5GXGB

High-resolution crystal structure of the electron transfer complex of cytochrome p450cam with putidaredoxin
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
106
structure length
106
Chain Sequence
SKVVYVSHDGTRRELDVADGVSLMQAAVSNGIYDIVGDCGGSASCATCHVYVNEAFTDKVPAANEREIGMLECVTAELKPNSRLCCQIIMTPELDGIVVDVPDRQW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Camphor 5-monooxygenase
publication title Identification of productive and futile encounters in an electron transfer protein complex
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase/electron transport
total genus 31
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2016-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5gxgB00
5EE1A 3AB5A 5EE0A 5MPOA 1YQ3B 1F0ZA 1FXIA 3AE7B 5G5HA 1OQQA 1TKGA 1QOGA 1TJEA 4N59A 3AE9B 3SR6A 4YXDB 1E0ZA 1FRDA 4A9AA 2H88B 1JW9D 4YSXB 1XLQA 2L52A 1NI3A 3VR9B 1WWTA 3EUB2 2AX5A 2CJOA 4JWUC 4IDIA 1XLPA 1FFVA 1J7AA 1DGJA 1L5PA 1L6UA 3B9JA 1NVID 1PUTA 2K5PA 3AEAB 1GAQB 4C7YA 2MH7A 2PVOD 3NVZA 3SFEB 3P1MA 4ZHOA 1SIJA 3LB8C 3W5VB 3P4PB 1KRHA 3AE1B 1FM0D 1A70A 1V8CA 3AEEB 3NS1A 4HROA 3DWMA 1E7PB 2L83A 3AECB 2K9XA 5EE3A 1T3QA 3AN1A 3SFDB 1B9RA 1CJEA 1N62A 1IUEA 1QT9A 4US8A 1FO4A 2DBYA 1E6EB 3L4PA 3WCQA 2N0SB 2WQYB 2ACZB 3AEBB 2M56B 3P4SB 5AUKA 1SB3C 2W54A 1PDXA 2PVGC 2WDRB 3AEDB 1DOIA 2W3RA 1FXAA 2MJDA 4C7ZA 3W5UB 2FBWB 1OFFA 4ITKA 1TKYA 5C2TB 1AYFA 2WS3B 1N63A 2PKOA 2H89B 1YQ4B 5GXGB 3FC4A 1L6VA 2B76B 3LXFA 1R7SA 3ZYYX 1CZPA 1JRPA 3NVWA 2WLBA 1RYJA 4ZHPA 1WXQA 2Y5CA 3DWGC 1KFYB 3B2GA 1AWDA 2BS3B 5AUIA 2CJNA 1N5WA 3B2FA 3AE4B 2MJEA 4HRSA 5H92C 4YTMB 3BIID 3AV8A 1DOYA 2PIAA 3AE8B 4YSZB 3AEFB 1GPXA 1ROEA 3VRAB 2LEKA 1E10A 1TKEA 1WGKA 1VDVA 4P6VF 3HVZA 1JROA 3P4QB 5C3JB 1DOXA 2WP9B 3P63A 1TYGB 2KMMA 2DWQA 2EKIA 1N5XA 2K22A 2WDQB 1V97A 1QLBB 3AM9A 1RM6C 3AE5B 3NVVA 3P4RB 4YTPB 3CIRB 2HTME 1ZUD2 1EWYC 4N6EB 4YSYB 3FAHA 1JALA 2G1EA 2CU3A 2OHFA 3AE3B 1JWBD 1NEKB 4WWMA 4ZOHC 1UWMA 1FIQA 1N61A 1KF6B 1YJJA 1NYQA 1VJKA 1ZXIA 3NVYA 2W55A 2QIEB 3PO0A 5H8YE 4C80A 1I7HA 1ZP0B 1J7CA 3ABVB 3HRDD 3ETRA 4KX6B 1J7BA 2JX5A 4USAA 1RWSA 1SF0A 2MJ3A 1RFKA 1WYGA 1PFDA 2KAJA 1QOFA 2BS4B 3AE6B 3AEGB 1YJIA 1XO3A 3AE2B 2WU2B 2W3SA 1FRRA 1VLBA 3NRZA 1QOAA 3VR8B 3VRBB 1JQ4A 4US9A 1L0VB 4YT0B 1N60A 3CWIA 1QF6A 2WU5B 3AMZA 3W9CB 3AH7A 4JX1C 1QOBA 5G5GA 4FXCA 2JQRB 1E9MA 2QJLA 1OQRA 3KWLA 4WQMA 4N58A 1FFUA 2BT6A 2WDVB 2M19A 2E3TA 1NENB 2Q5WD 4JWSC 1XLNA 3HUIA 4YTNB 1JWAD 1XLOA 5EE9A 1ZOYB 2BS2B 1NYRA 1FMAD 4LTUA 3RPFC 1WRIA
chains in the Genus database with same CATH superfamily
5EE0A 3AB5A 2NPTB 2K6DB 2DNFA 3A33B 2LGSA 2LWPA 1FRDA 2C7MB 1WZ0A 4MACA 2HJ1A 3DCGA 2BYEA 3VUXA 4O1NA 4MM3A 4IWQA 3JSVA 2KJHB 4KSLC 4MGYE 2L00B 3N1YC 4ZHOA 3NY5A 2LJ5A 3ONSA 1V8CA 2KTRB 1E7PB 2L83A 4BAXA 3MC0B 4DHZE 1NI2A 4ANXA 3U52E 5JHAA 4K3BA 3SD5A 1WX8A 2N7EA 4RGTA 4X57B 1TKYA 2I38A 2AQ2B 4KV2A 4LNIA 5J17A 4LDTB 1RLFA 2V3NA 3L08A 1SIFA 3U30A 3AEFB 5BMIA 1HEZE 5C3JB 3DVGY 2JWZA 4UDUC 2AQ3B 3BY4B 4YWGG 3FAHA 2IO1B 3ZW3A 3UGBB 3NVYA 1VJKA 4XDCA 3UI3A 3W1SA 1VD2A 2ZJDA 2BS4B 2HDEA 3TL5A 3IFWB 3VRBB 4DHJB 3VXWA 4GMVA 2W9NA 3AMZA 4MT5A 4ACFA 1V5OA 3R2TA 4WAAA 4HPLB 1QOBA 2DLBA 4RGOS 1T6BX 4I6LB 3PV1A 1B1ZA 4K7WA 4CHKA 3E9SA 2Z59B 2ZPYA 1Q5WB 2MWSB 1FNWA 2NS5A 4W9HA 1TBEA 3I57A 1IBXB 1YQ3B 2V1YA 2L76A 5D7GA 4N59A 3B1LX 2C7HA 3WAPA 1XLQA 2G4SA 2LGIA 2KO3A 1WGRA 3GE8C 1DGJA 2KACA 1L7YA 3A1QA 1KLUD 4FHKA 4CQNA 3U7DA 3APCA 4KGTA 1E8YA 4P7IA 1ZXHA 3AECB 1B9RA 1QT9A 3ZUNA 1HTOA 3ZQ4A 2O6VA 3AEBB 1SB3C 1MJDA 4MSMB 4NY0A 1BMLC 3IXSA 1ISNA 3QC8B 3T3NA 3H9DA 1UH6A 4WJQA 4GDLB 1N5WA 5FR3A 5H92C 2I1JA 1NDDA 4W9FA 2ASQA 1SGHA 2D5GA 2JF5A 2KXJA 3NVVA 1AARA 2KJ6A 3CIRB 1HA5A 4ANVA 4JGHB 4W9LA 4M00A 4TSSA 1MI0A 4EZJA 5G2NA 2QEJC 2WXNA 3PREA 4L1BA 1VRAB 4FULA 2NVUI 3PVLA 1SJED 1C1YB 4EE2A 1IGDA 4ZHPA 2YLMA 4QAYA 1V2YA 1HZ5A 1JQ4A 2BTEA 2NPTA 4NAWA 3UIPB 1AW7A 3OG5A 2WXOA 2E6XA 2BYTA 2BT6A 3N32A 2AWTA 3GS2A 4OZAA 4MH0E 3AULA 4RMAA 3MC9A 1ZKHA 4GDKB 4J6IA 3WALA 2NCNA 1Q10A 3EFUA 4FJVB 3DVNV 4WIPA 1UGMA 3VH3B 1TIFA 2V9HA 3AEEB 2R2OA 1T3QA 2RR9A 3B08A 4LLGM 3T3OA 4US8A 3NZSA 1XCQL 2I2YA 1WGDA 3IBEA 1BUIC 2D11A 4TUUA 4FN2A 1FXAA 3K9OB 4KKIA 3N1ZC 2A5UA 4IG7B 3R66C 4B0EA 3B2GA 1HE8A 4REZA 3BVMA 2NBVB 3VRAB 3QA8A 2RDHA 3IT4B 5D3DA 2O2VB 2MBOA 2N1WA 2JVCA 4MJSB 5AZHA 1RM6C 2KWUB 2DYBA 3DVNU 4AUQC 2WWZA 4B9KA 2QILA 3PZDA 1RAXA 4E3CA 5IP4D 3DBHB 3QWZB 3WAMA 1WZ3A 4BKSA 1FNUA 3IAS1 1WYGA 2KAJA 4EFOA 2KKCA 3BWUD 2EKEC 3BZDB 1E10A 1XO3A 3IG3A 1QOAA 2IGGA 4PYZA 4B95A 3M95A 2W82A 2GI9A 3VTUA 3RFZB 4JX1C 2IGDA 1WM2A 2GOWA 2JQRB 4G50A 3ZKJC 2M19A 3Q8FA 3PZ7A 3HUIA 2IDYA 4BBNC 2JZZA 2G3QB 3KUDB 5EE9A 3MHZA 3X0WA 2RPVA 2ZVOA 5LLIA 1AN8A 1QOGA 4DDID 3HM3A 1TGZB 2MEKA 1UUPA 2IBIB 5BYQA 1J7AA 2J53A 3MTNB 5FK9C 5J18A 1V1OA 1NVID 1PGAA 4BBNF 3ZXVA 1FXTB 1YX5B 3L54A 3VAWA 4E74A 1H8CA 3I5JC 2CHZA 4HXDA 1EO6A 5DPWA 2KDBA 3VFKA 3WCQA 2OEDA 4HCNB 2X8XX 3BVGA 2LHDA 4NAMA 3X23A 3VTWA 3NJTA 1YJ1A 2GLSA 2WLBA 1KFYB 1UF0A 2WXKA 3RNGC 4HRSA 1DYQA 3BIID 4TMAB 1E8WA 1T0RC 2QSDA 1UGJA 1VDVA 4TQ0A 4LJPB 2LI5A 2PMVA 1Z5SB 1ZW7A 4H2AA 3R7RA 2DWQA 4XC2A 4BKTA 2PE6B 5JH5C 3CF6E 1JALA 2CU3A 2OHFA 3MC8A 3Q3NC 5IO9A 2DYOA 2W55A 2DZMA 2QIEB 1E7UA 3GZNB 3HRDD 3ZDMC 1TY2A 3AE6B 1PFDA 3EC8A 1I35A 1BT0A 4WJOA 3RNAC 1T0YA 4GDKA 3I63C 2D3GA 1E9MA 3PHWB 3TEWA 1SE4A 1MHXA 2BF8B 3RD2A 1SBBB 3U8ZA 4W9JA 2NR2A 3Q3MC 2ZW0A 2HTHA 2G4DB 1TS5A 2ZW1A 4L2YA 5BMHA 1J8CA 3TEZA 1I4GA 2JUOA 3BYTB 2KQ7A 2FUHB 3WANA 1PUTA 1YN3A 5HG2A 4ZRIA 3PZ8A 4XZ4A 1TS2A 3DWMA 2KX3A 4DBGA 1XCTL 3D32A 2UU7A 2ACZB 5TSSA 2M56B 1J19A 1PDXA 4MH8A 1HQRD 4MJSA 4HEA1 1WE7A 3U2SC 2LRUA 1TZ1A 3OJ3A 2KDFB 2NTSA 5DPSA 3R7QA 1F2RI 1WXMA 4NPNA 3P42A 1AWDA 5AUIA 4OHJA 4YTMB 2JSVX 3GZNI 2FIDA 1GPXA 1ROEA 5CHVC 2MCNB 1WRDB 2LVOA 2VRRB 3N3KB 2Z0EB 2KWVB 4BFRA 3PT2B 2GBKA 1UBIA 4PS7A 1YD8U 3M3JA 1I4QA 2LRWA 4KGSA 2GBJA 1ZXIA 1ZDXA 2IO2B 5L83A 1ZP0B 4K1RB 4ARCA 5AZFA 1SF0A 1FRRA 1WXSA 2VZKB 4M01A 1SEBD 1UZXB 2ZCBA 4WJPA 5G5GA 4IWOA 4AJYB 2MBHA 2JRIB 1OQRA 4FLHA 2E3TA 1T0SC 3DHIC 4C4VA 2HE7A 3O13A 4I6NB 1MG4A 2KVRA 4F7ZA 4EUTA 2IY1B 4A8XC 2KDMA 5TR5A 1FXIA 2C60A 2BB5A 2IPKD 2LUEA 4IW0A 2BYVE 3BVZA 1F2RC 5BYRA 2K1FA 4JE3B 5IOIA 3RMKC 4FADA 3TUOA 1WMHB 3JW0X 4IDIA 1LGRA 1U4AA 4M8MA 1WE6A 2SAKA 4A3OA 1KJTA 4G11A 3BINA 4DK5A 3Q3OC 4BKSD 1FCCC 2YEPB 1QILA 2MA9B 5EE3A 2Z0DB 1IUEA 1EM7A 1YMHE 4WWOA 4HDOA 4KIKA 3KH0A 2PEAA 2NMQA 3RYTA 2K6QA 4KVGB 3W5UB 1IYFA 2MBEA 5E6OA 2M0AA 2WDTB 3R3MA 1V6EA 3B2FA 3AE4B 4KDLB 3A9KB 3AV8A 2LVPA 3ZTCA 2DHZA 1M4VA 2G45B 1OEYJ 2K22A 1A5RA 4DXAB 1TZOA 4N6EB 2GRIA 3SU8X 1I4RA 4GN1A 2WXLA 1YJJA 4A6QA 4RGMA 1V81A 1GB4A 3ABVB 2KYWA 2CS4A 3AEGB 2J7QB 2WXMA 3HHMA 4YT0B 2JY6A 2WU5B 2K0PA 1WSPA 1E90A 2QJLA 4N58A 2Q5WD 1XLNA 3V61A 2L05A 1R4MI 2XK5B 4LTUA 2LFIA 2KC2A 2KFKB 1YN5A 5D6JB 4EEWA 1ENFA 4IUMB 1XF5L 3VR9B 1EU4A 3L10B 1YX6B 1L5PA 3ZLZA 2ZCCA 4AJWA 2WX0A 1KTKA 1A70A 3SFDB 1K51A 3GB1A 2DYMA 3C19A 1E6EB 1WJUA 3GE3C 2LHEA 4HLEA 1KLVA 2BQQA 2PVGC 3H7SA 3PSEB 2RSUA 3EGRA 3V62A 3SHQA 1V1PB 4NJCA 4RFBA 3TEXA 1K53A 5JXVA 2BS3B 2WHIA 2MLBA 3RZWC 4OVVA 3QIJA 2LEKA 2M8SA 2DZKA 2JZPA 2N4FA 3DBLB 3Q69A 3ZNID 2K8HA 1CK1A 2RPQA 3ZRFA 3U4EG 1WR1A 2CHWA 3A9JB 4EOYA 3NHEB 4W9GA 3W2DA 5E6PA 1J7CA 2V4LA 3JYUA 4ZRPA 2WU2B 2Y5PA 2KLCA 2AEHA 2LGYA 4JLCA 3RI7C 4ICUA 4NQKE 2YEPF 3WIMA 1EF5A 1QZEA 1WGYA 2PLPA 4HJKA 1WMHA 2KWCA 4FHJA 2KMAA 1NYRA 1FMAD 1XQQA 1P7EA 1MFWA 4WH4A 2L0FA 4OVUA 3V6EB 4ZDVA 2ZZPB 2GB1A 3KYDD 1C3TA 4G3XB 2H88B 4MGKE 3WAOA 2N9LA 1C4AA 3PS6A 2LMCA 2VH2A 4LNNA 1D6EC 1TS4A 4IKGA 2K8BA 2KTRA 1FEHA 3N1XC 4HVBA 1WY8A 3DVGX 2WXQA 3PHXB 4C56C 2W3RA 4IM3A 3Q6BA 2V3SA 3R8BA 1KOTA 3FC4A 1L6VA 5EDSA 1JRPA 3ZXRA 1JRUA 1S1QB 3Q8AA 4F8CB 1FCLA 2MJEA 2IO3B 4GB9A 2AQ1B 2Z8LA 2N9XA 5I4DA 4EZKA 3P2BA 3S2AA 4DHZB 3HVZA 1WXVA 3P4QB 4XYCA 4R3DA 4PK1A 4I6PA 1SSNA 1ZUD2 3ENEA 3A4RA 2MBBB 1PYWD 1N61A 5HKHA 3RNBC 1L4DB 4M02A 1F1HA 2MJ3A 2XK5A 4BKGA 2EMTA 1VLBA 4US9A 1K8RB 1L0VB 3L17A 2FNJB 3ZJVA 4FXCA 2KX0A 4XWWA 1L0XB 2J0KA 1NENB 4ICVA 4W9CA 1JWAD 3RUIB 2D07B 3VVWB 3QQ8B 1V9JA 1GOZA 1WJNA 3GP7A 2ZEQA 1IBXA 2Y5BB 1STEA 1C76A 2L52A 2PTLA 2GBRA 3CMMB 2REXA 4OZBA 2AL6A 4JWUC 2XN9C 5BO4B 2IO0B 3AEAB 1E8ZA 2JT4B 3UQBA 1GB1A 2MH7A 3P1MA 5D3IB 2KZRA 4PYUA 1TS3A 2LD9A 2MQJA 3AU5A 2ZPNA 4FJZA 2KDIA 4HKZE 4N9F4 4P16A 2N1VA 1ZGUB 4NJ7A 4CO7A 2FAZA 1PGBA 3KQ4A 1WJ4A 3HM6X 4J3OD 2B76B 2MRPA 1ACCA 1C79A 1WXQA 3DWGC 1KLGD 1EUVB 3A9JA 2PW9A 1P9DU 3ZTDA 2PJHA 1EWCA 2PIAA 4HK2A 4GDLA 2Y3AA 1JWMD 4C00A 2IYDB 1QF6A 2MSED 3NS8A 5KHQA 2HTME 3DHGC 2NBWB 1V86A 2N7JA 4WWMA 4ZOHC 2WXRA 3DBHI 2MX2A 4DDGD 3HIZA 5G55A 2JX5A 3FILB 1JWSD 1RWSA 1LQBA 1QOFA 3NRZA 1QKZA 1WFYA 1YJIA 4B6WA 2N9PC 2KD0A 3Q8CA 2C9WB 2KOXA 2G9HD 1JWUD 1XLOA 3IT6B 3UF8A 3AXCA 4TV3A 2OJRA 4GXBA 2BKRB 2M0XA 3ZNGC 3MJ5A 2JYTA 4MM3B 1KH0A 4D2KA 2O6VD 5JZEB 3PRPB 2LXAA 3VHTC 2FCNA 2LASA 4XWTA 2RMMA 4IOIE 2L0TA 1P7FA 3NVZA 4II2B 4K7UA 1ESFA 1GNUA 3H7PB 4MDKE 1LM8B 4ARIA 4MGIE 1N62A 1L2NA 4AOFA 4ZYNA 2DBYA 3V60A 2WYQA 3Q8EA 4K7SA 1I4PA 4BZAA 5C2TB 4GIVA 2H89B 4ZRQA 2KNBA 3QCAA 1V49A 1R7SA 3VTVA 1RFAA 2GMIC 4GU2A 2Y5CA 2INCC 1MPEA 2CJNA 4M0WB 4YSZB 1WXAA 1C9FA 1TKEA 2KC1A 2N9KA 1F9JA 4P1BC 2WXGA 1E8XA 3AE5B 2O2VA 4YTPB 3APFA 2L8JA 3FKYA 2OOBB 2L3ZA 2BWES 5JHBA 3L13A 1MVKA 4JIOU 3EECA 5CTRC 2W3SA 3IHPC 4XGAB 3VQIA 2C5LC 2GBNA 3WA0A 3ZO5B 2DAJA 3W9CB 2BPSA 4BOZB 3AH7A 2JWUA 5BMGA 1SXTA 2JYEA 1I4XA 3ZJTA 2K8CA 2KN5A 4XE0A 5DPRA 3RULA 1ZOYB 3L0WB 2LVQA 2QHOA 2WXJA 3SR6A 4LDTD 1VZ8A 1JW9D 3V05A 2KDEB 2KN4A 2MP2B 3ZRCA 2HJ8A 2X38A 3UIOB 4NQLB 4PS8A 1N6ZA 1FM0D 1C78A 1C77A 4KKJA 3AN1A 2V4IB 3IAM1 4F1SA 3C0RB 1WR6E 3AI5A 4A90A 4DXGA 3Q3JA 4C7ZA 5DPTA 4DHJD 4ITKA 4DQOC 1GC6A 2PKOA 1Q1OA 2QDFA 3VH4B 1ZPSA 1E5WA 2NTTA 3ZNZB 1RYJA 3BYYB 3LDZE 2DZIA 5E6NA 5T8IA 4W9DA 4AP4C 2SEBD 4HWIB 3KW5B 2C7NB 3FILA 4YL8A 1N5XA 3DBSA 4RGNA 4HDQA 2JZ3B 4IWPA 1X1MA 4A55A 4FBJB 2FCSA 5E6JA 3ETRA 4NAWB 2J52A 3LB8C 4LCDE 3URYA 3OWEB 3OLMD 3TMPB 3CSTA 2M1MA 2ZVNA 4ZRJA 3MP9A 2D10A 1VCBA 1SE2A 2QMTA 5IN7A 5FKAC 4LJOB 4S0RA 3I3TB 4NZLB 3A4SC 4HJGE 2V0GA 2ICIA 2BS2B 5DCNA 5EE1A 1IPGA 4B0MA 2QCZA 3PRMB 1TJEA 3KWVA 4P1CC 5FR6A 3H7PA 4K81A 4ANWA 4K3CA 3W1SC 2BWFA 1GJZA 2JXXA 2ON8A 4JPSA 1GAQB 4ZYSA 2KWDA 1FD6A 1VZ7A 2J0JA 4Q2JA 1SIJA 2K25A 1KRHA 4HROA 3RNCC 4G0NB 4S17A 2K9XA 1CJEA 5CX3A 2K3UA 2N0SB 3BK2A 4FJYA 3DHHC 1UWXA 2J0MA 4M0WA 4KSKC 4RM8A 5HHDG 2WDRB 2INPE 1DOIA 5D2MB 1I4HA 3HK0A 1AYFA 2JPHA 3ZYYX 3PTFC 3NVWA 4L23A 2WXFA 3ZDTA 2LZ6A 3MHSD 1EU3A 3MFGA 5GMVA 3P63A 1TYGB 2KMMA 3AM9A 2JU6X 1D3ZA 2INDC 4FA6A 1YOVB 1OQYA 2I1KA 1KM7A 3O65B 1SJHD 2ZNVB 2QC8A 2DENB 1FIQA 1KF6B 2OJWA 2JRHA 2PE9A 2KMCA 4KX6B 1J7BA 3AE2B 3ALBA 2LGXA 2R2QA 5D94A 3KUCB 3RCZA 2B3AA 4RNAA 4WAFA 5CHWA 1SE3A 2WDVB 2MP2A 2KQSA 2D3AA 2KHWB 2KFJA 4AWJA 2J4XA 3VDZA 2KVZA 2JXTA 2BVCA 3RPFC 2INNE 5J2RA 1F0ZA 4AS1A 1VZ6A 2DX5B 1TKGA 4HPPA 1UD7A 1WGGA 2MW5A 3AU4A 2KT7A 3QAQA 4YSXB 1NI3A 3BK1A 3UQAA 4LNOA 2PVOD 3P4PB 2L1AA 1T5XD 3NS1A 4DXFA 3IVFA 2IY0B 4TQ1A 1FPYA 1TT5B 4GLSC 5C23A 4URKA 4JQWC 1WJ6A 2WQYB 3OAWA 3ZVVA 3N30A 3V6CB 3KYCD 1C4CA 3R2IA 2V3PA 5BYSA 4BVUC 1Y8RC 1PQSA 2WXIA 5IKCM 1DOYA 5LXHA 4IC7B 4EZLA 2RGFA 5C1ZA 1XT9B 4GSWA 3A9KA 3ZIMA 1TY0A 2EKIA 3C8YA 5IAAC 3ECIA 3J9CA 1EWYC 3DBLI 1K52A 3QK0A 2G1EA 2LUMA 1P0RA 2FCMA 5IA7A 2XNAC 2BKFA 2IJ0A 3PGEA 4A3PA 2YVCA 4USAA 2HD5B 1RFKA 1P3QU 1PGXA 3GOEA 1YN4A 1N60A 3CWIA 2N7DA 2M17A 1I42A 1MHHE 1YQBA 3KWLA 1C4PA 4GOCA 2IGHA 4YTNB 2CR5A 1JMLA 4MELA 2KANA 2KLGA 1SE9A 3H1UA 1OQQA 3ZJUA 3AE9B 2BB6A 1UELA 2ZNVC 1WX7A 1E7VA 3NUHB 3N20C 4MSQB 4IM0A 3TSSA 1HTQA 2KFKA 3EUB2 2CJOA 4W9IA 4BOSC 5HI1A 1FFVA 1L6UA 2KK8A 3B9JA 2K5PA 3DBRB 3VUWA 3PLVA 3SFEB 1D5ZC 3M62B 2CU1A 1WF9A 3W5VB 2GBMA 1TTNA 1S3SG 3QX1A 1XXGA 1M94A 2CHXA 2W54A 4EKUA 3AEDB 4WURA 1H4RA 2FBWB 1N63A 1IP9A 5GXGB 4W9KA 2D2QA 1CZPA 1V1PA 3H6NA 2R61A 1JCKB 1YIWA 1VR9A 2ONQA 4MEMA 3EFCA 4IM2A 1WGKA 3EHVA 1HXYD 1DOXA 4LNFA 3TCAA 2WDQB 1F52A 5LNK1 2AYOB 3P4RB 3W1YA 4MGZE 4RCOA 1XEEA 3DQVA 4LK0M 1WGHA 2FCQA 1L4ZB 4KZ0A 2IZVB 1NEKB 3RN9C 2WGSA 2PPHA 2BW2A 3Q3FA 1E0ZA 5H8YE 5AUKA 1K50A 2EELA 2MBQA 4ANUA 3T8MA 4XDDA 3RNEC 4C4VB 4WWNA 3RNFC 2MHJA 2LJIA 4JL9A 5CHFA 1R4NB 4OW0A 3DBRI 3SDLC 3M63B 3KUZA 1ZDVA 3QHTA 4LNKA 1GG3A 1Z2MA 4OVZA 4E71A 5MPOA 4TKNA 4RM9A 1WI0A 4YXDB 2BGFA 4A9AA 2WX1A 1ZE3D 2AL3A 2WXHA 2XBBC 3VUYA 2UYZB 4RF0A 1WWTA 1XLPA 4PT5A 4GGQA 2WNMA 4C7YA 2LXCA 3MJWA 1YNTE 1WYWB 5AZGA 4DWFA 3NZ3A 3NG0A 4KDIC 4KIKB 4HPMB 4ASWC 4HCPB 3CSFA 4W9EA 3L4PA 1D5XC 1ET9A 2RD0A 3JSVB 1OTRB 1QQRA 2WXPA 2N9EB 2VZKD 3APDA 5LXIB 2D3CA 1GUAB 4NJ6A 3LXFA 2NBUA 1L0YB 3T9LA 3AE8B 4WJNA 1WH3A 1Y56A 1F77A 1JROA 3L16A 1Q0WB 1V97A 2L7RA 1D5MC 4II3B 3N9YC 2D3BA 3QARA 1R4NI 2CKHB 1LFDA 4RH6A 1JWBD 1UWMA 3TBLD 4KZCA 3DOWA 4OZCA 1RRBA 3PO0A 5KHOA 3UINB 1I7HA 1G6JA 3K9PB 3HVDA 3Q2AC 3VR8B 1J0GA 3NZUA 2FE8A 3SEBA 3KVFB 3DDCB 5AEKB 1WM3A 3LJ3A 4KGRA 4JWSC 2RDGA 1D4BA 2KTFA 4ZRKA 1ET6A 3ZNHB 3PPAA 3I9V1 1LO5D 5G5HA 3AE7B 5HFYA 1FNVA 1OGWA 3U7ZA 2FIFA 1BXTA 4M8NA 1XD3B 2AX5A 4XX5A 3ZGZA 1P1AA 1WX9A 2RDBC 3PLUA 3AE1B 3TEYA 3RT3B 2M4NA 1UBQA 2L32A 3E56A 1OEYA 2LGDA 3V3XA 1WIAA 1FO4A 1P98A 4A20A 3P4SB 4WWPA 4RF1A 3JVZX 2MJDA 1CMXB 3A1QB 1OFFA 3Q14C 3PRZA 1V80A 2WS3B 2KQ4X 1YQ4B 2XEWA 4HKQA 3TIXA 2K39A 2BBCA 2TSSA 3TJPA 3LYYA 2EMSA 2O6VB 3B0AA 3ML8A 3H8HA 2A4ZA 2BYFA 4P6VF 1IGCA 3KLSX 2WP9B 1QLBB 4CYEA 2FUG1 4PS3A 3RZFA 3NOBA 1NBFC 4YSYB 2UWQA 1MG8A 3AE3B 5L95C 3ML9A 1NYQA 3OJ4B 1UNSA 4C80A 3Q8BA 1GC7A 1V5TA 1EF1A 2VH1A 2DZJA 1HZ6A 2DAFA 3EA6A 1CQVA 3DPDA 4NNJB 4WQOB 4WQMA 1T0QC 1FFUA 1R4MB 2KJRA 4AQ7A 3QJZA 1LXDA 2J42A 1WRIA
chains in the Genus database with same CATH topology
5EE0A 2INNE 2ZW0A 3AB5A 1F0ZA 1GOZA 4AS1A 1TS5A 1VZ6A 2ZW1A 1TKGA 3GP7A 4L2YA 5BMHA 1IBXA 1FRDA 3TEZA 4MACA 1STEA 1C76A 4YSXB 1I4GA 1NI3A 2L52A 2PTLA 4O1NA 4OZBA 3BYTB 4JWUC 2XN9C 3BK1A 1PUTA 1YN3A 3AEAB 1GB1A 2MH7A 2PVOD 5HG2A 3P1MA 4ZHOA 5D3IB 3P4PB 3PZ8A 2L1AA 1T5XD 1V8CA 3NS1A 4DXFA 1TS2A 1TS3A 3DWMA 1E7PB 2L83A 4TQ1A 3MC0B 4GLSC 1XCTL 4HKZE 3U52E 2WQYB 2ACZB 5TSSA 2M56B 4P16A 1PDXA 4MH8A 1HQRD 4RGTA 1TKYA 1C4CA 3R2IA 1PGBA 2I38A 3KQ4A 4HEA1 4J3OD 3U2SC 2V3PA 2AQ2B 2B76B 2NTSA 5BYSA 1F2RI 1ACCA 1C79A 3P42A 1WXQA 3DWGC 2WXIA 1KLGD 1AWDA 5AUIA 4OHJA 4YTMB 2JSVX 2V3NA 2PW9A 1EWCA 1DOYA 2PIAA 3AEFB 5BMIA 1GPXA 1ROEA 2Y3AA 1HEZE 5C3JB 1JWMD 1TY0A 2EKIA 1QF6A 3C8YA 4UDUC 2AQ3B 3J9CA 2HTME 1EWYC 4YWGG 1K52A 3FAHA 2G1EA 2LUMA 1I4QA 2N7JA 4WWMA 4ZOHC 2XNAC 3NVYA 1VJKA 1ZXIA 4KGSA 1ZDXA 2WXRA 4XDCA 2IJ0A 3UI3A 1ZP0B 4ARCA 2JX5A 3FILB 1JWSD 1RWSA 1SF0A 1RFKA 4USAA 3W1SA 1QOFA 2BS4B 3NRZA 1QKZA 1YJIA 2HDEA 1PGXA 1FRRA 3VRBB 2VZKB 1SEBD 1YN4A 1N60A 3CWIA 3AMZA 4MT5A 3R2TA 3Q8CA 1QOBA 2DLBA 4RGOS 5G5GA 1MHHE 1OQRA 3KWLA 1C4PA 1T6BX 2E3TA 2IGHA 1B1ZA 3E9SA 2G9HD 4YTNB 3O13A 1JMLA 1JWUD 1XLOA 3IT6B 1FNWA 1IBXB 3I57A 4A8XC 1YQ3B 2KDMA 1FXIA 2BB5A 1OQQA 2IPKD 5D7GA 3MJ5A 4N59A 3ZJUA 3AE9B 3BVZA 2JYTA 2BB6A 4MM3B 1F2RC 5BYRA 1KH0A 4D2KA 4JE3B 3NUHB 1XLQA 3TSSA 2LGIA 3EUB2 4XWTA 3TUOA 2CJOA 4IDIA 5HI1A 1FFVA 1DGJA 1L6UA 2RMMA 3B9JA 4IOIE 2K5PA 2SAKA 2KACA 1P7FA 1KLUD 3NVZA 3SFEB 1D5ZC 4CQNA 3W5VB 1ESFA 1FCCC 4KGTA 2YEPB 1QILA 1ZXHA 3AECB 5EE3A 4ARIA 1B9RA 1N62A 1IUEA 1QT9A 2DBYA 1XXGA 1EM7A 1YMHE 3ZQ4A 3AEBB 1SB3C 3Q8EA 2W54A 2NMQA 3AEDB 4WURA 1BMLC 1I4PA 3IXSA 2FBWB 3W5UB 5C2TB 1N63A 2M0AA 2H89B 5GXGB 4ZRQA 1R7SA 1CZPA 3T3NA 1V1PA 2Y5CA 1MPEA 4GDLB 2CJNA 2R61A 1N5WA 3B2FA 5FR3A 3AE4B 5H92C 1JCKB 3AV8A 4YSZB 1C9FA 1VR9A 1M4VA 2ONQA 1TKEA 1WGKA 1HXYD 2D5GA 1DOXA 2N9KA 2K22A 3NVVA 2WDQB 2WXGA 5LNK1 3AE5B 3P4RB 4YTPB 1TZOA 3CIRB 1HA5A 4RCOA 1XEEA 2GRIA 4N6EB 4TSSA 1MI0A 1I4RA 2QEJC 2WXNA 4LK0M 1L4ZB 2WXLA 4L1BA 1NEKB 1VRAB 2BW2A 1YJJA 1E0ZA 4A6QA 5H8YE 1SJED 4RGMA 1GB4A 3ABVB 1MVKA 4EE2A 5AUKA 1IGDA 4ZHPA 3AEGB 1K50A 2W3SA 2EELA 2WXMA 1HZ5A 3VQIA 1JQ4A 4YT0B 2BTEA 4XDDA 2WU5B 2K0PA 1AW7A 3W9CB 3AH7A 1WSPA 2JWUA 5BMGA 1SXTA 2WXOA 2QJLA 2E6XA 4N58A 2BYTA 2LJIA 2BT6A 2Q5WD 2JYEA 1I4XA 1XLNA 3ZJTA 4OW0A 4XE0A 1ZOYB 1ZDVA 3GS2A 4OZAA 4LTUA 4OVZA 5MPOA 2LFIA 2WXJA 3SR6A 4YXDB 1YN5A 4GDKB 4A9AA 1VZ8A 1ZE3D 1ENFA 1JW9D 2WXHA 3V05A 2KN4A 1XF5L 1Q10A 3VR9B 4RF0A 1WWTA 1EU4A 1XLPA 2X38A 1L5PA 4WIPA 4PT5A 4C7YA 2WNMA 1YNTE 1KTKA 1FM0D 1A70A 3AEEB 1C78A 1C77A 3NZ3A 4KKJA 1T3QA 3AN1A 3SFDB 1K51A 4LLGM 3GB1A 2V4IB 3T3OA 4US8A 2DYMA 1E6EB 1XCQL 3L4PA 3IAM1 1D5XC 2I2YA 1ET9A 1BUIC 2LHEA 4A90A 4DXGA 2PVGC 1QQRA 1FXAA 4C7ZA 2WXPA 2VZKD 4ITKA 4DQOC 4KKIA 3EGRA 1V1PB 2PKOA 4NJCA 4RFBA 3LXFA 1ZPSA 2NTTA 3TEXA 1K53A 5JXVA 1RYJA 4B0EA 3B2GA 2BS3B 1L0YB 3BYYB 3AE8B 4REZA 5T8IA 3BVMA 3VRAB 2LEKA 2SEBD 2RDHA 3IT4B 5D3DA 3FILA 1Y56A 1F77A 1JROA 1N5XA 2JZPA 1V97A 1RM6C 1D5MC 3Q69A 4RGNA 1CK1A 3N9YC 3U4EG 4A55A 2QILA 4RH6A 1JWBD 1UWMA 5E6JA 4OZCA 3PO0A 1FNUA 3IAS1 3W2DA 1I7HA 1J7CA 3ETRA 4NAWB 2J52A 3HVDA 1WYGA 2KAJA 3LB8C 3BWUD 3BZDB 1E10A 1XO3A 4ZRPA 2WU2B 3OWEB 3URYA 3VR8B 1QOAA 2IGGA 2Y5PA 3MP9A 2FE8A 2W82A 2GI9A 3RFZB 1SE2A 4JX1C 3SEBA 2IGDA 2QMTA 2JQRB 2YEPF 5FKAC 2M19A 4KGRA 3PZ7A 2PLPA 3HUIA 2IDYA 3Q8FA 4JWSC 2RDGA 4NZLB 4HJGE 1D4BA 2V0GA 5EE9A 1ET6A 2ICIA 2BS2B 1NYRA 1FMAD 3MHZA 3I9V1 1P7EA 2RPVA 5EE1A 1LO5D 4WH4A 5G5HA 3AE7B 4B0MA 5HFYA 1AN8A 1QOGA 1TJEA 3KWVA 1FNVA 2GB1A 3U7ZA 2H88B 2MEKA 1UUPA 1BXTA 2AX5A 3ZGZA 5BYQA 1J7AA 2J53A 2ON8A 5FK9C 2N9LA 1V1OA 1NVID 4JPSA 1C4AA 1GAQB 1PGAA 4ZYSA 2KWDA 1FD6A 1VZ7A 4Q2JA 1SIJA 1KRHA 2LMCA 3AE1B 3TEYA 4HROA 2K9XA 2L32A 1D6EC 3E56A 3V3XA 1CJEA 1TS4A 4IKGA 1FO4A 2K3UA 1FEHA 3WCQA 2N0SB 2OEDA 3BK2A 3P4SB 4M0WA 1UWXA 4RF1A 2WXQA 5HHDG 4C56C 2WDRB 2INPE 1DOIA 2W3RA 2MJDA 3BVGA 2LHDA 4NAMA 1OFFA 1I4HA 1AYFA 2WS3B 2KQ4X 1YQ4B 3R8BA 4HKQA 3FC4A 1L6VA 3ZYYX 2BBCA 2TSSA 1JRPA 3NVWA 2WLBA 1KFYB 3Q8AA 2WXKA 1FCLA 3LYYA 2MJEA 4HRSA 1DYQA 3BIID 4TMAB 4L23A 2WXFA 2AQ1B 2Z8LA 2QSDA 1EU3A 3H8HA 5I4DA 1UGJA 3MFGA 1VDVA 4P6VF 3HVZA 1IGCA 3P4QB 4TQ0A 3KLSX 2PMVA 2WP9B 3P63A 4H2AA 1TYGB 2KMMA 2DWQA 2JU6X 3AM9A 1QLBB 4R3DA 2FUG1 1SSNA 1ZUD2 4YSYB 1SJHD 1JALA 2CU3A 2OHFA 1PYWD 3AE3B 1FIQA 1N61A 1KF6B 1NYQA 2DYOA 1UNSA 2W55A 2QIEB 1L4DB 3Q8BA 4C80A 3HRDD 4KX6B 1J7BA 2MJ3A 1TY2A 3AE6B 1PFDA 3AE2B 1VLBA 4US9A 1HZ6A 1L0VB 3EA6A 1CQVA 4RNAA 4WAFA 3ZJVA 4FXCA 1E9MA 4WQMA 1SE3A 3TEWA 1SE4A 4XWWA 1FFUA 1L0XB 2WDVB 1MHXA 1NENB 4AQ7A 1JWAD 2J4XA 2JXTA 2J42A 1SBBB 3RPFC 1WRIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EE1 A;  3AB5 A;  5EE0 A;  5MPO A;  1YQ3 B;  1F0Z A;  1FXI A;  3AE7 B;  5G5H A;  1OQQ A;  1TKG A;  1QOG A;  1TJE A;  4N59 A;  3AE9 B;  3SR6 A;  4YXD B;  1E0Z A;  1FRD A;  4A9A A;  2H88 B;  1JW9 D;  4YSX B;  1XLQ A;  2L52 A;  1NI3 A;  3VR9 B;  1WWT A;  3EUB 2;  2AX5 A;  2CJO A;  4JWU C;  4IDI A;  1XLP A;  1FFV A;  1J7A A;  1DGJ A;  1L5P A;  1L6U A;  3B9J A;  1NVI D;  1PUT A;  2K5P A;  3AEA B;  1GAQ B;  4C7Y A;  2MH7 A;  2PVO D;  3NVZ A;  3SFE B;  3P1M A;  4ZHO A;  1SIJ A;  3LB8 C;  3W5V B;  3P4P B;  1KRH A;  3AE1 B;  1FM0 D;  1A70 A;  1V8C A;  3AEE B;  3NS1 A;  4HRO A;  3DWM A;  1E7P B;  2L83 A;  3AEC B;  2K9X A;  5EE3 A;  1T3Q A;  3AN1 A;  3SFD B;  1B9R A;  1CJE A;  1N62 A;  1IUE A;  1QT9 A;  4US8 A;  1FO4 A;  2DBY A;  1E6E B;  3L4P A;  3WCQ A;  2N0S B;  2WQY B;  2ACZ B;  3AEB B;  2M56 B;  3P4S B;  5AUK A;  1SB3 C;  2W54 A;  1PDX A;  2PVG C;  2WDR B;  3AED B;  1DOI A;  2W3R A;  1FXA A;  2MJD A;  4C7Z A;  3W5U B;  2FBW B;  1OFF A;  4ITK A;  1TKY A;  5C2T B;  1AYF A;  2WS3 B;  1N63 A;  2PKO A;  2H89 B;  1YQ4 B;  5GXG B;  3FC4 A;  1L6V A;  2B76 B;  3LXF A;  1R7S A;  3ZYY X;  1CZP A;  1JRP A;  3NVW A;  2WLB A;  1RYJ A;  4ZHP A;  1WXQ A;  2Y5C A;  3DWG C;  1KFY B;  3B2G A;  1AWD A;  2BS3 B;  5AUI A;  2CJN A;  1N5W A;  3B2F A;  3AE4 B;  2MJE A;  4HRS A;  5H92 C;  4YTM B;  3BII D;  3AV8 A;  1DOY A;  2PIA A;  3AE8 B;  4YSZ B;  3AEF B;  1GPX A;  1ROE A;  3VRA B;  2LEK A;  1E10 A;  1TKE A;  1WGK A;  1VDV A;  4P6V F;  3HVZ A;  1JRO A;  3P4Q B;  5C3J B;  1DOX A;  2WP9 B;  3P63 A;  1TYG B;  2KMM A;  2DWQ A;  2EKI A;  1N5X A;  2K22 A;  2WDQ B;  1V97 A;  1QLB B;  3AM9 A;  1RM6 C;  3AE5 B;  3NVV A;  3P4R B;  4YTP B;  3CIR B;  2HTM E;  1ZUD 2;  1EWY C;  4N6E B;  4YSY B;  3FAH A;  1JAL A;  2G1E A;  2CU3 A;  2OHF A;  3AE3 B;  1JWB D;  1NEK B;  4WWM A;  4ZOH C;  1UWM A;  1FIQ A;  1N61 A;  1KF6 B;  1YJJ A;  1NYQ A;  1VJK A;  1ZXI A;  3NVY A;  2W55 A;  2QIE B;  3PO0 A;  5H8Y E;  4C80 A;  1I7H A;  1ZP0 B;  1J7C A;  3ABV B;  3HRD D;  3ETR A;  4KX6 B;  1J7B A;  2JX5 A;  4USA A;  1RWS A;  1SF0 A;  2MJ3 A;  1RFK A;  1WYG A;  1PFD A;  2KAJ A;  1QOF A;  2BS4 B;  3AE6 B;  3AEG B;  1YJI A;  1XO3 A;  3AE2 B;  2WU2 B;  2W3S A;  1FRR A;  1VLB A;  3NRZ A;  1QOA A;  3VR8 B;  3VRB B;  1JQ4 A;  4US9 A;  1L0V B;  4YT0 B;  1N60 A;  3CWI A;  1QF6 A;  2WU5 B;  3AMZ A;  3W9C B;  3AH7 A;  4JX1 C;  1QOB A;  5G5G A;  4FXC A;  2JQR B;  1E9M A;  2QJL A;  1OQR A;  3KWL A;  4WQM A;  4N58 A;  1FFU A;  2BT6 A;  2WDV B;  2M19 A;  2E3T A;  1NEN B;  2Q5W D;  4JWS C;  1XLN A;  3HUI A;  4YTN B;  1JWA D;  1XLO A;  5EE9 A;  1ZOY B;  2BS2 B;  1NYR A;  1FMA D;  4LTU A;  3RPF C;  1WRI A; 
#chains in the Genus database with same CATH topology
 5EE0 A;  3AB5 A;  2NPT B;  2K6D B;  2DNF A;  3A33 B;  2LGS A;  2LWP A;  1FRD A;  2C7M B;  1WZ0 A;  4MAC A;  2HJ1 A;  3DCG A;  2BYE A;  3VUX A;  4O1N A;  4MM3 A;  4IWQ A;  3JSV A;  2KJH B;  4KSL C;  4MGY E;  2L00 B;  3N1Y C;  4ZHO A;  3NY5 A;  2LJ5 A;  3ONS A;  1V8C A;  2KTR B;  1E7P B;  2L83 A;  4BAX A;  3MC0 B;  4DHZ E;  1NI2 A;  4ANX A;  3U52 E;  5JHA A;  4K3B A;  3SD5 A;  1WX8 A;  2N7E A;  4RGT A;  4X57 B;  1TKY A;  2I38 A;  2AQ2 B;  4KV2 A;  4LNI A;  5J17 A;  4LDT B;  1RLF A;  2V3N A;  3L08 A;  1SIF A;  3U30 A;  3AEF B;  5BMI A;  1HEZ E;  5C3J B;  3DVG Y;  2JWZ A;  4UDU C;  2AQ3 B;  3BY4 B;  4YWG G;  3FAH A;  2IO1 B;  3ZW3 A;  3UGB B;  3NVY A;  1VJK A;  4XDC A;  3UI3 A;  3W1S A;  1VD2 A;  2ZJD A;  2BS4 B;  2HDE A;  3TL5 A;  3IFW B;  3VRB B;  4DHJ B;  3VXW A;  4GMV A;  2W9N A;  3AMZ A;  4MT5 A;  4ACF A;  1V5O A;  3R2T A;  4WAA A;  4HPL B;  1QOB A;  2DLB A;  4RGO S;  1T6B X;  4I6L B;  3PV1 A;  1B1Z A;  4K7W A;  4CHK A;  3E9S A;  2Z59 B;  2ZPY A;  1Q5W B;  2MWS B;  1FNW A;  2NS5 A;  4W9H A;  1TBE A;  3I57 A;  1IBX B;  1YQ3 B;  2V1Y A;  2L76 A;  5D7G A;  4N59 A;  3B1L X;  2C7H A;  3WAP A;  1XLQ A;  2G4S A;  2LGI A;  2KO3 A;  1WGR A;  3GE8 C;  1DGJ A;  2KAC A;  1L7Y A;  3A1Q A;  1KLU D;  4FHK A;  4CQN A;  3U7D A;  3APC A;  4KGT A;  1E8Y A;  4P7I A;  1ZXH A;  3AEC B;  1B9R A;  1QT9 A;  3ZUN A;  1HTO A;  3ZQ4 A;  2O6V A;  3AEB B;  1SB3 C;  1MJD A;  4MSM B;  4NY0 A;  1BML C;  3IXS A;  1ISN A;  3QC8 B;  3T3N A;  3H9D A;  1UH6 A;  4WJQ A;  4GDL B;  1N5W A;  5FR3 A;  5H92 C;  2I1J A;  1NDD A;  4W9F A;  2ASQ A;  1SGH A;  2D5G A;  2JF5 A;  2KXJ A;  3NVV A;  1AAR A;  2KJ6 A;  3CIR B;  1HA5 A;  4ANV A;  4JGH B;  4W9L A;  4M00 A;  4TSS A;  1MI0 A;  4EZJ A;  5G2N A;  2QEJ C;  2WXN A;  3PRE A;  4L1B A;  1VRA B;  4FUL A;  2NVU I;  3PVL A;  1SJE D;  1C1Y B;  4EE2 A;  1IGD A;  4ZHP A;  2YLM A;  4QAY A;  1V2Y A;  1HZ5 A;  1JQ4 A;  2BTE A;  2NPT A;  4NAW A;  3UIP B;  1AW7 A;  3OG5 A;  2WXO A;  2E6X A;  2BYT A;  2BT6 A;  3N32 A;  2AWT A;  3GS2 A;  4OZA A;  4MH0 E;  3AUL A;  4RMA A;  3MC9 A;  1ZKH A;  4GDK B;  4J6I A;  3WAL A;  2NCN A;  1Q10 A;  3EFU A;  4FJV B;  3DVN V;  4WIP A;  1UGM A;  3VH3 B;  1TIF A;  2V9H A;  3AEE B;  2R2O A;  1T3Q A;  2RR9 A;  3B08 A;  4LLG M;  3T3O A;  4US8 A;  3NZS A;  1XCQ L;  2I2Y A;  1WGD A;  3IBE A;  1BUI C;  2D11 A;  4TUU A;  4FN2 A;  1FXA A;  3K9O B;  4KKI A;  3N1Z C;  2A5U A;  4IG7 B;  3R66 C;  4B0E A;  3B2G A;  1HE8 A;  4REZ A;  3BVM A;  2NBV B;  3VRA B;  3QA8 A;  2RDH A;  3IT4 B;  5D3D A;  2O2V B;  2MBO A;  2N1W A;  2JVC A;  4MJS B;  5AZH A;  1RM6 C;  2KWU B;  2DYB A;  3DVN U;  4AUQ C;  2WWZ A;  4B9K A;  2QIL A;  3PZD A;  1RAX A;  4E3C A;  5IP4 D;  3DBH B;  3QWZ B;  3WAM A;  1WZ3 A;  4BKS A;  1FNU A;  3IAS 1;  1WYG A;  2KAJ A;  4EFO A;  2KKC A;  3BWU D;  2EKE C;  3BZD B;  1E10 A;  1XO3 A;  3IG3 A;  1QOA A;  2IGG A;  4PYZ A;  4B95 A;  3M95 A;  2W82 A;  2GI9 A;  3VTU A;  3RFZ B;  4JX1 C;  2IGD A;  1WM2 A;  2GOW A;  2JQR B;  4G50 A;  3ZKJ C;  2M19 A;  3Q8F A;  3PZ7 A;  3HUI A;  2IDY A;  4BBN C;  2JZZ A;  2G3Q B;  3KUD B;  5EE9 A;  3MHZ A;  3X0W A;  2RPV A;  2ZVO A;  5LLI A;  1AN8 A;  1QOG A;  4DDI D;  3HM3 A;  1TGZ B;  2MEK A;  1UUP A;  2IBI B;  5BYQ A;  1J7A A;  2J53 A;  3MTN B;  5FK9 C;  5J18 A;  1V1O A;  1NVI D;  1PGA A;  4BBN F;  3ZXV A;  1FXT B;  1YX5 B;  3L54 A;  3VAW A;  4E74 A;  1H8C A;  3I5J C;  2CHZ A;  4HXD A;  1EO6 A;  5DPW A;  2KDB A;  3VFK A;  3WCQ A;  2OED A;  4HCN B;  2X8X X;  3BVG A;  2LHD A;  4NAM A;  3X23 A;  3VTW A;  3NJT A;  1YJ1 A;  2GLS A;  2WLB A;  1KFY B;  1UF0 A;  2WXK A;  3RNG C;  4HRS A;  1DYQ A;  3BII D;  4TMA B;  1E8W A;  1T0R C;  2QSD A;  1UGJ A;  1VDV A;  4TQ0 A;  4LJP B;  2LI5 A;  2PMV A;  1Z5S B;  1ZW7 A;  4H2A A;  3R7R A;  2DWQ A;  4XC2 A;  4BKT A;  2PE6 B;  5JH5 C;  3CF6 E;  1JAL A;  2CU3 A;  2OHF A;  3MC8 A;  3Q3N C;  5IO9 A;  2DYO A;  2W55 A;  2DZM A;  2QIE B;  1E7U A;  3GZN B;  3HRD D;  3ZDM C;  1TY2 A;  3AE6 B;  1PFD A;  3EC8 A;  1I35 A;  1BT0 A;  4WJO A;  3RNA C;  1T0Y A;  4GDK A;  3I63 C;  2D3G A;  1E9M A;  3PHW B;  3TEW A;  1SE4 A;  1MHX A;  2BF8 B;  3RD2 A;  1SBB B;  3U8Z A;  4W9J A;  2NR2 A;  3Q3M C;  2ZW0 A;  2HTH A;  2G4D B;  1TS5 A;  2ZW1 A;  4L2Y A;  5BMH A;  1J8C A;  3TEZ A;  1I4G A;  2JUO A;  3BYT B;  2KQ7 A;  2FUH B;  3WAN A;  1PUT A;  1YN3 A;  5HG2 A;  4ZRI A;  3PZ8 A;  4XZ4 A;  1TS2 A;  3DWM A;  2KX3 A;  4DBG A;  1XCT L;  3D32 A;  2UU7 A;  2ACZ B;  5TSS A;  2M56 B;  1J19 A;  1PDX A;  4MH8 A;  1HQR D;  4MJS A;  4HEA 1;  1WE7 A;  3U2S C;  2LRU A;  1TZ1 A;  3OJ3 A;  2KDF B;  2NTS A;  5DPS A;  3R7Q A;  1F2R I;  1WXM A;  4NPN A;  3P42 A;  1AWD A;  5AUI A;  4OHJ A;  4YTM B;  2JSV X;  3GZN I;  2FID A;  1GPX A;  1ROE A;  5CHV C;  2MCN B;  1WRD B;  2LVO A;  2VRR B;  3N3K B;  2Z0E B;  2KWV B;  4BFR A;  3PT2 B;  2GBK A;  1UBI A;  4PS7 A;  1YD8 U;  3M3J A;  1I4Q A;  2LRW A;  4KGS A;  2GBJ A;  1ZXI A;  1ZDX A;  2IO2 B;  5L83 A;  1ZP0 B;  4K1R B;  4ARC A;  5AZF A;  1SF0 A;  1FRR A;  1WXS A;  2VZK B;  4M01 A;  1SEB D;  1UZX B;  2ZCB A;  4WJP A;  5G5G A;  4IWO A;  4AJY B;  2MBH A;  2JRI B;  1OQR A;  4FLH A;  2E3T A;  1T0S C;  3DHI C;  4C4V A;  2HE7 A;  3O13 A;  4I6N B;  1MG4 A;  2KVR A;  4F7Z A;  4EUT A;  2IY1 B;  4A8X C;  2KDM A;  5TR5 A;  1FXI A;  2C60 A;  2BB5 A;  2IPK D;  2LUE A;  4IW0 A;  2BYV E;  3BVZ A;  1F2R C;  5BYR A;  2K1F A;  4JE3 B;  5IOI A;  3RMK C;  4FAD A;  3TUO A;  1WMH B;  3JW0 X;  4IDI A;  1LGR A;  1U4A A;  4M8M A;  1WE6 A;  2SAK A;  4A3O A;  1KJT A;  4G11 A;  3BIN A;  4DK5 A;  3Q3O C;  4BKS D;  1FCC C;  2YEP B;  1QIL A;  2MA9 B;  5EE3 A;  2Z0D B;  1IUE A;  1EM7 A;  1YMH E;  4WWO A;  4HDO A;  4KIK A;  3KH0 A;  2PEA A;  2NMQ A;  3RYT A;  2K6Q A;  4KVG B;  3W5U B;  1IYF A;  2MBE A;  5E6O A;  2M0A A;  2WDT B;  3R3M A;  1V6E A;  3B2F A;  3AE4 B;  4KDL B;  3A9K B;  3AV8 A;  2LVP A;  3ZTC A;  2DHZ A;  1M4V A;  2G45 B;  1OEY J;  2K22 A;  1A5R A;  4DXA B;  1TZO A;  4N6E B;  2GRI A;  3SU8 X;  1I4R A;  4GN1 A;  2WXL A;  1YJJ A;  4A6Q A;  4RGM A;  1V81 A;  1GB4 A;  3ABV B;  2KYW A;  2CS4 A;  3AEG B;  2J7Q B;  2WXM A;  3HHM A;  4YT0 B;  2JY6 A;  2WU5 B;  2K0P A;  1WSP A;  1E90 A;  2QJL A;  4N58 A;  2Q5W D;  1XLN A;  3V61 A;  2L05 A;  1R4M I;  2XK5 B;  4LTU A;  2LFI A;  2KC2 A;  2KFK B;  1YN5 A;  5D6J B;  4EEW A;  1ENF A;  4IUM B;  1XF5 L;  3VR9 B;  1EU4 A;  3L10 B;  1YX6 B;  1L5P A;  3ZLZ A;  2ZCC A;  4AJW A;  2WX0 A;  1KTK A;  1A70 A;  3SFD B;  1K51 A;  3GB1 A;  2DYM A;  3C19 A;  1E6E B;  1WJU A;  3GE3 C;  2LHE A;  4HLE A;  1KLV A;  2BQQ A;  2PVG C;  3H7S A;  3PSE B;  2RSU A;  3EGR A;  3V62 A;  3SHQ A;  1V1P B;  4NJC A;  4RFB A;  3TEX A;  1K53 A;  5JXV A;  2BS3 B;  2WHI A;  2MLB A;  3RZW C;  4OVV A;  3QIJ A;  2LEK A;  2M8S A;  2DZK A;  2JZP A;  2N4F A;  3DBL B;  3Q69 A;  3ZNI D;  2K8H A;  1CK1 A;  2RPQ A;  3ZRF A;  3U4E G;  1WR1 A;  2CHW A;  3A9J B;  4EOY A;  3NHE B;  4W9G A;  3W2D A;  5E6P A;  1J7C A;  2V4L A;  3JYU A;  4ZRP A;  2WU2 B;  2Y5P A;  2KLC A;  2AEH A;  2LGY A;  4JLC A;  3RI7 C;  4ICU A;  4NQK E;  2YEP F;  3WIM A;  1EF5 A;  1QZE A;  1WGY A;  2PLP A;  4HJK A;  1WMH A;  2KWC A;  4FHJ A;  2KMA A;  1NYR A;  1FMA D;  1XQQ A;  1P7E A;  1MFW A;  4WH4 A;  2L0F A;  4OVU A;  3V6E B;  4ZDV A;  2ZZP B;  2GB1 A;  3KYD D;  1C3T A;  4G3X B;  2H88 B;  4MGK E;  3WAO A;  2N9L A;  1C4A A;  3PS6 A;  2LMC A;  2VH2 A;  4LNN A;  1D6E C;  1TS4 A;  4IKG A;  2K8B A;  2KTR A;  1FEH A;  3N1X C;  4HVB A;  1WY8 A;  3DVG X;  2WXQ A;  3PHX B;  4C56 C;  2W3R A;  4IM3 A;  3Q6B A;  2V3S A;  3R8B A;  1KOT A;  3FC4 A;  1L6V A;  5EDS A;  1JRP A;  3ZXR A;  1JRU A;  1S1Q B;  3Q8A A;  4F8C B;  1FCL A;  2MJE A;  2IO3 B;  4GB9 A;  2AQ1 B;  2Z8L A;  2N9X A;  5I4D A;  4EZK A;  3P2B A;  3S2A A;  4DHZ B;  3HVZ A;  1WXV A;  3P4Q B;  4XYC A;  4R3D A;  4PK1 A;  4I6P A;  1SSN A;  1ZUD 2;  3ENE A;  3A4R A;  2MBB B;  1PYW D;  1N61 A;  5HKH A;  3RNB C;  1L4D B;  4M02 A;  1F1H A;  2MJ3 A;  2XK5 A;  4BKG A;  2EMT A;  1VLB A;  4US9 A;  1K8R B;  1L0V B;  3L17 A;  2FNJ B;  3ZJV A;  4FXC A;  2KX0 A;  4XWW A;  1L0X B;  2J0K A;  1NEN B;  4ICV A;  4W9C A;  1JWA D;  3RUI B;  2D07 B;  3VVW B;  3QQ8 B;  1V9J A;  1GOZ A;  1WJN A;  3GP7 A;  2ZEQ A;  1IBX A;  2Y5B B;  1STE A;  1C76 A;  2L52 A;  2PTL A;  2GBR A;  3CMM B;  2REX A;  4OZB A;  2AL6 A;  4JWU C;  2XN9 C;  5BO4 B;  2IO0 B;  3AEA B;  1E8Z A;  2JT4 B;  3UQB A;  1GB1 A;  2MH7 A;  3P1M A;  5D3I B;  2KZR A;  4PYU A;  1TS3 A;  2LD9 A;  2MQJ A;  3AU5 A;  2ZPN A;  4FJZ A;  2KDI A;  4HKZ E;  4N9F 4;  4P16 A;  2N1V A;  1ZGU B;  4NJ7 A;  4CO7 A;  2FAZ A;  1PGB A;  3KQ4 A;  1WJ4 A;  3HM6 X;  4J3O D;  2B76 B;  2MRP A;  1ACC A;  1C79 A;  1WXQ A;  3DWG C;  1KLG D;  1EUV B;  3A9J A;  2PW9 A;  1P9D U;  3ZTD A;  2PJH A;  1EWC A;  2PIA A;  4HK2 A;  4GDL A;  2Y3A A;  1JWM D;  4C00 A;  2IYD B;  1QF6 A;  2MSE D;  3NS8 A;  5KHQ A;  2HTM E;  3DHG C;  2NBW B;  1V86 A;  2N7J A;  4WWM A;  4ZOH C;  2WXR A;  3DBH I;  2MX2 A;  4DDG D;  3HIZ A;  5G55 A;  2JX5 A;  3FIL B;  1JWS D;  1RWS A;  1LQB A;  1QOF A;  3NRZ A;  1QKZ A;  1WFY A;  1YJI A;  4B6W A;  2N9P C;  2KD0 A;  3Q8C A;  2C9W B;  2KOX A;  2G9H D;  1JWU D;  1XLO A;  3IT6 B;  3UF8 A;  3AXC A;  4TV3 A;  2OJR A;  4GXB A;  2BKR B;  2M0X A;  3ZNG C;  3MJ5 A;  2JYT A;  4MM3 B;  1KH0 A;  4D2K A;  2O6V D;  5JZE B;  3PRP B;  2LXA A;  3VHT C;  2FCN A;  2LAS A;  4XWT A;  2RMM A;  4IOI E;  2L0T A;  1P7F A;  3NVZ A;  4II2 B;  4K7U A;  1ESF A;  1GNU A;  3H7P B;  4MDK E;  1LM8 B;  4ARI A;  4MGI E;  1N62 A;  1L2N A;  4AOF A;  4ZYN A;  2DBY A;  3V60 A;  2WYQ A;  3Q8E A;  4K7S A;  1I4P A;  4BZA A;  5C2T B;  4GIV A;  2H89 B;  4ZRQ A;  2KNB A;  3QCA A;  1V49 A;  1R7S A;  3VTV A;  1RFA A;  2GMI C;  4GU2 A;  2Y5C A;  2INC C;  1MPE A;  2CJN A;  4M0W B;  4YSZ B;  1WXA A;  1C9F A;  1TKE A;  2KC1 A;  2N9K A;  1F9J A;  4P1B C;  2WXG A;  1E8X A;  3AE5 B;  2O2V A;  4YTP B;  3APF A;  2L8J A;  3FKY A;  2OOB B;  2L3Z A;  2BWE S;  5JHB A;  3L13 A;  1MVK A;  4JIO U;  3EEC A;  5CTR C;  2W3S A;  3IHP C;  4XGA B;  3VQI A;  2C5L C;  2GBN A;  3WA0 A;  3ZO5 B;  2DAJ A;  3W9C B;  2BPS A;  4BOZ B;  3AH7 A;  2JWU A;  5BMG A;  1SXT A;  2JYE A;  1I4X A;  3ZJT A;  2K8C A;  2KN5 A;  4XE0 A;  5DPR A;  3RUL A;  1ZOY B;  3L0W B;  2LVQ A;  2QHO A;  2WXJ A;  3SR6 A;  4LDT D;  1VZ8 A;  1JW9 D;  3V05 A;  2KDE B;  2KN4 A;  2MP2 B;  3ZRC A;  2HJ8 A;  2X38 A;  3UIO B;  4NQL B;  4PS8 A;  1N6Z A;  1FM0 D;  1C78 A;  1C77 A;  4KKJ A;  3AN1 A;  2V4I B;  3IAM 1;  4F1S A;  3C0R B;  1WR6 E;  3AI5 A;  4A90 A;  4DXG A;  3Q3J A;  4C7Z A;  5DPT A;  4DHJ D;  4ITK A;  4DQO C;  1GC6 A;  2PKO A;  1Q1O A;  2QDF A;  3VH4 B;  1ZPS A;  1E5W A;  2NTT A;  3ZNZ B;  1RYJ A;  3BYY B;  3LDZ E;  2DZI A;  5E6N A;  5T8I A;  4W9D A;  4AP4 C;  2SEB D;  4HWI B;  3KW5 B;  2C7N B;  3FIL A;  4YL8 A;  1N5X A;  3DBS A;  4RGN A;  4HDQ A;  2JZ3 B;  4IWP A;  1X1M A;  4A55 A;  4FBJ B;  2FCS A;  5E6J A;  3ETR A;  4NAW B;  2J52 A;  3LB8 C;  4LCD E;  3URY A;  3OWE B;  3OLM D;  3TMP B;  3CST A;  2M1M A;  2ZVN A;  4ZRJ A;  3MP9 A;  2D10 A;  1VCB A;  1SE2 A;  2QMT A;  5IN7 A;  5FKA C;  4LJO B;  4S0R A;  3I3T B;  4NZL B;  3A4S C;  4HJG E;  2V0G A;  2ICI A;  2BS2 B;  5DCN A;  5EE1 A;  1IPG A;  4B0M A;  2QCZ A;  3PRM B;  1TJE A;  3KWV A;  4P1C C;  5FR6 A;  3H7P A;  4K81 A;  4ANW A;  4K3C A;  3W1S C;  2BWF A;  1GJZ A;  2JXX A;  2ON8 A;  4JPS A;  1GAQ B;  4ZYS A;  2KWD A;  1FD6 A;  1VZ7 A;  2J0J A;  4Q2J A;  1SIJ A;  2K25 A;  1KRH A;  4HRO A;  3RNC C;  4G0N B;  4S17 A;  2K9X A;  1CJE A;  5CX3 A;  2K3U A;  2N0S B;  3BK2 A;  4FJY A;  3DHH C;  1UWX A;  2J0M A;  4M0W A;  4KSK C;  4RM8 A;  5HHD G;  2WDR B;  2INP E;  1DOI A;  5D2M B;  1I4H A;  3HK0 A;  1AYF A;  2JPH A;  3ZYY X;  3PTF C;  3NVW A;  4L23 A;  2WXF A;  3ZDT A;  2LZ6 A;  3MHS D;  1EU3 A;  3MFG A;  5GMV A;  3P63 A;  1TYG B;  2KMM A;  3AM9 A;  2JU6 X;  1D3Z A;  2IND C;  4FA6 A;  1YOV B;  1OQY A;  2I1K A;  1KM7 A;  3O65 B;  1SJH D;  2ZNV B;  2QC8 A;  2DEN B;  1FIQ A;  1KF6 B;  2OJW A;  2JRH A;  2PE9 A;  2KMC A;  4KX6 B;  1J7B A;  3AE2 B;  3ALB A;  2LGX A;  2R2Q A;  5D94 A;  3KUC B;  3RCZ A;  2B3A A;  4RNA A;  4WAF A;  5CHW A;  1SE3 A;  2WDV B;  2MP2 A;  2KQS A;  2D3A A;  2KHW B;  2KFJ A;  4AWJ A;  2J4X A;  3VDZ A;  2KVZ A;  2JXT A;  2BVC A;  3RPF C;  2INN E;  5J2R A;  1F0Z A;  4AS1 A;  1VZ6 A;  2DX5 B;  1TKG A;  4HPP A;  1UD7 A;  1WGG A;  2MW5 A;  3AU4 A;  2KT7 A;  3QAQ A;  4YSX B;  1NI3 A;  3BK1 A;  3UQA A;  4LNO A;  2PVO D;  3P4P B;  2L1A A;  1T5X D;  3NS1 A;  4DXF A;  3IVF A;  2IY0 B;  4TQ1 A;  1FPY A;  1TT5 B;  4GLS C;  5C23 A;  4URK A;  4JQW C;  1WJ6 A;  2WQY B;  3OAW A;  3ZVV A;  3N30 A;  3V6C B;  3KYC D;  1C4C A;  3R2I A;  2V3P A;  5BYS A;  4BVU C;  1Y8R C;  1PQS A;  2WXI A;  5IKC M;  1DOY A;  5LXH A;  4IC7 B;  4EZL A;  2RGF A;  5C1Z A;  1XT9 B;  4GSW A;  3A9K A;  3ZIM A;  1TY0 A;  2EKI A;  3C8Y A;  5IAA C;  3ECI A;  3J9C A;  1EWY C;  3DBL I;  1K52 A;  3QK0 A;  2G1E A;  2LUM A;  1P0R A;  2FCM A;  5IA7 A;  2XNA C;  2BKF A;  2IJ0 A;  3PGE A;  4A3P A;  2YVC A;  4USA A;  2HD5 B;  1RFK A;  1P3Q U;  1PGX A;  3GOE A;  1YN4 A;  1N60 A;  3CWI A;  2N7D A;  2M17 A;  1I42 A;  1MHH E;  1YQB A;  3KWL A;  1C4P A;  4GOC A;  2IGH A;  4YTN B;  2CR5 A;  1JML A;  4MEL A;  2KAN A;  2KLG A;  1SE9 A;  3H1U A;  1OQQ A;  3ZJU A;  3AE9 B;  2BB6 A;  1UEL A;  2ZNV C;  1WX7 A;  1E7V A;  3NUH B;  3N20 C;  4MSQ B;  4IM0 A;  3TSS A;  1HTQ A;  2KFK A;  3EUB 2;  2CJO A;  4W9I A;  4BOS C;  5HI1 A;  1FFV A;  1L6U A;  2KK8 A;  3B9J A;  2K5P A;  3DBR B;  3VUW A;  3PLV A;  3SFE B;  1D5Z C;  3M62 B;  2CU1 A;  1WF9 A;  3W5V B;  2GBM A;  1TTN A;  1S3S G;  3QX1 A;  1XXG A;  1M94 A;  2CHX A;  2W54 A;  4EKU A;  3AED B;  4WUR A;  1H4R A;  2FBW B;  1N63 A;  1IP9 A;  5GXG B;  4W9K A;  2D2Q A;  1CZP A;  1V1P A;  3H6N A;  2R61 A;  1JCK B;  1YIW A;  1VR9 A;  2ONQ A;  4MEM A;  3EFC A;  4IM2 A;  1WGK A;  3EHV A;  1HXY D;  1DOX A;  4LNF A;  3TCA A;  2WDQ B;  1F52 A;  5LNK 1;  2AYO B;  3P4R B;  3W1Y A;  4MGZ E;  4RCO A;  1XEE A;  3DQV A;  4LK0 M;  1WGH A;  2FCQ A;  1L4Z B;  4KZ0 A;  2IZV B;  1NEK B;  3RN9 C;  2WGS A;  2PPH A;  2BW2 A;  3Q3F A;  1E0Z A;  5H8Y E;  5AUK A;  1K50 A;  2EEL A;  2MBQ A;  4ANU A;  3T8M A;  4XDD A;  3RNE C;  4C4V B;  4WWN A;  3RNF C;  2MHJ A;  2LJI A;  4JL9 A;  5CHF A;  1R4N B;  4OW0 A;  3DBR I;  3SDL C;  3M63 B;  3KUZ A;  1ZDV A;  3QHT A;  4LNK A;  1GG3 A;  1Z2M A;  4OVZ A;  4E71 A;  5MPO A;  4TKN A;  4RM9 A;  1WI0 A;  4YXD B;  2BGF A;  4A9A A;  2WX1 A;  1ZE3 D;  2AL3 A;  2WXH A;  2XBB C;  3VUY A;  2UYZ B;  4RF0 A;  1WWT A;  1XLP A;  4PT5 A;  4GGQ A;  2WNM A;  4C7Y A;  2LXC A;  3MJW A;  1YNT E;  1WYW B;  5AZG A;  4DWF A;  3NZ3 A;  3NG0 A;  4KDI C;  4KIK B;  4HPM B;  4ASW C;  4HCP B;  3CSF A;  4W9E A;  3L4P A;  1D5X C;  1ET9 A;  2RD0 A;  3JSV B;  1OTR B;  1QQR A;  2WXP A;  2N9E B;  2VZK D;  3APD A;  5LXI B;  2D3C A;  1GUA B;  4NJ6 A;  3LXF A;  2NBU A;  1L0Y B;  3T9L A;  3AE8 B;  4WJN A;  1WH3 A;  1Y56 A;  1F77 A;  1JRO A;  3L16 A;  1Q0W B;  1V97 A;  2L7R A;  1D5M C;  4II3 B;  3N9Y C;  2D3B A;  3QAR A;  1R4N I;  2CKH B;  1LFD A;  4RH6 A;  1JWB D;  1UWM A;  3TBL D;  4KZC A;  3DOW A;  4OZC A;  1RRB A;  3PO0 A;  5KHO A;  3UIN B;  1I7H A;  1G6J A;  3K9P B;  3HVD A;  3Q2A C;  3VR8 B;  1J0G A;  3NZU A;  2FE8 A;  3SEB A;  3KVF B;  3DDC B;  5AEK B;  1WM3 A;  3LJ3 A;  4KGR A;  4JWS C;  2RDG A;  1D4B A;  2KTF A;  4ZRK A;  1ET6 A;  3ZNH B;  3PPA A;  3I9V 1;  1LO5 D;  5G5H A;  3AE7 B;  5HFY A;  1FNV A;  1OGW A;  3U7Z A;  2FIF A;  1BXT A;  4M8N A;  1XD3 B;  2AX5 A;  4XX5 A;  3ZGZ A;  1P1A A;  1WX9 A;  2RDB C;  3PLU A;  3AE1 B;  3TEY A;  3RT3 B;  2M4N A;  1UBQ A;  2L32 A;  3E56 A;  1OEY A;  2LGD A;  3V3X A;  1WIA A;  1FO4 A;  1P98 A;  4A20 A;  3P4S B;  4WWP A;  4RF1 A;  3JVZ X;  2MJD A;  1CMX B;  3A1Q B;  1OFF A;  3Q14 C;  3PRZ A;  1V80 A;  2WS3 B;  2KQ4 X;  1YQ4 B;  2XEW A;  4HKQ A;  3TIX A;  2K39 A;  2BBC A;  2TSS A;  3TJP A;  3LYY A;  2EMS A;  2O6V B;  3B0A A;  3ML8 A;  3H8H A;  2A4Z A;  2BYF A;  4P6V F;  1IGC A;  3KLS X;  2WP9 B;  1QLB B;  4CYE A;  2FUG 1;  4PS3 A;  3RZF A;  3NOB A;  1NBF C;  4YSY B;  2UWQ A;  1MG8 A;  3AE3 B;  5L95 C;  3ML9 A;  1NYQ A;  3OJ4 B;  1UNS A;  4C80 A;  3Q8B A;  1GC7 A;  1V5T A;  1EF1 A;  2VH1 A;  2DZJ A;  1HZ6 A;  2DAF A;  3EA6 A;  1CQV A;  3DPD A;  4NNJ B;  4WQO B;  4WQM A;  1T0Q C;  1FFU A;  1R4M B;  2KJR A;  4AQ7 A;  3QJZ A;  1LXD A;  2J42 A;  1WRI A; 
#chains in the Genus database with same CATH homology
 5EE0 A;  2INN E;  2ZW0 A;  3AB5 A;  1F0Z A;  1GOZ A;  4AS1 A;  1TS5 A;  1VZ6 A;  2ZW1 A;  1TKG A;  3GP7 A;  4L2Y A;  5BMH A;  1IBX A;  1FRD A;  3TEZ A;  4MAC A;  1STE A;  1C76 A;  4YSX B;  1I4G A;  1NI3 A;  2L52 A;  2PTL A;  4O1N A;  4OZB A;  3BYT B;  4JWU C;  2XN9 C;  3BK1 A;  1PUT A;  1YN3 A;  3AEA B;  1GB1 A;  2MH7 A;  2PVO D;  5HG2 A;  3P1M A;  4ZHO A;  5D3I B;  3P4P B;  3PZ8 A;  2L1A A;  1T5X D;  1V8C A;  3NS1 A;  4DXF A;  1TS2 A;  1TS3 A;  3DWM A;  1E7P B;  2L83 A;  4TQ1 A;  3MC0 B;  4GLS C;  1XCT L;  4HKZ E;  3U52 E;  2WQY B;  2ACZ B;  5TSS A;  2M56 B;  4P16 A;  1PDX A;  4MH8 A;  1HQR D;  4RGT A;  1TKY A;  1C4C A;  3R2I A;  1PGB A;  2I38 A;  3KQ4 A;  4HEA 1;  4J3O D;  3U2S C;  2V3P A;  2AQ2 B;  2B76 B;  2NTS A;  5BYS A;  1F2R I;  1ACC A;  1C79 A;  3P42 A;  1WXQ A;  3DWG C;  2WXI A;  1KLG D;  1AWD A;  5AUI A;  4OHJ A;  4YTM B;  2JSV X;  2V3N A;  2PW9 A;  1EWC A;  1DOY A;  2PIA A;  3AEF B;  5BMI A;  1GPX A;  1ROE A;  2Y3A A;  1HEZ E;  5C3J B;  1JWM D;  1TY0 A;  2EKI A;  1QF6 A;  3C8Y A;  4UDU C;  2AQ3 B;  3J9C A;  2HTM E;  1EWY C;  4YWG G;  1K52 A;  3FAH A;  2G1E A;  2LUM A;  1I4Q A;  2N7J A;  4WWM A;  4ZOH C;  2XNA C;  3NVY A;  1VJK A;  1ZXI A;  4KGS A;  1ZDX A;  2WXR A;  4XDC A;  2IJ0 A;  3UI3 A;  1ZP0 B;  4ARC A;  2JX5 A;  3FIL B;  1JWS D;  1RWS A;  1SF0 A;  1RFK A;  4USA A;  3W1S A;  1QOF A;  2BS4 B;  3NRZ A;  1QKZ A;  1YJI A;  2HDE A;  1PGX A;  1FRR A;  3VRB B;  2VZK B;  1SEB D;  1YN4 A;  1N60 A;  3CWI A;  3AMZ A;  4MT5 A;  3R2T A;  3Q8C A;  1QOB A;  2DLB A;  4RGO S;  5G5G A;  1MHH E;  1OQR A;  3KWL A;  1C4P A;  1T6B X;  2E3T A;  2IGH A;  1B1Z A;  3E9S A;  2G9H D;  4YTN B;  3O13 A;  1JML A;  1JWU D;  1XLO A;  3IT6 B;  1FNW A;  1IBX B;  3I57 A;  4A8X C;  1YQ3 B;  2KDM A;  1FXI A;  2BB5 A;  1OQQ A;  2IPK D;  5D7G A;  3MJ5 A;  4N59 A;  3ZJU A;  3AE9 B;  3BVZ A;  2JYT A;  2BB6 A;  4MM3 B;  1F2R C;  5BYR A;  1KH0 A;  4D2K A;  4JE3 B;  3NUH B;  1XLQ A;  3TSS A;  2LGI A;  3EUB 2;  4XWT A;  3TUO A;  2CJO A;  4IDI A;  5HI1 A;  1FFV A;  1DGJ A;  1L6U A;  2RMM A;  3B9J A;  4IOI E;  2K5P A;  2SAK A;  2KAC A;  1P7F A;  1KLU D;  3NVZ A;  3SFE B;  1D5Z C;  4CQN A;  3W5V B;  1ESF A;  1FCC C;  4KGT A;  2YEP B;  1QIL A;  1ZXH A;  3AEC B;  5EE3 A;  4ARI A;  1B9R A;  1N62 A;  1IUE A;  1QT9 A;  2DBY A;  1XXG A;  1EM7 A;  1YMH E;  3ZQ4 A;  3AEB B;  1SB3 C;  3Q8E A;  2W54 A;  2NMQ A;  3AED B;  4WUR A;  1BML C;  1I4P A;  3IXS A;  2FBW B;  3W5U B;  5C2T B;  1N63 A;  2M0A A;  2H89 B;  5GXG B;  4ZRQ A;  1R7S A;  1CZP A;  3T3N A;  1V1P A;  2Y5C A;  1MPE A;  4GDL B;  2CJN A;  2R61 A;  1N5W A;  3B2F A;  5FR3 A;  3AE4 B;  5H92 C;  1JCK B;  3AV8 A;  4YSZ B;  1C9F A;  1VR9 A;  1M4V A;  2ONQ A;  1TKE A;  1WGK A;  1HXY D;  2D5G A;  1DOX A;  2N9K A;  2K22 A;  3NVV A;  2WDQ B;  2WXG A;  5LNK 1;  3AE5 B;  3P4R B;  4YTP B;  1TZO A;  3CIR B;  1HA5 A;  4RCO A;  1XEE A;  2GRI A;  4N6E B;  4TSS A;  1MI0 A;  1I4R A;  2QEJ C;  2WXN A;  4LK0 M;  1L4Z B;  2WXL A;  4L1B A;  1NEK B;  1VRA B;  2BW2 A;  1YJJ A;  1E0Z A;  4A6Q A;  5H8Y E;  1SJE D;  4RGM A;  1GB4 A;  3ABV B;  1MVK A;  4EE2 A;  5AUK A;  1IGD A;  4ZHP A;  3AEG B;  1K50 A;  2W3S A;  2EEL A;  2WXM A;  1HZ5 A;  3VQI A;  1JQ4 A;  4YT0 B;  2BTE A;  4XDD A;  2WU5 B;  2K0P A;  1AW7 A;  3W9C B;  3AH7 A;  1WSP A;  2JWU A;  5BMG A;  1SXT A;  2WXO A;  2QJL A;  2E6X A;  4N58 A;  2BYT A;  2LJI A;  2BT6 A;  2Q5W D;  2JYE A;  1I4X A;  1XLN A;  3ZJT A;  4OW0 A;  4XE0 A;  1ZOY B;  1ZDV A;  3GS2 A;  4OZA A;  4LTU A;  4OVZ A;  5MPO A;  2LFI A;  2WXJ A;  3SR6 A;  4YXD B;  1YN5 A;  4GDK B;  4A9A A;  1VZ8 A;  1ZE3 D;  1ENF A;  1JW9 D;  2WXH A;  3V05 A;  2KN4 A;  1XF5 L;  1Q10 A;  3VR9 B;  4RF0 A;  1WWT A;  1EU4 A;  1XLP A;  2X38 A;  1L5P A;  4WIP A;  4PT5 A;  4C7Y A;  2WNM A;  1YNT E;  1KTK A;  1FM0 D;  1A70 A;  3AEE B;  1C78 A;  1C77 A;  3NZ3 A;  4KKJ A;  1T3Q A;  3AN1 A;  3SFD B;  1K51 A;  4LLG M;  3GB1 A;  2V4I B;  3T3O A;  4US8 A;  2DYM A;  1E6E B;  1XCQ L;  3L4P A;  3IAM 1;  1D5X C;  2I2Y A;  1ET9 A;  1BUI C;  2LHE A;  4A90 A;  4DXG A;  2PVG C;  1QQR A;  1FXA A;  4C7Z A;  2WXP A;  2VZK D;  4ITK A;  4DQO C;  4KKI A;  3EGR A;  1V1P B;  2PKO A;  4NJC A;  4RFB A;  3LXF A;  1ZPS A;  2NTT A;  3TEX A;  1K53 A;  5JXV A;  1RYJ A;  4B0E A;  3B2G A;  2BS3 B;  1L0Y B;  3BYY B;  3AE8 B;  4REZ A;  5T8I A;  3BVM A;  3VRA B;  2LEK A;  2SEB D;  2RDH A;  3IT4 B;  5D3D A;  3FIL A;  1Y56 A;  1F77 A;  1JRO A;  1N5X A;  2JZP A;  1V97 A;  1RM6 C;  1D5M C;  3Q69 A;  4RGN A;  1CK1 A;  3N9Y C;  3U4E G;  4A55 A;  2QIL A;  4RH6 A;  1JWB D;  1UWM A;  5E6J A;  4OZC A;  3PO0 A;  1FNU A;  3IAS 1;  3W2D A;  1I7H A;  1J7C A;  3ETR A;  4NAW B;  2J52 A;  3HVD A;  1WYG A;  2KAJ A;  3LB8 C;  3BWU D;  3BZD B;  1E10 A;  1XO3 A;  4ZRP A;  2WU2 B;  3OWE B;  3URY A;  3VR8 B;  1QOA A;  2IGG A;  2Y5P A;  3MP9 A;  2FE8 A;  2W82 A;  2GI9 A;  3RFZ B;  1SE2 A;  4JX1 C;  3SEB A;  2IGD A;  2QMT A;  2JQR B;  2YEP F;  5FKA C;  2M19 A;  4KGR A;  3PZ7 A;  2PLP A;  3HUI A;  2IDY A;  3Q8F A;  4JWS C;  2RDG A;  4NZL B;  4HJG E;  1D4B A;  2V0G A;  5EE9 A;  1ET6 A;  2ICI A;  2BS2 B;  1NYR A;  1FMA D;  3MHZ A;  3I9V 1;  1P7E A;  2RPV A;  5EE1 A;  1LO5 D;  4WH4 A;  5G5H A;  3AE7 B;  4B0M A;  5HFY A;  1AN8 A;  1QOG A;  1TJE A;  3KWV A;  1FNV A;  2GB1 A;  3U7Z A;  2H88 B;  2MEK A;  1UUP A;  1BXT A;  2AX5 A;  3ZGZ A;  5BYQ A;  1J7A A;  2J53 A;  2ON8 A;  5FK9 C;  2N9L A;  1V1O A;  1NVI D;  4JPS A;  1C4A A;  1GAQ B;  1PGA A;  4ZYS A;  2KWD A;  1FD6 A;  1VZ7 A;  4Q2J A;  1SIJ A;  1KRH A;  2LMC A;  3AE1 B;  3TEY A;  4HRO A;  2K9X A;  2L32 A;  1D6E C;  3E56 A;  3V3X A;  1CJE A;  1TS4 A;  4IKG A;  1FO4 A;  2K3U A;  1FEH A;  3WCQ A;  2N0S B;  2OED A;  3BK2 A;  3P4S B;  4M0W A;  1UWX A;  4RF1 A;  2WXQ A;  5HHD G;  4C56 C;  2WDR B;  2INP E;  1DOI A;  2W3R A;  2MJD A;  3BVG A;  2LHD A;  4NAM A;  1OFF A;  1I4H A;  1AYF A;  2WS3 B;  2KQ4 X;  1YQ4 B;  3R8B A;  4HKQ A;  3FC4 A;  1L6V A;  3ZYY X;  2BBC A;  2TSS A;  1JRP A;  3NVW A;  2WLB A;  1KFY B;  3Q8A A;  2WXK A;  1FCL A;  3LYY A;  2MJE A;  4HRS A;  1DYQ A;  3BII D;  4TMA B;  4L23 A;  2WXF A;  2AQ1 B;  2Z8L A;  2QSD A;  1EU3 A;  3H8H A;  5I4D A;  1UGJ A;  3MFG A;  1VDV A;  4P6V F;  3HVZ A;  1IGC A;  3P4Q B;  4TQ0 A;  3KLS X;  2PMV A;  2WP9 B;  3P63 A;  4H2A A;  1TYG B;  2KMM A;  2DWQ A;  2JU6 X;  3AM9 A;  1QLB B;  4R3D A;  2FUG 1;  1SSN A;  1ZUD 2;  4YSY B;  1SJH D;  1JAL A;  2CU3 A;  2OHF A;  1PYW D;  3AE3 B;  1FIQ A;  1N61 A;  1KF6 B;  1NYQ A;  2DYO A;  1UNS A;  2W55 A;  2QIE B;  1L4D B;  3Q8B A;  4C80 A;  3HRD D;  4KX6 B;  1J7B A;  2MJ3 A;  1TY2 A;  3AE6 B;  1PFD A;  3AE2 B;  1VLB A;  4US9 A;  1HZ6 A;  1L0V B;  3EA6 A;  1CQV A;  4RNA A;  4WAF A;  3ZJV A;  4FXC A;  1E9M A;  4WQM A;  1SE3 A;  3TEW A;  1SE4 A;  4XWW A;  1FFU A;  1L0X B;  2WDV B;  1MHX A;  1NEN B;  4AQ7 A;  1JWA D;  2J4X A;  2JXT A;  2J42 A;  1SBB B;  3RPF C;  1WRI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...