5GXGB

High-resolution crystal structure of the electron transfer complex of cytochrome p450cam with putidaredoxin
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
106
structure length
106
Chain Sequence
b'SKVVYVSHDGTRRELDVADGVSLMQAAVSNGIYDIVGDCGGSASCATCHVYVNEAFTDKVPAANEREIGMLECVTAELKPNSRLCCQIIMTPELDGIVVDVPDRQW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Camphor 5-monooxygenase
molecule tags Oxidoreductase/electron transport
source organism Pseudomonas putida
publication title Identification of productive and futile encounters in an electron transfer protein complex
pubmed doi rcsb
total genus 31
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2016-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5gxgB00
2ACZB 4USAA 1OQRA 2AX5A 3AM9A 3NVWA 3AB5A 4C7ZA 1QLBB 5G5GA 1FRRA 5AUKA 1FM0D 2K5PA 2WDRB 3AMZA 5EE9A 1NVID 2N0SB 1YJIA 3AE7B 4N59A 1SB3C 1ZOYB 2W55A 4C80A 2E3TA 4LTUA 1PDXA 1V8CA 3HRDD 2OHFA 1TJEA 4YTMB 3SFEB 3VR8B 1JQ4A 3AEGB 1XLPA 3AEEB 4P6VF 5H8YE 3LB8C 4YTNB 3DWGC 1KRHA 1ZUD2 1TYGB 3DWMA 1B9RA 5EE0A 4WWMA 4JX1C 1FFUA 1RM6C 3FAHA 1XLNA 1XLQA 1V97A 1CZPA 2KMMA 1TKEA 3AECB 2PVGC 1QOBA 5EE1A 2L83A 3P4RB 3NRZA 2BS3B 5C3JB 1QF6A 4WQMA 1ZXIA 1YJJA 3NVYA 2WLBA 4YSZB 1WGKA 3AEDB 2W3RA 1FXAA 4JWSC 5C2TB 1TKGA 1WRIA 1L5PA 1KFYB 1WWTA 2LEKA 2WU5B 1J7BA 2EKIA 2QJLA 5AUIA 3P4QB 2MJDA 1E7PB 3VRBB 4C7YA 3AE6B 3L4PA 3P1MA 2CJOA 1YQ4B 1EWYC 1A70A 3VR9B 1GAQB 3W5VB 1N5XA 1SF0A 3ZYYX 1IUEA 1OQQA 3EUB2 1KF6B 4ZOHC 1FO4A 4YSXB 1NYQA 3B2GA 1TKYA 2CJNA 1N5WA 1DOIA 4YXDB 1I7HA 3VRAB 1QOFA 4JWUC 1WYGA 1N61A 2WP9B 2JX5A 1L6VA 3W9CB 3PO0A 1F0ZA 1N62A 1RYJA 2WDQB 2DBYA 2K9XA 3AE9B 1E0ZA 1JROA 2L52A 3KWLA 4ITKA 3HUIA 4YT0B 5MPOA 2DWQA 3FC4A 3NVZA 2PKOA 3AE3B 1E10A 2W3SA 1L6UA 2QIEB 1FRDA 5H92C 4ZHPA 2BT6A 3AV8A 2B76B 1VLBA 1JALA 1DOYA 1YQ3B 4HRSA 2W54A 4KX6B 1VDVA 1N60A 2BS2B 3AE2B 2JQRB 3B2FA 4FXCA 2HTME 4A9AA 2CU3A 1WXQA 2MJEA 1J7CA 3AE1B 3WCQA 1OFFA 3B9JA 2MH7A 2FBWB 2PIAA 1PUTA 2BS4B 1J7AA 2Y5CA 1ZP0B 3HVZA 4YSYB 5EE3A 1ROEA 1PFDA 2Q5WD 3ABVB 3RPFC 1SIJA 1RWSA 1FMAD 2PVOD 4YTPB 2M19A 1JRPA 1RFKA 5GXGB 5G5HA 1AWDA 1QOAA 2WDVB 1CJEA 2H88B 2WU2B 1N63A 1DGJA 3SFDB 1FIQA 1UWMA 1E6EB 3ETRA 3SR6A 1FXIA 1E9MA 3AN1A 4ZHOA 1R7SA 1DOXA 3AEBB 1JW9D 3NS1A 1VJKA 1QOGA 1JWBD 2MJ3A 3LXFA 2G1EA 4HROA 4US9A 1NYRA 1JWAD 1XLOA 2WS3B 2H89B 1QT9A 1XO3A 2M56B 3AE4B 1AYFA 3CIRB 4N58A 1NI3A 2K22A 3AH7A 3BIID 3AE8B 3P4SB 1L0VB 1FFVA 3CWIA 1GPXA 1NEKB 3AE5B 2WQYB 3NVVA 3AEAB 3P4PB 4IDIA 2KAJA 1T3QA 4N6EB 3W5UB 4US8A 1NENB 3AEFB 3P63A
chains in the Genus database with same CATH superfamily
2ACZB 4USAA 1QKZA 3AI5A 3EECA 4YL8A 2KDMA 1NVID 3ZKJC 5D3DA 1SB3C 4NNJB 2JPHA 1PDXA 2KYWA 5L83A 2G45B 1I35A 3BY4B 4DHJD 3QX1A 2D2QA 2WXKA 3AEEB 4W9JA 3H8HA 4YTNB 3O65B 1YN3A 1UELA 1ACCA 2ZVOA 4EZJA 2ZEQA 1K53A 1KH0A 2DNFA 3AECB 1IGCA 2L83A 2MBHA 3BZDB 1D6EC 1HEZE 2FNJB 3L54A 2INCC 4FN2A 3VRBB 1GAQB 3RNEC 1J0GA 2M17A 1OQQA 5CHWA 3Q8BA 5LNK1 2CR5A 2N4FA 2IDYA 2M0XA 4KZ0A 3DHGC 1T0QC 2BW2A 1RYJA 3AE9B 2EELA 2KTRA 2L52A 2Y5PA 4YT0B 3FC4A 2IO2B 3JVZX 4JGHB 1F2RI 1JALA 2LGSA 2NCNA 4IM0A 1VDVA 5BMGA 4FXCA 2HJ8A 2L8JA 4REZA 1KLUD 2RD0A 4LNKA 1UWXA 3UQBA 2L0FA 4MELA 2G3QB 4OZCA 2WXGA 1RFKA 1AWDA 2BGFA 3DQVA 3RN9C 2WYQA 2WXPA 3DPDA 1TY0A 1VD2A 4W9LA 4MM3B 1SSNA 3H7PB 1XLOA 1YN4A 5IOIA 4FADA 2ZNVB 4KVGB 2LGIA 3U8ZA 3AH7A 1E5WA 2MLBA 1HQRD 1R4NB 3AU4A 2LJ5A 4HJKA 1EUVB 1I4GA 4W9GA 2KTFA 4GB9A 1TGZB 2PEAA 2IY1B 4WQOB 4AQ7A 4RGTA 1XXGA 1C77A 3FAHA 3GZNI 2L3ZA 1PYWD 3TIXA 2D3GA 1P0RA 1K8RB 1QOBA 5CHVC 2QSDA 4O1NA 1TS2A 5JHBA 4F7ZA 2O2VA 1EWYC 3NZSA 4LJPB 3A9JA 5IO9A 1RLFA 4ACFA 1IUEA 3L16A 4WAAA 1WYWB 5FR3A 2BPSA 2R2QA 1JRUA 3RUIB 1U4AA 1C4PA 2MHJA 2JWUA 4HCPB 3MC0B 2RPQA 4ITKA 1SE4A 3NVZA 1MHHE 4W9HA 3IT6B 1BT0A 3NZUA 2I2YA 4C4VA 1UGMA 4B0MA 2Z8LA 2W54A 3RYTA 1LXDA 2GLSA 4HJGE 5JZEB 2C7MB 3P42A 2ZCBA 3OJ3A 3ZW3A 3KW5B 2LVPA 5EE3A 1LO5D 2BB6A 3TBLD 3SR6A 3DVNV 1ZPSA 1QOGA 4XC2A 3OWEB 4RGOS 3I9V1 1V1PB 3PTFC 5HG2A 2K3UA 3P4SB 1L0VB 2IYDB 2PMVA 3NVVA 2GRIA 4R3DA 3AEAB 2B3AA 4TKNA 3SD5A 2GBRA 2J0JA 4D2KA 1AARA 2AQ1B 2UWQA 4HPMB 2BQQA 2BKFA 2E3TA 4TQ0A 3B1LX 1F9JA 2N7EA 2OHFA 2LMCA 4NAWA 2JYTA 1M94A 3H9DA 4B95A 2Y5BB 3VUXA 2BYTA 1FFUA 1SIFA 3PZDA 3H7PA 5C3JB 3H1UA 4XZ4A 1K52A 4XWWA 4A3OA 2J7QB 1Z5SB 2ZW1A 3IAS1 2AQ2B 4RM8A 5HFYA 3UF8A 1EU3A 1SJHD 2HD5B 4IW0A 3GZNB 1TY2A 1YQ4B 3VR9B 2RDBC 1JWSD 1I7HA 2ZNVC 1C79A 4ANXA 1STEA 2VZKD 4CYEA 4I6PA 1WX8A 2KDIA 3HUIA 2LVOA 3KUCB 3ZNZB 4ZHPA 3N20C 3VTWA 4NQKE 4KV2A 2OJRA 4MGZE 2FBWB 2KANA 2KWVB 1J7AA 3A9KB 2PVOD 2KK8A 1GC7A 1Q1OA 1FXIA 2PW9A 4MDKE 3I3TB 5BYRA 1VJKA 4HROA 2YVCA 1UGJA 1L0XB 4GOCA 4M8NA 2WXHA 3Q3OC 3UGBB 1GB1A 4N58A 1NI3A 2BWES 3BIID 4LDTD 4KKIA 1GPXA 3UINB 2PTLA 3RT3B 1OGWA 1CK1A 1HA5A 1NENB 4RCOA 4LLGM 2JSVX 4AJYB 3NG0A 4LJOB 1WZ3A 2DLBA 3Q8FA 5AUKA 3VFKA 3ML8A 1WXMA 5D94A 2CHZA 4NAMA 4URKA 4WWOA 2DENB 5E6OA 5GMVA 2FUHB 4BOZB 1SE2A 1WY8A 4JX1C 2KMCA 3QK0A 2NBUA 1MVKA 2IGGA 2GB1A 2JXXA 3J9CA 3P4RB 1D5ZC 1NI2A 3U30A 3V3XA 3IBEA 3C0RB 3OAWA 3QJZA 2LEKA 1J7BA 2DAFA 1E7PB 5EDSA 1YJ1A 4C7YA 4FJYA 3L17A 1UD7A 4AUQC 3QWZB 4E71A 5DPWA 2JY6A 3EUB2 3K9OB 3I63C 4F8CB 4JL9A 2IO1B 1WXVA 4LCDE 1QOFA 1M4VA 3ZRCA 1WYGA 2BBCA 1L6VA 1UBIA 2KC2A 2XBBC 3DBHI 3KUZA 4IUMB 1L6UA 4BKSD 2B76B 4HCNB 1WFYA 2WXNA 2IGDA 3W1SA 4K7SA 3TEXA 2BS2B 2JQRB 1WH3A 2LRUA 3VHTC 4DXFA 3LJ3A 3S2AA 2V0GA 2Y5CA 3HVZA 1V86A 2NTTA 1KLVA 1FMAD 4Q2JA 3VQIA 2QDFA 1LM8B 1ET9A 4GU2A 2W9NA 1BMLC 3PHXB 4L2YA 4DHZB 2RMMA 4WIPA 4US9A 4EFOA 2DZKA 1WJ6A 4NPNA 1WXSA 2QHOA 5E6PA 3A4SC 2K25A 3VVWB 4W9IA 3CWIA 1Y56A 1WIAA 1P9DU 3RZFA 1C3TA 3N30A 2YEPB 5EE9A 1SBBB 1GB4A 4KSKC 3ZO5B 3TEYA 1V1OA 3DWGC 5G55A 1RM6C 1SGHA 2MW5A 2JZPA 3GB1A 4ZRPA 2JXTA 2KX3A 1F52A 1QF6A 1C4AA 3T9LA 2QMTA 1MG4A 2LASA 3WAPA 4YWGG 1KTKA 3B0AA 2JZ3B 2CJNA 1WJUA 2L7RA 3VRAB 3ZTCA 4NJ7A 1ZW7A 1IPGA 4G50A 3TCAA 2FAZA 5DCNA 3HM3A 3BWUD 1K50A 1C78A 3PPAA 1VLBA 4EE2A 3M62B 1BXTA 4KX6B 1I42A 2RPVA 2JWZA 3KH0A 4PK1A 2BKRB 1LFDA 2AL3A 4ANVA 2FCNA 4DXAB 1WE6A 5DPTA 3RPFC 1SIJA 3APDA 3VH4B 3U7ZA 4C00A 4NAWB 4BVUC 4K1RB 3MFGA 2KXJA 3UQAA 3DHIC 3AEBB 1WGYA 2N1WA 2ON8A 4DDID 2G1EA 3NUHB 1WZ0A 2H89B 1IBXB 4MSMB 3TEWA 3CIRB 2N9LA 1Q0WB 2KAJA 4ARCA 2E6XA 1WX7A 1EU4A 2WX1A 3PGEA 1KLGD 5CX3A 1J19A 2A4ZA 1P7FA 2WXRA 3MC9A 1VZ7A 2M0AA 2R2OA 4A20A 1JQ4A 1ZE3D 2BWFA 2O6VD 3KYDD 2KLGA 1F77A 1P3QU 3LDZE 3WAOA 1I4XA 2D5GA 1TKEA 2WXJA 1ISNA 4JE3B 2BYVE 4W9KA 2NBWB 3H6NA 4LNFA 2ONQA 3ZUNA 5AUIA 1D5XC 3RI7C 1VCBA 1D3ZA 3CMMB 4QAYA 1TZOA 2YLMA 2RDGA 4YXDB 4WJNA 1UZXB 1I4RA 1SJED 4ICUA 2N9EB 3JYUA 2INPE 2R61A 3A1QA 5L95C 2V3PA 1F2RC 2HE7A 4J6IA 1TBEA 4H2AA 3ZGZA 2DWQA 4BKSA 3ZJTA 2M1MA 5LXHA 2BT6A 3V05A 4MGIE 1SE3A 5FK9C 4L23A 2WXLA 1V49A 3ZNID 4RF1A 2D3AA 5E6JA 2NPTA 4YTPB 4CHKA 2M19A 3PRPB 4RF0A 3MP9A 1PQSA 2ZVNA 4XX5A 2WDVB 4HKZE 3ECIA 1DGJA 1TS5A 3MJ5A 2UU7A 3IT4B 4W9CA 1UNSA 2MJ3A 2RR9A 2FE8A 1XO3A 4KGSA 2LXCA 2AQ3B 3OLMD 2DHZA 4RFBA 2GI9A 3Q8AA 1JWUD 2N9KA 4WJOA 5D3IB 4S0RA 2LUMA 4N59A 3MJWA 3CSTA 2BYFA 4FBJB 5C23A 4EEWA 3SFEB 4DQOC 1D4BA 2WX0A 2OOBB 3IAM1 3X23A 1B9RA 3BK2A 4OVZA 4DK5A 1EF1A 2IY0B 4GDKA 3R3MA 4WJPA 2PVGC 5EE1A 2ZPNA 2BS3B 3A1QB 2KTRB 4ARIA 4HEA1 4E3CA 1FXAA 1AW7A 3EGRA 4NQLB 1WWTA 1KFYB 2EKIA 4M00A 5LXIB 2WWZA 3M63B 4YSXB 1HZ6A 3DVGY 2KKCA 4F1SA 4MJSB 1WX9A 4LNIA 1FPYA 1L2NA 1N61A 3IXSA 2KFKA 4ZYSA 2K9XA 4P1BC 3TEZA 5MPOA 2KN5A 3ZJVA 3AU5A 2M8SA 3AE3B 4HPLB 2LD9A 3AXCA 4KKJA 4TQ1A 4GMVA 1TT5B 3Q3JA 1EF5A 1WXQA 3U2SC 4BKGA 3T3NA 1OFFA 1WGRA 3TL5A 4CQNA 3R2TA 4MSQB 1VZ6A 4BBNF 3Q6BA 2V3NA 4ZRKA 2XN9C 5G5HA 1ET6A 4HK2A 1BUIC 4JQWC 3CSFA 1QT9A 2LHEA 2PE6B 3TSSA 4K7WA 4AP4C 4TMAB 1NEKB 3AE5B 2XEWA 1GUAB 2I1JA 1NBFC 2J0MA 5JH5C 4GIVA 3PLVA 1WE7A 1QZEA 1E8ZA 3RNFC 3N1XC 3WALA 2JZZA 2IZVB 4CO7A 2J42A 1NDDA 4G11A 3V60A 3VR8B 3NZ3A 3R8BA 3MC8A 2A5UA 2CS4A 3IHPC 2NMQA 2L76A 5CTRC 3JSVB 4FLHA 2WLBA 1WGKA 2MCNB 4LNNA 1MFWA 5C2TB 1WRIA 2WU5B 5D6JB 3VUWA 1ENFA 5T8IA 4ANUA 1JWMD 4L1BA 4DBGA 4PS3A 1S3SG 2L00B 4AS1A 3WANA 3MTNB 5I4DA 4ZDVA 3W9CB 5AEKB 4A90A 3WA0A 2WDQB 1E0ZA 3ZXVA 1MHXA 1SXTA 3ZVVA 2D07B 4P7IA 2XNAC 1IGDA 2QEJC 4OZBA 3B08A 1WJNA 1DOYA 1YQ3B 3SEBA 3N3KB 4A9AA 2X8XX 2HTME 3A33B 2CU3A 1J7CA 3APCA 2N9PC 2MH7A 2QILA 2PIAA 4GXBA 4MH0E 4GDLA 4OHJA 4KGTA 2KDEB 5GXGB 3D32A 1V9JA 1RRBA 5LLIA 4IM2A 3SFDB 2DZJA 3ZJUA 4FA6A 2K39A 1E8WA 1L0YB 1AYFA 4P16A 2K22A 1GNUA 3ONSA 3AE8B 2WXQA 4FHJA 4HDOA 2I38A 4N6EB 3P63A 2XK5A 2AWTA 4M02A 1WJ4A 3W2DA 4C7ZA 4X57B 4RNAA 3AMZA 5KHQA 2MEKA 2NR2A 2JRHA 3HRDD 3L10B 4XDCA 2G9HD 1TS4A 1T0RC 3U52E 1ZUD2 3ZNHB 4XDDA 2FIDA 4NY0A 3L0WB 3L08A 2V4IB 1V5OA 4BAXA 2LXAA 2KWCA 2KVZA 1TKGA 1J8CA 1Q5WB 2CKHB 4NJCA 4A3PA 2L32A 2BTEA 2KX0A 1DYQA 3ZQ4A 1V5TA 1E7UA 2TSSA 2INNE 2K0PA 2Z59B 1EO6A 3PO0A 1FCLA 1N62A 2KQ4X 2RDHA 2KDFB 2GBKA 4ZYNA 4HRSA 4B9KA 1I4HA 1UH6A 4EOYA 4MH8A 2ZCCA 4KGRA 4YSYB 1X1MA 1N6ZA 2KZRA 3MHZA 1V1PA 4N9F4 3DBHB 3DBSA 3AN1A 1FEHA 2NVUI 4GDKB 3ALBA 4GLSC 2IPKD 5HHDG 2LFIA 4IG7B 4M0WB 2MA9B 2HDEA 2ZZPB 4KIKA 1MI0A 1T3QA 1R4NI 1XCQL 5AZGA 3AEFB 4II2B 3NVWA 1WM3A 1I4QA 4RMAA 2MBQA 4C80A 2Y3AA 2JU6X 1TJEA 2PE9A 3H7SA 3W1YA 2J0KA 1TYGB 2WNMA 1V97A 1CZPA 3R7RA 3DCGA 1XCTL 5IN7A 4KSLC 2V3SA 2ZPYA 2HTHA 3W5VB 5AZFA 3ZYYX 3DHHC 4ZOHC 2M4NA 5BMIA 2RSUA 4EUTA 1XF5L 1HZ5A 4DDGD 4II3B 1P1AA 4LK0M 1C4CA 4HWIB 1HXYD 3QC8B 2WXMA 2W3SA 1V81A 4LNOA 1TS3A 3QCAA 2FCQA 1R4MI 1C9FA 1CMXB 1H4RA 2FUG1 4MJSA 4A55A 2ZW0A 2Q5WD 1YMHE 3RMKC 2DZMA 1E90A 1E8YA 2JT4B 1DOXA 1E9MA 3TUOA 3PV1A 2LGYA 2WS3B 3IVFA 3KWVA 2KO3A 2BVCA 2OJWA 3AE4B 3WIMA 1XD3B 4M8MA 4K3CA 1P98A 1GJZA 4WJQA 2WXIA 3QQ8B 5J2RA 2AX5A 3AM9A 1QLBB 5G5GA 1FRRA 1H8CA 1FM0D 3C19A 3Q69A 2MBBB 1V8CA 2KJRA 3RCZA 1YQBA 1L7YA 2J52A 3PT2B 1KRHA 2YEPF 5EE0A 5JHAA 2I1KA 1XLQA 5E6NA 1I4PA 5J17A 2J53A 4HKQA 2XK5B 5BO4B 4IWPA 3M3JA 4K3BA 2NTSA 4YSZB 2JF5A 2W3RA 1QQRA 3Q2AC 3PVLA 2MP2A 3GS2A 2UYZB 4NZLB 2PJHA 1SF0A 3QHTA 4BKTA 2V1YA 4EZLA 3VTUA 4JWUC 2NBVB 2WP9B 2J4XA 1L4ZB 4XYCA 3R2IA 2VRRB 2DBYA 3VH3B 2REXA 1T6BX 2KNBA 4IWQA 4PYZA 2LVQA 3RNBC 3KYCD 3VXWA 4AWJA 3HIZA 3QA8A 3ENEA 3EFCA 5AZHA 1ZP0B 4TUUA 3TJPA 4MGKE 1RWSA 4IM3A 3ZDTA 2K8HA 2H88B 2HJ1A 3EA6A 1UWMA 4OVUA 3ETRA 3NS1A 1WM2A 5HKHA 1F1HA 4OW0A 1ESFA 4FULA 3PLUA 1NYRA 4UDUC 4MT5A 3DBRB 1V80A 1WGHA 2O6VA 4TSSA 2LZ6A 4DHJB 4IDIA 2WHIA 4WWNA 4GDLB 3V6CB 2IO3B 4KDLB 2WDTB 3JW0X 5IP4D 3N9YC 2JYEA 1PGAA 2KT7A 5D2MB 2INDC 2KWDA 3Q8CA 1GG3A 1KM7A 1T0SC 2X38A 3BYYB 5H8YE 4BFRA 3L13A 3BVZA 2WGSA 3VUYA 3EHVA 5CHFA 2KD0A 4GSWA 4WURA 5DPRA 2EKEC 3KQ4A 2N1VA 3NVYA 4ICVA 1WI0A 3DBLI 5BYQA 2C9WB 3HHMA 1K51A 4FJVB 1OQYA 2N7JA 3AE6B 3L4PA 4DWFA 1ZDXA 1T5XD 1LQBA 4RGMA 1NYQA 2LGDA 3OJ4B 1DOIA 4NJ6A 3KVFB 2QCZA 3HK0A 3VDZA 2AL6A 3BYTB 3EC8A 4FJZA 3DDCB 1JROA 3FKYA 4MACA 3ZLZA 2KQ7A 2N9XA 1E10A 2VH1A 3NS8A 1Q10A 2KWUB 3KLSX 4HPPA 3AE2B 1ZXHA 1WR1A 2MJEA 4MEMA 4W9FA 1YN5A 4OVVA 5IA7A 2MBEA 3ZDMC 2FIFA 1IBXA 1EM7A 2DZIA 2IO0B 4RM9A 4W9EA 3PS6A 3R66C 5BYSA 3Q3NC 2MRPA 3BK1A 2N7DA 2SAKA 4OZAA 1WR6E 3RULA 3W5UB 1XQQA 1TZ1A 1P7EA 3PZ8A 2C60A 3E9SA 3NOBA 3AB5A 1PGBA 3MHSD 1YJIA 3DVGX 4LTUA 1KOTA 1ZGUB 3A4RA 2D3BA 4WAFA 2KMAA 1MPEA 1XEEA 4WWMA 3M95A 4KIKB 2KC1A 4C4VB 4WH4A 3ZTDA 2O2VB 1ZXIA 1C1YB 3IFWB 3AEDB 1WGDA 2MQJA 3BVMA 2C7HA 3U7DA 2KVRA 1ZKHA 1OEYA 4XWTA 4I6LB 2CJOA 2IJ0A 1A70A 1ZDVA 4JPSA 5DPSA 1N5WA 2JUOA 1HE8A 3NY5A 1YIWA 1F0ZA 1YNTE 3Q3MC 1FCCC 4IWOA 4FHKA 2BB5A 2PKOA 1FRDA 4HDQA 1YX6B 2KHWB 3N32A 3RNCC 1WRDB 2DYOA 3B2FA 1WMHA 3AE1B 1WGGA 1C76A 1TIFA 2KFJA 3APFA 1ROEA 1PGXA 3FILA 2KFKB 4I6NB 2KQSA 3VTVA 2WXFA 4ZHOA 5D7GA 3QIJA 3PSEB 2CU1A 1JWBD 2PLPA 3RNGC 3DBLB 2WQYB 1MJDA 3RD2A 4RGNA 2D3CA 1HTQA 3HM6X 2IGHA 1JCKB 2Z0EB 5IAAC 2JRIB 2WDRB 2K5PA 3DBRI 3AE7B 3NJTA 3BINA 2AYOB 5TR5A 3IG3A 4A6QA 4HLEA 1FD6A 3V61A 3PRMB 3T8MA 4YTMB 1XLPA 2QC8A 4J3OD 3RNAC 2JVCA 3V62A 4B0EA 3GE8C 1UF0A 3CF6E 2KMMA 5KHOA 3NRZA 2MX2A 2DAJA 3KUDB 4KDIC 1MG8A 4C56C 4JWSC 2KDBA 2ASQA 3I57A 5HI1A 3P4QB 1FXTB 2V4LA 4M01A 1YX5B 3RFZB 3AULA 1WSPA 2FCMA 3DVNU 2LGXA 4BOSC 1HTOA 1V2YA 2MWSB 2QIEB 1SE9A 5H92C 2C7NB 4K7UA 3A9KA 2MP2B 3ZXRA 4RH6A 2GOWA 4S17A 3ML9A 4KZCA 3WCQA 2BS4B 2K6DB 1EWCA 4ZRJA 1B1ZA 2KLCA 2LJIA 3UIOB 4DXGA 3P2BA 1CJEA 4LDTB 1JMLA 1FIQA 2L1AA 2O6VB 3Q8EA 1R7SA 1AN8A 1QILA 2G4SA 3U4EG 4IC7B 3GE3C 2KOXA 3W1SC 4K81A 4G3XB 1FFVA 4PS7A 1L4DB 2Z0DB 1G6JA 1FNUA 1OQRA 1OEYJ 3URYA 2K8CA 3PHWB 2EMTA 3O13A 4WWPA 1UBQA 2N0SB 1ZOYB 2L0TA 3GP7A 4P1CC 2DYMA 3AEGB 1Y8RC 2SEBD 3DWMA 1WF9A 1XLNA 2MBOA 4TV3A 4MM3A 1GOZA 2L05A 3GOEA 4B6WA 3BVGA 4WQMA 2RGFA 1YJJA 2LWPA 1LGRA 2LRWA 3OG5A 4EKUA 4EZKA 2QJLA 3P1MA 3PZ7A 3UI3A 5TSSA 3HVDA 2NS5A 4GN1A 1FO4A 5J18A 1KF6B 1S1QB 4AJWA 3T3OA 2IBIB 3JSVA 4ZRIA 3X0WA 5FR6A 3NHEB 1A5RA 3KWLA 4BBNC 1YD8U 2LUEA 1OTRB 2K6QA 2WXOA 1IYFA 2G4DB 4AOFA 3ZRFA 3SU8X 3LYYA 2D11A 3A9JB 1QOAA 4ZRQA 1V6EA 1E6EB 2C5LC 2D10A 3LXFA 4ANWA 1JWAD 2KJ6A 3SHQA 2FCSA 2M56B 5IKCM 2EMSA 2OEDA 4ASWC 5BMHA 3P4PB 5C1ZA 4US8A 3TMPB 2ZJDA 3K9PB 3ZNGC 2VH2A 3FILB 3UIPB 3QAQA 2LHDA 2GBJA 2GBMA 4BZAA 3ZIMA 3SDLC 2W55A 1VRAB 4XE0A 2CHWA 3PRZA 3N1ZC 4P6VF 3LB8C 3VAWA 4JIOU 2DX5B 2ICIA 1TTNA 2AEHA 3DOWA 1R4MB 4IOIE 1FNWA 3V6EB 5JXVA 1XT9B 1WMHB 1D5MC 4W9DA 1L5PA 3Q14C 2VZKB 4IKGA 2MJDA 4HXDA 1VR9A 1VZ8A 4A8XC 1N5XA 4JLCA 4E74A 3B2GA 1YOVB 1TKYA 4MGYE 1CQVA 2BYEA 2JX5A 1T0YA 4HVBA 4PT5A 1GC6A 3N1YC 3Q3FA 2GMIC 3AV8A 4G0NB 1RAXA 1UUPA 2K1FA 3PREA 1N60A 2V9HA 3I5JC 2BF8B 1E8XA 3B9JA 1PUTA 1Z2MA 3C8YA 1PFDA 3ABVB 1SEBD 2LI5A 1RFAA 1JRPA 2PPHA 2MSED 5FKAC 2W82A 2WU2B 4PYUA 1N63A 4M0WA 3RZWC 2KN4A 4XGAB 2KJHB 1JW9D 4PS8A 3WAMA 4DHZE 2KACA 1WXAA 2CHXA 5G2NA 2K8BA 1KJTA 1FNVA 2GBNA 2DYBA 3R7QA 4GGQA 3QARA 1E7VA 1IP9A 3EFUA 3E56A 2NPTB
chains in the Genus database with same CATH topology
2ACZB 1P7EA 3PZ8A 4USAA 1QKZA 3E9SA 3W2DA 3AB5A 4C7ZA 1PGBA 2KDMA 2YEPB 4RNAA 3AMZA 5EE9A 1NVID 1YJIA 1SBBB 2MEKA 5D3DA 1SB3C 4LTUA 1GB4A 1PDXA 3HRDD 4XDCA 2G9HD 4WAFA 1TS4A 2WXKA 3AEEB 3TEYA 3U52E 1MPEA 3H8HA 1V1OA 3DWGC 1XEEA 1ZUD2 4YTNB 1YN3A 4WWMA 4XDDA 1ACCA 1RM6C 2JZPA 3GB1A 4ZRPA 4WH4A 1K53A 1KH0A 3AECB 2V4IB 2JXTA 1IGCA 2L83A 3BZDB 1D6EC 1QF6A 1ZXIA 1C4AA 3AEDB 1HEZE 2QMTA 1TKGA 3BVMA 3VRBB 4YWGG 4XWTA 2CJOA 2IJ0A 1A70A 1GAQB 1KTKA 1ZDVA 4JPSA 1OQQA 4NJCA 2L32A 2BTEA 2CJNA 1N5WA 3Q8BA 5LNK1 1DYQA 3ZQ4A 2IDYA 3VRAB 2TSSA 2BW2A 2INNE 2K0PA 3PO0A 1FCLA 1F0ZA 1N62A 1RYJA 3AE9B 1YNTE 1FCCC 2EELA 2KQ4X 2L52A 2Y5PA 4YT0B 3FC4A 2BB5A 2PKOA 2RDHA 3BWUD 1FRDA 1C78A 1K50A 1VLBA 1F2RI 4EE2A 1JALA 1BXTA 4HRSA 2DYOA 1VDVA 4KX6B 5BMGA 3B2FA 2RPVA 4FXCA 4REZA 3AE1B 1I4HA 1KLUD 1C76A 4MH8A 1UWXA 4KGRA 4YSYB 1ROEA 1PGXA 4OZCA 3RPFC 1SIJA 3MHZA 2WXGA 1V1PA 3FILA 3U7ZA 1RFKA 1AWDA 4NAWB 3MFGA 2WXPA 2WXFA 3AN1A 4ZHOA 1TY0A 1FEHA 3AEBB 5D7GA 2ON8A 4GDKB 4MM3B 1SSNA 1JWBD 2G1EA 2PLPA 3NUHB 1XLOA 1YN4A 2H89B 1IBXB 2LGIA 2IPKD 4GLSC 5HHDG 2LFIA 3TEWA 3CIRB 3AH7A 2HDEA 2N9LA 2WQYB 1HQRD 1MI0A 1T3QA 1XCQL 2KAJA 4ARCA 4RGNA 2E6XA 3AEFB 2IGHA 1I4GA 1EU4A 1JCKB 3NVWA 1KLGD 1I4QA 2WDRB 2K5PA 1P7FA 2WXRA 3AE7B 1VZ7A 2M0AA 4A6QA 4C80A 2Y3AA 2JU6X 1FD6A 1TJEA 4YTMB 1JQ4A 1ZE3D 1XLPA 4J3OD 1TYGB 4AQ7A 1F77A 2WNMA 1XXGA 1C77A 3FAHA 4RGTA 4B0EA 1PYWD 1I4XA 1V97A 1CZPA 2D5GA 2KMMA 1TKEA 2WXJA 1QOBA 3NRZA 2QSDA 4JE3B 1XCTL 4O1NA 2ONQA 4C56C 4JWSC 1TS2A 3I57A 5HI1A 5AUIA 3P4QB 1D5XC 1EWYC 3W5VB 1TZOA 3ZYYX 1IUEA 4ZOHC 5BMIA 2RDGA 4YXDB 3RFZB 1I4RA 1SJED 1XF5L 1HZ5A 5FR3A 1WSPA 2INPE 1C4PA 2R61A 2JWUA 3MC0B 2V3PA 4LK0M 1F2RC 1C4CA 3ZGZA 4H2AA 1HXYD 1SE4A 4ITKA 2WXMA 2DWQA 3NVZA 3ZJTA 1MHHE 2W3SA 2QIEB 5H92C 3IT6B 1TS3A 2BT6A 2I2YA 3V05A 4B0MA 2Z8LA 4RH6A 2W54A 4HJGE 1SE3A 5FK9C 3P42A 4L23A 2WXLA 3WCQA 1C9FA 2FUG1 4RF1A 2BS4B 4A55A 1EWCA 2ZW0A 5E6JA 5EE3A 2Q5WD 4YTPB 1YMHE 1LO5D 2M19A 4RF0A 1B1ZA 3MP9A 2BB6A 2LJIA 4DXGA 2WDVB 1CJEA 1JMLA 4HKZE 1DGJA 1FIQA 2L1AA 1DOXA 1TS5A 3MJ5A 3SR6A 1E9MA 3IT4B 3Q8EA 1R7SA 3TUOA 1ZPSA 1UNSA 1AN8A 1QOGA 2MJ3A 1QILA 2FE8A 2WS3B 3OWEB 4RGOS 3I9V1 1V1PB 3KWVA 3U4EG 1XO3A 4KGSA 3AE4B 2AQ3B 5HG2A 2K3UA 3P4SB 1L0VB 1FFVA 2PMVA 3NVVA 2GRIA 4R3DA 3AEAB 4RFBA 1L4DB 2GI9A 3Q8AA 1FNUA 1JWUD 2N9KA 4D2KA 2WXIA 1OQRA 3URYA 2AX5A 3AM9A 2AQ1B 5D3IB 1QLBB 3O13A 1FRRA 5G5GA 1FM0D 2LUMA 2N0SB 4N59A 3Q69A 1ZOYB 2E3TA 4TQ0A 1V8CA 2OHFA 3GP7A 3SFEB 2DYMA 4DQOC 3AEGB 1D4BA 2LMCA 3IAM1 2J52A 2JYTA 1KRHA 2SEBD 3DWMA 2YEPF 1B9RA 3BK2A 4OVZA 5EE0A 2BYTA 1FFUA 1XLNA 1XLQA 1GOZA 1I4PA 2PVGC 2J53A 5EE1A 4HKQA 5C3JB 2BS3B 3BVGA 4WQMA 1K52A 4XWWA 1YJJA 2NTSA 4YSZB 4ARIA 2ZW1A 5HFYA 3IAS1 2AQ2B 2W3RA 4HEA1 1FXAA 1QQRA 1AW7A 3EGRA 1WWTA 1KFYB 1EU3A 1SJHD 2EKIA 2QJLA 3P1MA 3PZ7A 3UI3A 1TY2A 1YQ4B 3GS2A 4NZLB 3HVDA 5TSSA 3VR9B 1SF0A 1FO4A 1KF6B 4YSXB 1HZ6A 1JWSD 3T3OA 1I7HA 1C79A 4JWUC 1N61A 2WP9B 2J4XA 1L4ZB 1STEA 2VZKD 3IXSA 3R2IA 4ZYSA 2DBYA 2K9XA 3TEZA 5MPOA 3KWLA 3ZJVA 3HUIA 1T6BX 3AE3B 4ZHPA 4KKJA 4TQ1A 2WXOA 1WXQA 3U2SC 3T3NA 1OFFA 3LYYA 2FBWB 1J7AA 1ZP0B 4CQNA 3R2TA 1RWSA 1VZ6A 2PVOD 2V3NA 2XN9C 5G5HA 1QOAA 1ET6A 2H88B 4ZRQA 3EA6A 1UWMA 1E6EB 3ETRA 1FXIA 2PW9A 1BUIC 3NS1A 5BYRA 1VJKA 3LXFA 4HROA 1ESFA 4OW0A 1UGJA 1NYRA 1JWAD 4UDUC 1L0XB 4MT5A 1QT9A 2LHEA 2M56B 2WXHA 1GB1A 4N58A 1NI3A 3TSSA 3BIID 2OEDA 5BMHA 4TSSA 4KKIA 4TMAB 1NEKB 3AE5B 3P4PB 2PTLA 1GPXA 4IDIA 1CK1A 4US8A 1HA5A 1NENB 4GDLB 4RCOA 4LLGM 2JSVX 3FILB 2LHDA 2DLBA 3Q8FA 3N9YC 5AUKA 2JYEA 1PGAA 2KWDA 3Q8CA 2W55A 1VRAB 2J42A 4NAMA 4XE0A 2X38A 3VR8B 3BYYB 3NZ3A 4P6VF 3R8BA 5H8YE 3LB8C 2ICIA 1SE2A 4JX1C 3BVZA 2NMQA 1MVKA 2IGGA 2GB1A 3J9CA 3P4RB 1D5ZC 4IOIE 4WURA 1FNWA 3KQ4A 3V3XA 5JXVA 3NVYA 2WLBA 1WGKA 1D5MC 5BYQA 5C2TB 1WRIA 1L5PA 2LEKA 2WU5B 1J7BA 1ENFA 2VZKB 4IKGA 1K51A 2MJDA 1E7PB 5T8IA 2N7JA 3AE6B 4C7YA 3L4PA 1VR9A 1JWMD 4L1BA 1VZ8A 1ZDXA 1T5XD 4A8XC 4RGMA 1N5XA 3EUB2 1NYQA 3B2GA 4AS1A 1TKYA 1DOIA 1CQVA 5I4DA 1QOFA 1M4VA 1WYGA 2JX5A 2BBCA 1L6VA 3BYTB 3W9CB 4PT5A 4A90A 2WDQB 1E0ZA 1JROA 1MHXA 1SXTA 4MACA 1E10A 1L6UA 3AV8A 2B76B 1UUPA 2XNAC 1IGDA 2QEJC 2WXNA 4OZBA 1Q10A 1DOYA 2IGDA 1YQ3B 3SEBA 3KLSX 3W1SA 1N60A 3TEXA 2BS2B 3AE2B 2JQRB 4A9AA 2HTME 1ZXHA 2CU3A 2MJEA 1J7CA 4DXFA 3B9JA 2MH7A 2QILA 2PIAA 1YN5A 1PUTA 2V0GA 2Y5CA 3HVZA 3C8YA 1PFDA 2NTTA 1SEBD 3ABVB 1FMAD 4OHJA 1IBXA 4KGTA 1JRPA 1EM7A 4Q2JA 5FKAC 5GXGB 2W82A 3VQIA 2WU2B 1N63A 4M0WA 1ET9A 3SFDB 3ZJUA 2KN4A 1BMLC 4L2YA 1JW9D 5BYSA 2RMMA 2KACA 4WIPA 4US9A 1FNVA 1L0YB 1AYFA 3BK1A 4P16A 2K22A 3AE8B 2SAKA 3CWIA 1Y56A 2WXQA 4OZAA 2I38A 4N6EB 3W5UB 3E56A 3P63A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ACZ B;  4USA A;  1OQR A;  2AX5 A;  3AM9 A;  3NVW A;  3AB5 A;  4C7Z A;  1QLB B;  5G5G A;  1FRR A;  5AUK A;  1FM0 D;  2K5P A;  2WDR B;  3AMZ A;  5EE9 A;  1NVI D;  2N0S B;  1YJI A;  3AE7 B;  4N59 A;  1SB3 C;  1ZOY B;  2W55 A;  4C80 A;  2E3T A;  4LTU A;  1PDX A;  1V8C A;  3HRD D;  2OHF A;  1TJE A;  4YTM B;  3SFE B;  3VR8 B;  1JQ4 A;  3AEG B;  1XLP A;  3AEE B;  4P6V F;  5H8Y E;  3LB8 C;  4YTN B;  3DWG C;  1KRH A;  1ZUD 2;  1TYG B;  3DWM A;  1B9R A;  5EE0 A;  4WWM A;  4JX1 C;  1FFU A;  1RM6 C;  3FAH A;  1XLN A;  1XLQ A;  1V97 A;  1CZP A;  2KMM A;  1TKE A;  3AEC B;  2PVG C;  1QOB A;  5EE1 A;  2L83 A;  3P4R B;  3NRZ A;  2BS3 B;  5C3J B;  1QF6 A;  4WQM A;  1ZXI A;  1YJJ A;  3NVY A;  2WLB A;  4YSZ B;  1WGK A;  3AED B;  2W3R A;  1FXA A;  4JWS C;  5C2T B;  1TKG A;  1WRI A;  1L5P A;  1KFY B;  1WWT A;  2LEK A;  2WU5 B;  1J7B A;  2EKI A;  2QJL A;  5AUI A;  3P4Q B;  2MJD A;  1E7P B;  3VRB B;  4C7Y A;  3AE6 B;  3L4P A;  3P1M A;  2CJO A;  1YQ4 B;  1EWY C;  1A70 A;  3VR9 B;  1GAQ B;  3W5V B;  1N5X A;  1SF0 A;  3ZYY X;  1IUE A;  1OQQ A;  3EUB 2;  1KF6 B;  4ZOH C;  1FO4 A;  4YSX B;  1NYQ A;  3B2G A;  1TKY A;  2CJN A;  1N5W A;  1DOI A;  4YXD B;  1I7H A;  3VRA B;  1QOF A;  4JWU C;  1WYG A;  1N61 A;  2WP9 B;  2JX5 A;  1L6V A;  3W9C B;  3PO0 A;  1F0Z A;  1N62 A;  1RYJ A;  2WDQ B;  2DBY A;  2K9X A;  3AE9 B;  1E0Z A;  1JRO A;  2L52 A;  3KWL A;  4ITK A;  3HUI A;  4YT0 B;  5MPO A;  2DWQ A;  3FC4 A;  3NVZ A;  2PKO A;  3AE3 B;  1E10 A;  2W3S A;  1L6U A;  2QIE B;  1FRD A;  5H92 C;  4ZHP A;  2BT6 A;  3AV8 A;  2B76 B;  1VLB A;  1JAL A;  1DOY A;  1YQ3 B;  4HRS A;  2W54 A;  4KX6 B;  1VDV A;  1N60 A;  2BS2 B;  3AE2 B;  2JQR B;  3B2F A;  4FXC A;  2HTM E;  4A9A A;  2CU3 A;  1WXQ A;  2MJE A;  1J7C A;  3AE1 B;  3WCQ A;  1OFF A;  3B9J A;  2MH7 A;  2FBW B;  2PIA A;  1PUT A;  2BS4 B;  1J7A A;  2Y5C A;  1ZP0 B;  3HVZ A;  4YSY B;  5EE3 A;  1ROE A;  1PFD A;  2Q5W D;  3ABV B;  3RPF C;  1SIJ A;  1RWS A;  1FMA D;  2PVO D;  4YTP B;  2M19 A;  1JRP A;  1RFK A;  5GXG B;  5G5H A;  1AWD A;  1QOA A;  2WDV B;  1CJE A;  2H88 B;  2WU2 B;  1N63 A;  1DGJ A;  3SFD B;  1FIQ A;  1UWM A;  1E6E B;  3ETR A;  3SR6 A;  1FXI A;  1E9M A;  3AN1 A;  4ZHO A;  1R7S A;  1DOX A;  3AEB B;  1JW9 D;  3NS1 A;  1VJK A;  1QOG A;  1JWB D;  2MJ3 A;  3LXF A;  2G1E A;  4HRO A;  4US9 A;  1NYR A;  1JWA D;  1XLO A;  2WS3 B;  2H89 B;  1QT9 A;  1XO3 A;  2M56 B;  3AE4 B;  1AYF A;  3CIR B;  4N58 A;  1NI3 A;  2K22 A;  3AH7 A;  3BII D;  3AE8 B;  3P4S B;  1L0V B;  1FFV A;  3CWI A;  1GPX A;  1NEK B;  3AE5 B;  2WQY B;  3NVV A;  3AEA B;  3P4P B;  4IDI A;  2KAJ A;  1T3Q A;  4N6E B;  3W5U B;  4US8 A;  1NEN B;  3AEF B;  3P63 A; 
#chains in the Genus database with same CATH topology
 2ACZ B;  4USA A;  1QKZ A;  3AI5 A;  3EEC A;  4YL8 A;  2KDM A;  1NVI D;  3ZKJ C;  5D3D A;  1SB3 C;  4NNJ B;  2JPH A;  1PDX A;  2KYW A;  5L83 A;  2G45 B;  1I35 A;  3BY4 B;  4DHJ D;  3QX1 A;  2D2Q A;  2WXK A;  3AEE B;  4W9J A;  3H8H A;  4YTN B;  3O65 B;  1YN3 A;  1UEL A;  1ACC A;  2ZVO A;  4EZJ A;  2ZEQ A;  1K53 A;  1KH0 A;  2DNF A;  3AEC B;  1IGC A;  2L83 A;  2MBH A;  3BZD B;  1D6E C;  1HEZ E;  2FNJ B;  3L54 A;  2INC C;  4FN2 A;  3VRB B;  1GAQ B;  3RNE C;  1J0G A;  2M17 A;  1OQQ A;  5CHW A;  3Q8B A;  5LNK 1;  2CR5 A;  2N4F A;  2IDY A;  2M0X A;  4KZ0 A;  3DHG C;  1T0Q C;  2BW2 A;  1RYJ A;  3AE9 B;  2EEL A;  2KTR A;  2L52 A;  2Y5P A;  4YT0 B;  3FC4 A;  2IO2 B;  3JVZ X;  4JGH B;  1F2R I;  1JAL A;  2LGS A;  2NCN A;  4IM0 A;  1VDV A;  5BMG A;  4FXC A;  2HJ8 A;  2L8J A;  4REZ A;  1KLU D;  2RD0 A;  4LNK A;  1UWX A;  3UQB A;  2L0F A;  4MEL A;  2G3Q B;  4OZC A;  2WXG A;  1RFK A;  1AWD A;  2BGF A;  3DQV A;  3RN9 C;  2WYQ A;  2WXP A;  3DPD A;  1TY0 A;  1VD2 A;  4W9L A;  4MM3 B;  1SSN A;  3H7P B;  1XLO A;  1YN4 A;  5IOI A;  4FAD A;  2ZNV B;  4KVG B;  2LGI A;  3U8Z A;  3AH7 A;  1E5W A;  2MLB A;  1HQR D;  1R4N B;  3AU4 A;  2LJ5 A;  4HJK A;  1EUV B;  1I4G A;  4W9G A;  2KTF A;  4GB9 A;  1TGZ B;  2PEA A;  2IY1 B;  4WQO B;  4AQ7 A;  4RGT A;  1XXG A;  1C77 A;  3FAH A;  3GZN I;  2L3Z A;  1PYW D;  3TIX A;  2D3G A;  1P0R A;  1K8R B;  1QOB A;  5CHV C;  2QSD A;  4O1N A;  1TS2 A;  5JHB A;  4F7Z A;  2O2V A;  1EWY C;  3NZS A;  4LJP B;  3A9J A;  5IO9 A;  1RLF A;  4ACF A;  1IUE A;  3L16 A;  4WAA A;  1WYW B;  5FR3 A;  2BPS A;  2R2Q A;  1JRU A;  3RUI B;  1U4A A;  1C4P A;  2MHJ A;  2JWU A;  4HCP B;  3MC0 B;  2RPQ A;  4ITK A;  1SE4 A;  3NVZ A;  1MHH E;  4W9H A;  3IT6 B;  1BT0 A;  3NZU A;  2I2Y A;  4C4V A;  1UGM A;  4B0M A;  2Z8L A;  2W54 A;  3RYT A;  1LXD A;  2GLS A;  4HJG E;  5JZE B;  2C7M B;  3P42 A;  2ZCB A;  3OJ3 A;  3ZW3 A;  3KW5 B;  2LVP A;  5EE3 A;  1LO5 D;  2BB6 A;  3TBL D;  3SR6 A;  3DVN V;  1ZPS A;  1QOG A;  4XC2 A;  3OWE B;  4RGO S;  3I9V 1;  1V1P B;  3PTF C;  5HG2 A;  2K3U A;  3P4S B;  1L0V B;  2IYD B;  2PMV A;  3NVV A;  2GRI A;  4R3D A;  3AEA B;  2B3A A;  4TKN A;  3SD5 A;  2GBR A;  2J0J A;  4D2K A;  1AAR A;  2AQ1 B;  2UWQ A;  4HPM B;  2BQQ A;  2BKF A;  2E3T A;  4TQ0 A;  3B1L X;  1F9J A;  2N7E A;  2OHF A;  2LMC A;  4NAW A;  2JYT A;  1M94 A;  3H9D A;  4B95 A;  2Y5B B;  3VUX A;  2BYT A;  1FFU A;  1SIF A;  3PZD A;  3H7P A;  5C3J B;  3H1U A;  4XZ4 A;  1K52 A;  4XWW A;  4A3O A;  2J7Q B;  1Z5S B;  2ZW1 A;  3IAS 1;  2AQ2 B;  4RM8 A;  5HFY A;  3UF8 A;  1EU3 A;  1SJH D;  2HD5 B;  4IW0 A;  3GZN B;  1TY2 A;  1YQ4 B;  3VR9 B;  2RDB C;  1JWS D;  1I7H A;  2ZNV C;  1C79 A;  4ANX A;  1STE A;  2VZK D;  4CYE A;  4I6P A;  1WX8 A;  2KDI A;  3HUI A;  2LVO A;  3KUC B;  3ZNZ B;  4ZHP A;  3N20 C;  3VTW A;  4NQK E;  4KV2 A;  2OJR A;  4MGZ E;  2FBW B;  2KAN A;  2KWV B;  1J7A A;  3A9K B;  2PVO D;  2KK8 A;  1GC7 A;  1Q1O A;  1FXI A;  2PW9 A;  4MDK E;  3I3T B;  5BYR A;  1VJK A;  4HRO A;  2YVC A;  1UGJ A;  1L0X B;  4GOC A;  4M8N A;  2WXH A;  3Q3O C;  3UGB B;  1GB1 A;  4N58 A;  1NI3 A;  2BWE S;  3BII D;  4LDT D;  4KKI A;  1GPX A;  3UIN B;  2PTL A;  3RT3 B;  1OGW A;  1CK1 A;  1HA5 A;  1NEN B;  4RCO A;  4LLG M;  2JSV X;  4AJY B;  3NG0 A;  4LJO B;  1WZ3 A;  2DLB A;  3Q8F A;  5AUK A;  3VFK A;  3ML8 A;  1WXM A;  5D94 A;  2CHZ A;  4NAM A;  4URK A;  4WWO A;  2DEN B;  5E6O A;  5GMV A;  2FUH B;  4BOZ B;  1SE2 A;  1WY8 A;  4JX1 C;  2KMC A;  3QK0 A;  2NBU A;  1MVK A;  2IGG A;  2GB1 A;  2JXX A;  3J9C A;  3P4R B;  1D5Z C;  1NI2 A;  3U30 A;  3V3X A;  3IBE A;  3C0R B;  3OAW A;  3QJZ A;  2LEK A;  1J7B A;  2DAF A;  1E7P B;  5EDS A;  1YJ1 A;  4C7Y A;  4FJY A;  3L17 A;  1UD7 A;  4AUQ C;  3QWZ B;  4E71 A;  5DPW A;  2JY6 A;  3EUB 2;  3K9O B;  3I63 C;  4F8C B;  4JL9 A;  2IO1 B;  1WXV A;  4LCD E;  1QOF A;  1M4V A;  3ZRC A;  1WYG A;  2BBC A;  1L6V A;  1UBI A;  2KC2 A;  2XBB C;  3DBH I;  3KUZ A;  4IUM B;  1L6U A;  4BKS D;  2B76 B;  4HCN B;  1WFY A;  2WXN A;  2IGD A;  3W1S A;  4K7S A;  3TEX A;  2BS2 B;  2JQR B;  1WH3 A;  2LRU A;  3VHT C;  4DXF A;  3LJ3 A;  3S2A A;  2V0G A;  2Y5C A;  3HVZ A;  1V86 A;  2NTT A;  1KLV A;  1FMA D;  4Q2J A;  3VQI A;  2QDF A;  1LM8 B;  1ET9 A;  4GU2 A;  2W9N A;  1BML C;  3PHX B;  4L2Y A;  4DHZ B;  2RMM A;  4WIP A;  4US9 A;  4EFO A;  2DZK A;  1WJ6 A;  4NPN A;  1WXS A;  2QHO A;  5E6P A;  3A4S C;  2K25 A;  3VVW B;  4W9I A;  3CWI A;  1Y56 A;  1WIA A;  1P9D U;  3RZF A;  1C3T A;  3N30 A;  2YEP B;  5EE9 A;  1SBB B;  1GB4 A;  4KSK C;  3ZO5 B;  3TEY A;  1V1O A;  3DWG C;  5G55 A;  1RM6 C;  1SGH A;  2MW5 A;  2JZP A;  3GB1 A;  4ZRP A;  2JXT A;  2KX3 A;  1F52 A;  1QF6 A;  1C4A A;  3T9L A;  2QMT A;  1MG4 A;  2LAS A;  3WAP A;  4YWG G;  1KTK A;  3B0A A;  2JZ3 B;  2CJN A;  1WJU A;  2L7R A;  3VRA B;  3ZTC A;  4NJ7 A;  1ZW7 A;  1IPG A;  4G50 A;  3TCA A;  2FAZ A;  5DCN A;  3HM3 A;  3BWU D;  1K50 A;  1C78 A;  3PPA A;  1VLB A;  4EE2 A;  3M62 B;  1BXT A;  4KX6 B;  1I42 A;  2RPV A;  2JWZ A;  3KH0 A;  4PK1 A;  2BKR B;  1LFD A;  2AL3 A;  4ANV A;  2FCN A;  4DXA B;  1WE6 A;  5DPT A;  3RPF C;  1SIJ A;  3APD A;  3VH4 B;  3U7Z A;  4C00 A;  4NAW B;  4BVU C;  4K1R B;  3MFG A;  2KXJ A;  3UQA A;  3DHI C;  3AEB B;  1WGY A;  2N1W A;  2ON8 A;  4DDI D;  2G1E A;  3NUH B;  1WZ0 A;  2H89 B;  1IBX B;  4MSM B;  3TEW A;  3CIR B;  2N9L A;  1Q0W B;  2KAJ A;  4ARC A;  2E6X A;  1WX7 A;  1EU4 A;  2WX1 A;  3PGE A;  1KLG D;  5CX3 A;  1J19 A;  2A4Z A;  1P7F A;  2WXR A;  3MC9 A;  1VZ7 A;  2M0A A;  2R2O A;  4A20 A;  1JQ4 A;  1ZE3 D;  2BWF A;  2O6V D;  3KYD D;  2KLG A;  1F77 A;  1P3Q U;  3LDZ E;  3WAO A;  1I4X A;  2D5G A;  1TKE A;  2WXJ A;  1ISN A;  4JE3 B;  2BYV E;  4W9K A;  2NBW B;  3H6N A;  4LNF A;  2ONQ A;  3ZUN A;  5AUI A;  1D5X C;  3RI7 C;  1VCB A;  1D3Z A;  3CMM B;  4QAY A;  1TZO A;  2YLM A;  2RDG A;  4YXD B;  4WJN A;  1UZX B;  1I4R A;  1SJE D;  4ICU A;  2N9E B;  3JYU A;  2INP E;  2R61 A;  3A1Q A;  5L95 C;  2V3P A;  1F2R C;  2HE7 A;  4J6I A;  1TBE A;  4H2A A;  3ZGZ A;  2DWQ A;  4BKS A;  3ZJT A;  2M1M A;  5LXH A;  2BT6 A;  3V05 A;  4MGI E;  1SE3 A;  5FK9 C;  4L23 A;  2WXL A;  1V49 A;  3ZNI D;  4RF1 A;  2D3A A;  5E6J A;  2NPT A;  4YTP B;  4CHK A;  2M19 A;  3PRP B;  4RF0 A;  3MP9 A;  1PQS A;  2ZVN A;  4XX5 A;  2WDV B;  4HKZ E;  3ECI A;  1DGJ A;  1TS5 A;  3MJ5 A;  2UU7 A;  3IT4 B;  4W9C A;  1UNS A;  2MJ3 A;  2RR9 A;  2FE8 A;  1XO3 A;  4KGS A;  2LXC A;  2AQ3 B;  3OLM D;  2DHZ A;  4RFB A;  2GI9 A;  3Q8A A;  1JWU D;  2N9K A;  4WJO A;  5D3I B;  4S0R A;  2LUM A;  4N59 A;  3MJW A;  3CST A;  2BYF A;  4FBJ B;  5C23 A;  4EEW A;  3SFE B;  4DQO C;  1D4B A;  2WX0 A;  2OOB B;  3IAM 1;  3X23 A;  1B9R A;  3BK2 A;  4OVZ A;  4DK5 A;  1EF1 A;  2IY0 B;  4GDK A;  3R3M A;  4WJP A;  2PVG C;  5EE1 A;  2ZPN A;  2BS3 B;  3A1Q B;  2KTR B;  4ARI A;  4HEA 1;  4E3C A;  1FXA A;  1AW7 A;  3EGR A;  4NQL B;  1WWT A;  1KFY B;  2EKI A;  4M00 A;  5LXI B;  2WWZ A;  3M63 B;  4YSX B;  1HZ6 A;  3DVG Y;  2KKC A;  4F1S A;  4MJS B;  1WX9 A;  4LNI A;  1FPY A;  1L2N A;  1N61 A;  3IXS A;  2KFK A;  4ZYS A;  2K9X A;  4P1B C;  3TEZ A;  5MPO A;  2KN5 A;  3ZJV A;  3AU5 A;  2M8S A;  3AE3 B;  4HPL B;  2LD9 A;  3AXC A;  4KKJ A;  4TQ1 A;  4GMV A;  1TT5 B;  3Q3J A;  1EF5 A;  1WXQ A;  3U2S C;  4BKG A;  3T3N A;  1OFF A;  1WGR A;  3TL5 A;  4CQN A;  3R2T A;  4MSQ B;  1VZ6 A;  4BBN F;  3Q6B A;  2V3N A;  4ZRK A;  2XN9 C;  5G5H A;  1ET6 A;  4HK2 A;  1BUI C;  4JQW C;  3CSF A;  1QT9 A;  2LHE A;  2PE6 B;  3TSS A;  4K7W A;  4AP4 C;  4TMA B;  1NEK B;  3AE5 B;  2XEW A;  1GUA B;  2I1J A;  1NBF C;  2J0M A;  5JH5 C;  4GIV A;  3PLV A;  1WE7 A;  1QZE A;  1E8Z A;  3RNF C;  3N1X C;  3WAL A;  2JZZ A;  2IZV B;  4CO7 A;  2J42 A;  1NDD A;  4G11 A;  3V60 A;  3VR8 B;  3NZ3 A;  3R8B A;  3MC8 A;  2A5U A;  2CS4 A;  3IHP C;  2NMQ A;  2L76 A;  5CTR C;  3JSV B;  4FLH A;  2WLB A;  1WGK A;  2MCN B;  4LNN A;  1MFW A;  5C2T B;  1WRI A;  2WU5 B;  5D6J B;  3VUW A;  1ENF A;  5T8I A;  4ANU A;  1JWM D;  4L1B A;  4DBG A;  4PS3 A;  1S3S G;  2L00 B;  4AS1 A;  3WAN A;  3MTN B;  5I4D A;  4ZDV A;  3W9C B;  5AEK B;  4A90 A;  3WA0 A;  2WDQ B;  1E0Z A;  3ZXV A;  1MHX A;  1SXT A;  3ZVV A;  2D07 B;  4P7I A;  2XNA C;  1IGD A;  2QEJ C;  4OZB A;  3B08 A;  1WJN A;  1DOY A;  1YQ3 B;  3SEB A;  3N3K B;  4A9A A;  2X8X X;  2HTM E;  3A33 B;  2CU3 A;  1J7C A;  3APC A;  2N9P C;  2MH7 A;  2QIL A;  2PIA A;  4GXB A;  4MH0 E;  4GDL A;  4OHJ A;  4KGT A;  2KDE B;  5GXG B;  3D32 A;  1V9J A;  1RRB A;  5LLI A;  4IM2 A;  3SFD B;  2DZJ A;  3ZJU A;  4FA6 A;  2K39 A;  1E8W A;  1L0Y B;  1AYF A;  4P16 A;  2K22 A;  1GNU A;  3ONS A;  3AE8 B;  2WXQ A;  4FHJ A;  4HDO A;  2I38 A;  4N6E B;  3P63 A;  2XK5 A;  2AWT A;  4M02 A;  1WJ4 A;  3W2D A;  4C7Z A;  4X57 B;  4RNA A;  3AMZ A;  5KHQ A;  2MEK A;  2NR2 A;  2JRH A;  3HRD D;  3L10 B;  4XDC A;  2G9H D;  1TS4 A;  1T0R C;  3U52 E;  1ZUD 2;  3ZNH B;  4XDD A;  2FID A;  4NY0 A;  3L0W B;  3L08 A;  2V4I B;  1V5O A;  4BAX A;  2LXA A;  2KWC A;  2KVZ A;  1TKG A;  1J8C A;  1Q5W B;  2CKH B;  4NJC A;  4A3P A;  2L32 A;  2BTE A;  2KX0 A;  1DYQ A;  3ZQ4 A;  1V5T A;  1E7U A;  2TSS A;  2INN E;  2K0P A;  2Z59 B;  1EO6 A;  3PO0 A;  1FCL A;  1N62 A;  2KQ4 X;  2RDH A;  2KDF B;  2GBK A;  4ZYN A;  4HRS A;  4B9K A;  1I4H A;  1UH6 A;  4EOY A;  4MH8 A;  2ZCC A;  4KGR A;  4YSY B;  1X1M A;  1N6Z A;  2KZR A;  3MHZ A;  1V1P A;  4N9F 4;  3DBH B;  3DBS A;  3AN1 A;  1FEH A;  2NVU I;  4GDK B;  3ALB A;  4GLS C;  2IPK D;  5HHD G;  2LFI A;  4IG7 B;  4M0W B;  2MA9 B;  2HDE A;  2ZZP B;  4KIK A;  1MI0 A;  1T3Q A;  1R4N I;  1XCQ L;  5AZG A;  3AEF B;  4II2 B;  3NVW A;  1WM3 A;  1I4Q A;  4RMA A;  2MBQ A;  4C80 A;  2Y3A A;  2JU6 X;  1TJE A;  2PE9 A;  3H7S A;  3W1Y A;  2J0K A;  1TYG B;  2WNM A;  1V97 A;  1CZP A;  3R7R A;  3DCG A;  1XCT L;  5IN7 A;  4KSL C;  2V3S A;  2ZPY A;  2HTH A;  3W5V B;  5AZF A;  3ZYY X;  3DHH C;  4ZOH C;  2M4N A;  5BMI A;  2RSU A;  4EUT A;  1XF5 L;  1HZ5 A;  4DDG D;  4II3 B;  1P1A A;  4LK0 M;  1C4C A;  4HWI B;  1HXY D;  3QC8 B;  2WXM A;  2W3S A;  1V81 A;  4LNO A;  1TS3 A;  3QCA A;  2FCQ A;  1R4M I;  1C9F A;  1CMX B;  1H4R A;  2FUG 1;  4MJS A;  4A55 A;  2ZW0 A;  2Q5W D;  1YMH E;  3RMK C;  2DZM A;  1E90 A;  1E8Y A;  2JT4 B;  1DOX A;  1E9M A;  3TUO A;  3PV1 A;  2LGY A;  2WS3 B;  3IVF A;  3KWV A;  2KO3 A;  2BVC A;  2OJW A;  3AE4 B;  3WIM A;  1XD3 B;  4M8M A;  4K3C A;  1P98 A;  1GJZ A;  4WJQ A;  2WXI A;  3QQ8 B;  5J2R A;  2AX5 A;  3AM9 A;  1QLB B;  5G5G A;  1FRR A;  1H8C A;  1FM0 D;  3C19 A;  3Q69 A;  2MBB B;  1V8C A;  2KJR A;  3RCZ A;  1YQB A;  1L7Y A;  2J52 A;  3PT2 B;  1KRH A;  2YEP F;  5EE0 A;  5JHA A;  2I1K A;  1XLQ A;  5E6N A;  1I4P A;  5J17 A;  2J53 A;  4HKQ A;  2XK5 B;  5BO4 B;  4IWP A;  3M3J A;  4K3B A;  2NTS A;  4YSZ B;  2JF5 A;  2W3R A;  1QQR A;  3Q2A C;  3PVL A;  2MP2 A;  3GS2 A;  2UYZ B;  4NZL B;  2PJH A;  1SF0 A;  3QHT A;  4BKT A;  2V1Y A;  4EZL A;  3VTU A;  4JWU C;  2NBV B;  2WP9 B;  2J4X A;  1L4Z B;  4XYC A;  3R2I A;  2VRR B;  2DBY A;  3VH3 B;  2REX A;  1T6B X;  2KNB A;  4IWQ A;  4PYZ A;  2LVQ A;  3RNB C;  3KYC D;  3VXW A;  4AWJ A;  3HIZ A;  3QA8 A;  3ENE A;  3EFC A;  5AZH A;  1ZP0 B;  4TUU A;  3TJP A;  4MGK E;  1RWS A;  4IM3 A;  3ZDT A;  2K8H A;  2H88 B;  2HJ1 A;  3EA6 A;  1UWM A;  4OVU A;  3ETR A;  3NS1 A;  1WM2 A;  5HKH A;  1F1H A;  4OW0 A;  1ESF A;  4FUL A;  3PLU A;  1NYR A;  4UDU C;  4MT5 A;  3DBR B;  1V80 A;  1WGH A;  2O6V A;  4TSS A;  2LZ6 A;  4DHJ B;  4IDI A;  2WHI A;  4WWN A;  4GDL B;  3V6C B;  2IO3 B;  4KDL B;  2WDT B;  3JW0 X;  5IP4 D;  3N9Y C;  2JYE A;  1PGA A;  2KT7 A;  5D2M B;  2IND C;  2KWD A;  3Q8C A;  1GG3 A;  1KM7 A;  1T0S C;  2X38 A;  3BYY B;  5H8Y E;  4BFR A;  3L13 A;  3BVZ A;  2WGS A;  3VUY A;  3EHV A;  5CHF A;  2KD0 A;  4GSW A;  4WUR A;  5DPR A;  2EKE C;  3KQ4 A;  2N1V A;  3NVY A;  4ICV A;  1WI0 A;  3DBL I;  5BYQ A;  2C9W B;  3HHM A;  1K51 A;  4FJV B;  1OQY A;  2N7J A;  3AE6 B;  3L4P A;  4DWF A;  1ZDX A;  1T5X D;  1LQB A;  4RGM A;  1NYQ A;  2LGD A;  3OJ4 B;  1DOI A;  4NJ6 A;  3KVF B;  2QCZ A;  3HK0 A;  3VDZ A;  2AL6 A;  3BYT B;  3EC8 A;  4FJZ A;  3DDC B;  1JRO A;  3FKY A;  4MAC A;  3ZLZ A;  2KQ7 A;  2N9X A;  1E10 A;  2VH1 A;  3NS8 A;  1Q10 A;  2KWU B;  3KLS X;  4HPP A;  3AE2 B;  1ZXH A;  1WR1 A;  2MJE A;  4MEM A;  4W9F A;  1YN5 A;  4OVV A;  5IA7 A;  2MBE A;  3ZDM C;  2FIF A;  1IBX A;  1EM7 A;  2DZI A;  2IO0 B;  4RM9 A;  4W9E A;  3PS6 A;  3R66 C;  5BYS A;  3Q3N C;  2MRP A;  3BK1 A;  2N7D A;  2SAK A;  4OZA A;  1WR6 E;  3RUL A;  3W5U B;  1XQQ A;  1TZ1 A;  1P7E A;  3PZ8 A;  2C60 A;  3E9S A;  3NOB A;  3AB5 A;  1PGB A;  3MHS D;  1YJI A;  3DVG X;  4LTU A;  1KOT A;  1ZGU B;  3A4R A;  2D3B A;  4WAF A;  2KMA A;  1MPE A;  1XEE A;  4WWM A;  3M95 A;  4KIK B;  2KC1 A;  4C4V B;  4WH4 A;  3ZTD A;  2O2V B;  1ZXI A;  1C1Y B;  3IFW B;  3AED B;  1WGD A;  2MQJ A;  3BVM A;  2C7H A;  3U7D A;  2KVR A;  1ZKH A;  1OEY A;  4XWT A;  4I6L B;  2CJO A;  2IJ0 A;  1A70 A;  1ZDV A;  4JPS A;  5DPS A;  1N5W A;  2JUO A;  1HE8 A;  3NY5 A;  1YIW A;  1F0Z A;  1YNT E;  3Q3M C;  1FCC C;  4IWO A;  4FHK A;  2BB5 A;  2PKO A;  1FRD A;  4HDQ A;  1YX6 B;  2KHW B;  3N32 A;  3RNC C;  1WRD B;  2DYO A;  3B2F A;  1WMH A;  3AE1 B;  1WGG A;  1C76 A;  1TIF A;  2KFJ A;  3APF A;  1ROE A;  1PGX A;  3FIL A;  2KFK B;  4I6N B;  2KQS A;  3VTV A;  2WXF A;  4ZHO A;  5D7G A;  3QIJ A;  3PSE B;  2CU1 A;  1JWB D;  2PLP A;  3RNG C;  3DBL B;  2WQY B;  1MJD A;  3RD2 A;  4RGN A;  2D3C A;  1HTQ A;  3HM6 X;  2IGH A;  1JCK B;  2Z0E B;  5IAA C;  2JRI B;  2WDR B;  2K5P A;  3DBR I;  3AE7 B;  3NJT A;  3BIN A;  2AYO B;  5TR5 A;  3IG3 A;  4A6Q A;  4HLE A;  1FD6 A;  3V61 A;  3PRM B;  3T8M A;  4YTM B;  1XLP A;  2QC8 A;  4J3O D;  3RNA C;  2JVC A;  3V62 A;  4B0E A;  3GE8 C;  1UF0 A;  3CF6 E;  2KMM A;  5KHO A;  3NRZ A;  2MX2 A;  2DAJ A;  3KUD B;  4KDI C;  1MG8 A;  4C56 C;  4JWS C;  2KDB A;  2ASQ A;  3I57 A;  5HI1 A;  3P4Q B;  1FXT B;  2V4L A;  4M01 A;  1YX5 B;  3RFZ B;  3AUL A;  1WSP A;  2FCM A;  3DVN U;  2LGX A;  4BOS C;  1HTO A;  1V2Y A;  2MWS B;  2QIE B;  1SE9 A;  5H92 C;  2C7N B;  4K7U A;  3A9K A;  2MP2 B;  3ZXR A;  4RH6 A;  2GOW A;  4S17 A;  3ML9 A;  4KZC A;  3WCQ A;  2BS4 B;  2K6D B;  1EWC A;  4ZRJ A;  1B1Z A;  2KLC A;  2LJI A;  3UIO B;  4DXG A;  3P2B A;  1CJE A;  4LDT B;  1JML A;  1FIQ A;  2L1A A;  2O6V B;  3Q8E A;  1R7S A;  1AN8 A;  1QIL A;  2G4S A;  3U4E G;  4IC7 B;  3GE3 C;  2KOX A;  3W1S C;  4K81 A;  4G3X B;  1FFV A;  4PS7 A;  1L4D B;  2Z0D B;  1G6J A;  1FNU A;  1OQR A;  1OEY J;  3URY A;  2K8C A;  3PHW B;  2EMT A;  3O13 A;  4WWP A;  1UBQ A;  2N0S B;  1ZOY B;  2L0T A;  3GP7 A;  4P1C C;  2DYM A;  3AEG B;  1Y8R C;  2SEB D;  3DWM A;  1WF9 A;  1XLN A;  2MBO A;  4TV3 A;  4MM3 A;  1GOZ A;  2L05 A;  3GOE A;  4B6W A;  3BVG A;  4WQM A;  2RGF A;  1YJJ A;  2LWP A;  1LGR A;  2LRW A;  3OG5 A;  4EKU A;  4EZK A;  2QJL A;  3P1M A;  3PZ7 A;  3UI3 A;  5TSS A;  3HVD A;  2NS5 A;  4GN1 A;  1FO4 A;  5J18 A;  1KF6 B;  1S1Q B;  4AJW A;  3T3O A;  2IBI B;  3JSV A;  4ZRI A;  3X0W A;  5FR6 A;  3NHE B;  1A5R A;  3KWL A;  4BBN C;  1YD8 U;  2LUE A;  1OTR B;  2K6Q A;  2WXO A;  1IYF A;  2G4D B;  4AOF A;  3ZRF A;  3SU8 X;  3LYY A;  2D11 A;  3A9J B;  1QOA A;  4ZRQ A;  1V6E A;  1E6E B;  2C5L C;  2D10 A;  3LXF A;  4ANW A;  1JWA D;  2KJ6 A;  3SHQ A;  2FCS A;  2M56 B;  5IKC M;  2EMS A;  2OED A;  4ASW C;  5BMH A;  3P4P B;  5C1Z A;  4US8 A;  3TMP B;  2ZJD A;  3K9P B;  3ZNG C;  2VH2 A;  3FIL B;  3UIP B;  3QAQ A;  2LHD A;  2GBJ A;  2GBM A;  4BZA A;  3ZIM A;  3SDL C;  2W55 A;  1VRA B;  4XE0 A;  2CHW A;  3PRZ A;  3N1Z C;  4P6V F;  3LB8 C;  3VAW A;  4JIO U;  2DX5 B;  2ICI A;  1TTN A;  2AEH A;  3DOW A;  1R4M B;  4IOI E;  1FNW A;  3V6E B;  5JXV A;  1XT9 B;  1WMH B;  1D5M C;  4W9D A;  1L5P A;  3Q14 C;  2VZK B;  4IKG A;  2MJD A;  4HXD A;  1VR9 A;  1VZ8 A;  4A8X C;  1N5X A;  4JLC A;  4E74 A;  3B2G A;  1YOV B;  1TKY A;  4MGY E;  1CQV A;  2BYE A;  2JX5 A;  1T0Y A;  4HVB A;  4PT5 A;  1GC6 A;  3N1Y C;  3Q3F A;  2GMI C;  3AV8 A;  4G0N B;  1RAX A;  1UUP A;  2K1F A;  3PRE A;  1N60 A;  2V9H A;  3I5J C;  2BF8 B;  1E8X A;  3B9J A;  1PUT A;  1Z2M A;  3C8Y A;  1PFD A;  3ABV B;  1SEB D;  2LI5 A;  1RFA A;  1JRP A;  2PPH A;  2MSE D;  5FKA C;  2W82 A;  2WU2 B;  4PYU A;  1N63 A;  4M0W A;  3RZW C;  2KN4 A;  4XGA B;  2KJH B;  1JW9 D;  4PS8 A;  3WAM A;  4DHZ E;  2KAC A;  1WXA A;  2CHX A;  5G2N A;  2K8B A;  1KJT A;  1FNV A;  2GBN A;  2DYB A;  3R7Q A;  4GGQ A;  3QAR A;  1E7V A;  1IP9 A;  3EFU A;  3E56 A;  2NPT B; 
#chains in the Genus database with same CATH homology
 2ACZ B;  1P7E A;  3PZ8 A;  4USA A;  1QKZ A;  3E9S A;  3W2D A;  3AB5 A;  4C7Z A;  1PGB A;  2KDM A;  2YEP B;  4RNA A;  3AMZ A;  5EE9 A;  1NVI D;  1YJI A;  1SBB B;  2MEK A;  5D3D A;  1SB3 C;  4LTU A;  1GB4 A;  1PDX A;  3HRD D;  4XDC A;  2G9H D;  4WAF A;  1TS4 A;  2WXK A;  3AEE B;  3TEY A;  3U52 E;  1MPE A;  3H8H A;  1V1O A;  3DWG C;  1XEE A;  1ZUD 2;  4YTN B;  1YN3 A;  4WWM A;  4XDD A;  1ACC A;  1RM6 C;  2JZP A;  3GB1 A;  4ZRP A;  4WH4 A;  1K53 A;  1KH0 A;  3AEC B;  2V4I B;  2JXT A;  1IGC A;  2L83 A;  3BZD B;  1D6E C;  1QF6 A;  1ZXI A;  1C4A A;  3AED B;  1HEZ E;  2QMT A;  1TKG A;  3BVM A;  3VRB B;  4YWG G;  4XWT A;  2CJO A;  2IJ0 A;  1A70 A;  1GAQ B;  1KTK A;  1ZDV A;  4JPS A;  1OQQ A;  4NJC A;  2L32 A;  2BTE A;  2CJN A;  1N5W A;  3Q8B A;  5LNK 1;  1DYQ A;  3ZQ4 A;  2IDY A;  3VRA B;  2TSS A;  2BW2 A;  2INN E;  2K0P A;  3PO0 A;  1FCL A;  1F0Z A;  1N62 A;  1RYJ A;  3AE9 B;  1YNT E;  1FCC C;  2EEL A;  2KQ4 X;  2L52 A;  2Y5P A;  4YT0 B;  3FC4 A;  2BB5 A;  2PKO A;  2RDH A;  3BWU D;  1FRD A;  1C78 A;  1K50 A;  1VLB A;  1F2R I;  4EE2 A;  1JAL A;  1BXT A;  4HRS A;  2DYO A;  1VDV A;  4KX6 B;  5BMG A;  3B2F A;  2RPV A;  4FXC A;  4REZ A;  3AE1 B;  1I4H A;  1KLU D;  1C76 A;  4MH8 A;  1UWX A;  4KGR A;  4YSY B;  1ROE A;  1PGX A;  4OZC A;  3RPF C;  1SIJ A;  3MHZ A;  2WXG A;  1V1P A;  3FIL A;  3U7Z A;  1RFK A;  1AWD A;  4NAW B;  3MFG A;  2WXP A;  2WXF A;  3AN1 A;  4ZHO A;  1TY0 A;  1FEH A;  3AEB B;  5D7G A;  2ON8 A;  4GDK B;  4MM3 B;  1SSN A;  1JWB D;  2G1E A;  2PLP A;  3NUH B;  1XLO A;  1YN4 A;  2H89 B;  1IBX B;  2LGI A;  2IPK D;  4GLS C;  5HHD G;  2LFI A;  3TEW A;  3CIR B;  3AH7 A;  2HDE A;  2N9L A;  2WQY B;  1HQR D;  1MI0 A;  1T3Q A;  1XCQ L;  2KAJ A;  4ARC A;  4RGN A;  2E6X A;  3AEF B;  2IGH A;  1I4G A;  1EU4 A;  1JCK B;  3NVW A;  1KLG D;  1I4Q A;  2WDR B;  2K5P A;  1P7F A;  2WXR A;  3AE7 B;  1VZ7 A;  2M0A A;  4A6Q A;  4C80 A;  2Y3A A;  2JU6 X;  1FD6 A;  1TJE A;  4YTM B;  1JQ4 A;  1ZE3 D;  1XLP A;  4J3O D;  1TYG B;  4AQ7 A;  1F77 A;  2WNM A;  1XXG A;  1C77 A;  3FAH A;  4RGT A;  4B0E A;  1PYW D;  1I4X A;  1V97 A;  1CZP A;  2D5G A;  2KMM A;  1TKE A;  2WXJ A;  1QOB A;  3NRZ A;  2QSD A;  4JE3 B;  1XCT L;  4O1N A;  2ONQ A;  4C56 C;  4JWS C;  1TS2 A;  3I57 A;  5HI1 A;  5AUI A;  3P4Q B;  1D5X C;  1EWY C;  3W5V B;  1TZO A;  3ZYY X;  1IUE A;  4ZOH C;  5BMI A;  2RDG A;  4YXD B;  3RFZ B;  1I4R A;  1SJE D;  1XF5 L;  1HZ5 A;  5FR3 A;  1WSP A;  2INP E;  1C4P A;  2R61 A;  2JWU A;  3MC0 B;  2V3P A;  4LK0 M;  1F2R C;  1C4C A;  3ZGZ A;  4H2A A;  1HXY D;  1SE4 A;  4ITK A;  2WXM A;  2DWQ A;  3NVZ A;  3ZJT A;  1MHH E;  2W3S A;  2QIE B;  5H92 C;  3IT6 B;  1TS3 A;  2BT6 A;  2I2Y A;  3V05 A;  4B0M A;  2Z8L A;  4RH6 A;  2W54 A;  4HJG E;  1SE3 A;  5FK9 C;  3P42 A;  4L23 A;  2WXL A;  3WCQ A;  1C9F A;  2FUG 1;  4RF1 A;  2BS4 B;  4A55 A;  1EWC A;  2ZW0 A;  5E6J A;  5EE3 A;  2Q5W D;  4YTP B;  1YMH E;  1LO5 D;  2M19 A;  4RF0 A;  1B1Z A;  3MP9 A;  2BB6 A;  2LJI A;  4DXG A;  2WDV B;  1CJE A;  1JML A;  4HKZ E;  1DGJ A;  1FIQ A;  2L1A A;  1DOX A;  1TS5 A;  3MJ5 A;  3SR6 A;  1E9M A;  3IT4 B;  3Q8E A;  1R7S A;  3TUO A;  1ZPS A;  1UNS A;  1AN8 A;  1QOG A;  2MJ3 A;  1QIL A;  2FE8 A;  2WS3 B;  3OWE B;  4RGO S;  3I9V 1;  1V1P B;  3KWV A;  3U4E G;  1XO3 A;  4KGS A;  3AE4 B;  2AQ3 B;  5HG2 A;  2K3U A;  3P4S B;  1L0V B;  1FFV A;  2PMV A;  3NVV A;  2GRI A;  4R3D A;  3AEA B;  4RFB A;  1L4D B;  2GI9 A;  3Q8A A;  1FNU A;  1JWU D;  2N9K A;  4D2K A;  2WXI A;  1OQR A;  3URY A;  2AX5 A;  3AM9 A;  2AQ1 B;  5D3I B;  1QLB B;  3O13 A;  1FRR A;  5G5G A;  1FM0 D;  2LUM A;  2N0S B;  4N59 A;  3Q69 A;  1ZOY B;  2E3T A;  4TQ0 A;  1V8C A;  2OHF A;  3GP7 A;  3SFE B;  2DYM A;  4DQO C;  3AEG B;  1D4B A;  2LMC A;  3IAM 1;  2J52 A;  2JYT A;  1KRH A;  2SEB D;  3DWM A;  2YEP F;  1B9R A;  3BK2 A;  4OVZ A;  5EE0 A;  2BYT A;  1FFU A;  1XLN A;  1XLQ A;  1GOZ A;  1I4P A;  2PVG C;  2J53 A;  5EE1 A;  4HKQ A;  5C3J B;  2BS3 B;  3BVG A;  4WQM A;  1K52 A;  4XWW A;  1YJJ A;  2NTS A;  4YSZ B;  4ARI A;  2ZW1 A;  5HFY A;  3IAS 1;  2AQ2 B;  2W3R A;  4HEA 1;  1FXA A;  1QQR A;  1AW7 A;  3EGR A;  1WWT A;  1KFY B;  1EU3 A;  1SJH D;  2EKI A;  2QJL A;  3P1M A;  3PZ7 A;  3UI3 A;  1TY2 A;  1YQ4 B;  3GS2 A;  4NZL B;  3HVD A;  5TSS A;  3VR9 B;  1SF0 A;  1FO4 A;  1KF6 B;  4YSX B;  1HZ6 A;  1JWS D;  3T3O A;  1I7H A;  1C79 A;  4JWU C;  1N61 A;  2WP9 B;  2J4X A;  1L4Z B;  1STE A;  2VZK D;  3IXS A;  3R2I A;  4ZYS A;  2DBY A;  2K9X A;  3TEZ A;  5MPO A;  3KWL A;  3ZJV A;  3HUI A;  1T6B X;  3AE3 B;  4ZHP A;  4KKJ A;  4TQ1 A;  2WXO A;  1WXQ A;  3U2S C;  3T3N A;  1OFF A;  3LYY A;  2FBW B;  1J7A A;  1ZP0 B;  4CQN A;  3R2T A;  1RWS A;  1VZ6 A;  2PVO D;  2V3N A;  2XN9 C;  5G5H A;  1QOA A;  1ET6 A;  2H88 B;  4ZRQ A;  3EA6 A;  1UWM A;  1E6E B;  3ETR A;  1FXI A;  2PW9 A;  1BUI C;  3NS1 A;  5BYR A;  1VJK A;  3LXF A;  4HRO A;  1ESF A;  4OW0 A;  1UGJ A;  1NYR A;  1JWA D;  4UDU C;  1L0X B;  4MT5 A;  1QT9 A;  2LHE A;  2M56 B;  2WXH A;  1GB1 A;  4N58 A;  1NI3 A;  3TSS A;  3BII D;  2OED A;  5BMH A;  4TSS A;  4KKI A;  4TMA B;  1NEK B;  3AE5 B;  3P4P B;  2PTL A;  1GPX A;  4IDI A;  1CK1 A;  4US8 A;  1HA5 A;  1NEN B;  4GDL B;  4RCO A;  4LLG M;  2JSV X;  3FIL B;  2LHD A;  2DLB A;  3Q8F A;  3N9Y C;  5AUK A;  2JYE A;  1PGA A;  2KWD A;  3Q8C A;  2W55 A;  1VRA B;  2J42 A;  4NAM A;  4XE0 A;  2X38 A;  3VR8 B;  3BYY B;  3NZ3 A;  4P6V F;  3R8B A;  5H8Y E;  3LB8 C;  2ICI A;  1SE2 A;  4JX1 C;  3BVZ A;  2NMQ A;  1MVK A;  2IGG A;  2GB1 A;  3J9C A;  3P4R B;  1D5Z C;  4IOI E;  4WUR A;  1FNW A;  3KQ4 A;  3V3X A;  5JXV A;  3NVY A;  2WLB A;  1WGK A;  1D5M C;  5BYQ A;  5C2T B;  1WRI A;  1L5P A;  2LEK A;  2WU5 B;  1J7B A;  1ENF A;  2VZK B;  4IKG A;  1K51 A;  2MJD A;  1E7P B;  5T8I A;  2N7J A;  3AE6 B;  4C7Y A;  3L4P A;  1VR9 A;  1JWM D;  4L1B A;  1VZ8 A;  1ZDX A;  1T5X D;  4A8X C;  4RGM A;  1N5X A;  3EUB 2;  1NYQ A;  3B2G A;  4AS1 A;  1TKY A;  1DOI A;  1CQV A;  5I4D A;  1QOF A;  1M4V A;  1WYG A;  2JX5 A;  2BBC A;  1L6V A;  3BYT B;  3W9C B;  4PT5 A;  4A90 A;  2WDQ B;  1E0Z A;  1JRO A;  1MHX A;  1SXT A;  4MAC A;  1E10 A;  1L6U A;  3AV8 A;  2B76 B;  1UUP A;  2XNA C;  1IGD A;  2QEJ C;  2WXN A;  4OZB A;  1Q10 A;  1DOY A;  2IGD A;  1YQ3 B;  3SEB A;  3KLS X;  3W1S A;  1N60 A;  3TEX A;  2BS2 B;  3AE2 B;  2JQR B;  4A9A A;  2HTM E;  1ZXH A;  2CU3 A;  2MJE A;  1J7C A;  4DXF A;  3B9J A;  2MH7 A;  2QIL A;  2PIA A;  1YN5 A;  1PUT A;  2V0G A;  2Y5C A;  3HVZ A;  3C8Y A;  1PFD A;  2NTT A;  1SEB D;  3ABV B;  1FMA D;  4OHJ A;  1IBX A;  4KGT A;  1JRP A;  1EM7 A;  4Q2J A;  5FKA C;  5GXG B;  2W82 A;  3VQI A;  2WU2 B;  1N63 A;  4M0W A;  1ET9 A;  3SFD B;  3ZJU A;  2KN4 A;  1BML C;  4L2Y A;  1JW9 D;  5BYS A;  2RMM A;  2KAC A;  4WIP A;  4US9 A;  1FNV A;  1L0Y B;  1AYF A;  3BK1 A;  4P16 A;  2K22 A;  3AE8 B;  2SAK A;  3CWI A;  1Y56 A;  2WXQ A;  4OZA A;  2I38 A;  4N6E B;  3W5U B;  3E56 A;  3P63 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...