L0VB 3SFDB 1FFVA 1I7HA 2ACZB 2OHFA 1PFDA 3NVZA 4C7YA 5EE9A 1NVID 2BS3B 1JW9D 1XLPA 4JWUC 1DOXA 2HTME 1V8CA 2Q5WD 1WGKA 1VDVA 2QIEB 2WQYB 1FXAA 1J7CA 2K5PA 3AE5B 1QOGA 4YSZB 1NENB 3SR6A 5AUKA 1A70A 2QJLA 3LXFA 3AE1B 1GAQB 2B76B 2CJNA 1CZPA 2LEKA 4JWSC 1ROEA 1JALA 3ABVB 3AE6B 1N5XA 2W3RA 3FAHA 1FRRA 3HRDD 3VRBB 1DGJA 1N62A 1XO3A 1JROA 3AE8B 3W9CB 1IUEA 3ZYYX 5C2TB 1QT9A 1AWDA 2BT6A 3NVWA 3B2FA 4HRSA 4KX6B 1L6UA 1NYRA 1TKYA 3CIRB 1WYGA 2W54A 4YSXB 1AYFA 1NYQA 3AE3B 1VJKA 3AE7B 1JWBD 1YQ4B 2PVOD 3P4QB 3NVYA 3ETRA 2M19A 1RM6C 4US9A 2PKOA 5AUIA 3AEDB 1YJIA 1WRIA 2MJDA 3SFEB 4P6VF 3AEGB 2BS2B 2WS3B 1XLQA 1XLNA 2DBYA 2L83A 5H8YE 1YQ3B 4YXDB 3B2GA 1FFUA 1FMAD 2WU2B 3AE2B 1N60A 1OFFA 3B9JA 4HROA 3W5VB 3AE9B 3NS1A 1QLBB 1DOIA 1TKEA 2WDRB 1QOAA 3L4PA 3AE4B 1ZOYB 2E3TA 3AH7A 3DWGC 3NRZA 2H88B 1JRPA 2WDVB 2AX5A 3VRAB 3P4RB 2MJ3A 4N59A 1B9RA 1ZUD2 2K9XA 3AEAB 3BIID 5H92C 2KMMA 3CWIA 4A9AA 1E9MA 4C7ZA 1TYGB 3P63A 3AECB 1QOBA 1PDXA 4ITKA 1N63A 4N6EB 5EE0A 5MPOA 4JX1C 4ZOHC 1FO4A 3VR8B 1FXIA 1FRDA 1TKGA 5G5GA 4YSYB 3RPFC 3DWMA 3VR9B 1ZP0B 1JQ4A 5EE1A 1F0ZA 1EWYC 2MJEA 2WDQB 3KWLA 3NVVA 1QOFA 3FC4A 4C80A 1FM0D 4ZHOA 1KRHA 1CJEA 3AEFB 4FXCA 4US8A 2FBWB 2L52A 2JQRB 2KAJA 2MH7A 1VLBA 1OQRA 2WLBA 4YT0B 2CU3A 2BS4B 2WU5B 3AV8A 3P4PB 4USAA 1FIQA 2PIAA 1E0ZA 1RFKA 1ZXIA 1N5WA 1N61A 1NI3A 1SF0A 3HVZA 1L6VA 4WWMA 5EE3A 3W5UB 5GXGB 5G5HA 1T3QA 3AM9A 1E6EB 2N0SB 1V97A 2W55A 1E7PB 3PO0A
chains in the Genus database with same CATH superfamily
1HEZE 3Q3OC 2OJWA 5EDSA 1R7SA 4AP4C 4FJZA 3BVMA 3WCQA 2SEBD 4N58A 1J7AA 1V9JA 3BYTB 3UIOB 1DYQA 1GC7A 2KKCA 5TSSA 1UELA 5BMIA 2FCSA 2DWQA 1EM7A 3ZVVA 2ACZB 2N9KA 4BVUC 3BVGA 3KUCB 2KX3A 2GBKA 4IUMB 1XLPA 2Q5WD 2KDIA 4IOIE 3ENEA 2QSDA 3LYYA 2CJNA 5FKAC 1FRRA 1TZOA 3DVNU 3DPDA 2LMCA 3W9CB 4EEWA 4M00A 3NVWA 3B2FA 1M94A 1ZE3D 3QWZB 5LXIB 1UGJA 3N3KB 2WWZA 4BKTA 3RZFA 3AE3B 1WH3A 4WAAA 4EZLA 1WGRA 3VH3B 2MP2A 2INDC 3NJTA 1EU4A 3VHTC 1RLFA 2WXRA 1XD3B 2INNE 3H6NA 3B9JA 2BQQA 3AE9B 2L00B 2AL6A 2L05A 4ANUA 2C60A 5D6JB 3MJWA 2YEPF 2DZKA 1QILA 3AECB 1B1ZA 3CSTA 4PK1A 3BK1A 3VR8B 2V0GA 3AU4A 3H7PA 1C4AA 4ZHOA 1QOFA 2C7MB 1PGAA 4WJNA 3QHTA 4EZKA 1LFDA 4MELA 3KH0A 3P4PB 4USAA 3ZNHB 1UBIA 1E0ZA 4NPNA 3ZXVA 3ZRFA 1N5WA 4KGSA 3UIPB 4PS3A 4XDCA 4NQLB 3RZWC 1WXVA 2ONQA 1AN8A 1C3TA 1C79A 2IZVB 3WA0A 1V1PB 3TEYA 1TY0A 4M0WB 2ZVOA 4NAMA 4GLSC 1E5WA 4P7IA 3IBEA 2LJ5A 1WXQA 2M17A 2J7QB 4WJPA 5CX3A 2H89B 1F2RC 4MM3B 4MACA 5HFYA 1VCBA 3PT2B 2NPTB 1V49A 3NVZA 4F1SA 2BS3B 3KYCD 1MG8A 1AW7A 1XCTL 2KD0A 4NAWB 1FXAA 1R4NB 4FLHA 4A90A 4AJYB 4YSZB 2QJLA 4XGAB 4RGNA 4M01A 1P7EA 1ROEA 2QEJC 1N5XA 4P16A 1WZ0A 2IJ0A 4AJWA 1AWDA 2JT4B 2NMQA 4MSMB 3RNAC 2DLBA 1TKYA 4DHZE 1HA5A 5AZGA 1GOZA 4S0RA 1YQ4B 4NZLB 2X38A 2BBCA 4GDLA 5CTRC 2K8CA 4WQOB 1WI0A 2D3GA 2KFKB 3M63B 2KK8A 4FULA 1OEYJ 3GZNB 3HM3A 1D5XC 2D10A 1P9DU 5AZFA 2K9XA 2IBIB 1T6BX 2NR2A 1TYGB 2PE9A 2CKHB 4ANXA 4FHKA 5EE1A 1TS2A 2O6VA 3NUHB 1TS5A 4IKGA 5BMGA 2FAZA 3JVZX 1XQQA 3X0WA 1UUPA 4OVUA 3Q8FA 2L3ZA 4WWMA 1WXAA 2VH2A 2KZRA 2BF8B 2FE8A 1T3QA 2N1WA 1STEA 3SFEB 2NTSA 2EKEC 2GBMA 4LNFA 2C9WB 2W3SA 3ZJUA 3Q3FA 1L5PA 4AOFA 1IYFA 2ZNVB 1YIWA 2ZW1A 3RN9C 3Q2AC 2D5GA 5JH5C 3AEBB 2MWSB 2BPSA 3V6CB 3W1SA 1BMLC 2BYFA 5IKCM 5DPWA 1TS4A 2C7HA 3AN1A 2UU7A 2BYEA 2LVPA 1I7HA 5LNK1 2JYTA 1NENB 1GAQB 4HDOA 2KN4A 3ABVB 4OW0A 4DQOC 1DGJA 1WM2A 1IUEA 4HPLB 2KXJA 4REZA 1MI0A 3QCAA 4FN2A 4LNNA 4YSXB 1WX9A 1I4PA 4GDKB 2KT7A 3PSEB 2WNMA 3NVYA 3AEDB 2KFJA 3R2TA 4C4VA 1SEBD 1XLNA 3B2GA 1FMAD 3OLMD 2I38A 4Q2JA 4JIOU 2EELA 2WDRB 3EA6A 3NRZA 3AE4B 3CSFA 4JPSA 3OAWA 2AEHA 2H88B 2O2VB 1T0RC 2DENB 3U8ZA 4L2YA 2BWES 2BVCA 4YL8A 5D2MB 2BW2A 2MEKA 4RF0A 3I63C 4YSYB 5FK9C 1ZP0B 3ZUNA 2DZIA 2QILA 1TS3A 2KJHB 1SE4A 2G45B 2IY1B 3A33B 4JE3B 2PW9A 2N7EA 1D5ZC 3S2AA 1SF0A 2BYVE 3MC0B 5IOIA 3TUOA 2KOXA 3I5JC 2PMVA 2ASQA 1RWSA 3FKYA 5JHAA 4WJOA 5G2NA 3RNFC 2MRPA 2NBUA 2KLCA 1NDDA 1LXDA 3AMZA 2G1EA 3HUIA 3TL5A 3PV1A 2EKIA 3U4EG 1Q0WB 4OVVA 1XLOA 2C5LC 4WWPA 2I1KA 3GS2A 4W9DA 1V2YA 3VH4B 4EUTA 3N30A 1WGKA 2EMTA 2N7DA 4W9EA 1TTNA 4BBNC 3PRMB 4K1RB 1WX7A 1VD2A 2BKRB 4KGTA 5BYSA 3DBRI 4MJSB 5DPRA 1Z2MA 2WX1A 2N7JA 1L4DB 3P4QB 2Y5BB 2INPE 4MGZE 4ZYNA 2PKOA 2BTEA 1YJIA 2YLMA 3W1SC 3PLVA 2L83A 1F77A 1P1AA 3AE2B 3N1ZC 4ZDVA 3UI3A 1QLBB 1QOAA 1WYWB 3ZJVA 3VUWA 2RDGA 3L17A 1E9MA 1T0YA 3BY4B 2WXLA 3DVNV 5DPSA 4HXDA 2K1FA 3NZSA 2IDYA 2WYQA 5C1ZA 2LGDA 3Q14C 1CJEA 4RGMA 5E6OA 2CS4A 2WU5B 1P98A 1YX6B 3IAM1 3RNEC 1V6EA 1L6VA 1MG4A 2KN5A 3L08A 2JZ3B 2W9NA 3EFCA 1IP9A 4BBNF 4PS8A 2KNBA 3MHZA 3DVGY 3QC8B 1MPEA 1TBEA 2IO0B 1CK1A 4YTPB 2PLPA 2V4IB 3IXSA 4BFRA 3N1XC 3Q8BA 4FA6A 4E74A 3NZUA 2KMAA 1I4QA 1Q1OA 5DCNA 1JWMD 5G55A 1JW9D 5E6PA 3Q6BA 1KOTA 4TMAB 1C76A 2ZJDA 5AZHA 3AE6B 2BWFA 5CHVC 3ZNID 3NY5A 4LK0M 4URKA 2MBHA 3KUDB 4HRSA 1ENFA 1T0QC 1VJKA 2KC2A 4US9A 4B0MA 2O6VD 3W1YA 3EECA 1FCCC 4X57B 2G3QB 1DOIA 3AH7A 2PPHA 2IY0B 4FJYA 2D2QA 1VZ6A 2J52A 3DHGC 4JX1C 5T8IA 3QJZA 1E8YA 2DYBA 3NVVA 3JSVA 1FM0D 3EGRA 1ZGUB 4JGHB 1KJTA 3VXWA 3FILA 3T8MA 2KACA 1LO5D 1ZPSA 2M8SA 1HZ5A 1ZXIA 5J2RA 4G11A 4K3BA 3W5UB 5G5HA 3D32A 4S17A 4PT5A 2N0SB 2LXCA 3U7ZA 2BGFA 2Z59B 3A1QA 4RH6A 3TEWA 4W9GA 4MGIE 4OVZA 3TJPA 4LJPB 3TCAA 4FADA 3DHHC 5E6JA 2DNFA 4M8MA 1UZXB 4B6WA 3H8HA 2DAJA 2L0TA 3KW5B 4HJKA 2C7NB 3I57A 3KVFB 4MEMA 4W9IA 2KX0A 3DBLI 1QOGA 4HEA1 3DBLB 1CZPA 4JWSC 3R66C 4HPMB 3VRBB 1J0GA 3AU5A 2W82A 2DZMA 4WWNA 3OG5A 2LWPA 2RDBC 4IWQA 2LRUA 2CHZA 2WS3B 1MVKA 2FIFA 4HCPB 1UF0A 4BZAA 4CO7A 3ZLZA 3EFUA 4W9LA 3VUYA 3RYTA 1CQVA 3TMPB 2NVUI 4D2KA 1MHHE 3H7PB 5BO4B 1D3ZA 2LHEA 2KO3A 1D4BA 2LZ6A 1SSNA 4WWOA 1F9JA 3DWMA 2FUHB 3E9SA 4TUUA 3ZQ4A 3UINB 1K53A 4FXCA 2N4FA 1WGHA 4GIVA 3ZDMC 1FNVA 1WRDB 1RFAA 1ZW7A 4L1BA 3WAMA 3WAOA 5JXVA 2N9EB 1OQQA 4EFOA 2ZCCA 3WALA 3MP9A 4A55A 1VR9A 1WWTA 1SJED 3IT4B 3R2IA 3RNGC 1PUTA 4WQMA 1WZ3A 4ZRPA 2WP9B 3JW0X 1WGYA 2M56B 2V9HA 2LUEA 2WXMA 4KZCA 2FCQA 4DDGD 5FR3A 3PREA 4C7YA 4FBJB 4CYEA 4K81A 3ZTDA 2K5PA 2LVQA 4IM2A 3APCA 5AUKA 4BOSC 2RGFA 2A5UA 2M1MA 4ASWC 4ZYSA 3RNCC 3M3JA 3ZYYX 3K9PB 2BT6A 5IA7A 2WXQA 1BUIC 3ZNZB 1NYRA 1WYGA 2QHOA 2JF5A 4GDLB 1YQBA 3AE7B 3ONSA 4GGQA 4BKGA 3ETRA 2PE6B 3IT6B 5L95C 3C19A 2WHIA 1R4NI 2XEWA 4HLEA 1J8CA 1H8CA 3W2DA 2LI5A 4ICVA 4ARIA 2BKFA 3NS1A 2GRIA 1P0RA 3V61A 3DCGA 3Q3JA 1JRPA 1WXMA 2IO2B 3AEAB 1HZ6A 3H9DA 1TY2A 2HJ1A 4ZRJA 1WIAA 4XZ4A 1E8WA 2O6VB 3GE8C 4G3XB 1EWCA 4MGYE 4C00A 4MH8A 3V6EB 1I42A 4W9KA 3AEFB 2G4DB 4AWJA 3GZNI 4XDDA 3TIXA 3VTWA 2J0KA 1C4CA 1WR1A 1WJ4A 2FIDA 3PTFC 3SHQA 4RF1A 1E90A 1GG3A 4HVBA 4LTUA 4EKUA 3TEZA 1EO6A 1SXTA 1DOYA 1GNUA 1MJDA 3ZGZA 4KIKB 1WF9A 1EU3A 1WGDA 1LQBA 4OZAA 2MBOA 4ICUA 5I4DA 1UWMA 1L0VB 3GP7A 4YWGG 3SFDB 1PFDA 4GOCA 3GB1A 4DXFA 2CR5A 3R7QA 2GB1A 3VUXA 3U2SC 5CHFA 4GSWA 2R2QA 2B76B 3FAHA 3HRDD 3SEBA 3T3NA 1N62A 3AE8B 2I2YA 3UQAA 3E56A 5D94A 3APDA 2G4SA 3R7RA 3CIRB 3DQVA 1YN4A 2ZPNA 3NG0A 2E6XA 2XK5A 2WXKA 2M19A 1OTRB 2WXJA 1OQYA 3U7DA 4P6VF 1D5MC 4PYUA 3ML8A 5H8YE 1WR6E 1YJ1A 2ICIA 2VZKD 2V1YA 3Q69A 3TSSA 1ZUD2 4WJQA 4KSKC 3SDLC 1PDXA 4TKNA 2MX2A 4LDTD 4QAYA 4HKQA 2K8BA 4J6IA 1TT5B 4LJOB 2GOWA 2KDMA 4C56C 2HTHA 2I1JA 3CF6E 3NS8A 1SBBB 3A9JB 4OZBA 4HWIB 4RCOA 2HDEA 3V05A 4EZJA 2ZVNA 3GE3C 1E7UA 1HQRD 1SE3A 2N9XA 3DBHB 4KDIC 2W55A 4ZRKA 4DWFA 1H4RA 4DK5A 1XXGA 1IGDA 1WY8A 2JRIB 3NZ3A 2WXHA 2J4XA 1SGHA 1YN3A 1HTOA 1ZXHA 4XYCA 3U52E 2JVCA 2XN9C 1ISNA 2GLSA 4K7UA 2FUG1 1Z5SB 5HKHA 4GMVA 2LUMA 4GU2A 1NVID 4AQ7A 2LASA 2OOBB 4H2AA 3PHWB 3A9KA 4JLCA 1SE2A 4ZRQA 4DXGA 1PGBA 2J0JA 1QT9A 1I35A 2UWQA 1QZEA 3MJ5A 2MHJA 3L10B 1C78A 3MTNB 4LNKA 3AEGB 2BS2B 2DBYA 2V3NA 3HVDA 4W9CA 2DHZA 1WGGA 5AUIA 3ZO5B 2ZPYA 4PS7A 1I4XA 4N59A 2KMMA 3ZXRA 4C7ZA 3DDCB 1TZ1A 4HCNB 5MPOA 4II3B 4ZOHC 3QAQA 1IBXB 1VRAB 5D3DA 3VR9B 2WDQB 4C80A 1KM7A 2FBWB 4IG7B 2MH7A 2BS4B 4A3PA 2WXOA 5KHOA 1JCKB 4LNIA 1YX5B 2IO1B 4KSLC 4RGTA 4F7ZA 3X23A 2DYOA 5BMHA 4PYZA 2HD5B 3N20C 1U4AA 1IGCA 1YD8U 3OWEB 4ARCA 4YTMB 2PVGC 4F8CB 2NTTA 2JRHA 2KWDA 1IPGA 2AQ1B 2KWVB 5BYQA 4IM3A 2KDEB 4XC2A 4FJVB 4A20A 1L2NA 2TSSA 1K51A 2MA9B 4G50A 2IYDB 4MJSA 3MFGA 1TGZB 3O13A 2KC1A 1UH6A 4EOYA 4W9JA 2K8HA 4OHJA 2QMTA 1V1OA 5FR6A 1WMHB 4BKSA 2YVCA 2KJ6A 2N9PC 4DXAB 4TQ0A 1VZ8A 1BXTA 1RM6C 3PZDA 4DHJD 1SE9A 1WRIA 2K6QA 1XLQA 2Z0DB 1WJ6A 2K25A 3MC9A 1GC6A 2JXXA 2E3TA 2Y3AA 3DWGC 1S1QB 2MBQA 3CWIA 2KJRA 3PVLA 2LFIA 4N6EB 3JSVB 1X1MA 3Q8EA 3I3TB 4O1NA 1TKGA 3URYA 3FILB 3PGEA 2FCNA 1A5RA 1UBQA 4RGOS 4HKZE 2KVZA 2J42A 2LGSA 2IPKD 2VZKB 1VLBA 2CU3A 2J0MA 3RT3B 4TV3A 4P1CC 3HVZA 2N1VA 4LDTB 4IW0A 1F2RI 2ZCBA 5BYRA 1P3QU 2KDFB 5KHQA 4BAXA 2WXIA 4NY0A 1R4MB 1PGXA 3PO0A 4EE2A 2KTRA 3BVZA 4OZCA 2X8XX 4DHZB 4LNOA 2ZEQA 2FNJB 2K22A 1Y8RC 3IFWB 4WH4A 2D3AA 4ANVA 2UYZB 2NCNA 3L54A 3V62A 5C3JB 2K0PA 3AEEB 1SIJA 2MSED 2JXTA 1TJEA 3AULA 3C8YA 4KZ0A 4CQNA 3QX1A 3MC8A 2HJ8A 1FNWA 3OJ4B 1JRUA 1YN5A 1T5XD 3KWVA 3SR6A 3IG3A 1K50A 1WJUA 3ZJTA 3EC8A 2JZPA 5C2TB 1C77A 1WXSA 3RCZA 1GB1A 5JHBA 1AYFA 1QKZA 4TSSA 4W9HA 2A4ZA 2L7RA 2PVOD 3Q8CA 2MW5A 1V81A 1E7VA 1F1HA 1OGWA 2WU2B 3DOWA 4HROA 2MCNB 1RAXA 4A8XC 2D11A 2IGHA 1ZDXA 3Q3NC 5DPTA 1RRBA 2MP2B 1FPYA 3VQIA 1XEEA 1QOBA 4GXBA 1N63A 3QIJA 2Z0EB 3PZ8A 1I4RA 2D07B 2MJEA 3KWLA 4N9F4 2BYTA 2WLBA 4IC7B 3RD2A 1G6JA 3AV8A 1FIQA 2LHDA 4B0EA 2GBNA 2NBVB 3NOBA 4LLGM 1GUAB 2L1AA 3LJ3A 1JWAD 1QF6A 2RPQA 2BB6A 3ZRCA 2INCC 2OEDA 1KLGD 2L8JA 4XWTA 1KF6B 3N32A 3IAS1 1GPXA 2JU6X 3V60A 3BINA 3M62B 4KDLB 2WXPA 2WGSA 4IM0A 4R3DA 5EE9A 1DOXA 1YNTE 2GMIC 1UWXA 2HE7A 2G9HD 2SAKA 1AARA 3L16A 4WURA 4UDUC 4GB9A 1GJZA 3KYDD 3LDZE 4MDKE 2W54A 3I9V1 2VRRB 1GB4A 1ACCA 1TIFA 4J3OD 3WANA 1YQ3B 1FFUA 3VAWA 4DDID 3UQBA 2GI9A 1ZOYB 4ZRIA 2MQJA 3VRAB 2M4NA 3P2BA 4RNAA 4DHJB 4ITKA 1L7YA 2L76A 3ZW3A 4MT5A 5G5GA 5E6NA 1HTQA 3RUIB 1EWYC 3FC4A 1V5OA 1KTKA 1XCQL 4US8A 3DHIC 3A4SC 2RMMA 1N6ZA 3N9YC 2JWZA 3B0AA 1L0YB 2PTLA 2KVRA 3RFZB 1E6EB 3AXCA 3QK0A 4K7SA 1C9FA 2QCZA 1OEYA 1QQRA 3PS6A 5C23A 4XWWA 5HI1A 5JZEB 4LCDE 4NQKE 4MSQB 2WX0A 1V1PA 3R8BA 2CJOA 4I6NB 3J9CA 4M0WA 3P1MA 3KQ4A 3H7SA 4BKSD 1E10A 1SIFA 3PZ7A 3QARA 2K3UA 4MM3A 2OHFA 1WE6A 4JQWC 1V86A 2D3CA 1EUVB 4M02A 2R2OA 2NPTA 1V8CA 4B95A 4I6PA 1M4VA 3PRPB 5GMVA 2JYEA 3LXFA 2LEKA 4NAWA 3ZIMA 3ZKJC 3ALBA 1NI2A 2LRWA 1KLUD 3CMMB 2KQSA 2XK5B 4HK2A 1ET9A 5J17A 1LM8B 1PYWD 2DZJA 1FCLA 4AS1A 1XF5L 3K9OB 2LJIA 4ANWA 3V3XA 1OFFA 3PHXB 1V5TA 3GOEA 3L4PA 3IHPC 5IO9A 2KYWA 3DBSA 2KFKA 3HM6X 3BIID 4HDQA 3DVGX 5EE0A 1EF1A 3RI7C 4C4VB 2VH1A 3VVWB 1FRDA 2V3SA 4JL9A 3RPFC 2WXNA 1F0ZA 3M95A 3BK2A 1ESFA 1V80A 2AYOB 2IO3B 2ZZPB 3ML9A 2M0AA 2JQRB 4WIPA 1OQRA 4A3OA 3HK0A 5IP4D 2PIAA 4KIKA 2KQ4X 5EE3A 1C4PA 4M8NA 1V97A 3VDZA 3NHEB 1XT9B 2Y5PA 1C1YB 1WE7A 1I4GA 2Y5CA 1T0SC 4WAFA 3AI5A 4BOZB 3EUB2 1KFYB 4G0NB 1SB3C 2GBRA 4RMAA 1RYJA 3DBHI 3VTUA 4TQ1A 4K3CA 2QDFA 2GBJA 2J53A 2IGGA 2EMSA 1FFVA 1KLVA 5LXHA 3A9KB 2NBWB 2HTME 2L0FA 3WIMA 3SD5A 1NBFC 4W9FA 3WAPA 3AE1B 2K6DB 2KMCA 3HIZA 4KX6B 3RULA 1FD6A 1L6UA 2ZW0A 2IGDA 1E8ZA 1JWBD 5HG2A 2JSVX 3RNBC 2WXGA 1ZDVA 2MJDA 2WXFA 4GDKA 2LGIA 3HHMA 3SU8X 3T3OA 2PEAA 4RM8A 4IWOA 4II2B 4IDIA 1FNUA 4AUQC 3A9JA 3P4RB 1B9RA 3PPAA 2CU1A 1WX8A 5H92C 3TEXA 4A9AA 4HPPA 2O2VA 1MFWA 3L13A 4A6QA 2RSUA 1JMLA 3OJ3A 1UGMA 2KAJA 3UGBB 3APFA 3BZDB 2JWUA 2LXAA 5D7GA 4CHKA 1E7PB 5TR5A 1L4ZB 1VZ7A 2JPHA 5CHWA 2CHXA 3TBLD 2DAFA 3PLUA 3O65B 1WJNA 2LGXA 4KKIA 1P7FA 1YJJA 4KGRA 3AB5A 2NS5A 3QA8A 4ZHPA 2AL3A 3DBRB 3T9LA 5AEKB 2KLGA 2RPVA 1K8RB 3RMKC 2KWUB 2YEPB 4NNJB 3VTVA 1VDVA 1UNSA 1J7CA 2B3AA 1A70A 1E8XA 4P1BC 1FXTB 3C0RB 4K7WA 2LVOA 1XO3A 4ACFA 1WM3A 1NYQA 3B08A 2K39A 3JYUA 4XX5A 2ZNVC 1ZKHA 1IBXA 2JZZA 4DBGA 3IVFA 2WDTB 4YXDB 2DX5B 2JY6A 1N60A 3W5VB 2WDVB 2AX5A 1J19A 2KANA 2OJRA 4RM9A 1CMXB 1YMHE 1HXYD 3PRZA 2MBEA 5LLIA 1F52A 3Q8AA 4KV2A 2REXA 1KRHA 3ZNGC 4MH0E 4YT0B 1ET6A 3ZDTA 2D3BA 1RFKA 1NI3A 2KQ7A 2KTRB 2JUOA 3AM9A 5IAAC 1SJHD 5J18A 2KTFA 1JWUD 3BYYB 2V4LA 2XNAC 4B9KA 3P4SB 4NJCA 3LB8C 1J7BA 2PJHA 2KHWB 2JX5A 5L83A 4L23A 2RDHA 4KVGB 1NEKB 2FCMA 1I4HA 2KWCA 1WMHA 4FHJA 2DYMA 2MBBB 1R4MI 4YTNB 2MLBA 3A1QB 4GN1A 2M0XA 5HHDG 3N1YC 1S3SG 4RFBA 3BWUD 3EHVA 4JWUC 5D3IB 2QIEB 2WQYB 3AE5B 4I6LB 3U30A 1WFYA 2V3PA 2AQ3B 1JALA 2RD0A 4NJ6A 2W3RA 3Q3MC 3ECIA 4E3CA 4NJ7A 1JROA 1UD7A 2ON8A 3L0WB 2CHWA 1LGRA 2L32A 3B1LX 4HJGE 2AWTA 3VFKA 1JWSD 1YOVB 2BB5A 3UF8A 2Z8LA 3ZTCA 1K52A 2QC8A 1Q10A 4E71A 3A4RA 2RR9A 1HE8A 1MHXA 3KLSX 1EF5A 1TKEA 5IN7A 1L0XB 1WSPA 2R61A 1PQSA 2MJ3A 4IWPA 1FEHA 3P63A 2LD9A 2XBBC 3QQ8B 1FO4A 1FXIA 1KH0A 2LGYA 1BT0A 3R3MA 1JQ4A 3H1UA 2L52A 2AQ2B 3KUZA 1N61A 2N9LA 2KDBA 4KKJA 5GXGB 3MHSD 3P42A 1Y56A 4XE0A 1D6EC 1Q5WB 4MGKE
chains in the Genus database with same CATH topology
1HEZE 1QQRA 1XXGA 3MHZA 1MPEA 4XWWA 5HI1A 1IGDA 1R7SA 3BVMA 1CK1A 3NZ3A 2WXHA 2J4XA 3WCQA 1V1PA 2SEBD 3R8BA 4N58A 1J7AA 1YN3A 2CJOA 3BYTB 1DYQA 4YTPB 2PLPA 5TSSA 1ZXHA 3U52E 2V4IB 3IXSA 3J9CA 5BMIA 4M0WA 3P1MA 3KQ4A 2DWQA 2XN9C 1E10A 3Q8BA 2FUG1 3PZ7A 1EM7A 2K3UA 2OHFA 2ACZB 2N9KA 1I4QA 3BVGA 2LUMA 1JWMD 1NVID 4AQ7A 1JW9D 1XLPA 2Q5WD 1V8CA 4IOIE 4H2AA 4TMAB 1C76A 1M4VA 1SE2A 2QSDA 2JYEA 3LXFA 3LYYA 2CJNA 2LEKA 5FKAC 3AE6B 4ZRQA 1FRRA 1TZOA 3W9CB 1KLUD 1PGBA 2LMCA 4DXGA 4LK0M 1QT9A 3NVWA 4HRSA 3B2FA 1ZE3D 1UGJA 1ENFA 3AE3B 1ET9A 3MJ5A 1VJKA 1PYWD 1FCLA 4AS1A 4US9A 1EU4A 1XF5L 1C78A 4B0MA 2WXRA 3AEGB 2BS2B 2DBYA 2INNE 2LJIA 2V3NA 3V3XA 1FCCC 3B9JA 1OFFA 3HVDA 3AE9B 1DOIA 3L4PA 5AUIA 3AH7A 2YEPF 1I4XA 1VZ6A 4N59A 1QILA 2J52A 3BIID 2KMMA 4C7ZA 3AECB 1B1ZA 5EE0A 5MPOA 4JX1C 4ZOHC 1IBXB 1VRAB 3BK1A 3VR8B 2V0GA 1FRDA 5D3DA 5T8IA 3RPFC 3VR9B 2WXNA 1F0ZA 1C4AA 2WDQB 3NVVA 4C80A 1QOFA 4ZHOA 1FM0D 3EGRA 3BK2A 1ESFA 1PGAA 2FBWB 2M0AA 2JQRB 3FILA 2MH7A 4WIPA 1OQRA 2KACA 1LO5D 2BS4B 3P4PB 4USAA 2WXOA 2PIAA 1JCKB 1ZPSA 1E0ZA 1HZ5A 1ZXIA 1N5WA 4KGSA 2KQ4X 5EE3A 4RGTA 3W5UB 5G5HA 4XDCA 2DYOA 1C4PA 2ONQA 5BMHA 1AN8A 2N0SB 4PT5A 1V97A 3U7ZA 2Y5PA 1C79A 4RH6A 3TEWA 1IGCA 3OWEB 1V1PB 4ARCA 1I4GA 2Y5CA 4YTMB 4OVZA 3TEYA 1TY0A 2PVGC 2NTTA 4WAFA 4NAMA 4GLSC 3EUB2 2KWDA 1KFYB 5E6JA 1WXQA 2AQ1B 1SB3C 2H89B 1F2RC 4MM3B 5BYQA 1RYJA 4MACA 4TQ1A 5HFYA 3H8HA 2J53A 2TSSA 1K51A 2IGGA 1FFVA 3NVZA 3MFGA 3O13A 2BS3B 1AW7A 1XCTL 3I57A 2HTME 4NAWB 1FXAA 1QOGA 4A90A 4YSZB 2QJLA 4OHJA 2QMTA 4RGNA 4HEA1 3AE1B 1V1OA 1CZPA 4JWSC 1P7EA 1ROEA 2QEJC 1N5XA 3VRBB 4P16A 2IJ0A 1AWDA 4KX6B 2W82A 1FD6A 2NMQA 1L6UA 2DLBA 1TKYA 1HA5A 2ZW0A 2IGDA 4TQ0A 1JWBD 1GOZA 1VZ8A 2JSVX 5HG2A 1YQ4B 1BXTA 2WXGA 4NZLB 1RM6C 1ZDVA 2X38A 2BBCA 1WRIA 2MJDA 2WXFA 2LGIA 1XLQA 2WS3B 3T3OA 1MVKA 4IDIA 1FNUA 2Y3AA 2E3TA 3DWGC 1D5XC 1CQVA 3P4RB 1B9RA 2K9XA 1T6BX 5H92C 3TEXA 4D2KA 3CWIA 4A9AA 1MHHE 1TYGB 2LFIA 4N6EB 2LHEA 4A6QA 3Q8EA 1D4BA 1SSNA 4O1NA 1TKGA 3URYA 3FILB 3DWMA 4RGOS 5EE1A 3E9SA 4HKZE 3ZQ4A 1TS2A 3NUHB 2J42A 1TS5A 1K53A 4FXCA 4IKGA 1JMLA 2IPKD 2VZKB 5BMGA 2KAJA 1VLBA 2CU3A 1FNVA 1UUPA 3HVZA 3Q8FA 3BZDB 4WWMA 1F2RI 5BYRA 2JWUA 4L1BA 2FE8A 1T3QA 2WXIA 5JXVA 5D7GA 1STEA 1E7PB 1PGXA 3PO0A 1OQQA 2NTSA 3SFEB 4EE2A 3BVZA 4OZCA 3MP9A 4A55A 1VR9A 1L4ZB 1WWTA 1SJED 1VZ7A 3IT4B 2W3SA 2K22A 3ZJUA 1L5PA 3R2IA 1PUTA 4WQMA 2ZW1A 4WH4A 4ZRPA 4KKIA 1P7FA 2WP9B 2D5GA 1YJJA 2M56B 3AEBB 2K0PA 3AEEB 1SIJA 4KGRA 5C3JB 3AB5A 2WXMA 3W1SA 1BMLC 2JXTA 4ZHPA 1TJEA 3C8YA 1TS4A 4CQNA 3AN1A 5FR3A 2RPVA 5LNK1 1I7HA 4C7YA 1FNWA 2YEPB 1VDVA 1UNSA 2K5PA 1J7CA 1YN5A 1T5XD 2JYTA 1NENB 3KWVA 3SR6A 5AUKA 1A70A 1K50A 1GAQB 2KN4A 3ABVB 4OW0A 3ZJTA 4ZYSA 4DQOC 1DGJA 1XO3A 1IUEA 3ZYYX 2JZPA 5C2TB 1C77A 2BT6A 4REZA 1MI0A 2WXQA 1BUIC 1NYRA 1GB1A 1WYGA 4YSXB 1AYFA 1NYQA 1QKZA 4TSSA 4GDLB 1I4PA 4GDKB 3AE7B 2WNMA 2PVOD 3NVYA 3ETRA 3IT6B 3Q8CA 3AEDB 3R2TA 1IBXA 1SEBD 1XLNA 3W2DA 4YXDB 3B2GA 4ARIA 1FMAD 2WU2B 1N60A 4HROA 3W5VB 3NS1A 2I38A 4A8XC 4Q2JA 2EELA 2GRIA 2WDRB 3EA6A 3NRZA 3AE4B 2IGHA 4JPSA 2H88B 1JRPA 2WDVB 2AX5A 1ZDXA 4L2YA 3AEAB 1HZ6A 3VQIA 1TY2A 1XEEA 1YMHE 1QOBA 1HXYD 1N63A 3PZ8A 1I4RA 1EWCA 2BW2A 3Q8AA 2MEKA 4RF0A 4YSYB 5FK9C 1ZP0B 1C9FA 4MH8A 2QILA 1TS3A 2MJEA 3KWLA 1KRHA 1SE4A 3AEFB 2BYTA 2WLBA 4YT0B 1ET6A 3AV8A 4XDDA 1FIQA 2LHDA 4B0EA 4JE3B 2PW9A 1RFKA 1D5ZC 1NI3A 1SF0A 3MC0B 1C4CA 3TUOA 4LLGM 3AM9A 1SJHD 1JWUD 3BYYB 2L1AA 2PMVA 2XNAC 4RF1A 3P4SB 1RWSA 4NJCA 4LTUA 3TEZA 1SXTA 1JWAD 1DOYA 1QF6A 3LB8C 1J7BA 2BB6A 3ZGZA 2OEDA 1KLGD 3AMZA 2G1EA 2JX5A 3HUIA 4L23A 4XWTA 1KF6B 1EU3A 2RDHA 1NEKB 2EKIA 3U4EG 3IAS1 1GPXA 1I4HA 4OZAA 1XLOA 2DYMA 2JU6X 4YTNB 5I4DA 1UWMA 1L0VB 3GP7A 4YWGG 3SFDB 3GS2A 1PFDA 5HHDG 2WXPA 3GB1A 4R3DA 4RFBA 5EE9A 4DXFA 3BWUD 4JWUC 1DOXA 1WGKA 1YNTE 2GB1A 5D3IB 3U2SC 2QIEB 2WQYB 3AE5B 1UWXA 2V3PA 2G9HD 2AQ3B 2SAKA 2B76B 1JALA 4WURA 4UDUC 2W3RA 3FAHA 3HRDD 3SEBA 3T3NA 1N62A 3AE8B 1JROA 4KGTA 5BYSA 2I2YA 2ON8A 3E56A 2L32A 3CIRB 2W54A 2N7JA 1L4DB 4HJGE 3I9V1 1YN4A 3P4QB 2INPE 2E6XA 2WXKA 2M19A 1JWSD 1GB4A 1ACCA 2PKOA 2BTEA 2BB5A 2WXJA 1YJIA 2Z8LA 4P6VF 1D5MC 1K52A 4J3OD 1Q10A 2L83A 1F77A 5H8YE 1YQ3B 1FFUA 3AE2B 1MHXA 3KLSX 3UI3A 2GI9A 1QLBB 1TKEA 2ICIA 1L0XB 1QOAA 1WSPA 1ZOYB 2R61A 2VZKD 3ZJVA 3Q69A 3VRAB 2MJ3A 3TSSA 1ZUD2 2RDGA 4RNAA 1FEHA 1E9MA 3P63A 2WXLA 1PDXA 4ITKA 1FO4A 1FXIA 4MT5A 1KH0A 4HKQA 5G5GA 2IDYA 1JQ4A 1EWYC 3FC4A 4RGMA 1CJEA 1KTKA 2KDMA 1XCQL 4US8A 2L52A 4C56C 2RMMA 2WU5B 4OZBA 1SBBB 3N9YC 3IAM1 2AQ2B 1N61A 1L0YB 1L6VA 2N9LA 2PTLA 2HDEA 4RCOA 3V05A 4KKJA 5GXGB 3P42A 3RFZB 1Y56A 1HQRD 1SE3A 4XE0A 1E6EB 1D6EC 2W55A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OQQ A;  3P4S B;  1RWS A;  4LTU A;  1WWT A;  1JWA D;  1DOY A;  2W3S A;  2K22 A;  1L5P A;  1R7S A;  2Y5C A;  3LB8 C;  4YTM B;  1QF6 A;  1J7B A;  1PUT A;  2PVG C;  4WQM A;  3WCQ A;  3EUB 2;  1J7A A;  2CJO A;  4N58 A;  4YTP B;  1KFY B;  2G1E A;  2JX5 A;  2WP9 B;  3AMZ A;  3HUI A;  1KF6 B;  1WXQ A;  1YJJ A;  2M56 B;  3AEB B;  3AEE B;  5C3J B;  1SIJ A;  1SB3 C;  1NEK B;  2EKI A;  2H89 B;  3P1M A;  3AB5 A;  1E10 A;  2DWQ A;  1GPX A;  4ZHP A;  1RYJ A;  1TJE A;  1XLO A;  4IDI A;  4YTN B;  1UWM A;  3AN1 A;  1L0V B;  3SFD B;  1FFV A;  1I7H A;  2ACZ B;  2OHF A;  1PFD A;  3NVZ A;  4C7Y A;  5EE9 A;  1NVI D;  2BS3 B;  1JW9 D;  1XLP A;  4JWU C;  1DOX A;  2HTM E;  1V8C A;  2Q5W D;  1WGK A;  1VDV A;  2QIE B;  2WQY B;  1FXA A;  1J7C A;  2K5P A;  3AE5 B;  1QOG A;  4YSZ B;  1NEN B;  3SR6 A;  5AUK A;  1A70 A;  2QJL A;  3LXF A;  3AE1 B;  1GAQ B;  2B76 B;  2CJN A;  1CZP A;  2LEK A;  4JWS C;  1ROE A;  1JAL A;  3ABV B;  3AE6 B;  1N5X A;  2W3R A;  3FAH A;  1FRR A;  3HRD D;  3VRB B;  1DGJ A;  1N62 A;  1XO3 A;  1JRO A;  3AE8 B;  3W9C B;  1IUE A;  3ZYY X;  5C2T B;  1QT9 A;  1AWD A;  2BT6 A;  3NVW A;  3B2F A;  4HRS A;  4KX6 B;  1L6U A;  1NYR A;  1TKY A;  3CIR B;  1WYG A;  2W54 A;  4YSX B;  1AYF A;  1NYQ A;  3AE3 B;  1VJK A;  3AE7 B;  1JWB D;  1YQ4 B;  2PVO D;  3P4Q B;  3NVY A;  3ETR A;  2M19 A;  1RM6 C;  4US9 A;  2PKO A;  5AUI A;  3AED B;  1YJI A;  1WRI A;  2MJD A;  3SFE B;  4P6V F;  3AEG B;  2BS2 B;  2WS3 B;  1XLQ A;  1XLN A;  2DBY A;  2L83 A;  5H8Y E;  1YQ3 B;  4YXD B;  3B2G A;  1FFU A;  1FMA D;  2WU2 B;  3AE2 B;  1N60 A;  1OFF A;  3B9J A;  4HRO A;  3W5V B;  3AE9 B;  3NS1 A;  1QLB B;  1DOI A;  1TKE A;  2WDR B;  1QOA A;  3L4P A;  3AE4 B;  1ZOY B;  2E3T A;  3AH7 A;  3DWG C;  3NRZ A;  2H88 B;  1JRP A;  2WDV B;  2AX5 A;  3VRA B;  3P4R B;  2MJ3 A;  4N59 A;  1B9R A;  1ZUD 2;  2K9X A;  3AEA B;  3BII D;  5H92 C;  2KMM A;  3CWI A;  4A9A A;  1E9M A;  4C7Z A;  1TYG B;  3P63 A;  3AEC B;  1QOB A;  1PDX A;  4ITK A;  1N63 A;  4N6E B;  5EE0 A;  5MPO A;  4JX1 C;  4ZOH C;  1FO4 A;  3VR8 B;  1FXI A;  1FRD A;  1TKG A;  5G5G A;  4YSY B;  3RPF C;  3DWM A;  3VR9 B;  1ZP0 B;  1JQ4 A;  5EE1 A;  1F0Z A;  1EWY C;  2MJE A;  2WDQ B;  3KWL A;  3NVV A;  1QOF A;  3FC4 A;  4C80 A;  1FM0 D;  4ZHO A;  1KRH A;  1CJE A;  3AEF B;  4FXC A;  4US8 A;  2FBW B;  2L52 A;  2JQR B;  2KAJ A;  2MH7 A;  1VLB A;  1OQR A;  2WLB A;  4YT0 B;  2CU3 A;  2BS4 B;  2WU5 B;  3AV8 A;  3P4P B;  4USA A;  1FIQ A;  2PIA A;  1E0Z A;  1RFK A;  1ZXI A;  1N5W A;  1N61 A;  1NI3 A;  1SF0 A;  3HVZ A;  1L6V A;  4WWM A;  5EE3 A;  3W5U B;  5GXG B;  5G5H A;  1T3Q A;  3AM9 A;  1E6E B;  2N0S B;  1V97 A;  2W55 A;  1E7P B;  3PO0 A; 
#chains in the Genus database with same CATH topology
 1HEZ E;  3Q3O C;  2OJW A;  5EDS A;  1R7S A;  4AP4 C;  4FJZ A;  3BVM A;  3WCQ A;  2SEB D;  4N58 A;  1J7A A;  1V9J A;  3BYT B;  3UIO B;  1DYQ A;  1GC7 A;  2KKC A;  5TSS A;  1UEL A;  5BMI A;  2FCS A;  2DWQ A;  1EM7 A;  3ZVV A;  2ACZ B;  2N9K A;  4BVU C;  3BVG A;  3KUC B;  2KX3 A;  2GBK A;  4IUM B;  1XLP A;  2Q5W D;  2KDI A;  4IOI E;  3ENE A;  2QSD A;  3LYY A;  2CJN A;  5FKA C;  1FRR A;  1TZO A;  3DVN U;  3DPD A;  2LMC A;  3W9C B;  4EEW A;  4M00 A;  3NVW A;  3B2F A;  1M94 A;  1ZE3 D;  3QWZ B;  5LXI B;  1UGJ A;  3N3K B;  2WWZ A;  4BKT A;  3RZF A;  3AE3 B;  1WH3 A;  4WAA A;  4EZL A;  1WGR A;  3VH3 B;  2MP2 A;  2IND C;  3NJT A;  1EU4 A;  3VHT C;  1RLF A;  2WXR A;  1XD3 B;  2INN E;  3H6N A;  3B9J A;  2BQQ A;  3AE9 B;  2L00 B;  2AL6 A;  2L05 A;  4ANU A;  2C60 A;  5D6J B;  3MJW A;  2YEP F;  2DZK A;  1QIL A;  3AEC B;  1B1Z A;  3CST A;  4PK1 A;  3BK1 A;  3VR8 B;  2V0G A;  3AU4 A;  3H7P A;  1C4A A;  4ZHO A;  1QOF A;  2C7M B;  1PGA A;  4WJN A;  3QHT A;  4EZK A;  1LFD A;  4MEL A;  3KH0 A;  3P4P B;  4USA A;  3ZNH B;  1UBI A;  1E0Z A;  4NPN A;  3ZXV A;  3ZRF A;  1N5W A;  4KGS A;  3UIP B;  4PS3 A;  4XDC A;  4NQL B;  3RZW C;  1WXV A;  2ONQ A;  1AN8 A;  1C3T A;  1C79 A;  2IZV B;  3WA0 A;  1V1P B;  3TEY A;  1TY0 A;  4M0W B;  2ZVO A;  4NAM A;  4GLS C;  1E5W A;  4P7I A;  3IBE A;  2LJ5 A;  1WXQ A;  2M17 A;  2J7Q B;  4WJP A;  5CX3 A;  2H89 B;  1F2R C;  4MM3 B;  4MAC A;  5HFY A;  1VCB A;  3PT2 B;  2NPT B;  1V49 A;  3NVZ A;  4F1S A;  2BS3 B;  3KYC D;  1MG8 A;  1AW7 A;  1XCT L;  2KD0 A;  4NAW B;  1FXA A;  1R4N B;  4FLH A;  4A90 A;  4AJY B;  4YSZ B;  2QJL A;  4XGA B;  4RGN A;  4M01 A;  1P7E A;  1ROE A;  2QEJ C;  1N5X A;  4P16 A;  1WZ0 A;  2IJ0 A;  4AJW A;  1AWD A;  2JT4 B;  2NMQ A;  4MSM B;  3RNA C;  2DLB A;  1TKY A;  4DHZ E;  1HA5 A;  5AZG A;  1GOZ A;  4S0R A;  1YQ4 B;  4NZL B;  2X38 A;  2BBC A;  4GDL A;  5CTR C;  2K8C A;  4WQO B;  1WI0 A;  2D3G A;  2KFK B;  3M63 B;  2KK8 A;  4FUL A;  1OEY J;  3GZN B;  3HM3 A;  1D5X C;  2D10 A;  1P9D U;  5AZF A;  2K9X A;  2IBI B;  1T6B X;  2NR2 A;  1TYG B;  2PE9 A;  2CKH B;  4ANX A;  4FHK A;  5EE1 A;  1TS2 A;  2O6V A;  3NUH B;  1TS5 A;  4IKG A;  5BMG A;  2FAZ A;  3JVZ X;  1XQQ A;  3X0W A;  1UUP A;  4OVU A;  3Q8F A;  2L3Z A;  4WWM A;  1WXA A;  2VH2 A;  2KZR A;  2BF8 B;  2FE8 A;  1T3Q A;  2N1W A;  1STE A;  3SFE B;  2NTS A;  2EKE C;  2GBM A;  4LNF A;  2C9W B;  2W3S A;  3ZJU A;  3Q3F A;  1L5P A;  4AOF A;  1IYF A;  2ZNV B;  1YIW A;  2ZW1 A;  3RN9 C;  3Q2A C;  2D5G A;  5JH5 C;  3AEB B;  2MWS B;  2BPS A;  3V6C B;  3W1S A;  1BML C;  2BYF A;  5IKC M;  5DPW A;  1TS4 A;  2C7H A;  3AN1 A;  2UU7 A;  2BYE A;  2LVP A;  1I7H A;  5LNK 1;  2JYT A;  1NEN B;  1GAQ B;  4HDO A;  2KN4 A;  3ABV B;  4OW0 A;  4DQO C;  1DGJ A;  1WM2 A;  1IUE A;  4HPL B;  2KXJ A;  4REZ A;  1MI0 A;  3QCA A;  4FN2 A;  4LNN A;  4YSX B;  1WX9 A;  1I4P A;  4GDK B;  2KT7 A;  3PSE B;  2WNM A;  3NVY A;  3AED B;  2KFJ A;  3R2T A;  4C4V A;  1SEB D;  1XLN A;  3B2G A;  1FMA D;  3OLM D;  2I38 A;  4Q2J A;  4JIO U;  2EEL A;  2WDR B;  3EA6 A;  3NRZ A;  3AE4 B;  3CSF A;  4JPS A;  3OAW A;  2AEH A;  2H88 B;  2O2V B;  1T0R C;  2DEN B;  3U8Z A;  4L2Y A;  2BWE S;  2BVC A;  4YL8 A;  5D2M B;  2BW2 A;  2MEK A;  4RF0 A;  3I63 C;  4YSY B;  5FK9 C;  1ZP0 B;  3ZUN A;  2DZI A;  2QIL A;  1TS3 A;  2KJH B;  1SE4 A;  2G45 B;  2IY1 B;  3A33 B;  4JE3 B;  2PW9 A;  2N7E A;  1D5Z C;  3S2A A;  1SF0 A;  2BYV E;  3MC0 B;  5IOI A;  3TUO A;  2KOX A;  3I5J C;  2PMV A;  2ASQ A;  1RWS A;  3FKY A;  5JHA A;  4WJO A;  5G2N A;  3RNF C;  2MRP A;  2NBU A;  2KLC A;  1NDD A;  1LXD A;  3AMZ A;  2G1E A;  3HUI A;  3TL5 A;  3PV1 A;  2EKI A;  3U4E G;  1Q0W B;  4OVV A;  1XLO A;  2C5L C;  4WWP A;  2I1K A;  3GS2 A;  4W9D A;  1V2Y A;  3VH4 B;  4EUT A;  3N30 A;  1WGK A;  2EMT A;  2N7D A;  4W9E A;  1TTN A;  4BBN C;  3PRM B;  4K1R B;  1WX7 A;  1VD2 A;  2BKR B;  4KGT A;  5BYS A;  3DBR I;  4MJS B;  5DPR A;  1Z2M A;  2WX1 A;  2N7J A;  1L4D B;  3P4Q B;  2Y5B B;  2INP E;  4MGZ E;  4ZYN A;  2PKO A;  2BTE A;  1YJI A;  2YLM A;  3W1S C;  3PLV A;  2L83 A;  1F77 A;  1P1A A;  3AE2 B;  3N1Z C;  4ZDV A;  3UI3 A;  1QLB B;  1QOA A;  1WYW B;  3ZJV A;  3VUW A;  2RDG A;  3L17 A;  1E9M A;  1T0Y A;  3BY4 B;  2WXL A;  3DVN V;  5DPS A;  4HXD A;  2K1F A;  3NZS A;  2IDY A;  2WYQ A;  5C1Z A;  2LGD A;  3Q14 C;  1CJE A;  4RGM A;  5E6O A;  2CS4 A;  2WU5 B;  1P98 A;  1YX6 B;  3IAM 1;  3RNE C;  1V6E A;  1L6V A;  1MG4 A;  2KN5 A;  3L08 A;  2JZ3 B;  2W9N A;  3EFC A;  1IP9 A;  4BBN F;  4PS8 A;  2KNB A;  3MHZ A;  3DVG Y;  3QC8 B;  1MPE A;  1TBE A;  2IO0 B;  1CK1 A;  4YTP B;  2PLP A;  2V4I B;  3IXS A;  4BFR A;  3N1X C;  3Q8B A;  4FA6 A;  4E74 A;  3NZU A;  2KMA A;  1I4Q A;  1Q1O A;  5DCN A;  1JWM D;  5G55 A;  1JW9 D;  5E6P A;  3Q6B A;  1KOT A;  4TMA B;  1C76 A;  2ZJD A;  5AZH A;  3AE6 B;  2BWF A;  5CHV C;  3ZNI D;  3NY5 A;  4LK0 M;  4URK A;  2MBH A;  3KUD B;  4HRS A;  1ENF A;  1T0Q C;  1VJK A;  2KC2 A;  4US9 A;  4B0M A;  2O6V D;  3W1Y A;  3EEC A;  1FCC C;  4X57 B;  2G3Q B;  1DOI A;  3AH7 A;  2PPH A;  2IY0 B;  4FJY A;  2D2Q A;  1VZ6 A;  2J52 A;  3DHG C;  4JX1 C;  5T8I A;  3QJZ A;  1E8Y A;  2DYB A;  3NVV A;  3JSV A;  1FM0 D;  3EGR A;  1ZGU B;  4JGH B;  1KJT A;  3VXW A;  3FIL A;  3T8M A;  2KAC A;  1LO5 D;  1ZPS A;  2M8S A;  1HZ5 A;  1ZXI A;  5J2R A;  4G11 A;  4K3B A;  3W5U B;  5G5H A;  3D32 A;  4S17 A;  4PT5 A;  2N0S B;  2LXC A;  3U7Z A;  2BGF A;  2Z59 B;  3A1Q A;  4RH6 A;  3TEW A;  4W9G A;  4MGI E;  4OVZ A;  3TJP A;  4LJP B;  3TCA A;  4FAD A;  3DHH C;  5E6J A;  2DNF A;  4M8M A;  1UZX B;  4B6W A;  3H8H A;  2DAJ A;  2L0T A;  3KW5 B;  4HJK A;  2C7N B;  3I57 A;  3KVF B;  4MEM A;  4W9I A;  2KX0 A;  3DBL I;  1QOG A;  4HEA 1;  3DBL B;  1CZP A;  4JWS C;  3R66 C;  4HPM B;  3VRB B;  1J0G A;  3AU5 A;  2W82 A;  2DZM A;  4WWN A;  3OG5 A;  2LWP A;  2RDB C;  4IWQ A;  2LRU A;  2CHZ A;  2WS3 B;  1MVK A;  2FIF A;  4HCP B;  1UF0 A;  4BZA A;  4CO7 A;  3ZLZ A;  3EFU A;  4W9L A;  3VUY A;  3RYT A;  1CQV A;  3TMP B;  2NVU I;  4D2K A;  1MHH E;  3H7P B;  5BO4 B;  1D3Z A;  2LHE A;  2KO3 A;  1D4B A;  2LZ6 A;  1SSN A;  4WWO A;  1F9J A;  3DWM A;  2FUH B;  3E9S A;  4TUU A;  3ZQ4 A;  3UIN B;  1K53 A;  4FXC A;  2N4F A;  1WGH A;  4GIV A;  3ZDM C;  1FNV A;  1WRD B;  1RFA A;  1ZW7 A;  4L1B A;  3WAM A;  3WAO A;  5JXV A;  2N9E B;  1OQQ A;  4EFO A;  2ZCC A;  3WAL A;  3MP9 A;  4A55 A;  1VR9 A;  1WWT A;  1SJE D;  3IT4 B;  3R2I A;  3RNG C;  1PUT A;  4WQM A;  1WZ3 A;  4ZRP A;  2WP9 B;  3JW0 X;  1WGY A;  2M56 B;  2V9H A;  2LUE A;  2WXM A;  4KZC A;  2FCQ A;  4DDG D;  5FR3 A;  3PRE A;  4C7Y A;  4FBJ B;  4CYE A;  4K81 A;  3ZTD A;  2K5P A;  2LVQ A;  4IM2 A;  3APC A;  5AUK A;  4BOS C;  2RGF A;  2A5U A;  2M1M A;  4ASW C;  4ZYS A;  3RNC C;  3M3J A;  3ZYY X;  3K9P B;  2BT6 A;  5IA7 A;  2WXQ A;  1BUI C;  3ZNZ B;  1NYR A;  1WYG A;  2QHO A;  2JF5 A;  4GDL B;  1YQB A;  3AE7 B;  3ONS A;  4GGQ A;  4BKG A;  3ETR A;  2PE6 B;  3IT6 B;  5L95 C;  3C19 A;  2WHI A;  1R4N I;  2XEW A;  4HLE A;  1J8C A;  1H8C A;  3W2D A;  2LI5 A;  4ICV A;  4ARI A;  2BKF A;  3NS1 A;  2GRI A;  1P0R A;  3V61 A;  3DCG A;  3Q3J A;  1JRP A;  1WXM A;  2IO2 B;  3AEA B;  1HZ6 A;  3H9D A;  1TY2 A;  2HJ1 A;  4ZRJ A;  1WIA A;  4XZ4 A;  1E8W A;  2O6V B;  3GE8 C;  4G3X B;  1EWC A;  4MGY E;  4C00 A;  4MH8 A;  3V6E B;  1I42 A;  4W9K A;  3AEF B;  2G4D B;  4AWJ A;  3GZN I;  4XDD A;  3TIX A;  3VTW A;  2J0K A;  1C4C A;  1WR1 A;  1WJ4 A;  2FID A;  3PTF C;  3SHQ A;  4RF1 A;  1E90 A;  1GG3 A;  4HVB A;  4LTU A;  4EKU A;  3TEZ A;  1EO6 A;  1SXT A;  1DOY A;  1GNU A;  1MJD A;  3ZGZ A;  4KIK B;  1WF9 A;  1EU3 A;  1WGD A;  1LQB A;  4OZA A;  2MBO A;  4ICU A;  5I4D A;  1UWM A;  1L0V B;  3GP7 A;  4YWG G;  3SFD B;  1PFD A;  4GOC A;  3GB1 A;  4DXF A;  2CR5 A;  3R7Q A;  2GB1 A;  3VUX A;  3U2S C;  5CHF A;  4GSW A;  2R2Q A;  2B76 B;  3FAH A;  3HRD D;  3SEB A;  3T3N A;  1N62 A;  3AE8 B;  2I2Y A;  3UQA A;  3E56 A;  5D94 A;  3APD A;  2G4S A;  3R7R A;  3CIR B;  3DQV A;  1YN4 A;  2ZPN A;  3NG0 A;  2E6X A;  2XK5 A;  2WXK A;  2M19 A;  1OTR B;  2WXJ A;  1OQY A;  3U7D A;  4P6V F;  1D5M C;  4PYU A;  3ML8 A;  5H8Y E;  1WR6 E;  1YJ1 A;  2ICI A;  2VZK D;  2V1Y A;  3Q69 A;  3TSS A;  1ZUD 2;  4WJQ A;  4KSK C;  3SDL C;  1PDX A;  4TKN A;  2MX2 A;  4LDT D;  4QAY A;  4HKQ A;  2K8B A;  4J6I A;  1TT5 B;  4LJO B;  2GOW A;  2KDM A;  4C56 C;  2HTH A;  2I1J A;  3CF6 E;  3NS8 A;  1SBB B;  3A9J B;  4OZB A;  4HWI B;  4RCO A;  2HDE A;  3V05 A;  4EZJ A;  2ZVN A;  3GE3 C;  1E7U A;  1HQR D;  1SE3 A;  2N9X A;  3DBH B;  4KDI C;  2W55 A;  4ZRK A;  4DWF A;  1H4R A;  4DK5 A;  1XXG A;  1IGD A;  1WY8 A;  2JRI B;  3NZ3 A;  2WXH A;  2J4X A;  1SGH A;  1YN3 A;  1HTO A;  1ZXH A;  4XYC A;  3U52 E;  2JVC A;  2XN9 C;  1ISN A;  2GLS A;  4K7U A;  2FUG 1;  1Z5S B;  5HKH A;  4GMV A;  2LUM A;  4GU2 A;  1NVI D;  4AQ7 A;  2LAS A;  2OOB B;  4H2A A;  3PHW B;  3A9K A;  4JLC A;  1SE2 A;  4ZRQ A;  4DXG A;  1PGB A;  2J0J A;  1QT9 A;  1I35 A;  2UWQ A;  1QZE A;  3MJ5 A;  2MHJ A;  3L10 B;  1C78 A;  3MTN B;  4LNK A;  3AEG B;  2BS2 B;  2DBY A;  2V3N A;  3HVD A;  4W9C A;  2DHZ A;  1WGG A;  5AUI A;  3ZO5 B;  2ZPY A;  4PS7 A;  1I4X A;  4N59 A;  2KMM A;  3ZXR A;  4C7Z A;  3DDC B;  1TZ1 A;  4HCN B;  5MPO A;  4II3 B;  4ZOH C;  3QAQ A;  1IBX B;  1VRA B;  5D3D A;  3VR9 B;  2WDQ B;  4C80 A;  1KM7 A;  2FBW B;  4IG7 B;  2MH7 A;  2BS4 B;  4A3P A;  2WXO A;  5KHO A;  1JCK B;  4LNI A;  1YX5 B;  2IO1 B;  4KSL C;  4RGT A;  4F7Z A;  3X23 A;  2DYO A;  5BMH A;  4PYZ A;  2HD5 B;  3N20 C;  1U4A A;  1IGC A;  1YD8 U;  3OWE B;  4ARC A;  4YTM B;  2PVG C;  4F8C B;  2NTT A;  2JRH A;  2KWD A;  1IPG A;  2AQ1 B;  2KWV B;  5BYQ A;  4IM3 A;  2KDE B;  4XC2 A;  4FJV B;  4A20 A;  1L2N A;  2TSS A;  1K51 A;  2MA9 B;  4G50 A;  2IYD B;  4MJS A;  3MFG A;  1TGZ B;  3O13 A;  2KC1 A;  1UH6 A;  4EOY A;  4W9J A;  2K8H A;  4OHJ A;  2QMT A;  1V1O A;  5FR6 A;  1WMH B;  4BKS A;  2YVC A;  2KJ6 A;  2N9P C;  4DXA B;  4TQ0 A;  1VZ8 A;  1BXT A;  1RM6 C;  3PZD A;  4DHJ D;  1SE9 A;  1WRI A;  2K6Q A;  1XLQ A;  2Z0D B;  1WJ6 A;  2K25 A;  3MC9 A;  1GC6 A;  2JXX A;  2E3T A;  2Y3A A;  3DWG C;  1S1Q B;  2MBQ A;  3CWI A;  2KJR A;  3PVL A;  2LFI A;  4N6E B;  3JSV B;  1X1M A;  3Q8E A;  3I3T B;  4O1N A;  1TKG A;  3URY A;  3FIL B;  3PGE A;  2FCN A;  1A5R A;  1UBQ A;  4RGO S;  4HKZ E;  2KVZ A;  2J42 A;  2LGS A;  2IPK D;  2VZK B;  1VLB A;  2CU3 A;  2J0M A;  3RT3 B;  4TV3 A;  4P1C C;  3HVZ A;  2N1V A;  4LDT B;  4IW0 A;  1F2R I;  2ZCB A;  5BYR A;  1P3Q U;  2KDF B;  5KHQ A;  4BAX A;  2WXI A;  4NY0 A;  1R4M B;  1PGX A;  3PO0 A;  4EE2 A;  2KTR A;  3BVZ A;  4OZC A;  2X8X X;  4DHZ B;  4LNO A;  2ZEQ A;  2FNJ B;  2K22 A;  1Y8R C;  3IFW B;  4WH4 A;  2D3A A;  4ANV A;  2UYZ B;  2NCN A;  3L54 A;  3V62 A;  5C3J B;  2K0P A;  3AEE B;  1SIJ A;  2MSE D;  2JXT A;  1TJE A;  3AUL A;  3C8Y A;  4KZ0 A;  4CQN A;  3QX1 A;  3MC8 A;  2HJ8 A;  1FNW A;  3OJ4 B;  1JRU A;  1YN5 A;  1T5X D;  3KWV A;  3SR6 A;  3IG3 A;  1K50 A;  1WJU A;  3ZJT A;  3EC8 A;  2JZP A;  5C2T B;  1C77 A;  1WXS A;  3RCZ A;  1GB1 A;  5JHB A;  1AYF A;  1QKZ A;  4TSS A;  4W9H A;  2A4Z A;  2L7R A;  2PVO D;  3Q8C A;  2MW5 A;  1V81 A;  1E7V A;  1F1H A;  1OGW A;  2WU2 B;  3DOW A;  4HRO A;  2MCN B;  1RAX A;  4A8X C;  2D11 A;  2IGH A;  1ZDX A;  3Q3N C;  5DPT A;  1RRB A;  2MP2 B;  1FPY A;  3VQI A;  1XEE A;  1QOB A;  4GXB A;  1N63 A;  3QIJ A;  2Z0E B;  3PZ8 A;  1I4R A;  2D07 B;  2MJE A;  3KWL A;  4N9F 4;  2BYT A;  2WLB A;  4IC7 B;  3RD2 A;  1G6J A;  3AV8 A;  1FIQ A;  2LHD A;  4B0E A;  2GBN A;  2NBV B;  3NOB A;  4LLG M;  1GUA B;  2L1A A;  3LJ3 A;  1JWA D;  1QF6 A;  2RPQ A;  2BB6 A;  3ZRC A;  2INC C;  2OED A;  1KLG D;  2L8J A;  4XWT A;  1KF6 B;  3N32 A;  3IAS 1;  1GPX A;  2JU6 X;  3V60 A;  3BIN A;  3M62 B;  4KDL B;  2WXP A;  2WGS A;  4IM0 A;  4R3D A;  5EE9 A;  1DOX A;  1YNT E;  2GMI C;  1UWX A;  2HE7 A;  2G9H D;  2SAK A;  1AAR A;  3L16 A;  4WUR A;  4UDU C;  4GB9 A;  1GJZ A;  3KYD D;  3LDZ E;  4MDK E;  2W54 A;  3I9V 1;  2VRR B;  1GB4 A;  1ACC A;  1TIF A;  4J3O D;  3WAN A;  1YQ3 B;  1FFU A;  3VAW A;  4DDI D;  3UQB A;  2GI9 A;  1ZOY B;  4ZRI A;  2MQJ A;  3VRA B;  2M4N A;  3P2B A;  4RNA A;  4DHJ B;  4ITK A;  1L7Y A;  2L76 A;  3ZW3 A;  4MT5 A;  5G5G A;  5E6N A;  1HTQ A;  3RUI B;  1EWY C;  3FC4 A;  1V5O A;  1KTK A;  1XCQ L;  4US8 A;  3DHI C;  3A4S C;  2RMM A;  1N6Z A;  3N9Y C;  2JWZ A;  3B0A A;  1L0Y B;  2PTL A;  2KVR A;  3RFZ B;  1E6E B;  3AXC A;  3QK0 A;  4K7S A;  1C9F A;  2QCZ A;  1OEY A;  1QQR A;  3PS6 A;  5C23 A;  4XWW A;  5HI1 A;  5JZE B;  4LCD E;  4NQK E;  4MSQ B;  2WX0 A;  1V1P A;  3R8B A;  2CJO A;  4I6N B;  3J9C A;  4M0W A;  3P1M A;  3KQ4 A;  3H7S A;  4BKS D;  1E10 A;  1SIF A;  3PZ7 A;  3QAR A;  2K3U A;  4MM3 A;  2OHF A;  1WE6 A;  4JQW C;  1V86 A;  2D3C A;  1EUV B;  4M02 A;  2R2O A;  2NPT A;  1V8C A;  4B95 A;  4I6P A;  1M4V A;  3PRP B;  5GMV A;  2JYE A;  3LXF A;  2LEK A;  4NAW A;  3ZIM A;  3ZKJ C;  3ALB A;  1NI2 A;  2LRW A;  1KLU D;  3CMM B;  2KQS A;  2XK5 B;  4HK2 A;  1ET9 A;  5J17 A;  1LM8 B;  1PYW D;  2DZJ A;  1FCL A;  4AS1 A;  1XF5 L;  3K9O B;  2LJI A;  4ANW A;  3V3X A;  1OFF A;  3PHX B;  1V5T A;  3GOE A;  3L4P A;  3IHP C;  5IO9 A;  2KYW A;  3DBS A;  2KFK A;  3HM6 X;  3BII D;  4HDQ A;  3DVG X;  5EE0 A;  1EF1 A;  3RI7 C;  4C4V B;  2VH1 A;  3VVW B;  1FRD A;  2V3S A;  4JL9 A;  3RPF C;  2WXN A;  1F0Z A;  3M95 A;  3BK2 A;  1ESF A;  1V80 A;  2AYO B;  2IO3 B;  2ZZP B;  3ML9 A;  2M0A A;  2JQR B;  4WIP A;  1OQR A;  4A3O A;  3HK0 A;  5IP4 D;  2PIA A;  4KIK A;  2KQ4 X;  5EE3 A;  1C4P A;  4M8N A;  1V97 A;  3VDZ A;  3NHE B;  1XT9 B;  2Y5P A;  1C1Y B;  1WE7 A;  1I4G A;  2Y5C A;  1T0S C;  4WAF A;  3AI5 A;  4BOZ B;  3EUB 2;  1KFY B;  4G0N B;  1SB3 C;  2GBR A;  4RMA A;  1RYJ A;  3DBH I;  3VTU A;  4TQ1 A;  4K3C A;  2QDF A;  2GBJ A;  2J53 A;  2IGG A;  2EMS A;  1FFV A;  1KLV A;  5LXH A;  3A9K B;  2NBW B;  2HTM E;  2L0F A;  3WIM A;  3SD5 A;  1NBF C;  4W9F A;  3WAP A;  3AE1 B;  2K6D B;  2KMC A;  3HIZ A;  4KX6 B;  3RUL A;  1FD6 A;  1L6U A;  2ZW0 A;  2IGD A;  1E8Z A;  1JWB D;  5HG2 A;  2JSV X;  3RNB C;  2WXG A;  1ZDV A;  2MJD A;  2WXF A;  4GDK A;  2LGI A;  3HHM A;  3SU8 X;  3T3O A;  2PEA A;  4RM8 A;  4IWO A;  4II2 B;  4IDI A;  1FNU A;  4AUQ C;  3A9J A;  3P4R B;  1B9R A;  3PPA A;  2CU1 A;  1WX8 A;  5H92 C;  3TEX A;  4A9A A;  4HPP A;  2O2V A;  1MFW A;  3L13 A;  4A6Q A;  2RSU A;  1JML A;  3OJ3 A;  1UGM A;  2KAJ A;  3UGB B;  3APF A;  3BZD B;  2JWU A;  2LXA A;  5D7G A;  4CHK A;  1E7P B;  5TR5 A;  1L4Z B;  1VZ7 A;  2JPH A;  5CHW A;  2CHX A;  3TBL D;  2DAF A;  3PLU A;  3O65 B;  1WJN A;  2LGX A;  4KKI A;  1P7F A;  1YJJ A;  4KGR A;  3AB5 A;  2NS5 A;  3QA8 A;  4ZHP A;  2AL3 A;  3DBR B;  3T9L A;  5AEK B;  2KLG A;  2RPV A;  1K8R B;  3RMK C;  2KWU B;  2YEP B;  4NNJ B;  3VTV A;  1VDV A;  1UNS A;  1J7C A;  2B3A A;  1A70 A;  1E8X A;  4P1B C;  1FXT B;  3C0R B;  4K7W A;  2LVO A;  1XO3 A;  4ACF A;  1WM3 A;  1NYQ A;  3B08 A;  2K39 A;  3JYU A;  4XX5 A;  2ZNV C;  1ZKH A;  1IBX A;  2JZZ A;  4DBG A;  3IVF A;  2WDT B;  4YXD B;  2DX5 B;  2JY6 A;  1N60 A;  3W5V B;  2WDV B;  2AX5 A;  1J19 A;  2KAN A;  2OJR A;  4RM9 A;  1CMX B;  1YMH E;  1HXY D;  3PRZ A;  2MBE A;  5LLI A;  1F52 A;  3Q8A A;  4KV2 A;  2REX A;  1KRH A;  3ZNG C;  4MH0 E;  4YT0 B;  1ET6 A;  3ZDT A;  2D3B A;  1RFK A;  1NI3 A;  2KQ7 A;  2KTR B;  2JUO A;  3AM9 A;  5IAA C;  1SJH D;  5J18 A;  2KTF A;  1JWU D;  3BYY B;  2V4L A;  2XNA C;  4B9K A;  3P4S B;  4NJC A;  3LB8 C;  1J7B A;  2PJH A;  2KHW B;  2JX5 A;  5L83 A;  4L23 A;  2RDH A;  4KVG B;  1NEK B;  2FCM A;  1I4H A;  2KWC A;  1WMH A;  4FHJ A;  2DYM A;  2MBB B;  1R4M I;  4YTN B;  2MLB A;  3A1Q B;  4GN1 A;  2M0X A;  5HHD G;  3N1Y C;  1S3S G;  4RFB A;  3BWU D;  3EHV A;  4JWU C;  5D3I B;  2QIE B;  2WQY B;  3AE5 B;  4I6L B;  3U30 A;  1WFY A;  2V3P A;  2AQ3 B;  1JAL A;  2RD0 A;  4NJ6 A;  2W3R A;  3Q3M C;  3ECI A;  4E3C A;  4NJ7 A;  1JRO A;  1UD7 A;  2ON8 A;  3L0W B;  2CHW A;  1LGR A;  2L32 A;  3B1L X;  4HJG E;  2AWT A;  3VFK A;  1JWS D;  1YOV B;  2BB5 A;  3UF8 A;  2Z8L A;  3ZTC A;  1K52 A;  2QC8 A;  1Q10 A;  4E71 A;  3A4R A;  2RR9 A;  1HE8 A;  1MHX A;  3KLS X;  1EF5 A;  1TKE A;  5IN7 A;  1L0X B;  1WSP A;  2R61 A;  1PQS A;  2MJ3 A;  4IWP A;  1FEH A;  3P63 A;  2LD9 A;  2XBB C;  3QQ8 B;  1FO4 A;  1FXI A;  1KH0 A;  2LGY A;  1BT0 A;  3R3M A;  1JQ4 A;  3H1U A;  2L52 A;  2AQ2 B;  3KUZ A;  1N61 A;  2N9L A;  2KDB A;  4KKJ A;  5GXG B;  3MHS D;  3P42 A;  1Y56 A;  4XE0 A;  1D6E C;  1Q5W B;  4MGK E; 
#chains in the Genus database with same CATH homology
 1HEZ E;  1QQR A;  1XXG A;  3MHZ A;  1MPE A;  4XWW A;  5HI1 A;  1IGD A;  1R7S A;  3BVM A;  1CK1 A;  3NZ3 A;  2WXH A;  2J4X A;  3WCQ A;  1V1P A;  2SEB D;  3R8B A;  4N58 A;  1J7A A;  1YN3 A;  2CJO A;  3BYT B;  1DYQ A;  4YTP B;  2PLP A;  5TSS A;  1ZXH A;  3U52 E;  2V4I B;  3IXS A;  3J9C A;  5BMI A;  4M0W A;  3P1M A;  3KQ4 A;  2DWQ A;  2XN9 C;  1E10 A;  3Q8B A;  2FUG 1;  3PZ7 A;  1EM7 A;  2K3U A;  2OHF A;  2ACZ B;  2N9K A;  1I4Q A;  3BVG A;  2LUM A;  1JWM D;  1NVI D;  4AQ7 A;  1JW9 D;  1XLP A;  2Q5W D;  1V8C A;  4IOI E;  4H2A A;  4TMA B;  1C76 A;  1M4V A;  1SE2 A;  2QSD A;  2JYE A;  3LXF A;  3LYY A;  2CJN A;  2LEK A;  5FKA C;  3AE6 B;  4ZRQ A;  1FRR A;  1TZO A;  3W9C B;  1KLU D;  1PGB A;  2LMC A;  4DXG A;  4LK0 M;  1QT9 A;  3NVW A;  4HRS A;  3B2F A;  1ZE3 D;  1UGJ A;  1ENF A;  3AE3 B;  1ET9 A;  3MJ5 A;  1VJK A;  1PYW D;  1FCL A;  4AS1 A;  4US9 A;  1EU4 A;  1XF5 L;  1C78 A;  4B0M A;  2WXR A;  3AEG B;  2BS2 B;  2DBY A;  2INN E;  2LJI A;  2V3N A;  3V3X A;  1FCC C;  3B9J A;  1OFF A;  3HVD A;  3AE9 B;  1DOI A;  3L4P A;  5AUI A;  3AH7 A;  2YEP F;  1I4X A;  1VZ6 A;  4N59 A;  1QIL A;  2J52 A;  3BII D;  2KMM A;  4C7Z A;  3AEC B;  1B1Z A;  5EE0 A;  5MPO A;  4JX1 C;  4ZOH C;  1IBX B;  1VRA B;  3BK1 A;  3VR8 B;  2V0G A;  1FRD A;  5D3D A;  5T8I A;  3RPF C;  3VR9 B;  2WXN A;  1F0Z A;  1C4A A;  2WDQ B;  3NVV A;  4C80 A;  1QOF A;  4ZHO A;  1FM0 D;  3EGR A;  3BK2 A;  1ESF A;  1PGA A;  2FBW B;  2M0A A;  2JQR B;  3FIL A;  2MH7 A;  4WIP A;  1OQR A;  2KAC A;  1LO5 D;  2BS4 B;  3P4P B;  4USA A;  2WXO A;  2PIA A;  1JCK B;  1ZPS A;  1E0Z A;  1HZ5 A;  1ZXI A;  1N5W A;  4KGS A;  2KQ4 X;  5EE3 A;  4RGT A;  3W5U B;  5G5H A;  4XDC A;  2DYO A;  1C4P A;  2ONQ A;  5BMH A;  1AN8 A;  2N0S B;  4PT5 A;  1V97 A;  3U7Z A;  2Y5P A;  1C79 A;  4RH6 A;  3TEW A;  1IGC A;  3OWE B;  1V1P B;  4ARC A;  1I4G A;  2Y5C A;  4YTM B;  4OVZ A;  3TEY A;  1TY0 A;  2PVG C;  2NTT A;  4WAF A;  4NAM A;  4GLS C;  3EUB 2;  2KWD A;  1KFY B;  5E6J A;  1WXQ A;  2AQ1 B;  1SB3 C;  2H89 B;  1F2R C;  4MM3 B;  5BYQ A;  1RYJ A;  4MAC A;  4TQ1 A;  5HFY A;  3H8H A;  2J53 A;  2TSS A;  1K51 A;  2IGG A;  1FFV A;  3NVZ A;  3MFG A;  3O13 A;  2BS3 B;  1AW7 A;  1XCT L;  3I57 A;  2HTM E;  4NAW B;  1FXA A;  1QOG A;  4A90 A;  4YSZ B;  2QJL A;  4OHJ A;  2QMT A;  4RGN A;  4HEA 1;  3AE1 B;  1V1O A;  1CZP A;  4JWS C;  1P7E A;  1ROE A;  2QEJ C;  1N5X A;  3VRB B;  4P16 A;  2IJ0 A;  1AWD A;  4KX6 B;  2W82 A;  1FD6 A;  2NMQ A;  1L6U A;  2DLB A;  1TKY A;  1HA5 A;  2ZW0 A;  2IGD A;  4TQ0 A;  1JWB D;  1GOZ A;  1VZ8 A;  2JSV X;  5HG2 A;  1YQ4 B;  1BXT A;  2WXG A;  4NZL B;  1RM6 C;  1ZDV A;  2X38 A;  2BBC A;  1WRI A;  2MJD A;  2WXF A;  2LGI A;  1XLQ A;  2WS3 B;  3T3O A;  1MVK A;  4IDI A;  1FNU A;  2Y3A A;  2E3T A;  3DWG C;  1D5X C;  1CQV A;  3P4R B;  1B9R A;  2K9X A;  1T6B X;  5H92 C;  3TEX A;  4D2K A;  3CWI A;  4A9A A;  1MHH E;  1TYG B;  2LFI A;  4N6E B;  2LHE A;  4A6Q A;  3Q8E A;  1D4B A;  1SSN A;  4O1N A;  1TKG A;  3URY A;  3FIL B;  3DWM A;  4RGO S;  5EE1 A;  3E9S A;  4HKZ E;  3ZQ4 A;  1TS2 A;  3NUH B;  2J42 A;  1TS5 A;  1K53 A;  4FXC A;  4IKG A;  1JML A;  2IPK D;  2VZK B;  5BMG A;  2KAJ A;  1VLB A;  2CU3 A;  1FNV A;  1UUP A;  3HVZ A;  3Q8F A;  3BZD B;  4WWM A;  1F2R I;  5BYR A;  2JWU A;  4L1B A;  2FE8 A;  1T3Q A;  2WXI A;  5JXV A;  5D7G A;  1STE A;  1E7P B;  1PGX A;  3PO0 A;  1OQQ A;  2NTS A;  3SFE B;  4EE2 A;  3BVZ A;  4OZC A;  3MP9 A;  4A55 A;  1VR9 A;  1L4Z B;  1WWT A;  1SJE D;  1VZ7 A;  3IT4 B;  2W3S A;  2K22 A;  3ZJU A;  1L5P A;  3R2I A;  1PUT A;  4WQM A;  2ZW1 A;  4WH4 A;  4ZRP A;  4KKI A;  1P7F A;  2WP9 B;  2D5G A;  1YJJ A;  2M56 B;  3AEB B;  2K0P A;  3AEE B;  1SIJ A;  4KGR A;  5C3J B;  3AB5 A;  2WXM A;  3W1S A;  1BML C;  2JXT A;  4ZHP A;  1TJE A;  3C8Y A;  1TS4 A;  4CQN A;  3AN1 A;  5FR3 A;  2RPV A;  5LNK 1;  1I7H A;  4C7Y A;  1FNW A;  2YEP B;  1VDV A;  1UNS A;  2K5P A;  1J7C A;  1YN5 A;  1T5X D;  2JYT A;  1NEN B;  3KWV A;  3SR6 A;  5AUK A;  1A70 A;  1K50 A;  1GAQ B;  2KN4 A;  3ABV B;  4OW0 A;  3ZJT A;  4ZYS A;  4DQO C;  1DGJ A;  1XO3 A;  1IUE A;  3ZYY X;  2JZP A;  5C2T B;  1C77 A;  2BT6 A;  4REZ A;  1MI0 A;  2WXQ A;  1BUI C;  1NYR A;  1GB1 A;  1WYG A;  4YSX B;  1AYF A;  1NYQ A;  1QKZ A;  4TSS A;  4GDL B;  1I4P A;  4GDK B;  3AE7 B;  2WNM A;  2PVO D;  3NVY A;  3ETR A;  3IT6 B;  3Q8C A;  3AED B;  3R2T A;  1IBX A;  1SEB D;  1XLN A;  3W2D A;  4YXD B;  3B2G A;  4ARI A;  1FMA D;  2WU2 B;  1N60 A;  4HRO A;  3W5V B;  3NS1 A;  2I38 A;  4A8X C;  4Q2J A;  2EEL A;  2GRI A;  2WDR B;  3EA6 A;  3NRZ A;  3AE4 B;  2IGH A;  4JPS A;  2H88 B;  1JRP A;  2WDV B;  2AX5 A;  1ZDX A;  4L2Y A;  3AEA B;  1HZ6 A;  3VQI A;  1TY2 A;  1XEE A;  1YMH E;  1QOB A;  1HXY D;  1N63 A;  3PZ8 A;  1I4R A;  1EWC A;  2BW2 A;  3Q8A A;  2MEK A;  4RF0 A;  4YSY B;  5FK9 C;  1ZP0 B;  1C9F A;  4MH8 A;  2QIL A;  1TS3 A;  2MJE A;  3KWL A;  1KRH A;  1SE4 A;  3AEF B;  2BYT A;  2WLB A;  4YT0 B;  1ET6 A;  3AV8 A;  4XDD A;  1FIQ A;  2LHD A;  4B0E A;  4JE3 B;  2PW9 A;  1RFK A;  1D5Z C;  1NI3 A;  1SF0 A;  3MC0 B;  1C4C A;  3TUO A;  4LLG M;  3AM9 A;  1SJH D;  1JWU D;  3BYY B;  2L1A A;  2PMV A;  2XNA C;  4RF1 A;  3P4S B;  1RWS A;  4NJC A;  4LTU A;  3TEZ A;  1SXT A;  1JWA D;  1DOY A;  1QF6 A;  3LB8 C;  1J7B A;  2BB6 A;  3ZGZ A;  2OED A;  1KLG D;  3AMZ A;  2G1E A;  2JX5 A;  3HUI A;  4L23 A;  4XWT A;  1KF6 B;  1EU3 A;  2RDH A;  1NEK B;  2EKI A;  3U4E G;  3IAS 1;  1GPX A;  1I4H A;  4OZA A;  1XLO A;  2DYM A;  2JU6 X;  4YTN B;  5I4D A;  1UWM A;  1L0V B;  3GP7 A;  4YWG G;  3SFD B;  3GS2 A;  1PFD A;  5HHD G;  2WXP A;  3GB1 A;  4R3D A;  4RFB A;  5EE9 A;  4DXF A;  3BWU D;  4JWU C;  1DOX A;  1WGK A;  1YNT E;  2GB1 A;  5D3I B;  3U2S C;  2QIE B;  2WQY B;  3AE5 B;  1UWX A;  2V3P A;  2G9H D;  2AQ3 B;  2SAK A;  2B76 B;  1JAL A;  4WUR A;  4UDU C;  2W3R A;  3FAH A;  3HRD D;  3SEB A;  3T3N A;  1N62 A;  3AE8 B;  1JRO A;  4KGT A;  5BYS A;  2I2Y A;  2ON8 A;  3E56 A;  2L32 A;  3CIR B;  2W54 A;  2N7J A;  1L4D B;  4HJG E;  3I9V 1;  1YN4 A;  3P4Q B;  2INP E;  2E6X A;  2WXK A;  2M19 A;  1JWS D;  1GB4 A;  1ACC A;  2PKO A;  2BTE A;  2BB5 A;  2WXJ A;  1YJI A;  2Z8L A;  4P6V F;  1D5M C;  1K52 A;  4J3O D;  1Q10 A;  2L83 A;  1F77 A;  5H8Y E;  1YQ3 B;  1FFU A;  3AE2 B;  1MHX A;  3KLS X;  3UI3 A;  2GI9 A;  1QLB B;  1TKE A;  2ICI A;  1L0X B;  1QOA A;  1WSP A;  1ZOY B;  2R61 A;  2VZK D;  3ZJV A;  3Q69 A;  3VRA B;  2MJ3 A;  3TSS A;  1ZUD 2;  2RDG A;  4RNA A;  1FEH A;  1E9M A;  3P63 A;  2WXL A;  1PDX A;  4ITK A;  1FO4 A;  1FXI A;  4MT5 A;  1KH0 A;  4HKQ A;  5G5G A;  2IDY A;  1JQ4 A;  1EWY C;  3FC4 A;  4RGM A;  1CJE A;  1KTK A;  2KDM A;  1XCQ L;  4US8 A;  2L52 A;  4C56 C;  2RMM A;  2WU5 B;  4OZB A;  1SBB B;  3N9Y C;  3IAM 1;  2AQ2 B;  1N61 A;  1L0Y B;  1L6V A;  2N9L A;  2PTL A;  2HDE A;  4RCO A;  3V05 A;  4KKJ A;  5GXG B;  3P42 A;  3RFZ B;  1Y56 A;  1HQR D;  1SE3 A;  4XE0 A;  1E6E B;  1D6E C;  2W55 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...