5GXPA

Cationic trypsin with gol/pge as dimer at ph 4.6
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Cationic Trypsin With GOL/PGE as Dimer at pH 4.6
rcsb
molecule tags Hydrolase
total genus 56
structure length 223
sequence length 223
chains with identical sequence B
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2016-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5gxpA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5gxpA02
3RXQA 3M5OA 6GCHF 2A1DB 1M9UA 1ELFA 4YLUA 4X1RU 3VXFH 1GVLA 3BTQE 1V2KT 2ZI2H 1QBVH 4DW2U 2FP7B 3KEEA 1MTVA 3PO1C 4NGAH 5GXPA 5J4QA 1TMTH 4BTTB 2A31A 1GBHA 1SMFE 5T3HA 4I7YH 1EB1H 1ELCA 1GJ4H 1GMHF 1SGRE 5DG6A 2W7UA 5CHAC 1GBAA 2ZIQH 3PTBA 2AGEX 4DJZB 2AGGX 2PUXB 2WPKS 4YM9A 1D3TB 1DX5M 1AZ8A 3RM0H 3S69A 4DGJA 3E8LA 1VCQA 3LGWA 6CHAB 1EJNA 4AN7A 1VGCC 3OX7U 2RCEA 3ZVBA 4RSPA 2GZ9A 4X2XA 2PUQH 2FEQH 1WQVH 2BY8X 2FZZA 1C5LH 1GBFA 3A83A 3LDXH 3BEUA 2ZDNA 4CHAC 1EPTA 2WPHS 1EZXC 4GLYA 1HAVB 3RXVA 2BVSH 4MNYA 1J8AA 4ISIH 4KTCA 1AN1E 1OWEA 2VIOA 4X1QU 4XDEA 1L2EA 2OQUA 1EZUC 1BRBE 1HAYB 2ZHQH 5AVDA 3VB4A 1OX1A 2BQ7B 3MTYA 5EPYA 3BTKE 3UOUA 4AG1A 3BTME 3CENA 3K2UA 4O97A 1S81A 1S6HA 2CV3A 2Y81A 1QIXB 1SVPA 4AG2A 1ESTA 4D8NA 1FLEE 3S9AA 3D65E 4Y8ZA 4K69A 3Q77A 4ZROA 1BHXF 2JH6D 1IAUA 3HKJB 1K21H 1WYKA 3RDZA 1KTSB 1A3EH 4FU7A 1WSSH 3VB3A 1GJ9B 1EQ9A 1MKWH 2G5NA 3S7KB 2GT7A 1UTOA 4BOHA 1FXYA 3MU0A 1THRH 3A87A 1C1PA 1Q3XA 1JMOH 1SSXA 3RP2A 2NU2E 2GZ7A 1QBNA 1NU9A 1NS3A 3SV6A 1THSH 2SGQE 2PSXA 4OGYA 5C2ZA 1YKTA 2O8LA 1NRSH 4WXVA 5FXLA 1IQEA 1G9IE 1KXDA 2BD3A 2F9UA 1D6WA 2IN2A 1V2JT 1FN6A 4WWYA 1W12U 1YCPM 4UDWH 7KMEH 1NRQH 2YNBA 1OP8A 9LPRA 4H6SB 1E37B 3BTTE 1NESE 1O2JA 1GHBF 4MNVA 3TH4H 4D9QA 2ZECA 3SNEA 1N6YA 3FFGA 1T32A 3QUMP 1TX6A 5DP3A 1DSTA 3SJ9A 2ODQA 5T6GA 2GCTC 3PV4A 1C2EA 5FHTA 2XCNA 2WPIS 2B0FA 4BXWA 4X6OA 8GCHF 2ZU3A 5C5NA 1AZZA 4YOGA 2PV9B 2WUBA 1MKXH 1EZQA 3H7OA 1C1WH 1AVGH 1CGHA 1HRTH 1JRTA 4ISNA 2CHAB 6GCHG 4TPIZ 3UREA 1GBBA 2W5EA 1XUJA 1DOJA 3RLYH 1SLVB 1C4V2 1MTNC 4CBOA 1NRNH 3MOCA 3U9AH 2DE8A 2JETC 1HXEH 3UR9A 1SLWB 3BTEE 4ISHH 1O39A 3A7YA 1N8OB 2F9PA 4FUBA 4RN6A 1O37A 4ZAEA 1NFUA 1BTPA 2D8WA 3PMAB 4NIVA 5EPNA 4JMYA 3SU5A 3F9HA 4A5TS 2OC0A 4AGKA 1TRYA 1Z6EA 3GY7A 2BD9A 1DWCH 1TBQH 4E7RG 1ORFA 2OC1A 3GY2A 1UTQA 2FTMA 1AFQB 2FS9A 2BY6X 1UVTH 2BZ6H 3LT3A 1PFXC 1GGDB 3A8DA 1PQAA 4OS5A 2A7JA 2ZFFH 1QR3E 1H8DH 1HYLA 3ESTA 1QFKH 1AI8H 1GCTB 2P93A 1AGJA 1ZMLA 3HKIB 1EJMA 5TCAA 1HNEE 1JIRA 4CRBA 5I46H 4X8SH 1D3DB 4B74A 2G51A 3MNXA 3STIA 2RDLA 3OTJE 1SI5H 1KXFA 3SJIA 4MQAA 1AIXH 1O2YA 3EA9A 1BTYA 1G30B 4YOJA 1C4Y2 3BIUH 3IITA 3FAOA 4NWKA 1HAXB 4DOQA 2Z9LA 1KLJH 4WJG2 2JH0D 4DIHH 1J9CH 1HJ9A 1SGQE 2AERH 1QJ1B 3TPIZ 2TRMA 1QRZA 4MNXA 5FBEA 3C27B 3ZZ4A 3ZZAA 1F7ZA 1NZQH 1C5YB 1QRXA 1SOZA 4A92A 4XBBA 1UO6A 3QDZB 1O3PB 2V6NA 1LCYA 1IQNA 5DP9A 1Z7KA 1ANDA 1DE7H 2C90B 1ANEA 2XXLA 2A2QH 1P11E 1EX3A 2BD2A 2CN0H 1BBRE 5F6MA 2QXHA 4JZIA 1QJ7B 1WUNH 4H42U 9ESTA 3GDSA 2OC7A 5EXMA 3VEQB 1OWKA 1QHRB 3SNAA 1EOLA 1HAZB 3EQ0H 1HAPH 3RXCA 3EE0B 3TJUA 3MH5A 5IDKA 1ZJDA 4NSVA 2OD3B 2ZU2A 2ZU1A 4IW4E 5EGMA 3TNSA 4CRFA 1BDAA 4X2VA 5ESBA 2G81E 2BDAA 2F9VA 3PROA 4U01A 4K1EA 2GV7A 1V2OT 1AE5A 2G00A 5F03A 1YF4A 1W10U 3KIDU 1TE0A 1Y59T 1TIOA 1TLDA 1CA0B 1H9HE 4K8BA 4TWYA 1GJCB 2B7DH 4XBCA 3DT0H 8ESTE 1O5AB 3PYHA 1CHOF 1O2VA 2ZPRA 1CVWH 1FQ3A 3GCHC 3HPTB 3QWCH 1G37A 4BXSA 1GMCF 2EEKA 3WY8A 3UQVA 1C1OA 3ELAH 1YPHE 1CE5A 3DUXH 5HMAA 3UNRA 1P0SH 1FJSA 4ZXXH 2VVUA 3MNBA 3QN7A 1A7SA 1C1TA 3SV8A 4JYUH 5TCCA 2BX4A 3SQEE 1MAYA 2YNAA 1E38B 4ZKRU 1UCYE 1O2RA 2ZCLP 1DUAA 2H9HA 2TGAA 3PMBB 1GI6A 1HV7A 2ZDLA 4Z6AH 1BTXA 3GYMA 1TX8A 1C2IA 1G3DA 4ISLA 5L6NH 1BOQA 4JZFH 2H9TH 3E3TA 1EASA 3B9FH 2FESH 5JBCS 1AWHB 3MO3A 2VJ1A 2BYAX 3SNDA 3DHKH 2FXRA 3FZDA 2R2MB 3E0PB 1H8IH 4GCHF 1AWFH 2J2UA 3P95A 3K9XB 1O3HA 2YOLA 7LPRA 5GCHG 1ZR0A 4Y0YE 2R3YA 2Y5HA 1MU6B 1QQUA 4Y10E 1LHCH 4AGJA 1ELGA 1NU7B 3O8BA 3A8BA 4LZ1H 1K1NA 1SOTA 5A0AE 1O2IA 2OUAA 4AORA 1C5VA 3AAVA 1LHEH 1TQ0B 3VB7A 2FOCA 2CF9H 1EATA 2DE9A 1SR5C 4CH8B 3PTNA 2ZTXA 4X1NU 3PWBA 1GHZA 1T8LA 2J9NA 3LKWA 3P6ZB 5DKMA 1A5HA 1GHXH 2FOAA 2Z3EA 1MQ6A 4B2AA 1PPFE 2QAAA 1LQEA 1BTZA 2GGVB 1K1IA 1SC8U 1OP0A 1VR1H 2BD5A 1JWTA 2BLOA 1G3BA 1EAIA 1ZTJA 3RXHA 4B2BA 6CHAC 2Y7XA 3SUGA 2XTTB 1GWAA 5A8YA 2Y5FA 4ZHLU 1K1LA 3MO6A 4WF8A 5BRRE 2Z3DA 3BTDE 4OS1A 3BTHE 3TK9A 2R9PA 4OS6A 4AFUA 3ZVCA 2BY7X 3ZZ5A 1YPLH 1O2PA 2G52A 1JRSA 3KN2A 3NKKA 1DT2A 2WPLS 3VB5A 1KXAA 5HYOA 2EA3A 1NN6A 2GDEH 1VITF 5FPYA 3RMMH 1FPCH 1MD8A 4ASHA 1P2IA 3QGNB 1AHTH 1NROH 4CR5A 1UTKA 1LPGB 1MQ5A 2ALVA 2HPPH 3SU2A 1F0TA 4DCDA 4I8LA 1EJAA 2SNWA 3BV9B 2VIQA 2D2DA 4FUFA 1P12E 2GKVE 3P8OA 3GISB 1SGPE 2LNCA 1L0ZA 1UTPA 3ZVDA 3RXFA 2FOHA 2GMTB 3I77A 3DD2H 1Z8IB 2IPHA 1FMGA 3SN8A 2FWWA 2GZ8A 1XUGA 5EQQA 1EXFA 1O30A 2C8WB 4FUIA 2ANKH 2LPRA 2Y6TA 2BD8A 1C2HA 1TNLA 4QT8C 3T2NA 1RTFB 2P3FH 4Z0KA 4WY3A 3UOPA 1BITA 1D9IA 2RG3A 4XFQA 2BQ6B 4YT7H 1TALA 1W14U 1GI3A 1BMAA 3U1JB 5DPAA 1INCA 4WH6A 4Y7BA 4O9VA 3A84A 4IBLH 2ZHEH 3CS7A 4MTBA 2BVXH 1VJAU 1DLKB 3W95A 1ZHMA 1GCDA 3QLPH 3U98H 5EOKA 3BEIB 1C2MA 3RU4D 1IQHA 3UTUH 2XC0A 1Z8JB 3AASA 3R3GB 3S7HB 1E0FD 1SGFG 2P95A 3PMJA 1GBTA 4JZ1A 1YPMH 3ATKA 2G55A 2XBWA 4NIYA 1S84A 2GX4A 1UMAH 3Q3KA 2AMDA 1O2TA 2QA9E 3LOXA 1A61H 1O3AA 4ABJA 2BHGA 4ESTE 1S83A 1S0QA 3B8JA 1ELVA 1KXEA 1UVSH 3SNBA 2SFAA 1SFQB 1X7AC 1HAVA 2BXTH 4ABEA 1SLXB 1C2DA 2BD4A 4TPYA 1C2JA 3STJA 3M7QA 1SGTA 2CHAC 3H5CB 1DWDH 1O2HA 1YC0A 3QTOH 2Z6BD 4TWWA 3E16B 3RU4E 4ZKOU 3LH3A 2NU3E 3BSQA 3MI4A 3A85A 3BF6H 3DA9B 1KYNA 2EI8A 2OQ5A 4R8TB 4K2YA 5FAHA 1H9LB 4O03A 5T6DA 3L6PA 4I8KA 1OWDA 1ZGIA 1WV7H 3FANA 2FOEA 1SGIB 1TAWA 1CT4E 1FY5A 1N8OC 3SHAH 3GCTG 7GCHG 1O2LA 4D7FA 1QA7A 2A7HA 1ZPBA 3F68H 1TONA 5EQSA 3SJKA 2XNIA 2OINA 1KIGH 3W94A 2PHBA 1V2UT 4OS7A 2VIPA 3UWJH 3UNSA 3GICB 4FUDA 3LGYA 3ZZ9A 1GMDF 2GV6A 3E90B 5EXNA 1PPZA 3A7TA 3SU1A 2JH5D 3B23B 2W7SA 1AFQC 2WUCA 2ZO3H 3BEFB 5JBBS 1C1SA 1GGDC 1CT0E 4MPVA 3RXKA 2Z9IA 1C2FA 1NO9H 3Q3XA 2RA0A 1V2RT 1LHFH 1XX9A 2BLWA 1GCTC 1WTHD 2F3CE 3GY4A 3PMHB 4NA9H 4B73A 1DXWA 1N6XA 4ISOA 1XVOA 4BAMB 3KQDA 1TYNA 1P10A 3LGVA 2QV1A 2R0KA 4D7GA 1O2QA 1VITG 2UUJB 2I6SA 4O3UA 4FUHA 2SGPE 4Y71A 1Z1JA 3NK8A 1OWHA 3IG6B 3M36A 3IWMA 4UEHH 1NT1A 5BPEA 3V3MA 3T26A 2J94A 2A7CA 2A5KA 1TNKA 2XBYA 1HUTH 3Q00A 3BIVH 1JXPA 1TNGA 1EUFA 2Z3CA 1O3GA 1EKBB 1GJ6A 1P06A 3M3SA 3QO6A 3ZVEA 4X0WU 4ZHAA 5H4IB 3V0XA 1FIWA 4LZ4B 3RXDA 1VCWA 1YPKH 5AFZH 4M7GA 3A82A 4YZUA 3LGTA 3DFLA 1FAKH 1KLIH 1JOUB 1C1VH 1V2WT 1O3KA 4JZDH 1TBRH 1EAXA 1KY9A 3RC6A 2QC2A 1K1OA 4IN2A 1BA8B 2ZDKA 4BNRA 5DJ7A 4X2YA 1MTSA 1OKXA 1MCTA 8LPRA 1SG8B 4U2WA 1BRCE 1HGTH 1AUJA 2I6QA 4KGAA 5LPEA 1BCUH 2XYAA 5DP4A 5LPFA 1SFIA 1ZMNA 4JCNA 3MHWU 2XC4A 1FONA 2QIQA 1GG6B 2ZHFH 1FI8A 1MU8B 2EI7A 3RXRA 2A4RA 3QZQA 5JDUB 1QGFA 1XUIA 1W0ZU 1GL0E 1QQ4A 2ZHWH 3PLPA 1DPOA 2G4UA 1ZZZA 1L4DA 5FCKA 4IN1A 1ZRBA 1PYTC 1MCVA 5E2OA 2V3OH 1Q2WA 1HIAB 2HALA 3VGCB 3M5LA 3A86A 3RXBA 2AFQB 2GTBA 3GCOA 3TH2H 2FI4E 2V0BA 4FXGH 3KQEA 3TGIE 1S82A 3NZIA 1YPGH 1UCYK 1QNJA 2J92A 1GHAG 1DLEA 4Y7AA 2ZNKH 4B1TA 5A0BA 1QRWA 4DT7B 1QJ6B 2THFB 1XKBC 1C1NA 3SZNA 1W11U 1GHWH 2OBQA 1LO6A 4KELA 1MZAA 1B5GH 1ELBA 1AVXA 1GBEA 4AX9H 4FVBA 1RJXB 3R0FA 2BZAA 3EYDA 1TRMA 2DUCA 1TPPA 3TK6A 3RXAA 4ABDA 1FV9A 1IHSH 3MWIU 4J1YA 1OWIA 1AVWA 1P9SA 5GCHF 1FUJA 2H5DA 3SV9A 1Y3YA 2ASUB 2J95A 1MZDA 4TY6A 5C5OA 2PFEA 2KAIA 3MNSA 4RKJB 1A5IA 1YCPK 2QF0A 2F9OA 5E0JA 1ZPZA 1O3LA 2WYJA 1BRUP 1E35B 3RXUA 2Z7FE 2TIOA 4ABGA 4WMFA 2QXGA 2VWLA 5AHGH 1GMDG 4X1SU 1H1BA 1SQAA 3MU4A 1ZPCA 2W26A 1O2MA 4K1TA 1O3IA 1FIZA 3GY8A 1THPB 1LVYA 1O3OA 1HAGE 5F8XA 3ODDA 3TIUA 4SGAE 4NCYA 3SUFA 4CRAA 2BDYA 2EC9H 4ZH8A 3TGJE 3FP6E 2UWOA 1UK2A 1D4PB 1FN8A 5L2YH 4X6PA 1DUEA 4X8UH 4X2WA 2BTCE 1S0RA 1KXBA 4NZLA 3E91A 3A88A 2ZGJA 4I8GA 4HZHA 2V3HH 5EXLA 1O32A 1Z8RA 2XW9A 1AU8A 3E6PH 2AEIH 2BD7A 4BAOB 1CBWB 4NFEA 1FY8E 1PQ5A 3ZZ3A 1XXDA 2HRVA 4INKA 4NWLA 1A0HB 1MD7A 3ZVGA 1G2MA 3GY3A 1DICA 1UTLM 2QXIA 4Q7ZA 1NFXA 1PQ7A 1UTNA 1Y3WA 2PTNA 1P3EA 3TVJB 1QBOA 5C20A 1D3PB 1BT7A 2R3UA 1TGCA 2ZFRH 3M7UA 1O3CA 1KSNA 1HCGA 2Z94A 4AFQA 4AYYB 4THNH 1TQ7B 3TK5A 1L1GA 2FM2A 2ZQ1A 4LOYH 1YBWA 2C4FH 3ZZ7A 1UHBA 1RGQA 4IC6A 2D26C 1BRAA 1FY3A 1GJ8B 1LQDB 1H9IE 3OSYA 1LPKB 8KME2 1UVPA 2ZFSA 1BMLA 1LHDH 4H6TA 3NXPA 2GMTC 2HPQH 1C1RA 1Q31A 1YLCA 5EW2H 2ZEBA 5LPRA 2XBVA 1AKSB 2WPMS 1MAXA 1TWXB 1K2I1 3I78A 3EA7A 2VINA 2C3SA 2ZGCA 1BMMH 2AMPA 4FUGA 3ATIA 1GBKA 1LVBA 1RD3B 2Z9JA 2HVXA 1ZSJA 2ZZUH 3MH6A 4YTAA 2AMQA 2PKSB 3OU0A 2A4OA 4GPGA 2FOGA 3AW1A 2RA3A 2ZC9H 1IOEA 3U8RH 2STBE 3CP7A 4FU8A 2VGCB 1C5MD 3LC5A 3RXMA 1GDNA 5CE1A 5EQRA 4NG9H 3U8OH 1IQFA 2FTLE 1QY6A 2H1UA 3S9BA 1ZHPA 1C5PA 3TH3H 1VITH 1G32B 1NRRH 4Y6DA 3QTVH 3SBKA 1QCPA 1MBQA 1SGDE 3Q76A 3M5MA 2CF8H 3I29A 5GIBA 5C3NA 3SI4H 1A2CH 1GJ7B 1KDQA 4Y79A 1J14A 1V3XA 3KNXA 1ZYOA 1WQSA 3RMOH 1AB9B 4MG3A 1S85A 1LTOA 1T31A 1UTJA 3V13A 3RLWH 1D6RA 2JKHA 3SOSA 2FOBA 1YPEH 2QY0B 3FVFB 3P8FA 1E34B 3BN9A 4YESB 1AY6H 5FX5A 2ZU5A 1DS2E 2GT8A 4F4OC 5HGGA 2ZHDA 5JPMH 3NUMA 1WCZA 2ZKSA 1UCYH 4A1XA 2GD4B 4GAWA 1W0YH 3RXIA 3OYPA 2F83A 1EB2A 1BJUA 2FO9A 1O36A 1ZLRA 3M5NA 1W2KH 3RXJA 1GPZA 3PLKA 1O5DH 3GCTF 4CRCA 2ZFTA 7GCHF 1EP5A 2ALPA 1JIMA 3TU7H 1DANH 1TMBH 4INLA 4INHA 1A4WH 3UIRA 1ESAA 5GDSH 3ODFA 1V2MT 2BDCA 3M3TA 4R0IA 2K1QA 1WAYB 2B5TB 2GVFA 3UY9A 3TJOA 3V7TA 1GI0A 3A8CA 4BANB 1K9OE 2ZGHA 2FLRH 3ATMA 3MU5A 2SGFE 1DFPA 1UVUH 2G8TA 3QGJA 3MFJA 3NCLA 4OS4A 1XKAC 1PPBH 2NU1E 2QXJA 5JBAS 5HM9A 2ZDVH 1GVKB 3ATWA 3KGPA 3SU6A 1QB6A 2VB0A 2TPIZ 1OP2A 1S5SA 3QK1A 1YCPH 4Q2KA 1EOJA 4X6NA 3ATLA 1P03A 3N7OA 1K28D 1P9UA 4I8JA 5EW1H 5G4BA 3UPEA 1BB0B 1U6QA 2UWLA 4CRDA 3SUEA 2P59A 4Q7XA 3ZZCA 2ESTE 3GDUA 4Q7YA 4UFGH 2OBOA 2VIWA 2G5VA 3LIWA 1F5LA 1N1LA 3MO9A 4YT6H 1O2UA 3GY6A 1ZGVA 1C2KA 1O31A 1AUTC 4KTUA 4XBDA 3C1KA 4AFSA 1O5BB 4KTSA 1PPCE 1MMJN 3L3TA 5C1UA 3S9CA 3LPRA 1TABE 2AYWA 4Y0ZE 2PW8H 3SJ8A 1HJAB 3ENSB 3TGKE 2ZDMA 2QN5T 3M35A 4D9RA 1GJ5H 3U1IB 2C8YB 3ZVFA 1IHTH 4UONA 2OP9A 4MPWA 1C5OH 2Y7ZA 1BHXB 1V2ST 3E0NB 2VWOA 3ZZBA 3EA8A 4YOIA 1QL7A 4UFFH 1RXPA 4FVDA 1K22H 1TPSA 4CR9A 2Q6DA 2ZPQA 1GI7B 1O35A 3T29A 1C5ZB 1S6FA 1TPAE 1SHYA 2H2ZA 1FAXA 1CSOE 2PKAB 3H7TA 1TFXA 2HNTE 2IJOB 5HM2A 1CQQA 2VWMA 3VFEA 1F0RA 3BG4B 3EDXB 4MNWA 3T27A 4I8HA 1G3CA 2SGAA 2ODPA 1ETTH 2B9LA 1A5GH 1C5XB 2VIVA 1ZSLA 1C5WB 2R0LA 1QB1A 5F8TA 5F8ZA 1IQKA 3TLOA 2AH4X 1NY22 1ABJH 2Q6FA 2ZG0H 3GCHB 4ABFA 5E0GA 1RTKA 4NZQA 1GI5A 1GG6C 2FX4A 1BZXE 1O5CB 1A1RA 1QL9A 5A8ZA 3ZYDA 1GBDA 5CMXH 1QTFA 1O3MA 3SGBE 3RMNH 3FP7E 4NFFA 2TGPZ 2CGAA 4HI3A 1O3DA 3D49H 2FYRA 3VGCC 1TX7A 3A7XA 3PB1E 1TGNA 3LU9B 2XCFA 4X6MA 2FDAA 4VGCB 2UUKB 4AOQA 1OOKB 1WTGH 1GHAF 5A0CA 3BTWE 2F91A 1XM1A 1V2PT 2AS9A 4Y8YA 2O8MA 4AB9A 2NU4E 2OC8A 1MH0A 1IQJA 2ZTYA 4UE7H 5FBIA 1V2QT 1G2LA 4J2YB 1O3EA 2A4GA 6ESTA 4FUEA 3KHVA 4XSKU 1O2KA 1T4UH 4WVPE 1DY9A 7ESTE 1O3NA 3ITIA 3BG8A 4DVAU 5C1YA 1BMNH 3U8TH 2A5AA 3T25A 2ODYB 2ANWA 3K65B 1TNIA 1YYY1 1TPOA 4GHQA 2P94A 4K60A 1GDQA 2HOBA 1FZZA 5E8EH 1RFNA 2FLBH 3RXLA 1NFWA 3D62A 4MVNA 1K1PA 4B76A 2OXSA 4GHTA 1EP6A 1O2OA 1O3FA 1V2NT 3UNQA 2A5IA 5FX6A 3BTFE 3UUZA 4ZMAH 1SGYE 2ZU4A 4UFDH 1O2NA 1PPGE 1VZQH 1PQ8A 2P8OB 1TOCB 4ZKNU 1J15A 5DP6A 3F9GA 1F0UA 1SGEE 5A09A 4WH8A 3M37A 3D23A 4UD9H 1GL1A 2FX6A 3RC4A 2FPZA 1DDJA 2BDIA 4X8VH 1A0JA 1GJBB 2ZCKP 2TGTA 1GDUA 2PR3A 3O8CA 1F92A 1WU1A 1RIWB 2ZCHP 1SGFA 1B7XB 4KP0A 3MMGA 3RXSA 4FUCA 4NA8A 1HIAA 3K6ZA 2Z9GA 3TJVA 1O5GH 2XBXA 3O8DA 5IYTA 2VU8E 1CBWC 5SGAE 2HNTF 1IQLA 1ID5H 5DP8A 2V35A 2C8ZB 4ZKSU 1C1MA 1BBRK 3RC5A 2NU0E 2WV5A 1P04A 2FMJA 1IQGA 1O2SA 1PPEE 3QX5H 3T62A 1NPMA 1YPHC 2O9QA 1KTTB 1ABIH 4A1TA 5AF9H 3LC3A 4A7IB 2CMYA 1SQOA 3MU8A 1OYQA 3M3VA 5GPIB 3UR6A 1O33A 2CXVA 3F6UH 1EAUA 3RMLH 1TBZH 4BAKB 2ZFQH 2F9BH 4ABBA 1RTLA 3ZYEA 1P2OA 1DWEH 2ZP0H 1G36A 4D76A 2ANMH 3M61U 1GJAB 1CA0C 4GUXA 3LJOA 1HFDA 1YLDA 2BDBA 3URCA 2QGRA 1ACBE 4TYDA 3P17H 1Y5UT 3A7ZA 1RS0A 1HPGA 3RXOA 3E1XB 1EPTB 1HJ8A 3EAJA 1O5FH 1NC6A 2Z9KA 2IOTA 1JBUH 1IQIA 1P2KA 1V2LT 2VVVA 3RXEA 3VB6A 1HB0B 2UWPA 5L30H 2PKSC 3UQOA 5FPSA 2ZPSA 3MH4A 1C2GA 1P2NA 4DURA 3ZV8A 1ARCA 5DK1A 4ZXYH 3RXGA 3BTGE 1P09A 1ELDE 2XC5A 3G01A 2VH6A 2PGBB 1YM0A 3SU3A 3S0NA 4TY7A 2O8UA 3P92A 1PJPA 2VGCC 2ZFPH 1PPHE 2OTVA 4Q80A 4CRGA 3OY5U 5JB8S 1P02A 3GDVA 2BLQA 3HK6B 3RXPA 2WPJS 2B8OH 1ELEE 3NPSA 3UFAA 3LGIA 5EODA 3SQHE 3HGPA 1C5TA 2STAE 4HFPB 1WBGB 4FUJA 1CGIE 1XUFA 2TBSA 1XUHA 1NFYA 1DVAH 1TRNA 1AB9C 5L2ZH 2GCHG 1GBJA 5J4SA 1DY8A 2VVCA 4CH2B 1F5RA 1Y3UA 3LJJA 1UVOA 4GVUA 1K1JA 5EG4A 2PLXA 1TGTA 4U30A 1O0DH 2BX3A 1SB1H 1HXFH 3LONA 1ZHRA 1P2JA 2G4TA 1TGBA 1ETSH 1B0FA 1P2QA 3PO1B 1ZTLA 1HAOH 4K8YA 1Z8GA 1E36B 1Y5BT 2H9EH 1OPHB 1AO5A 3A7VA 2ILNA 3MNCA 1GMHG 5CHAB 1C1QA 1ZSKA 2P16A 1W7GH 1ELAA 4MPXA 1YPJH 2ZTZA 2FS8A 1O2XA 1MTWA 1T4VH 1H4WA 1UTMA 1P3CA 2WYGA 1J16A 3SGAE 3TITA 1FY1A 1KLTA 1BTUA 1SQTA 3RU4T 1GJDB 5DP5A 4K1SA 1P2MA 4I33A 2ZGXH 5K0HA 1V6DA 1VGCB 1AKSA 1HDTH 2UUYA 1GBLA 3GYLB 1F2SE 3QZRA 3L33A 1Z71A 4HTCH 1D3QB 2WINI 4AB8A 3ZV9A 1FDPA 4YO9A 2BM2A 4IS5A 2FIRH 3GY5A 4SGBE 4CHAB 3O8RA 1T7CA 2FOFA 5HXFA 3Q3YA 4F49A 1F5KU 2QF3A 2BDHA 3MYWA 1ETRH 2FYQA 4H4FA 5DGJA 3SORA 3SU4A 1DM4B 2D1JA 2HLCA 3V12A 1UJ1A 3SHCH 1T8MA 1O38A 1UK3A 2HNTC 2ZA5A 2BLVA 1CGJE 3P8NA 3RM2H 3T5FH 5TJXA 4RKOB 5A2MH 1EAWA 2W3IA 5JBTA 2TGDA 2J34A 1W7XH 1C4U2 1P57B 2A32A 2Q1JA 2XRCA 2HWLB 1TA2A 4JK5A 3MU1A 1AE8H 1J17T 3F9FA 1HAIH 1HJAC 1XXFA 4MLFB 3AAUA 1FNIA 1W3CA 1GBIA 3SV2H 1SLUB 4DG4A 4XE4A 1O34A 2Q6GA 1OWJA 2KAIB 1CHGA 4IMZA 1OYTH 4B2CA 2P3TB 2GP9B 3SO3A 4ZHMU 1SHHB 1KXCA 3VXEH 2Y82A 5LH8A 1ESBA 3TJNA 1LMWB 4JYVH 4JZEH 2BY9X 5E0HA 4MPUA 3VPKA 1GHVH 1GVZA 1ANCA 4Y8XA 4BAHB 3HK3B 2BQWB 1BBRH 1QL8A 4CBNA 4O3TA 1P01A 3EGKH 3BG4C 3A81A 1FY4A 1BTHH 3KQCA 4ABHA 5AFYH 1LVOA 1UK4A 2P3UB 3JZ2B 2M5TA 1ZJKA 1GI8B 4JK6A 1GHBG 5I25A 2GDDA 3PM3A 5ETXA 4BAQB 1DWBH 1Y5AT 1HLTH 5T6FA 4A1VA 4KKDA 2SGEE 2CJIA 1GI9B 1GI2A 2GCTB 2A45B 1HAHH 1BIOA 1LKAA 1P05A 3ZVAA 2J4IA 1NM6A 3MH7A 3U69H 1CO7E 1L1JA 1ARBA 1LKBA 1PYTD 2QCYA 4X8TH 1C5UA 1TOMH 1A3BH 2XWAA 8GCHG 1V2TT 2C8XB 1Y3XA 2FI3E 5FPTA 1DXPA 1MUEB 4VGCC 5GJ4B 1LDTT 1DITH 3JZ1B 3P70B 2VNTA 2FODA 1AQ7A 2AGIX 2ANYA 4IMQA 1WOFA 1BTWA 1EZSC 1O5EH 1A0LA 1C5QA 4NSYA 2VH0A 2ZQ2A 3KF2A 4ABIA 1MTNB 4OGXA 3TNTA 5LGOA 1T8OA 1UHBB 4I31A 2JETB 2Y80A 4IGDA 1TA6A 1NTPA 1MBMA 1VCPA 1Z6JH 2ZWLH 1ANBA 1TB6H 4YLQH 1P8VC 3RUOA 3SJOA 1OSSA 3SUDA 3SV7A 1SBWA 2ULLA 2BDGA 2BMGB 1QURH 2BOKA 4B75A 5C67A 1W13U 2EI6A 1QA0A 2J38A 2QYIA 4X1PU 3M7TA 1GBCA 4K5ZA 3KL6A 4E7NA 2C93B 1XUKA 4WMDA 4K3JA 1O3BA 3NWUA 2AIPA 2SGDE 5GWZA 4Y11E 2SNVA 3F1SB 1HBTH 1Z1IA 1ZTKA 1DSUA 2XWBI 2H6MA 3T28A 2UUFB 4IC5A 3FZZA 3GOVB 2BY5X 3HGNA 1ZMJA 2BVRH 2PKAA 1A46H 1GBMA 3KQBA 1OXGA 1SGNE 2P8OC 3DFJA 2ZGBH 3RXTA 5FCRA 2H5CA 5EU8A 2PWXA 1T8NA 2WV4A 1XMNB 4Y76A 1V2VT 4WMEA 1BJVA 1L4ZA 1LHGH 1GI4A 1QB9A 3CS0A 3URDA 2A2XH 3PWCA 1AD8H 6LPRA 4LXBH 1C5NH 4XOJA 2BXUH 4UFEH 5B6OA 3ZZ8A 2PGQB 3SU0A 1KDQB 1GI1A 1G3EA 2OCVB 1YP9A 4GSOA 1MKWK 4BTIB 4DIIH 3A8AA 1O2WA 4NIXA 1RIWC 3LGUA 1OS8A 5K7RA 1TNJA 2Y5GA 5C1XA 4A6LA 2VWNA 1GHYH 2HGTH 4MDSA 1ZOMA 1O2ZA 3GCNA 2FI5E 3SNCA 2F9NA 4BTUB 3LH1A 1AFEH 3HATH 1C5SA 1ZRKA 1YGCH 3UWIA 2BB4A 1Y8TA 4NIWA 3AVZA 5JYIA 2FOMB 1IQMA 1RRKA 2ZDAH 2O8TA 2OLGA 2VIDA 5DO4H 4FU9A 2ZF0H 1CA8B 3K6YA 4I32A 5DP7A 3SI3H 1VJ9U 2O8WA 1TMUH 5ESTE 1BUIA 3P8GA 2BOHB 4U32A 1O3JA 1Y3VA 1CHOG 1LVMA 1C2LA 3A89A 4JYTA 4LK4A 3ZZDA 1C9TA 2A4QA 1TNHA 1CT2E 1MKXK 1BQYA 1GMCG 3SGQE 4B71A 1B0EA 1AMHA 2W3KA 1O2GH 5ABWA 1EPTC 5PTPA 1C9PA 1L1NA 1LPZB 3PLBA 5JB9S 4HGCA 4OS2A 4CREA 3A7WA 1CU1A 5E2PA 5A8XA 3ZZ6A 3F9EA 4PROA 1NRPH 3OY6U 2R2WU 1C1UH 1C5RA 4ZUHA 3SW2B 4AZ2B 4E05H 1K1MA 4AFZA 1XVMA 4NA7A 2PSYA 2AIQA 3A80A 4ABAA 1F0SA 4DY7B 1FPHH 4WXIA 3FP8E 1W8BH 3AW0A 1SPJA 2NWNA 4AYVB 1SL3A 4GCHG 1TGSZ 1SGCA 1ELTA 4E06H 1MTUA 2PTCE 3KCGH 2GCHF 2A0QB
chains in the Genus database with same CATH superfamily
3RXQA 3F2FA 3M5OA 6GCHF 2A1DB 1M9UA 1ELFA 4YLUA 1OHHD 4X1RU 3VXFH 1GVLA 3BTQE 1V2KT 2ZI2H 1QBVH 4DW2U 2FP7B 3KEEA 1MTVA 3PO1C 4NGAH 5GXPA 5J4QA 1TMTH 4BTTB 2A31A 1GBHA 1K0HA 1SMFE 5T3HA 4I7YH 1EB1H 1ELCA 1GJ4H 1GMHF 1SGRE 5DG6A 2W7UA 5HIYA 5CHAC 1GBAA 2ZIQH 3PTBA 2AGEX 4DJZB 2KCOA 2AGGX 2PUXB 2WPKS 4YM9A 1D3TB 1DX5M 2F4LA 1AZ8A 3RM0H 3S69A 4DGJA 3E8LA 1VCQA 3LGWA 6CHAB 1EJNA 4AN7A 1VGCC 3OX7U 2RCEA 3ZVBA 4RSPA 2GZ9A 4X2XA 2PUQH 2FEQH 1WQVH 2BY8X 2FZZA 1C5LH 1GBFA 3A83A 3LDXH 3BEUA 2ZDNA 4CHAC 1EPTA 2WPHS 1EZXC 4GLYA 1HAVB 3RXVA 2BVSH 4MNYA 1J8AA 4ISIH 4KTCA 1AN1E 1OWEA 2VIOA 5EJLA 4X1QU 4XDEA 1L2EA 2OQUA 1EZUC 2M2AA 3F0OA 1BRBE 1HAYB 2ZHQH 5AVDA 2JDID 3VB4A 1OX1A 2BQ7B 3MTYA 5EPYA 3BTKE 3UOUA 4AG1A 3BTME 3CENA 3K2UA 4O97A 1S81A 1S6HA 2CV3A 2Y81A 1QIXB 1SVPA 4AG2A 1ESTA 4D8NA 1FLEE 3S9AA 3D65E 4Y8ZA 4K69A 3Q77A 4ZROA 1BHXF 2JH6D 1IAUA 3HKJB 1K21H 1WYKA 3RDZA 1KTSB 1A3EH 4FU7A 1WSSH 3VB3A 1GJ9B 1EQ9A 1MKWH 2G5NA 3S7KB 2GT7A 3PV5A 3DCLA 1UTOA 4BOHA 1FXYA 3MU0A 1THRH 3A87A 1C1PA 1Q3XA 1JMOH 1SSXA 3RP2A 2NU2E 2GZ7A 1QBNA 1NU9A 1NS3A 3SV6A 1THSH 2SGQE 2PSXA 4OGYA 5C2ZA 1YKTA 2O8LA 1NRSH 3OE7D 4WXVA 5FXLA 1IQEA 1G9IE 1KXDA 2BD3A 2F9UA 1D6WA 2IN2A 1V2JT 1FN6A 4WWYA 1W12U 1YCPM 4UDWH 7KMEH 1NRQH 2YNBA 1OP8A 9LPRA 4H6SB 1E37B 3BTTE 1NESE 1O2JA 5C17A 1GHBF 4MNVA 1YY3A 3TH4H 4D9QA 2ZECA 3SNEA 1N6YA 3FFGA 1T32A 3QUMP 1TX6A 5DP3A 1DSTA 3SJ9A 2ODQA 5T6GA 2GCTC 3PV4A 4ACAA 1C2EA 5FHTA 2XCNA 5F53A 2WPIS 2B0FA 3OFND 4BXWA 4X6OA 8GCHF 2ZU3A 5C5NA 1AZZA 4YOGA 2PV9B 2WUBA 1MKXH 1EZQA 2J98A 3H7OA 1C1WH 1AVGH 1CGHA 1HRTH 1JRTA 4ISNA 2CHAB 6GCHG 4TPIZ 3UREA 1GBBA 2W5EA 1XUJA 1DOJA 3RLYH 1SLVB 1C4V2 1MTNC 4CBOA 1NRNH 3MOCA 3U9AH 2IPQX 2DE8A 2JETC 1HXEH 2J97A 3UR9A 1SLWB 3BTEE 4ISHH 1O39A 3A7YA 1N8OB 2F9PA 4FUBA 4RN6A 1O37A 4ZAEA 1NFUA 1BTPA 2D8WA 3PMAB 4NIVA 4F48B 5EPNA 4JMYA 3SU5A 3F9HA 4A5TS 2OC0A 4AGKA 3PRBA 1TRYA 1Z6EA 3GY7A 2BD9A 1DWCH 1TBQH 4E7RG 1ORFA 3MQKC 2OC1A 3GY2A 1UTQA 2FTMA 1AFQB 2FS9A 2BY6X 1UVTH 2BZ6H 3LT3A 1PFXC 2L74A 1GGDB 3A8DA 1PQAA 4OS5A 2A7JA 2ZFFH 1QR3E 1H8DH 1HYLA 3ESTA 1QFKH 1AI8H 1GCTB 1KMHB 2P93A 1AGJA 1ZMLA 3HKIB 1EJMA 5TCAA 1HNEE 1JIRA 4CRBA 5I46H 4X8SH 1D3DB 4B74A 2G51A 1VKYA 3MNXA 3STIA 2RDLA 3OTJE 1SI5H 1KXFA 3SJIA 4MQAA 1AIXH 5GNDA 1O2YA 3EA9A 1BTYA 1G30B 4YOJA 1C4Y2 3BIUH 3IITA 3FAOA 4NWKA 1HAXB 4DOQA 5EJ1A 2Z9LA 1KLJH 4WJG2 2JH0D 4DIHH 1J9CH 1HJ9A 1SGQE 2AERH 1QJ1B 3TPIZ 2TRMA 1QRZA 4MNXA 5FBEA 3C27B 3ZZ4A 3ZZAA 1F7ZA 1NZQH 1C5YB 1QRXA 1SOZA 4A92A 4XBBA 1UO6A 2V7QD 3QDZB 1O3PB 2V6NA 1LCYA 1IQNA 2K8IA 5DP9A 1Z7KA 1ANDA 1DE7H 2C90B 1ANEA 2XXLA 2A2QH 4ACBA 2KFWA 1P11E 1EX3A 2BD2A 2CN0H 1BBRE 5F6MA 2QXHA 4JZIA 1QJ7B 1WUNH 4H42U 9ESTA 3GDSA 2OC7A 5EXMA 3VEQB 1OWKA 1QHRB 3SNAA 1EOLA 1HAZB 3EQ0H 1HAPH 3RXCA 2RFKC 3EE0B 3TJUA 3MH5A 5IDKA 1ZJDA 2YMSD 4NSVA 2OD3B 2ZU2A 2ZU1A 4IW4E 5EGMA 3TNSA 4CRFA 1BDAA 4X2VA 5ESBA 2G81E 1E79D 2BDAA 2F9VA 3PROA 4U01A 4K1EA 2GV7A 2HVYB 1V2OT 1AE5A 2G00A 5F03A 1YF4A 1W10U 3KIDU 1TE0A 1Y59T 1TIOA 1TLDA 1CA0B 1H9HE 4K8BA 4TWYA 1GJCB 2B7DH 4XBCA 3DT0H 8ESTE 1O5AB 3PYHA 1CHOF 1O2VA 2ZPRA 1CVWH 1FQ3A 2WSSD 3GCHC 3HPTB 3QWCH 1G37A 4BXSA 3FO8D 1GMCF 2EEKA 3WY8A 3UQVA 1C1OA 3ELAH 1YPHE 1CE5A 3DUXH 5HMAA 3UNRA 1P0SH 1FJSA 2EQNA 1W0JD 4ZXXH 2VVUA 3MNBA 3QN7A 1A7SA 1C1TA 3SV8A 4JYUH 5TCCA 2BX4A 4FOUC 3SQEE 1MAYA 2YNAA 1E38B 4ZKRU 1UCYE 1O2RA 2ZCLP 1DUAA 2H9HA 2TGAA 3PMBB 3U28C 1GI6A 1HV7A 2ZDLA 4Z6AH 1BTXA 3GYMA 1TX8A 1C2IA 1G3DA 4ISLA 5L6NH 1BOQA 4JZFH 2H9TH 3E3TA 1EASA 3B9FH 2FESH 5JBCS 1AWHB 3MO3A 2VJ1A 2BYAX 3SNDA 3DHKH 2FXRA 3FZDA 2R2MB 3E0PB 1H8IH 4GCHF 1AWFH 2J2UA 3P95A 2QE7D 3K9XB 1O3HA 2YOLA 7LPRA 5GCHG 1ZR0A 4Y0YE 2R3YA 2Y5HA 1MU6B 1QQUA 4Y10E 1LHCH 1YLNA 4AGJA 1ELGA 1NU7B 1W0KD 3O8BA 3A8BA 4LZ1H 1K1NA 1SOTA 5A0AE 1O2IA 2OUAA 4AORA 1C5VA 3AAVA 1LHEH 1TQ0B 3VB7A 2FOCA 4HG6A 2CF9H 1EATA 2DE9A 1SR5C 4CH8B 3PTNA 4F55A 2ZTXA 4X1NU 1WDIA 3PWBA 4P02A 1GHZA 1T8LA 2J9NA 3LKWA 3P6ZB 5DKMA 1A5HA 1GHXH 2FOAA 2Z3EA 1MQ6A 4B2AA 1PPFE 2QAAA 1LQEA 2QF5A 1BTZA 2GGVB 1K1IA 1SC8U 1OP0A 1VR1H 2BD5A 1JWTA 2BLOA 1G3BA 1EAIA 5HKKD 1ZTJA 3RXHA 4B2BA 3UB0A 6CHAC 2Y7XA 3SUGA 2XTTB 1GWAA 5A8YA 2Y5FA 4ZHLU 1K1LA 3MO6A 4WF8A 5BRRE 2Z3DA 3BTDE 4OS1A 3BTHE 3TK9A 2R9PA 3UAIC 4OS6A 4AFUA 3ZVCA 2BY7X 3ZZ5A 1YPLH 1O2PA 2G52A 1JRSA 3KN2A 3NKKA 1DT2A 2WPLS 3VB5A 1KXAA 5HYOA 2EA3A 1NN6A 2GDEH 1VITF 5FPYA 3RMMH 1FPCH 1MD8A 4ASHA 1P2IA 3QGNB 1AHTH 1NROH 4CR5A 1UTKA 1LPGB 1MQ5A 2ALVA 3SYJA 2HPPH 3SU2A 1F0TA 4DCDA 4I8LA 1EJAA 2SNWA 3BV9B 2VIQA 3FKSD 2D2DA 4FUFA 1P12E 2GKVE 3P8OA 3GISB 1SGPE 2LNCA 1L0ZA 1UTPA 3ZVDA 3RXFA 2FOHA 2GMTB 3I77A 3DD2H 1Z8IB 2IPHA 1FMGA 3SN8A 2FWWA 2GZ8A 1XUGA 5EQQA 1EXFA 1O30A 2C8WB 4FUIA 2ANKH 2LPRA 2Y6TA 2BD8A 1C2HA 1TNLA 4QT8C 3T2NA 1RTFB 2P3FH 4Z0KA 4WY3A 3UOPA 1BITA 1D9IA 2RG3A 4XFQA 2BQ6B 4YT7H 1TALA 1W14U 1GI3A 2VBCA 1BMAA 3U1JB 5DPAA 1INCA 4WH6A 4Y7BA 4O9VA 3A84A 4IBLH 2ZHEH 3CS7A 4MTBA 2BVXH 1VJAU 1DLKB 3W95A 1ZHMA 1GCDA 3QLPH 3U98H 5EOKA 3BEIB 3FOAA 1C2MA 3RU4D 1IQHA 3UTUH 2XC0A 1Z8JB 3AASA 3R3GB 3S7HB 1SKYE 1E0FD 1SGFG 2P95A 3PMJA 1GBTA 4JZ1A 1YPMH 3ATKA 2G55A 2XBWA 4NIYA 1S84A 2GX4A 1UMAH 3Q3KA 2AMDA 1O2TA 2QA9E 3LOXA 1A61H 1O3AA 2EY4C 4I86A 2BHGA 4ABJA 4ESTE 1S83A 1S0QA 3B8JA 1ELVA 1KXEA 2LP6A 1UVSH 3SNBA 5KECA 2SFAA 1H8ED 1SFQB 1X7AC 1HAVA 2BXTH 4ABEA 1SLXB 1C2DA 2BD4A 4TPYA 1C2JA 3STJA 3M7QA 1SGTA 2CHAC 3H5CB 1DWDH 1O2HA 1YC0A 3QTOH 2Z6BD 4TWWA 3E16B 3RU4E 4ZKOU 3LH3A 2NU3E 3BSQA 3MI4A 3A85A 3BF6H 3DA9B 1KYNA 2EI8A 2OQ5A 4R8TB 4K2YA 5FAHA 1H9LB 4O03A 5T6DA 3L6PA 4I8KA 1OWDA 1ZGIA 1WV7H 3FANA 2FOEA 1SGIB 4Q63A 1TAWA 1CT4E 1FY5A 1N8OC 3SHAH 3GCTG 7GCHG 1O2LA 4D7FA 1QA7A 2A7HA 1ZPBA 3F68H 2W6ID 1TONA 5EQSA 3SJKA 2XNIA 2OINA 1KIGH 3W94A 2PHBA 2GJGA 1V2UT 4OS7A 2VIPA 3UWJH 3UNSA 3GICB 4FUDA 3LGYA 3ZZ9A 1GMDF 2GV6A 3E90B 5EXNA 1PPZA 3A7TA 3SU1A 2JH5D 3B23B 2W7SA 1AFQC 2WUCA 2ZO3H 3BEFB 5JBBS 1C1SA 1GGDC 1CT0E 4MPVA 3RXKA 2Z9IA 1C2FA 1NO9H 3Q3XA 2RA0A 3KYGA 1V2RT 1LHFH 1XX9A 2BLWA 1GCTC 1WTHD 2F3CE 3GY4A 3PMHB 4NA9H 4B73A 1DXWA 1N6XA 4ISOA 1XVOA 4BAMB 3KQDA 2RDEA 2KX4A 2KCPA 1TYNA 1P10A 3LGVA 2QV1A 2R0KA 4D7GA 1NBMD 1O2QA 5CHBA 1VITG 2UUJB 2I6SA 4O3UA 4FUHA 2SGPE 4Y71A 1Z1JA 3NK8A 1OWHA 3IG6B 3M36A 3IWMA 4UEHH 1NT1A 4DT4A 5BPEA 3V3MA 3T26A 2J94A 2A7CA 2A5KA 1TNKA 2XBYA 1HUTH 3Q00A 3BIVH 3SZEA 2OK5A 1JXPA 1TNGA 1EUFA 2Z3CA 1O3GA 1EKBB 1GJ6A 1P06A 3M3SA 5FL7D 3QO6A 3ZVEA 1WXRA 4X0WU 4ZHAA 5H4IB 3V0XA 1FIWA 2AHME 4XD7D 4LZ4B 3RXDA 1VCWA 2XNDD 1YPKH 5AFZH 4M7GA 3A82A 4YZUA 3LGTA 4P00A 3DFLA 1FAKH 1KLIH 1JOUB 4RT1A 1C1VH 1V2WT 1O3KA 4JZDH 1TBRH 1EAXA 1KY9A 3RC6A 2QC2A 1K1OA 4IN2A 1BA8B 2ZDKA 4BNRA 5DJ7A 4X2YA 1MTSA 1OKXA 1MCTA 8LPRA 1SG8B 5EJZA 4U2WA 3N7DA 1BRCE 1HGTH 1AUJA 2I6QA 4KGAA 5LPEA 1BCUH 2XYAA 5DP4A 5LPFA 1SFIA 1ZMNA 4JCNA 3MHWU 2XC4A 1FONA 2QIQA 1GG6B 2ZHFH 1FI8A 1MU8B 2EI7A 3RXRA 2A4RA 3QZQA 5JDUB 1QGFA 1XUIA 4M9FA 1W0ZU 1GL0E 1QQ4A 2ZHWH 3PLPA 1DPOA 2G4UA 1ZZZA 1L4DA 5FCKA 4IN1A 1ZRBA 1PYTC 1MCVA 5E2OA 2V3OH 1Q2WA 1HIAB 2HALA 3VGCB 3M5LA 3A86A 3RXBA 2AFQB 2GTBA 3GCOA 3TH2H 2FI4E 2HLDD 2V0BA 5CDFE 3F0PA 4FXGH 3KQEA 3TGIE 1S82A 3NZIA 1YPGH 1UCYK 1QNJA 2J92A 1GHAG 1DLEA 4Y7AA 2ZNKH 4B1TA 5A0BA 1QRWA 5C0UA 4DT7B 1QJ6B 2LELA 2THFB 1XKBC 1C1NA 3SZNA 1W11U 1GHWH 2OBQA 1LO6A 4KELA 1MZAA 1B5GH 1ELBA 3DSPA 1AVXA 1GBEA 4AX9H 4FVBA 1RJXB 3R0FA 2BZAA 3EYDA 1TRMA 2DUCA 1TPPA 3TK6A 3RXAA 4ABDA 5B6LA 1FV9A 1IHSH 3MWIU 4J1YA 1OWIA 1S6LA 1AVWA 1P9SA 5GCHF 1FUJA 2H5DA 3SV9A 1Y3YA 2ASUB 2J95A 1MZDA 4TY6A 3DSOA 5C5OA 2PFEA 2KAIA 3MNSA 4RKJB 1A5IA 1YCPK 2QF0A 2F9OA 5E0JA 1ZPZA 1O3LA 2WYJA 1BRUP 1E35B 3RXUA 2Z7FE 2TIOA 4ABGA 3PRDA 4WMFA 2QXGA 2VWLA 5AHGH 1GMDG 4X1SU 1H1BA 3KYFA 1SQAA 3MU4A 1ZPCA 2W26A 4FETA 1O2MA 4K1TA 1O3IA 1FIZA 3GY8A 1THPB 1LVYA 1O3OA 1HAGE 5F8XA 3ODDA 3TIUA 4SGAE 4NCYA 3SUFA 4CRAA 2BDYA 2EC9H 4ZH8A 3TGJE 3FP6E 2UWOA 1UK2A 1D4PB 1FN8A 5L2YH 1QZ8A 4X6PA 1DUEA 4X8UH 4X2WA 2BTCE 1S0RA 1KXBA 1E1RD 4NZLA 3E91A 3A88A 2ZGJA 4I8GA 4HZHA 2V3HH 5EXLA 1O32A 1Z8RA 2XW9A 1AU8A 3E6PH 2AEIH 2BD7A 4BAOB 1CBWB 4NFEA 1FY8E 5DN6D 1PQ5A 3ZZ3A 1XXDA 2HRVA 4INKA 4NWLA 5KEDA 1A0HB 1MD7A 3ZVGA 1G2MA 3GY3A 1DICA 1UTLM 2QXIA 4Q7ZA 1NFXA 1PQ7A 1UTNA 1Y3WA 2PTNA 1P3EA 3TVJB 1QBOA 5C20A 1D3PB 1BT7A 2R3UA 3H09A 1TGCA 2ZFRH 3M7UA 1O3CA 1KSNA 1HCGA 2YMSB 2Z94A 3ZIAD 4AFQA 4AYYB 4THNH 1TQ7B 3TK5A 1L1GA 2FM2A 2ZQ1A 4LOYH 1YBWA 2C4FH 3ZZ7A 1UHBA 3W1EA 1RGQA 4IC6A 2D26C 1BRAA 1FY3A 1GJ8B 1LQDB 1H8HD 1H9IE 3OSYA 1LPKB 8KME2 1UVPA 2ZFSA 1BMLA 1LHDH 4H6TA 3NXPA 2GMTC 2HPQH 1C1RA 1Q31A 1YLCA 5EW2H 2ZEBA 5LPRA 2JIZD 2XBVA 1AKSB 2WPMS 1MAXA 1TWXB 1K2I1 3I78A 3EA7A 2VINA 2C3SA 2ZGCA 1BMMH 2AMPA 4FUGA 3ATIA 1GBKA 1LVBA 1RD3B 2Z9JA 2HVXA 2J5UA 2V3MA 1ZSJA 2ZZUH 3MH6A 4YTAA 2AMQA 2PKSB 3OU0A 2A4OA 1FX0B 4GPGA 2FOGA 3AW1A 2RA3A 2ZC9H 1IOEA 3U8RH 2STBE 3CP7A 4FU8A 2VGCB 1C5MD 3LC5A 3RXMA 1GDNA 5CE1A 5EQRA 4NG9H 3U8OH 3AK5A 1IQFA 2FTLE 1QY6A 3NRLA 2H1UA 3S9BA 1ZHPA 1C5PA 3TH3H 1VITH 1G32B 1NRRH 4Y6DA 3QTVH 3SBKA 1QCPA 1MBQA 1SGDE 3Q76A 3M5MA 2CF8H 3I29A 5GIBA 5C3NA 3SI4H 1A2CH 1GJ7B 1KDQA 4Y79A 1J14A 1V3XA 3KNXA 1ZYOA 1WQSA 3RMOH 1AB9B 4MG3A 1S85A 1LTOA 1T31A 1UTJA 3V13A 2WPDD 3RLWH 1D6RA 2JKHA 3SOSA 2FOBA 1YPEH 2QY0B 3FVFB 3P8FA 1E34B 3BN9A 4YESB 3F2GA 1AY6H 5FX5A 2ZU5A 1DS2E 2GT8A 2K0QA 4F4OC 5HGGA 2ZHDA 5JPMH 3NUMA 1WCZA 2ZKSA 1UCYH 4A1XA 2GD4B 4GAWA 1W0YH 3RXIA 3OYPA 2F83A 1EB2A 1BJUA 2FO9A 1O36A 1ZLRA 3M5NA 1W2KH 3RXJA 1GPZA 3PLKA 1O5DH 3GCTF 4CRCA 2ZFTA 7GCHF 1EP5A 2ALPA 1JIMA 3TU7H 1DANH 1TMBH 4INLA 4INHA 1A4WH 3UIRA 1ESAA 5GDSH 3ODFA 1V2MT 2BDCA 3M3TA 4R0IA 3WWFA 2K1QA 2L6OA 1WAYB 2B5TB 2GVFA 3UY9A 3TJOA 3V7TA 1GI0A 3A8CA 4BANB 1K9OE 2ZGHA 2FLRH 3ATMA 3MU5A 2SGFE 1DFPA 1UVUH 2G8TA 3QGJA 3MFJA 3NCLA 4OS4A 1XKAC 1PPBH 2NU1E 2QXJA 5JBAS 5HM9A 2ZDVH 1GVKB 4ZCNA 3ATWA 3KGPA 3SU6A 1QB6A 2VB0A 2TPIZ 1OP2A 1S5SA 3QK1A 1YCPH 4Q2KA 1EOJA 4X6NA 3ATLA 1P03A 3OAAD 3N7OA 1K28D 1P9UA 4I8JA 5EW1H 5G4BA 3UPEA 1BB0B 1BMFD 1U6QA 2UWLA 4CRDA 3SUEA 2W6JD 2P59A 4Q7XA 3ZZCA 2ESTE 3GDUA 4Q7YA 4UFGH 4YXWD 2OBOA 2VIWA 2G5VA 3LIWA 1F5LA 1N1LA 3MO9A 4YT6H 1O2UA 3GY6A 1ZGVA 1C2KA 1O31A 1AUTC 4KTUA 4XBDA 3C1KA 4AFSA 1O5BB 4KTSA 1PPCE 1MMJN 3L3TA 5C1UA 3S9CA 3LPRA 1TABE 2AYWA 4Y0ZE 2PW8H 3SJ8A 1HJAB 3ENSB 3TGKE 2ZDMA 2QN5T 3M35A 4D9RA 1GJ5H 3U1IB 2C8YB 3ZVFA 1IHTH 3WWBA 4UONA 2OP9A 4MPWA 1C5OH 2Y7ZA 1BHXB 1V2ST 3E0NB 2VWOA 3ZZBA 3EA8A 4YOIA 1QL7A 4UFFH 1RXPA 4FVDA 1K22H 1TPSA 4CR9A 2Q6DA 2ZPQA 3OEED 1GI7B 1O35A 3T29A 1C5ZB 1S6FA 1TPAE 1SHYA 2H2ZA 1FAXA 1YWUA 1CSOE 2PKAB 3H7TA 1TFXA 2HNTE 2IJOB 5HM2A 1CQQA 2VWMA 3VFEA 1F0RA 3BG4B 3EDXB 4MNWA 3T27A 4I8HA 1G3CA 2SGAA 2ODPA 1ETTH 2B9LA 1A5GH 1C5XB 2VIVA 1ZSLA 1C5WB 2R0LA 1QB1A 5F8TA 5F8ZA 1IQKA 3TLOA 2KCAA 2AH4X 1NY22 1ABJH 2Q6FA 2ZG0H 3GCHB 4ABFA 5E0GA 1RTKA 4NZQA 1GI5A 1GG6C 2FX4A 1BZXE 1O5CB 1A1RA 1QL9A 5A8ZA 3ZYDA 1GBDA 5CMXH 1QTFA 1O3MA 4OM9A 3SGBE 3RMNH 3FP7E 4NFFA 2TGPZ 2CGAA 2WHXA 4HI3A 1O3DA 3D49H 2FYRA 3VGCC 1TX7A 3A7XA 3PB1E 4AC9A 1TGNA 3LU9B 2XCFA 4X6MA 2FDAA 4VGCB 2UUKB 4AOQA 2F43B 1OOKB 1WTGH 1GHAF 5A0CA 3BTWE 2F91A 1XM1A 1V2PT 2AS9A 4Y8YA 2O8MA 4AB9A 2NU4E 2OC8A 1MH0A 1IQJA 2ZTYA 4UE7H 5FBIA 1V2QT 1G2LA 4J2YB 1O3EA 2A4GA 6ESTA 4FUEA 3KHVA 4XSKU 1O2KA 1T4UH 2IJD1 4WVPE 1DY9A 7ESTE 3PV2A 1O3NA 3ITIA 3BG8A 4DVAU 5C1YA 1BMNH 3U8TH 2A5AA 3T25A 2ODYB 2ANWA 3K65B 1TNIA 1YYY1 1TPOA 4GHQA 2WV9A 2P94A 4K60A 1GDQA 2HOBA 1FZZA 5E8EH 1RFNA 2FLBH 3RXLA 1NFWA 3D62A 4MVNA 1K1PA 4B76A 2OXSA 4GHTA 1EP6A 1O2OA 1O3FA 1V2NT 3UNQA 2A5IA 5FX6A 3BTFE 3UUZA 4ZMAH 1SGYE 2ZU4A 4UFDH 1O2NA 1PPGE 1VZQH 1PQ8A 2P8OB 1TOCB 4ZKNU 1J15A 5DP6A 3F9GA 1F0UA 1SGEE 5A09A 4WH8A 3M37A 3D23A 4UD9H 1GL1A 2FX6A 3RC4A 2FPZA 1DDJA 2BDIA 4X8VH 1A0JA 1GJBB 5KGOA 2ZCKP 2TGTA 3WW7A 1GDUA 2PR3A 3O8CA 1F92A 1WU1A 4TSFD 1RIWB 2ZCHP 1SGFA 1B7XB 4KP0A 3MMGA 3RXSA 4FUCA 4NA8A 4TT3D 1HIAA 3K6ZA 2Z9GA 3TJVA 1O5GH 2XBXA 3O8DA 5IYTA 2VU8E 1CBWC 5SGAE 2HNTF 1IQLA 1ID5H 5DP8A 2V35A 2C8ZB 4ZKSU 1C1MA 1BBRK 3RC5A 2NU0E 2WV5A 1P04A 2FMJA 1IQGA 1O2SA 1PPEE 3QX5H 3T62A 1NPMA 1YPHC 2O9QA 3N99A 1E1QD 2YMSC 3VG8A 1KTTB 1ABIH 4A1TA 5AF9H 3KQ5A 2PP6A 3LC3A 4A7IB 2CMYA 1SQOA 1NBME 3MU8A 1OYQA 3M3VA 5GPIB 3UR6A 1O33A 2CXVA 3F6UH 1EAUA 3RMLH 1TBZH 4BAKB 2ZFQH 2F9BH 4ABBA 1RTLA 3ZYEA 1P2OA 1DWEH 2ZP0H 1G36A 4D76A 2ANMH 3M61U 1GJAB 1CA0C 4GUXA 3LJOA 1HFDA 1YLDA 2BDBA 3URCA 2QGRA 1ACBE 4TYDA 3P17H 1Y5UT 3A7ZA 1RS0A 1HPGA 3RXOA 3E1XB 1EPTB 1HJ8A 3EAJA 1O5FH 1NC6A 2Z9KA 2IOTA 1JBUH 1IQIA 1P2KA 1V2LT 2VVVA 3RXEA 3VB6A 1HB0B 2UWPA 5L30H 2PKSC 3UQOA 5FPSA 2ZPSA 3MH4A 1C2GA 1P2NA 4DURA 3ZV8A 1ARCA 5DK1A 4ZXYH 3RXGA 3BTGE 1P09A 1ELDE 1UW7A 2XC5A 3G01A 2VH6A 2PGBB 1YM0A 3SU3A 3S0NA 4TY7A 2O8UA 3P92A 1PJPA 2VGCC 2ZFPH 1PPHE 2OTVA 4Q80A 4ASUD 3OY5U 4CRGA 5JB8S 1P02A 3GDVA 2BLQA 3HK6B 4Q4LA 3RXPA 2WPJS 2B8OH 1ELEE 3NPSA 3UFAA 3LGIA 2JJ2D 5EODA 3SQHE 3HGPA 1C5TA 2STAE 4HFPB 1WBGB 3OEHD 4FUJA 1CGIE 1XUFA 2TBSA 3GS9A 1XUHA 1NFYA 1DVAH 1COWD 1TRNA 1AB9C 5L2ZH 2GCHG 1GBJA 5J4SA 1DY8A 2VVCA 4CH2B 1F5RA 1Y3UA 3LJJA 4B6EA 1UVOA 4GVUA 1K1JA 5EG4A 2PLXA 1TGTA 4U30A 1O0DH 2BX3A 1SB1H 4RI0A 1HXFH 3LONA 1ZHRA 1P2JA 2WZQA 2G4TA 1TGBA 1ETSH 1B0FA 1P2QA 3PO1B 1ZTLA 1HAOH 4K8YA 1Z8GA 1E36B 1Y5BT 2H9EH 1OPHB 1AO5A 3A7VA 5T1VA 2ILNA 3MNCA 1GMHG 5CHAB 1C1QA 1ZSKA 2P16A 1W7GH 1ELAA 4MPXA 1YPJH 2ZTZA 2FS8A 1O2XA 1MTWA 1T4VH 1H4WA 1UTMA 1P3CA 2WYGA 1J16A 3SGAE 1EFRD 3TITA 1FY1A 1KLTA 1BTUA 1SQTA 3RU4T 1GJDB 5DP5A 4K1SA 3CNRA 1P2MA 4I33A 2ZGXH 5K0HA 1V6DA 1VGCB 1AKSA 1HDTH 2UUYA 1GBLA 3GYLB 1F2SE 3QZRA 3L33A 1Z71A 4HTCH 1D3QB 2WINI 4AB8A 3ZV9A 1FDPA 4YO9A 2BM2A 4IS5A 2FIRH 3GY5A 4SGBE 4CHAB 3O8RA 1T7CA 2FOFA 5HXFA 3Q3YA 4F49A 1F5KU 2QF3A 2BDHA 2J98B 3MYWA 1ETRH 2FYQA 4H4FA 5DGJA 3SORA 3SU4A 1DM4B 2D1JA 2HLCA 3V12A 1UJ1A 3SHCH 1T8MA 1O38A 1UK3A 2HNTC 2ZA5A 2BLVA 1CGJE 3P8NA 3RM2H 3T5FH 5TJXA 4RKOB 5A2MH 1EAWA 2W3IA 5JBTA 2TGDA 2J34A 1W7XH 1C4U2 1P57B 2A32A 2Q1JA 2XRCA 2HWLB 1TA2A 4JK5A 2KM0A 3MU1A 1AE8H 1J17T 3F9FA 1HAIH 1HJAC 1XXFA 4MLFB 3AAUA 1FNIA 1W3CA 1GBIA 3SV2H 1SLUB 4DG4A 4XE4A 2JJ1D 1O34A 2Q6GA 1OWJA 2KAIB 1CHGA 4IMZA 1OYTH 4B2CA 2P3TB 2GP9B 3SO3A 4ZHMU 1SHHB 1KXCA 3VXEH 2Y82A 5LH8A 1ESBA 3TJNA 1LMWB 4JYVH 4JZEH 2BY9X 5E0HA 4MPUA 3VPKA 1GHVH 1GVZA 1ANCA 3DSGA 4Y8XA 4BAHB 3HK3B 2BQWB 1BBRH 1QL8A 4CBNA 4O3TA 1P01A 3EGKH 3BG4C 3A81A 1FY4A 1BTHH 3KQCA 4ABHA 5AFYH 1LVOA 1UK4A 2P3UB 3JZ2B 2M5TA 5IK2D 1ZJKA 1GI8B 5C0TA 4JK6A 1GHBG 5I25A 2GDDA 3PM3A 5ETXA 4BAQB 1DWBH 1Y5AT 1HLTH 3EE7A 5T6FA 4A1VA 4KKDA 2SGEE 2CJIA 1GI9B 1GI2A 2GCTB 2A45B 1HAHH 1BIOA 1LKAA 1P05A 3ZVAA 2J4IA 1NM6A 3MH7A 3U69H 1CO7E 1L1JA 1ARBA 1LKBA 1PYTD 2QCYA 4X8TH 1C5UA 1TOMH 1A3BH 2XWAA 8GCHG 1V2TT 2C8XB 1SQRA 1Y3XA 2FI3E 5FPTA 1DXPA 1MUEB 4VGCC 5GJ4B 1LDTT 1DITH 3JZ1B 3P70B 2VNTA 2FODA 1AQ7A 4Z1MD 2AGIX 2ANYA 4IMQA 1WOFA 1BTWA 1EZSC 1O5EH 1A0LA 1C5QA 4NSYA 2VH0A 2ZQ2A 3KF2A 4ABIA 1MTNB 4OGXA 3TNTA 5LGOA 1T8OA 1UHBB 4I31A 2JETB 2Y80A 4IGDA 4B6FA 1TA6A 1NTPA 1MBMA 1VCPA 1Z6JH 2ZWLH 1ANBA 1TB6H 4YLQH 1P8VC 3RUOA 3SJOA 1OSSA 3SUDA 3SV7A 1SBWA 2ULLA 2BDGA 2BMGB 1QURH 2BOKA 4B75A 5C67A 1W13U 2EI6A 1QA0A 2J38A 2QYIA 4X1PU 3M7TA 1GBCA 3F3BA 4K5ZA 3KL6A 4E7NA 2C93B 1XUKA 4WMDA 4K3JA 1O3BA 3NWUA 2AIPA 2SGDE 5GWZA 4Y11E 2SNVA 3F1SB 1HBTH 5C94A 1Z1IA 1ZTKA 1DSUA 2XWBI 2H6MA 3T28A 2UUFB 4IC5A 3FZZA 3GOVB 2BY5X 3HGNA 1ZMJA 2BVRH 2PKAA 1A46H 1GBMA 3KQBA 1OXGA 1SGNE 2P8OC 3DFJA 2ZGBH 3RXTA 5FCRA 2H5CA 5EU8A 2PWXA 1T8NA 2WV4A 1XMNB 4Y76A 1V2VT 4WMEA 2KZ4A 1BJVA 1L4ZA 1LHGH 1GI4A 1QB9A 3CS0A 3URDA 2A2XH 3PWCA 1AD8H 6LPRA 4LXBH 1C5NH 4XOJA 2BXUH 4UFEH 5B6OA 3ZZ8A 2PGQB 3SU0A 1KDQB 1GI1A 1G3EA 2OCVB 1YP9A 4GSOA 1MKWK 4BTIB 2QF4A 3A8AA 4DIIH 1O2WA 4NIXA 1RIWC 3LGUA 1OS8A 5K7RA 1TNJA 2Y5GA 5C1XA 4A6LA 2VWNA 1GHYH 2HGTH 4MDSA 1ZOMA 1O2ZA 3GCNA 2FI5E 3SNCA 2CK3D 2F9NA 4BTUB 3LH1A 4RT0A 1AFEH 3HATH 1C5SA 1ZRKA 1YGCH 3UWIA 2BB4A 2XOKD 1Y8TA 4NIWA 3AVZA 5JYIA 2FOMB 1IQMA 1RRKA 2ZDAH 2O8TA 2OLGA 2VIDA 5DO4H 4FU9A 2ZF0H 1CA8B 3K6YA 4I32A 5DP7A 3SI3H 1VJ9U 2O8WA 1TMUH 5ESTE 1BUIA 3P8GA 5DSFA 2BOHB 4U32A 1O3JA 1Y3VA 1CHOG 3F2HA 1LVMA 1C2LA 3A89A 4JYTA 4LK4A 3ZZDA 1C9TA 2A4QA 1TNHA 1CT2E 1MKXK 5HIZA 1BQYA 1GMCG 3SGQE 3FN8A 4B71A 1B0EA 3OTPA 1AMHA 2W3KA 1O2GH 5ABWA 1EPTC 5PTPA 1C9PA 1L1NA 1LPZB 3PLBA 5JB9S 4XRNA 4HGCA 4OS2A 4CREA 5EIYA 3A7WA 1CU1A 5E2PA 5A8XA 3ZZ6A 3F9EA 4PROA 1NRPH 3OY6U 2R2WU 2KR7A 1C1UH 1C5RA 4ZUHA 3SW2B 4AZ2B 4E05H 1K1MA 4AFZA 1MABB 1XVMA 3N7EA 4NA7A 2PSYA 2AIQA 3A80A 4ABAA 1F0SA 4DY7B 2KCYA 1FPHH 4WXIA 3FP8E 1W8BH 3AW0A 1SPJA 2NWNA 4AYVB 1SL3A 4GCHG 1TGSZ 1SGCA 1ELTA 4E06H 1MTUA 2PTCE 3KCGH 2GCHF 2A0QB
chains in the Genus database with same CATH topology
3RXQA 3M5OA 6GCHF 2A1DB 1M9UA 1ELFA 4YLUA 4X1RU 3VXFH 1GVLA 3BTQE 1V2KT 2ZI2H 1QBVH 4DW2U 2FP7B 3KEEA 1MTVA 3PO1C 4NGAH 5GXPA 5J4QA 1TMTH 4BTTB 2A31A 1GBHA 1SMFE 5T3HA 4I7YH 1EB1H 1ELCA 1GJ4H 1GMHF 1SGRE 5DG6A 2W7UA 5CHAC 1GBAA 2ZIQH 3PTBA 2AGEX 4DJZB 2AGGX 2PUXB 2WPKS 4YM9A 1D3TB 1DX5M 1AZ8A 3RM0H 3S69A 4DGJA 3E8LA 1VCQA 3LGWA 6CHAB 1EJNA 4AN7A 1VGCC 3OX7U 2RCEA 3ZVBA 4RSPA 2GZ9A 4X2XA 2PUQH 2FEQH 1WQVH 2BY8X 2FZZA 1C5LH 1GBFA 3A83A 3LDXH 3BEUA 2ZDNA 4CHAC 1EPTA 2WPHS 1EZXC 4GLYA 1HAVB 3RXVA 2BVSH 4MNYA 1J8AA 4ISIH 4KTCA 1AN1E 1OWEA 2VIOA 4X1QU 4XDEA 1L2EA 2OQUA 1EZUC 1BRBE 1HAYB 2ZHQH 5AVDA 3VB4A 1OX1A 2BQ7B 3MTYA 5EPYA 3BTKE 3UOUA 4AG1A 3BTME 3CENA 3K2UA 4O97A 1S81A 1S6HA 2CV3A 2Y81A 1QIXB 1SVPA 4AG2A 1ESTA 4D8NA 1FLEE 3S9AA 3D65E 4Y8ZA 4K69A 3Q77A 4ZROA 1BHXF 2JH6D 1IAUA 3HKJB 1K21H 1WYKA 3RDZA 1KTSB 1A3EH 4FU7A 1WSSH 3VB3A 1GJ9B 1EQ9A 1MKWH 2G5NA 3S7KB 2GT7A 1UTOA 4BOHA 1FXYA 3MU0A 1THRH 3A87A 1C1PA 1Q3XA 1JMOH 1SSXA 3RP2A 2NU2E 2GZ7A 1QBNA 1NU9A 1NS3A 3SV6A 1THSH 2SGQE 2PSXA 4OGYA 5C2ZA 1YKTA 2O8LA 1NRSH 4WXVA 5FXLA 1IQEA 1G9IE 1KXDA 2BD3A 2F9UA 1D6WA 2IN2A 1V2JT 1FN6A 4WWYA 1W12U 1YCPM 4UDWH 7KMEH 1NRQH 2YNBA 1OP8A 9LPRA 4H6SB 1E37B 3BTTE 1NESE 1O2JA 1GHBF 4MNVA 3TH4H 4D9QA 2ZECA 3SNEA 1N6YA 3FFGA 1T32A 3QUMP 1TX6A 5DP3A 1DSTA 3SJ9A 2ODQA 5T6GA 2GCTC 3PV4A 1C2EA 5FHTA 2XCNA 2WPIS 2B0FA 4BXWA 4X6OA 8GCHF 2ZU3A 5C5NA 1AZZA 4YOGA 2PV9B 2WUBA 1MKXH 1EZQA 3H7OA 1C1WH 1AVGH 1CGHA 1HRTH 1JRTA 4ISNA 2CHAB 6GCHG 4TPIZ 3UREA 1GBBA 2W5EA 1XUJA 1DOJA 3RLYH 1SLVB 1C4V2 1MTNC 4CBOA 1NRNH 3MOCA 3U9AH 2DE8A 2JETC 1HXEH 3UR9A 1SLWB 3BTEE 4ISHH 1O39A 3A7YA 1N8OB 2F9PA 4FUBA 4RN6A 1O37A 4ZAEA 1NFUA 1BTPA 2D8WA 3PMAB 4NIVA 5EPNA 4JMYA 3SU5A 3F9HA 4A5TS 2OC0A 4AGKA 1TRYA 1Z6EA 3GY7A 2BD9A 1DWCH 1TBQH 4E7RG 1ORFA 2OC1A 3GY2A 1UTQA 2FTMA 1AFQB 2FS9A 2BY6X 1UVTH 2BZ6H 3LT3A 1PFXC 1GGDB 3A8DA 1PQAA 4OS5A 2A7JA 2ZFFH 1QR3E 1H8DH 1HYLA 3ESTA 1QFKH 1AI8H 1GCTB 2P93A 1AGJA 1ZMLA 3HKIB 1EJMA 5TCAA 1HNEE 1JIRA 4CRBA 5I46H 4X8SH 1D3DB 4B74A 2G51A 3MNXA 3STIA 2RDLA 3OTJE 1SI5H 1KXFA 3SJIA 4MQAA 1AIXH 1O2YA 3EA9A 1BTYA 1G30B 4YOJA 1C4Y2 3BIUH 3IITA 3FAOA 4NWKA 1HAXB 4DOQA 2Z9LA 1KLJH 4WJG2 2JH0D 4DIHH 1J9CH 1HJ9A 1SGQE 2AERH 1QJ1B 3TPIZ 2TRMA 1QRZA 4MNXA 5FBEA 3C27B 3ZZ4A 3ZZAA 1F7ZA 1NZQH 1C5YB 1QRXA 1SOZA 4A92A 4XBBA 1UO6A 3QDZB 1O3PB 2V6NA 1LCYA 1IQNA 5DP9A 1Z7KA 1ANDA 1DE7H 2C90B 1ANEA 2XXLA 2A2QH 1P11E 1EX3A 2BD2A 2CN0H 1BBRE 5F6MA 2QXHA 4JZIA 1QJ7B 1WUNH 4H42U 9ESTA 3GDSA 2OC7A 5EXMA 3VEQB 1OWKA 1QHRB 3SNAA 1EOLA 1HAZB 3EQ0H 1HAPH 3RXCA 3EE0B 3TJUA 3MH5A 5IDKA 1ZJDA 4NSVA 2OD3B 2ZU2A 2ZU1A 4IW4E 5EGMA 3TNSA 4CRFA 1BDAA 4X2VA 5ESBA 2G81E 2BDAA 2F9VA 3PROA 4U01A 4K1EA 2GV7A 1V2OT 1AE5A 2G00A 5F03A 1YF4A 1W10U 3KIDU 1TE0A 1Y59T 1TIOA 1TLDA 1CA0B 1H9HE 4K8BA 4TWYA 1GJCB 2B7DH 4XBCA 3DT0H 8ESTE 1O5AB 3PYHA 1CHOF 1O2VA 2ZPRA 1CVWH 1FQ3A 3GCHC 3HPTB 3QWCH 1G37A 4BXSA 1GMCF 2EEKA 3WY8A 3UQVA 1C1OA 3ELAH 1YPHE 1CE5A 3DUXH 5HMAA 3UNRA 1P0SH 1FJSA 4ZXXH 2VVUA 3MNBA 3QN7A 1A7SA 1C1TA 3SV8A 4JYUH 5TCCA 2BX4A 3SQEE 1MAYA 2YNAA 1E38B 4ZKRU 1UCYE 1O2RA 2ZCLP 1DUAA 2H9HA 2TGAA 3PMBB 1GI6A 1HV7A 2ZDLA 4Z6AH 1BTXA 3GYMA 1TX8A 1C2IA 1G3DA 4ISLA 5L6NH 1BOQA 4JZFH 2H9TH 3E3TA 1EASA 3B9FH 2FESH 5JBCS 1AWHB 3MO3A 2VJ1A 2BYAX 3SNDA 3DHKH 2FXRA 3FZDA 2R2MB 3E0PB 1H8IH 4GCHF 1AWFH 2J2UA 3P95A 3K9XB 1O3HA 2YOLA 7LPRA 5GCHG 1ZR0A 4Y0YE 2R3YA 2Y5HA 1MU6B 1QQUA 4Y10E 1LHCH 4AGJA 1ELGA 1NU7B 3O8BA 3A8BA 4LZ1H 1K1NA 1SOTA 5A0AE 1O2IA 2OUAA 4AORA 1C5VA 3AAVA 1LHEH 1TQ0B 3VB7A 2FOCA 2CF9H 1EATA 2DE9A 1SR5C 4CH8B 3PTNA 2ZTXA 4X1NU 3PWBA 1GHZA 1T8LA 2J9NA 3LKWA 3P6ZB 5DKMA 1A5HA 1GHXH 2FOAA 2Z3EA 1MQ6A 4B2AA 1PPFE 2QAAA 1LQEA 1BTZA 2GGVB 1K1IA 1SC8U 1OP0A 1VR1H 2BD5A 1JWTA 2BLOA 1G3BA 1EAIA 1ZTJA 3RXHA 4B2BA 6CHAC 2Y7XA 3SUGA 2XTTB 1GWAA 5A8YA 2Y5FA 4ZHLU 1K1LA 3MO6A 4WF8A 5BRRE 2Z3DA 3BTDE 4OS1A 3BTHE 3TK9A 2R9PA 4OS6A 4AFUA 3ZVCA 2BY7X 3ZZ5A 1YPLH 1O2PA 2G52A 1JRSA 3KN2A 3NKKA 1DT2A 2WPLS 3VB5A 1KXAA 5HYOA 2EA3A 1NN6A 2GDEH 1VITF 5FPYA 3RMMH 1FPCH 1MD8A 4ASHA 1P2IA 3QGNB 1AHTH 1NROH 4CR5A 1UTKA 1LPGB 1MQ5A 2ALVA 2HPPH 3SU2A 1F0TA 4DCDA 4I8LA 1EJAA 2SNWA 3BV9B 2VIQA 2D2DA 4FUFA 1P12E 2GKVE 3P8OA 3GISB 1SGPE 2LNCA 1L0ZA 1UTPA 3ZVDA 3RXFA 2FOHA 2GMTB 3I77A 3DD2H 1Z8IB 2IPHA 1FMGA 3SN8A 2FWWA 2GZ8A 1XUGA 5EQQA 1EXFA 1O30A 2C8WB 4FUIA 2ANKH 2LPRA 2Y6TA 2BD8A 1C2HA 1TNLA 4QT8C 3T2NA 1RTFB 2P3FH 4Z0KA 4WY3A 3UOPA 1BITA 1D9IA 2RG3A 4XFQA 2BQ6B 4YT7H 1TALA 1W14U 1GI3A 1BMAA 3U1JB 5DPAA 1INCA 4WH6A 4Y7BA 4O9VA 3A84A 4IBLH 2ZHEH 3CS7A 4MTBA 2BVXH 1VJAU 1DLKB 3W95A 1ZHMA 1GCDA 3QLPH 3U98H 5EOKA 3BEIB 1C2MA 3RU4D 1IQHA 3UTUH 2XC0A 1Z8JB 3AASA 3R3GB 3S7HB 1E0FD 1SGFG 2P95A 3PMJA 1GBTA 4JZ1A 1YPMH 3ATKA 2G55A 2XBWA 4NIYA 1S84A 2GX4A 1UMAH 3Q3KA 2AMDA 1O2TA 2QA9E 3LOXA 1A61H 1O3AA 4ABJA 2BHGA 4ESTE 1S83A 1S0QA 3B8JA 1ELVA 1KXEA 1UVSH 3SNBA 2SFAA 1SFQB 1X7AC 1HAVA 2BXTH 4ABEA 1SLXB 1C2DA 2BD4A 4TPYA 1C2JA 3STJA 3M7QA 1SGTA 2CHAC 3H5CB 1DWDH 1O2HA 1YC0A 3QTOH 2Z6BD 4TWWA 3E16B 3RU4E 4ZKOU 3LH3A 2NU3E 3BSQA 3MI4A 3A85A 3BF6H 3DA9B 1KYNA 2EI8A 2OQ5A 4R8TB 4K2YA 5FAHA 1H9LB 4O03A 5T6DA 3L6PA 4I8KA 1OWDA 1ZGIA 1WV7H 3FANA 2FOEA 1SGIB 1TAWA 1CT4E 1FY5A 1N8OC 3SHAH 3GCTG 7GCHG 1O2LA 4D7FA 1QA7A 2A7HA 1ZPBA 3F68H 1TONA 5EQSA 3SJKA 2XNIA 2OINA 1KIGH 3W94A 2PHBA 1V2UT 4OS7A 2VIPA 3UWJH 3UNSA 3GICB 4FUDA 3LGYA 3ZZ9A 1GMDF 2GV6A 3E90B 5EXNA 1PPZA 3A7TA 3SU1A 2JH5D 3B23B 2W7SA 1AFQC 2WUCA 2ZO3H 3BEFB 5JBBS 1C1SA 1GGDC 1CT0E 4MPVA 3RXKA 2Z9IA 1C2FA 1NO9H 3Q3XA 2RA0A 1V2RT 1LHFH 1XX9A 2BLWA 1GCTC 1WTHD 2F3CE 3GY4A 3PMHB 4NA9H 4B73A 1DXWA 1N6XA 4ISOA 1XVOA 4BAMB 3KQDA 1TYNA 1P10A 3LGVA 2QV1A 2R0KA 4D7GA 1O2QA 1VITG 2UUJB 2I6SA 4O3UA 4FUHA 2SGPE 4Y71A 1Z1JA 3NK8A 1OWHA 3IG6B 3M36A 3IWMA 4UEHH 1NT1A 5BPEA 3V3MA 3T26A 2J94A 2A7CA 2A5KA 1TNKA 2XBYA 1HUTH 3Q00A 3BIVH 1JXPA 1TNGA 1EUFA 2Z3CA 1O3GA 1EKBB 1GJ6A 1P06A 3M3SA 3QO6A 3ZVEA 4X0WU 4ZHAA 5H4IB 3V0XA 1FIWA 4LZ4B 3RXDA 1VCWA 1YPKH 5AFZH 4M7GA 3A82A 4YZUA 3LGTA 3DFLA 1FAKH 1KLIH 1JOUB 1C1VH 1V2WT 1O3KA 4JZDH 1TBRH 1EAXA 1KY9A 3RC6A 2QC2A 1K1OA 4IN2A 1BA8B 2ZDKA 4BNRA 5DJ7A 4X2YA 1MTSA 1OKXA 1MCTA 8LPRA 1SG8B 4U2WA 1BRCE 1HGTH 1AUJA 2I6QA 4KGAA 5LPEA 1BCUH 2XYAA 5DP4A 5LPFA 1SFIA 1ZMNA 4JCNA 3MHWU 2XC4A 1FONA 2QIQA 1GG6B 2ZHFH 1FI8A 1MU8B 2EI7A 3RXRA 2A4RA 3QZQA 5JDUB 1QGFA 1XUIA 1W0ZU 1GL0E 1QQ4A 2ZHWH 3PLPA 1DPOA 2G4UA 1ZZZA 1L4DA 5FCKA 4IN1A 1ZRBA 1PYTC 1MCVA 5E2OA 2V3OH 1Q2WA 1HIAB 2HALA 3VGCB 3M5LA 3A86A 3RXBA 2AFQB 2GTBA 3GCOA 3TH2H 2FI4E 2V0BA 4FXGH 3KQEA 3TGIE 1S82A 3NZIA 1YPGH 1UCYK 1QNJA 2J92A 1GHAG 1DLEA 4Y7AA 2ZNKH 4B1TA 5A0BA 1QRWA 4DT7B 1QJ6B 2THFB 1XKBC 1C1NA 3SZNA 1W11U 1GHWH 2OBQA 1LO6A 4KELA 1MZAA 1B5GH 1ELBA 1AVXA 1GBEA 4AX9H 4FVBA 1RJXB 3R0FA 2BZAA 3EYDA 1TRMA 2DUCA 1TPPA 3TK6A 3RXAA 4ABDA 1FV9A 1IHSH 3MWIU 4J1YA 1OWIA 1AVWA 1P9SA 5GCHF 1FUJA 2H5DA 3SV9A 1Y3YA 2ASUB 2J95A 1MZDA 4TY6A 5C5OA 2PFEA 2KAIA 3MNSA 4RKJB 1A5IA 1YCPK 2QF0A 2F9OA 5E0JA 1ZPZA 1O3LA 2WYJA 1BRUP 1E35B 3RXUA 2Z7FE 2TIOA 4ABGA 4WMFA 2QXGA 2VWLA 5AHGH 1GMDG 4X1SU 1H1BA 1SQAA 3MU4A 1ZPCA 2W26A 1O2MA 4K1TA 1O3IA 1FIZA 3GY8A 1THPB 1LVYA 1O3OA 1HAGE 5F8XA 3ODDA 3TIUA 4SGAE 4NCYA 3SUFA 4CRAA 2BDYA 2EC9H 4ZH8A 3TGJE 3FP6E 2UWOA 1UK2A 1D4PB 1FN8A 5L2YH 4X6PA 1DUEA 4X8UH 4X2WA 2BTCE 1S0RA 1KXBA 4NZLA 3E91A 3A88A 2ZGJA 4I8GA 4HZHA 2V3HH 5EXLA 1O32A 1Z8RA 2XW9A 1AU8A 3E6PH 2AEIH 2BD7A 4BAOB 1CBWB 4NFEA 1FY8E 1PQ5A 3ZZ3A 1XXDA 2HRVA 4INKA 4NWLA 1A0HB 1MD7A 3ZVGA 1G2MA 3GY3A 1DICA 1UTLM 2QXIA 4Q7ZA 1NFXA 1PQ7A 1UTNA 1Y3WA 2PTNA 1P3EA 3TVJB 1QBOA 5C20A 1D3PB 1BT7A 2R3UA 1TGCA 2ZFRH 3M7UA 1O3CA 1KSNA 1HCGA 2Z94A 4AFQA 4AYYB 4THNH 1TQ7B 3TK5A 1L1GA 2FM2A 2ZQ1A 4LOYH 1YBWA 2C4FH 3ZZ7A 1UHBA 1RGQA 4IC6A 2D26C 1BRAA 1FY3A 1GJ8B 1LQDB 1H9IE 3OSYA 1LPKB 8KME2 1UVPA 2ZFSA 1BMLA 1LHDH 4H6TA 3NXPA 2GMTC 2HPQH 1C1RA 1Q31A 1YLCA 5EW2H 2ZEBA