5GXPA

Cationic trypsin with gol/pge as dimer at ph 4.6
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cationic Trypsin With GOL/PGE as Dimer at pH 4.6
rcsb
molecule tags Hydrolase
molecule keywords Cationic trypsin
total genus 56
structure length 223
sequence length 223
chains with identical sequence B
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2016-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5gxpA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5gxpA02
4LZ4B 3D49H 5DP9A 2J4IA 1BZXE 3KN2A 2Z3DA 1C1MA 1GBLA 1Y3UA 3E1XB 5DK1A 2RG3A 1DM4B 1GCTB 1TB6H 3BTHE 3OSYA 3UNRA 4ZKOU 1GBIA 1MH0A 2HRVA 2ZFFH 3LDXH 3RXOA 1UMAH 1OYQA 3ZVGA 2QXGA 4YT7H 2CF8H 1V2NT 2BXUH 1SPJA 2ZTZA 1UTQA 1QR3E 1CQQA 1K28D 4YLQH 5FHTA 3T28A 2ODYB 2ZWLH 1VCQA 4LXBH 1FIWA 2VWMA 1T32A 4ABHA 1QRXA 5ESBA 2XC5A 4Y0YE 1AWFH 4ISNA 3S0NA 2G55A 4ISOA 1O3LA 1ZPBA 1IOEA 1K1IA 1O2ZA 3LJOA 4K2YA 3RLYH 1S84A 3RLWH 2LNCA 1T8LA 1XMNB 1MD7A 1WCZA 3EYDA 1TPPA 3UOUA 8GCHF 3TVJB 2H9HA 3BTQE 4X6MA 4CRCA 4ZH8A 1HAZB 1T8NA 1SQAA 1G32B 1DITH 3RXEA 1Z8RA 2FPZA 2W26A 1FY4A 1O2MA 2GTBA 3ZZ6A 1L4ZA 1C5OH 1C5NH 4MPUA 3B8JA 1HCGA 3BIVH 4AYVB 2PSXA 1UVTH 2ZKSA 1TGSZ 4AG1A 1G2MA 1GI7B 2EC9H 2FOBA 3VB6A 1DWBH 2GZ7A 1C2IA 1VCPA 1V2QT 1GBAA 4AG2A 1WTHD 2G00A 1DXPA 2ZECA 3M7UA 4MPWA 2H2ZA 3UOPA 1FONA 2OUAA 3DUXH 1BRUP 1AIXH 2ALVA 5E2OA 3ZVFA 4D76A 2VGCB 2A4GA 3PV4A 1GI4A 1ESTA 2A4QA 3U8TH 3M5MA 3SBKA 3DT0H 5K7RA 4NIYA 1IQLA 1PPEE 1MKWK 1GBFA 4FU8A 2AS9A 5T6DA 2BQ6B 3TGJE 3O8RA 4X8VH 1CHOF 4THNH 2C8YB 2QIQA 2ZPQA 3PMAB 1O2TA 1DLEA 1GI2A 1YPKH 1EB1H 1T4UH 2SNVA 5C1XA 4CRFA 1FN8A 1V3XA 1KTTB 3ATWA 5FPYA 1NU7B 1GHYH 4OS6A 1V2PT 1QCPA 1LPZB 2A2XH 3PB1E 2SGDE 2OQUA 3SU2A 3U98H 5LH8A 1ZTJA 2CN0H 5C3NA 2WUCA 1C4U2 1CVWH 1NRSH 1C5LH 1O0DH 3RXPA 1RTKA 4CREA 2BX4A 1LO6A 2P16A 5JYIA 1Y5AT 1SHYA 1PQ5A 1SSXA 2UUKB 2DE9A 2I6SA 5EXLA 3A83A 2NU2E 4NZLA 4X1PU 3A86A 3R3GB 3ZVBA 1F0TA 5AHGH 3DFLA 1LVYA 3UTUH 3A8DA 1IQHA 3STIA 3RXUA 3SZNA 1AD8H 1O32A 3L6PA 3GCHB 2GZ9A 4Y8ZA 2OC7A 3RC5A 2BLQA 5AFZH 1ABIH 2CV3A 1O2RA 2RA3A 1W0ZU 1IQGA 1B5GH 1OWJA 1ZR0A 1TALA 1WBGB 2XW9A 4DJZB 4X8UH 4D7FA 4Y11E 4INKA 3T62A 4ZAEA 5ETXA 4K5ZA 2ZDLA 2I6QA 4Y71A 3ZZBA 2O8MA 3AW0A 2YOLA 3OYPA 3RU4E 1PPBH 1BB0B 4NIVA 1C2GA 3RMMH 1CBWC 1V2OT 3RP2A 1ELEE 1YPJH 2G5VA 1GJ4H 5DKMA 2WUBA 3KHVA 2A0QB 2BLWA 1CA0C 1DUEA 4WMDA 1O30A 4OS4A 3SGQE 1GVZA 3MU0A 1GBCA 1OP0A 1Z1JA 1XUFA 3RDZA 1P09A 4MNXA 3TITA 2GVFA 1JXPA 1S81A 4ESTE 1IHSH 1C5UA 3RM2H 3E0NB 3T5FH 4ABEA 3P70B 1HLTH 1GMHG 3UNQA 4F49A 1SBWA 2WPHS 3M37A 5B6OA 5A0CA 3TGIE 3GY2A 5F6MA 3A82A 1NY22 3VGCC 2Z9GA 1C2KA 1GG6C 1O3CA 1GJBB 4CH8B 3Q77A 3SGBE 1E37B 1SLXB 1J8AA 3SJOA 1EAXA 2CHAC 1LPGB 2IPHA 2H6MA 4F4OC 2BDYA 2SGPE 1A4WH 4TPIZ 1V6DA 1RFNA 2FXRA 1X7AC 2ZDKA 4AB9A 4J2YB 2XYAA 3KQCA 1NRRH 2CGAA 4B71A 1TGBA 4K69A 2FS8A 1WSSH 2W7UA 1O3EA 3SUGA 1A0LA 2ZDAH 1OP2A 1GCDA 1S6HA 1V2KT 1ELDE 1E34B 1DSUA 2D26C 2PTNA 3ZZAA 2H5CA 5C5OA 1EKBB 3FP6E 3FVFB 1N8OC 3UY9A 1UHBB 5CMXH 1RIWB 2HALA 1YM0A 4ISIH 1NO9H 2ESTE 3BG4C 3HKIB 1BBRK 3M3VA 3PROA 1AUTC 3QDZB 5DO4H 1ZRKA 1TBQH 1SQOA 4IC6A 1KYNA 4DVAU 2EI8A 2O8LA 1LHDH 3ZVDA 2BDBA 3LGIA 1PQ7A 1NFWA 1O2JA 3KCGH 1GBJA 1GGDB 1YYY1 1IQIA 4A1VA 2FX6A 1GHWH 6CHAC 2TGTA 1O2HA 1NRQH 4O3UA 3SNCA 1ARCA 1D6WA 3UREA 4Q2KA 2PTCE 2AMQA 1QQ4A 4IC5A 1HAVB 2UUJB 2VIQA 1GI5A 3U1JB 1HUTH 3E90B 1GG6B 2ZHDA 1GVKB 1V2UT 4LK4A 2ZDNA 1SGFA 4NFEA 1HYLA 2FI3E 1O2GH 4FUCA 1C1OA 5ESTE 2FZZA 3FZZA 1O3IA 1CHOG 1B7XB 1O34A 1TMTH 1EB2A 1AHTH 1K21H 2GX4A 2BMGB 1ANEA 3QZQA 1T31A 2W3IA 3T29A 1QFKH 2FIRH 5C5NA 3LU9B 1MD8A 1XXDA 2VIWA 1P02A 4GUXA 4BAMB 2AGGX 7ESTE 2VIOA 3RMOH 1BTYA 1F0RA 2AGEX 4H42U 3MO3A 2BD2A 2AH4X 3ZV8A 3BIUH 3SGAE 3S7KB 5GCHF 3MH6A 3KQEA 2RDLA 1P2QA 1FPCH 2ILNA 2Y5GA 4TYDA 1UK4A 1LHFH 3F1SB 3Q3XA 4ZHMU 2Z7FE 2R0LA 4D7GA 1ETTH 2RCEA 4HZHA 2YNAA 3MTYA 5DPAA 3SU1A 2BVRH 1O5BB 3Q76A 1ZMLA 1FY3A 1TNIA 4D8NA 1CGHA 6CHAB 1K1MA 2VB0A 2ZCKP 3AASA 5G4BA 1W11U 1GI9B 1A46H 4GCHG 2C4FH 2ANKH 2GMTB 4U2WA 1DANH 3A8BA 1ZJDA 1C5YB 3MOCA 4K1EA 2VIVA 1V2VT 3BEFB 1F7ZA 1C5ZB 5PTPA 4GAWA 2UWLA 1GJ8B 1O3NA 1QJ1B 3MH5A 4JZDH 5DP8A 1F5RA 1C1SA 1PPZA 1SGPE 1SLVB 2JETB 2OXSA 3S7HB 2BVSH 1C5MD 3BV9B 3ZVAA 2ZZUH 5EW1H 3GCOA 4ZXYH 1L2EA 1UK3A 1AU8A 2BZ6H 2J94A 1SG8B 3K9XB 6GCHF 1FJSA 1EZSC 3GISB 3U9AH 3FP8E 2QAAA 1P2OA 4JZ1A 1LKAA 1ZGIA 2A5KA 4GHQA 1EP6A 3UQVA 4FVDA 1QL9A 3PTNA 1TRNA 1C1UH 1NFYA 3Q3KA 1O2LA 1A3BH 2VVVA 1ABJH 1BRAA 4WY3A 3QX5H 2GT7A 1JIMA 5DG6A 1A5IA 1P2MA 2F9UA 1AFEH 2CJIA 1GDNA 1IQMA 1EPTC 4XBDA 1HB0B 3SQEE 1DY8A 2BDCA 4TWWA 1MKWH 1O37A 3A8AA 1CGIE 1J17T 2ZGHA 4Y8XA 3RUOA 1IQJA 2BD9A 2XCNA 1UCYK 1SGYE 4B74A 3GCNA 3Q3YA 2Q6FA 1BTUA 1ESBA 1P8VC 4Y79A 1ZPCA 2TRMA 3OTJE 3GY4A 4RN6A 4IMQA 1Z71A 2B8OH 1SGDE 4RSPA 4J1YA 1QB9A 3K6ZA 2VNTA 4CBNA 4GHTA 1SLWB 1MQ5A 3KNXA 1RTFB 4UONA 1BQYA 2FOCA 7GCHG 4H4FA 2XBVA 1SMFE 5A0AE 3LH1A 1F92A 3O8CA 3A8CA 1EJAA 1ZMNA 1QURH 1K1PA 1LVBA 2F9BH 2FX4A 4R8TB 1AI8H 4AFSA 1VGCC 2GCTC 3QTOH 4HGCA 1UTJA 4K60A 1SLUB 1EZXC 3UQOA 5EXNA 4OS2A 2UWPA 2CF9H 5EU8A 4CHAC 3ZZ3A 5A8YA 3P17H 4CRAA 2BY6X 1QL7A 3V0XA 3VPKA 3S9AA 2P59A 4B2CA 4B1TA 2FODA 2VVUA 1FN6A 1K1LA 1L0ZA 4MLFB 5L2YH 1KDQA 1CT0E 1S5SA 1FQ3A 3CP7A 2A7JA 2HWLB 4Y8YA 2ZIQH 2RA0A 1F5KU 4XE4A 4FUBA 2OQ5A 2QXIA 2VWOA 3AW1A 5L6NH 1SHHB 2BDAA 5DGJA 3W95A 3MYWA 2OC8A 2PUQH 2ASUB 4CR5A 1AZ8A 4H6TA 1C2JA 1ZTKA 1BDAA 4ZROA 2G52A 4CBOA 4WWYA 3ZV9A 2OD3B 1AB9C 2BM2A 1HXEH 1O33A 1UVOA 5FCRA 1H9IE 1G3DA 3LKWA 3TK9A 1O2UA 1BMNH 1ZSJA 1YCPK 1YGCH 3QGNB 1P05A 1XKBC 1BCUH 2ZTYA 1MAXA 4MPVA 1ELAA 1K1JA 1YCPH 3LC3A 4U30A 1YPLH 2XWAA 2BD5A 3M5OA 3RXMA 4X8TH 4NIXA 2CXVA 5E0JA 1THSH 1OWEA 2ULLA 1KXEA 1OP8A 3BTEE 5JBCS 1MTNC 1O36A 4VGCB 4AYYB 2JETC 5CE1A 1GCTC 1HAIH 1PJPA 1O3JA 4NIWA 3SV2H 1G37A 4BAQB 4UD9H 1ELTA 2PW8H 3T27A 1TFXA 1P2IA 3F9HA 1O31A 1ELFA 2JH0D 1HAHH 1D6RA 1L1GA 1FLEE 2GDEH 1DWEH 1P06A 3URCA 1EOLA 4I33A 5TJXA 1B0FA 1MTSA 4DIHH 1T7CA 1S85A 1ELGA 4MDSA 4JYVH 2BDIA 3F68H 1KXDA 3MU1A 5JDUB 1DSTA 1GL0E 3PO1B 4ISHH 2V3HH 4XBBA 3TH3H 7GCHF 1O2WA 4NWKA 3W94A 3EQ0H 1XUGA 1EZQA 1ZHMA 2BY9X 3GY8A 2VH0A 2BLOA 1UVUH 3HATH 4FUJA 4I8HA 1HRTH 3TK6A 2QC2A 2GMTC 4H6SB 3VGCB 1IHTH 1JWTA 1DLKB 4JK6A 3D65E 3RXIA 2C90B 2K1QA 1NZQH 2XWBI 1RS0A 4BAOB 2FESH 4I8GA 2BD4A 6LPRA 1WOFA 4O3TA 2O8WA 2ANYA 1UHBA 2C8ZB 3G01A 4XDEA 1S6FA 4ZKSU 3UWJH 3MHWU 3C1KA 4AORA 1MMJN 2P3UB 2SNWA 1C1TA 1ZZZA 2H5DA 1A2CH 2G5NA 1DXWA 2WV5A 1AKSB 2BLVA 3PMHB 3ZZ8A 3L33A 2FOFA 2W3KA 4HFPB 5T6FA 2A45B 2G81E 3BG8A 1HJAB 4NFFA 3ATKA 3SO3A 1C1QA 1C1NA 3A7WA 3VB5A 4Y6DA 3ATLA 5C1UA 1TA2A 5BRRE 1TQ0B 2G8TA 1GI6A 1HFDA 5DP5A 4UFEH 2BX3A 3AAVA 4FU9A 1QBVH 3LIWA 3ESTA 3TNSA 4B73A 4ABBA 3EDXB 4B2AA 1Z7KA 2BOKA 2GCTB 4TY7A 9LPRA 3U1IB 1QRZA 4KP0A 1LHCH 2R3YA 2Y7ZA 4NZQA 4X1QU 1O2OA 1K9OE 1DFPA 3LGVA 1WV7H 5F8ZA 1C1PA 2OINA 1FZZA 4A5TS 3FAOA 1LTOA 5ABWA 1TX6A 1S83A 2EA3A 3UFAA 1Y3VA 2O8TA 1FPHH 2HOBA 3FFGA 1ZSKA 1ZPZA 5SGAE 3U8RH 5JBBS 2F83A 3CS0A 1O3FA 1SFIA 3SU3A 3SU4A 2A1DB 4I7YH 1O5AB 1YF4A 4JZIA 2BVXH 2ZF0H 1MUEB 1EX3A 3A80A 1DE7H 1SGIB 1TE0A 4I8JA 2PSYA 1V2MT 3R0FA 1Z8JB 1Y3YA 1LVMA 4B76A 2Y5HA 1Q3XA 3O8BA 5C20A 1S82A 5A8XA 2ZDVH 3LT3A 7LPRA 3LGTA 5C67A 3N7OA 4WF8A 1P10A 3M35A 2F9NA 1GI1A 1UVPA 5EGMA 2J95A 2TGDA 3A7XA 1F5LA 1FIZA 1MTVA 4ZKRU 4WH6A 1GHXH 1KY9A 1S0QA 1T4VH 3QN7A 1XM1A 4R0IA 1GHAG 1YPMH 4NSVA 3BSQA 3I29A 2Z6BD 1UJ1A 5EQRA 3GY6A 2ZGCA 3M3SA 4AZ2B 2PKSB 2TGPZ 3TH2H 3O8DA 5EQQA 2VJ1A 2BB4A 4U01A 2J9NA 1TABE 2BYAX 2H1UA 4UDWH 2WPLS 2ZTXA 1ID5H 3RC6A 3QZRA 1MKXK 1GBKA 1BBRH 2WYJA 1VJAU 3LH3A 3P8OA 5E0HA 1ZHRA 1K1OA 4CHAB 2V35A 4LZ1H 2BDGA 1CBWB 4WMEA 1VITG 2QXJA 3BEUA 8ESTE 1EAUA 4MG3A 3RXJA 2A4RA 3JZ1B 2DE8A 1C5XB 2B7DH 2FMJA 1H9LB 1IQFA 2XNIA 3Q00A 3RXBA 1C5PA 2UUYA 4Y76A 1TRYA 2HPPH 1P2JA 1XUIA 2O9QA 1CU1A 2OBOA 4INLA 4IMZA 4E05H 2J92A 4U32A 3V3MA 1SR5C 1TOMH 3MO9A 2EEKA 2ZFTA 1OWKA 1NM6A 1QJ7B 4QT8C 4ZHAA 1TNGA 1O2IA 1FAKH 1KXFA 2A31A 5A2MH 1V2LT 3SUDA 1DX5M 2BD3A 3PWCA 3ODFA 4YO9A 3UNSA 3I78A 4JZFH 4A1XA 1MCTA 3RXSA 3RXVA 3MH7A 1GBEA 1RJXB 1MQ6A 3AAUA 4Q7YA 3RMLH 4AGKA 1HAPH 2Z9IA 2H9TH 4MVNA 1OPHB 1N1LA 4K1SA 1HAYB 2F9VA 3SNDA 2ZFRH 4X2WA 1QIXB 5EXMA 5HM9A 4D9RA 4I32A 2J2UA 3P6ZB 2HNTC 5JB8S 2TGAA 1GHZA 1DOJA 2AFQB 2AEIH 1TLDA 1KLJH 1L1JA 2ZFPH 1TNLA 3BTKE 4RKOB 3S69A 2ZG0H 1BTZA 1C2EA 1TBRH 2ZGBH 1FV9A 3ODDA 1GMCF 1G9IE 1CT4E 1V2RT 2GZ8A 2ZGXH 1IAUA 4X2YA 2HNTE 1ZGVA 1THRH 4FUHA 1BMMH 4K8BA 2ZPRA 3SOSA 2AGIX 1KXCA 1LQDB 2NU1E 1GHVH 1O39A 2ZQ2A 4M7GA 1B0EA 1QQUA 1XVMA 1XUKA 1W8BH 1Y5BT 3E0PB 2Y5FA 3MH4A 4OS5A 3QWCH 1NT1A 4AN7A 3EA9A 4GSOA 1Y8TA 1GBBA 1K2I1 5E2PA 2NWNA 4Y7AA 3TJVA 1G3CA 1SL3A 1EQ9A 2Q6DA 2GV6A 1AN1E 1BHXB 4IW4E 3BTME 4SGAE 2AYWA 1AUJA 3SUFA 3SU6A 2SGAA 3PM3A 1TAWA 5EPYA 3EGKH 2A32A 5LPEA 1AKSA 3GDUA 1FY5A 5FX6A 8LPRA 1W7XH 3HK3B 1NROH 1PQAA 5AVDA 1OS8A 1Z8IB 2VH6A 4YOJA 2STBE 3KGPA 3RMNH 1OWDA 3RM0H 3MU5A 2TBSA 2UWOA 4XOJA 4JZEH 3LJJA 1L4DA 3LGYA 4OS7A 1IQEA 1NFUA 1O5GH 1AE8H 2XC0A 1GBMA 4XFQA 1GJAB 1G3EA 2PR3A 1TA6A 4JMYA 4NG9H 2OC1A 2BY5X 3MO6A 3RXKA 2SFAA 1OWHA 1A0JA 1YLCA 2A7HA 1TWXB 4DG4A 1QGFA 3BG4B 3CENA 3PYHA 2ZI2H 4FUFA 1O2QA 2FTMA 3SJ9A 1TGNA 2GKVE 3TH4H 1SGCA 2FOGA 3HGPA 3QK1A 1HAOH 1W3CA 3VB4A 1H4WA 1O3GA 2G4TA 1OSSA 1MKXH 1AB9B 3GCTG 3TJNA 2D2DA 2R2MB 4IBLH 1H8IH 4NGAH 2IN2A 1BTWA 2JH6D 1O5CB 3ZZ4A 1FY8E 5IDKA 1BBRE 1HAXB 1DWDH 4KGAA 1C2DA 4NA9H 3NK8A 4ISLA 2C8WB 5L2ZH 2UUFB 2ZU1A 4K1TA 1AO5A 5T3HA 1O2YA 1G2LA 4WVPE 1AY6H 2J38A 3IWMA 5DP7A 2AMPA 2FI4E 5TCAA 1CA8B 5TCCA 5E0GA 1Y3XA 2Y6TA 2GT8A 4E7RG 3FP7E 3TJUA 3VXEH 1ANBA 3MI4A 1NFXA 3MNCA 4K3JA 2A2QH 1DPOA 1J9CH 2OTVA 1QBOA 1C4Y2 4E06H 1EZUC 4KTSA 2F3CE 1JRTA 1HIAB 1NS3A 1O3MA 1FI8A 4AGJA 5FXLA 3RXHA 1WUNH 1C1WH 3E16B 4KTCA 2A7CA 2ZHFH 1W10U 3MNXA 3NXPA 3SW2B 2PKAB 1TX8A 1C2MA 8GCHG 2GDDA 1SOTA 3BTWE 1C2LA 5IYTA 2FOEA 1PPFE 3HGNA 1UTKA 3UPEA 3QLPH 3E6PH 1OOKB 1SOZA 1NRNH 2FTLE 2NU3E 2QF3A 2FI5E 1AFQC 3LONA 5CHAC 5K0HA 3LPRA 1ETRH 1O2VA 2B5TB 2STAE 4BANB 1AVXA 1A5HA 5JBTA 1VITF 1D4PB 1C5TA 1KDQB 5EG4A 3SNBA 4YTAA 2ANMH 2OBQA 4AFZA 2IJOB 2HPQH 5F03A 3ZYDA 1UTPA 3TLOA 3KEEA 4CR9A 3NZIA 2XCFA 1J15A 1ETSH 1O2KA 4MNYA 1V2WT 1CO7E 4GCHF 2C3SA 4MQAA 3H5CB 3LGWA 5GIBA 3EAJA 1CGJE 1GHBG 1MBMA 2WINI 1WQSA 3T25A 1FNIA 4TWYA 5EOKA 3OY5U 3ENSB 1KIGH 5J4QA 2PV9B 4XBCA 1QA0A 4DY7B 1SC8U 1WTGH 1HNEE 1WQVH 5C1YA 1TPSA 1GPZA 4WXVA 3RXDA 5FX5A 4I31A 4Z0KA 1SI5H 1K1NA 4ABAA 1M9UA 1GGDC 3NUMA 1W12U 4O03A 1RXPA 1H8DH 3B9FH 3SU5A 1Z6JH 1UTNA 4NA7A 1HAVA 4DIIH 1JBUH 2TPIZ 1EAWA 2O8UA 2Z9LA 5F8TA 2C93B 1F2SE 3A87A 1RTLA 3RXFA 5JB9S 1TOCB 3SV6A 1LDTT 3A7TA 1ARBA 1GHAF 2WPJS 1YPHE 2M5TA 2KAIA 4INHA 3RXAA 4IGDA 1TONA 1HBTH 2BD8A 2Y7XA 4Y7BA 3QTVH 2WV4A 4ZHLU 1WAYB 3TK5A 3EE0B 1UCYH 1O5FH 1BTXA 3GYMA 2FWWA 1P2KA 3ZVEA 1IQKA 4IN2A 4GLYA 3GY5A 1MZAA 2GCHG 1CSOE 1GDQA 4NSYA 3OY6U 5FCKA 5FPTA 1INCA 1MBQA 1O3KA 1QNJA 2AMDA 2ODQA 2R9PA 3MNSA 2AERH 4BXWA 1BITA 3MU4A 1P9SA 1D3PB 1HXFH 3P8NA 3D62A 3A88A 2XXLA 2Z9JA 4OGYA 1BJUA 1OX1A 2FEQH 3FANA 4CH2B 2JKHA 2F9OA 1SB1H 3F6UH 2Z94A 2P8OB 4KELA 2IOTA 1FY1A 4MNVA 1PFXC 3M36A 1TYNA 1XUJA 2XC4A 1SGNE 1W7GH 1O3HA 4Z6AH 3GDSA 1AE5A 1GHBF 1GJ7B 5T6GA 2W5EA 2THFB 3F9EA 2BD7A 4FUEA 3BN9A 2GGVB 4YT6H 1O3DA 3P8FA 1AMHA 4A1TA 3SJIA 3ZZ5A 4ABJA 3KQBA 4BAHB 1O3BA 1TX7A 2Z3CA 3UWIA 3EA8A 2A5AA 1YBWA 1S0RA 2HVXA 1XXFA 1NPMA 1EASA 5JBAS 4Y0ZE 4YLUA 1E36B 1ZYOA 1A1RA 1CT2E 4UFDH 5FBIA 3DD2H 5LGOA 1P2NA 3QGJA 1FUJA 1EPTB 2AIQA 1YPHC 4NA8A 3BTTE 2F91A 4X8SH 1TNJA 4IS5A 4NWLA 3UIRA 1C1RA 2CHAB 3GY7A 1TPAE 1PYTC 2QCYA 4FVBA 1GJ5H 1KLTA 4FUDA 4MPXA 1SGFG 1BTPA 1G30B 3B23B 1TNKA 8KME2 3H7OA 4AB8A 1TPOA 1EATA 1EAIA 3PLPA 3PLKA 3TGKE 5A09A 2ZC9H 3VXFH 1PQ8A 1ZHPA 4AOQA 1EUFA 4ZXXH 1NC6A 2ZQ1A 4DOQA 3SJKA 3VB7A 1MTNB 3PMBB 3CS7A 5AFYH 1PPGE 4TY6A 1ZSLA 2QGRA 2Y82A 1N8OB 1HIAA 4JYTA 1GJ9B 1GWAA 3P8GA 4ABGA 3STJA 4I8KA 5HM2A 1DS2E 1NESE 4Q7XA 1LVOA 1P3CA 3IITA 1W0YH 3PMJA 7KMEH 1MTWA 3C27B 4FUIA 1G3BA 1UK2A 1EJNA 1GI3A 2JH5D 1TRMA 3OU0A 1NU9A 3RU4T 2VIDA 1N6XA 2LPRA 1PPCE 1OXGA 2PGQB 4X1SU 4ZKNU 2ZU2A 1HPGA 3ZZ7A 3D23A 2EI7A 3KF2A 3VFEA 1Y5UT 1QTFA 5L30H 4HTCH 4WJG2 1OKXA 2BY8X 2XBWA 3DHKH 1XUHA 1YP9A 4E7NA 1MU8B 4BTUB 1JMOH 2B9LA 3ITIA 3DFJA 1SFQB 1J16A 2Q1JA 3BF6H 3SV9A 2ALPA 1BHXF 4OS1A 4JYUH 4UFGH 1TNHA 4BTIB 2QYIA 1ZTLA 1THPB 1VITH 1JIRA 1E35B 1H1BA 5HXFA 2AIPA 4AX9H 5EODA 3AVZA 4UEHH 3ZZ9A 4FUGA 1GBHA 6GCHG 1BT7A 1YPEH 2BOHB 1ANCA 2R0KA 3HPTB 1SVPA 3BTGE 2HGTH 1MZDA 1GL1A 1KXAA 1DICA 1FXYA 1C5QA 4WH8A 3LC5A 4ABDA 1QB6A 3QUMP 1MTUA 1HAGE 2VGCC 4ASHA 3SHCH 1LHGH 1UTOA 4A6LA 1EXFA 1VJ9U 1Y59T 3GCHC 1TQ7B 1TMBH 2PLXA 3UR9A 1EP5A 1BRCE 3OX7U 3URDA 4JK5A 4X6PA 4RKJB 2XBXA 4AFQA 4X0WU 2WPKS 1F0SA 1OYTH 3M7QA 1XX9A 3PWBA 2BZAA 5BPEA 1P04A 2BDHA 1DUAA 1FMGA 1YC0A 5HYOA 1KXBA 4UFFH 4XSKU 3SN8A 2ZP0H 1Z8GA 1E0FD 3A89A 4IN1A 3WY8A 4BAKB 1H9HE 2Q6GA 3T2NA 4AFUA 3ATMA 4UE7H 1UVSH 2PWXA 4LOYH 1AZZA 1MCVA 4YESB 1FDPA 5GCHG 3TU7H 3TJOA 1Q2WA 1RRKA 3SORA 4A92A 1HV7A 2A4OA 2GCHF 3M5LA 4CRDA 1SGRE 4YM9A 1HGTH 5GXPA 1ELCA 1QL8A 1GBTA 1ELBA 3E8LA 4B2BA 1TMUH 4FU7A 3SV7A 2Y80A 1A0HB 1O2XA 3UR6A 5GWZA 2F9PA 1D9IA 2HLCA 1SGQE 2SGEE 3A7YA 3HK6B 2XRCA 1NN6A 1P9UA 3BEIB 1P12E 1BTHH 1C2FA 3ZYEA 3SJ8A 4ZMAH 4ABFA 2ZU4A 1GBDA 4O97A 3RXTA 1TIOA 1O35A 1RD3B 2VWLA 2FOAA 3JZ2B 4OGXA 2PGBB 2PKAA 3VB3A 1TBZH 3E3TA 1ORFA 2FYQA 2Z9KA 1GVLA 2OC0A 3TPIZ 2CMYA 3ZZDA 1ESAA 3S9BA 1UTMA 3QO6A 1VZQH 3ZVCA 4CRGA 3GYLB 5DP4A 1MU6B 1QY6A 3I77A 3RXLA 2ODPA 2ZHQH 1ZLRA 2P3FH 1TGCA 2OLGA 5AF9H 4A7IB 1ZOMA 3ZZCA 1C5WB 2GP9B 4O9VA 5EQSA 3U8OH 2BXTH 2FDAA 1BOQA 3TIUA 5HMAA 4DGJA 1DDJA 2P93A 1XKAC 1TGTA 3V13A 3S9CA 1GDUA 4KKDA 1CHGA 3MU8A 4YOIA 4BOHA 1LPKB 2SGQE 5C2ZA 1BIOA 3HKJB 2ZEBA 2G4UA 2P94A 2BQ7B 3RXGA 4X6OA 2WPMS 2D1JA 2VINA 5EPNA 3NCLA 6ESTA 5I25A 3K6YA 2PFEA 5GJ4B 3F9GA 1ZMJA 1GJ6A 1BMAA 2FYRA 5DP6A 3SI3H 2J34A 3GOVB 1NTPA 1AWHB 3K2UA 1P3EA 2P3TB 2ANWA 4SGBE 3GICB 1UCYE 1FAXA 2H9EH 1C1VH 3M3TA 1A3EH 3RXRA 2ZU3A 1W2KH 1O3AA 4WXIA 1GJDB 5LPRA 2VVCA 1BJVA 1IQNA 1BA8B 3P92A 3A85A 4BTTB 5FPSA 2ZNKH 1LMWB 2V3OH 2VWNA 4DW2U 1C5SA 5FAHA 2PUXB 2V6NA 1O3PB 1KSNA 1U6QA 2BY7X 2ZPSA 3UUZA 1DT2A 1GMDG 3A7ZA 1LKBA 3IG6B 1C5VA 2FO9A 1JRSA 1KLIH 2Y81A 2XTTB 3SQHE 2TIOA 2NU0E 2KAIB 1GI0A 1V2TT 1YKTA 4X2XA 5F8XA 1JOUB 2P8OC 1RIWC 1PPHE 2GV7A 3KQDA 1O5DH 3MNBA 4TPYA 1O2NA 3RXCA 2GD4B 3V7TA 3M5NA 1C4V2 3A7VA 1OWIA 1YLDA 3BTFE 2QV1A 2WYGA 5FBEA 2PKSC 5GDSH 1QHRB 3GCTF 1DY9A 3EA7A 2R3UA 3MMGA 2Z3EA 5J4SA 2ZHWH 1QJ6B 1W14U 2WPIS 2QA9E 4X1NU 3K65B 1P11E 1N6YA 3KL6A 3SUEA 3E91A 1WYKA 2FM2A 3NKKA 1AFQB 2FLRH 4FXGH 5CHAB 3LGUA 1SGEE 1D3QB 2ZDMA 1CA0B 1QB1A 1A61H 2BHGA 1NRPH 1YCPM 4MTBA 4GVUA 5JPMH 1LHEH 3NPSA 5HGGA 2G51A 3MWIU 4HI3A 4K8YA 2OP9A 1GJCB 4B75A 1BMLA 1O38A 1MAYA 2ZO3H 2B0FA 2YNBA 5LPFA 3KIDU 1VR1H 1A5GH 1GI8B 1O5EH 1P03A 1ELVA 2V0BA 1HJAC 1O3OA 1Q31A 3LOXA 2R2WU 1P0SH 4X1RU 1AGJA 1C9TA 3F9FA 4D9QA 1VGCB 1BRBE 4JCNA 1UO6A 2ZGJA 1P57B 3GY3A 3A84A 1EPTA 4PROA 1PYTD 3SI4H 1ZRBA 1HDTH 1Z1IA 2QF0A 1E38B 2D8WA 1WU1A 4MNWA 5E8EH 3P95A 4VGCC 3SNAA 4YZUA 5A0BA 1T8MA 1J14A 2FS9A 1P01A 1QBNA 2BQWB 3RXQA 2A5IA 1KTSB 3PLBA 2XBYA 1O2PA 2ZCLP 4X2VA 1QA7A 2FLBH 2HNTF 2VU8E 5GPIB 4DT7B 4YOGA 1DVAH 4Q80A 4X6NA 3H7TA 1D3DB 1Y3WA 1C5RA 3GDVA 1T8OA 2ZCHP 3M61U 5I46H 4DURA 3ELAH 1SQTA 1LQEA 1F0UA 3PO1C 3RC4A 1C9PA 1Z6EA 2QY0B 2DUCA 3VEQB 3PTBA 1QRWA 2VIPA 4BNRA 1A7SA 9ESTA 1GMCG 1RGQA 1AVGH 2P95A 5DJ7A 1HJ8A 2NU4E 2FOMB 1C2HA 3MFJA 1G36A 3SHAH 1ANDA 3L3TA 4BXSA 2EI6A 5DP3A 1BUIA 4NCYA 2QXHA 1AQ7A 2ZFSA 1YPGH 2OCVB 3NWUA 1EJMA 1LCYA 2BTCE 1ACBE 1GMHF 2FP7B 2QN5T 3DA9B 1AVWA 1CE5A 5EW2H 2ZU5A 2ZHEH 1UTLM 1VCWA 3SNEA 3M7TA 4ZUHA 1GMDF 1O2SA 3T26A 4Y10E 1D3TB 3FZDA 2ZFQH 3U69H 3SU0A 4WMFA 4ABIA 5A8ZA 2C8XB 2SGFE 4DCDA 4CRBA 1K22H 4KTUA 3SV8A 3V12A 3ATIA 3RU4D 1ZJKA 1XVOA 1W13U 2ZA5A 1SGTA 1V2JT 4I8LA 3BTDE 1HJ9A 1DWCH 3A81A 4Q7ZA 2PHBA 4GPGA 3TNTA 5H4IB 1EOJA 2FOHA 1V2ST 1L1NA 2W7SA
chains in the Genus database with same CATH superfamily
4LZ4B 3D49H 5DP9A 2J4IA 1BZXE 2W6ID 3KN2A 2Z3DA 1C1MA 1GBLA 1Y3UA 3E1XB 5DK1A 2RG3A 1DM4B 1GCTB 1TB6H 3BTHE 3OSYA 3UNRA 4ZKOU 1GBIA 1MH0A 2HRVA 2ZFFH 3ZIAD 3LDXH 3RXOA 1UMAH 1OYQA 3ZVGA 2QXGA 4YT7H 2CF8H 1V2NT 2BXUH 1SPJA 2ZTZA 1UTQA 1QR3E 1CQQA 1K28D 4YLQH 5FHTA 3T28A 2ODYB 2ZWLH 1VCQA 4LXBH 1FIWA 2VWMA 1T32A 4ABHA 1QRXA 5ESBA 2XC5A 4Y0YE 1AWFH 4ISNA 3S0NA 2G55A 4ISOA 1O3LA 1ZPBA 1IOEA 1K1IA 1O2ZA 3LJOA 4K2YA 3RLYH 1S84A 3RLWH 2LNCA 1T8LA 1XMNB 1MD7A 4Q63A 1WCZA 3EYDA 1TPPA 3UOUA 8GCHF 3TVJB 2H9HA 3BTQE 4X6MA 4CRCA 4ZH8A 1HAZB 1T8NA 1SQAA 1G32B 1DITH 3RXEA 1Z8RA 2FPZA 2W26A 1FY4A 1O2MA 2GTBA 2LP6A 3ZZ6A 1L4ZA 1C5OH 1C5NH 4MPUA 3B8JA 1HCGA 3BIVH 4XRNA 4AYVB 2PSXA 1UVTH 2ZKSA 1TGSZ 4AG1A 1G2MA 1GI7B 2EC9H 2FOBA 3VB6A 1DWBH 2GZ7A 1C2IA 1VCPA 1V2QT 1GBAA 4AG2A 1WTHD 2G00A 1DXPA 2ZECA 3M7UA 4MPWA 2H2ZA 4P02A 3UOPA 1FONA 2OUAA 3DUXH 1BRUP 1AIXH 2ALVA 5E2OA 3ZVFA 4D76A 2VGCB 2A4GA 3PV4A 1GI4A 1ESTA 4OM9A 2A4QA 3U8TH 3M5MA 3SBKA 3DT0H 5K7RA 4NIYA 1IQLA 1PPEE 1MKWK 1GBFA 4FU8A 2AS9A 1SQRA 4F55A 5T6DA 2BQ6B 3TGJE 3O8RA 4X8VH 5GNDA 1CHOF 4THNH 2C8YB 2J98B 2QIQA 2ZPQA 3PMAB 1O2TA 1DLEA 1GI2A 1YPKH 1EB1H 1T4UH 2SNVA 5C1XA 4CRFA 1FN8A 1V3XA 1KTTB 3ATWA 5FPYA 1NU7B 1GHYH 4OS6A 1V2PT 5EJZA 1QCPA 1LPZB 2EQNA 2A2XH 3PB1E 2SGDE 2OQUA 4P00A 5F53A 3SU2A 3U98H 5LH8A 1ZTJA 2CN0H 5C3NA 1C4U2 1CVWH 2WUCA 1NRSH 1C5LH 1O0DH 3RXPA 1RTKA 4CREA 2BX4A 1LO6A 2P16A 5JYIA 1Y5AT 1SHYA 1PQ5A 1SSXA 2UUKB 2DE9A 2I6SA 5EXLA 3A83A 2NU2E 4NZLA 4X1PU 3A86A 3R3GB 3ZVBA 1F0TA 5AHGH 3DFLA 1LVYA 3UTUH 3A8DA 1IQHA 3H09A 3STIA 3RXUA 3SZNA 1AD8H 1O32A 3L6PA 3GCHB 2GZ9A 4Y8ZA 2OC7A 3RC5A 2BLQA 5AFZH 1ABIH 2CV3A 1O2RA 2RA3A 1W0ZU 1IQGA 1B5GH 1OWJA 1ZR0A 1TALA 1WBGB 2XW9A 4DJZB 4X8UH 4D7FA 4Y11E 4INKA 3T62A 4ZAEA 5ETXA 2JJ1D 4K5ZA 2ZDLA 2I6QA 4Y71A 3ZZBA 2O8MA 3AW0A 2YOLA 3OYPA 3RU4E 1PPBH 1BB0B 4NIVA 1C2GA 3RMMH 1CBWC 1V2OT 3RP2A 1ELEE 1YPJH 2G5VA 1GJ4H 5DKMA 5DN6D 2WUBA 3KHVA 2A0QB 2BLWA 1CA0C 1DUEA 4WMDA 1O30A 4OS4A 3SGQE 1GVZA 3MU0A 1GBCA 1OP0A 1BMFD 1XUFA 1Z1JA 3RDZA 1P09A 4MNXA 3TITA 2K0QA 2GVFA 1JXPA 1S81A 4ESTE 1IHSH 1C5UA 3RM2H 3E0NB 3T5FH 4ABEA 3P70B 1HLTH 1GMHG 1YY3A 3UNQA 4F49A 1SBWA 2WPHS 3M37A 5B6OA 5A0CA 3TGIE 3GY2A 5F6MA 3A82A 1NY22 3VGCC 2Z9GA 1C2KA 1GG6C 1O3CA 1GJBB 4CH8B 3EE7A 3Q77A 3SGBE 1E37B 1SLXB 1J8AA 3SJOA 1EAXA 5IK2D 2CHAC 1LPGB 2IPHA 2H6MA 4F4OC 2BDYA 2SGPE 1A4WH 4TPIZ 1V6DA 1RFNA 2FXRA 1X7AC 2KCYA 2ZDKA 3FO8D 4AB9A 4J2YB 2XYAA 3KQCA 1NRRH 2CGAA 4B71A 1TGBA 4K69A 2FS8A 1WSSH 2W7UA 1O3EA 3SUGA 1A0LA 2ZDAH 1OP2A 1GCDA 1S6HA 1V2KT 5EJLA 1ELDE 1E34B 1DSUA 2D26C 2PTNA 3ZZAA 2H5CA 5C5OA 1EKBB 3FP6E 3FVFB 1N8OC 3UY9A 1UHBB 5CMXH 1RIWB 2HALA 1YM0A 4ISIH 1NO9H 2ESTE 3BG4C 3HKIB 1BBRK 3M3VA 3PROA 3U28C 1AUTC 3QDZB 5CDFE 1ZRKA 5DO4H 1TBQH 1SQOA 4IC6A 1KYNA 4DVAU 2EI8A 2O8LA 1LHDH 3ZVDA 2BDBA 3LGIA 1PQ7A 2F4LA 1NFWA 1O2JA 3KCGH 1GBJA 1GGDB 1YYY1 1IQIA 4A1VA 2FX6A 1GHWH 6CHAC 2TGTA 1O2HA 1NRQH 4O3UA 3SNCA 1ARCA 1D6WA 3UREA 4Q2KA 2PTCE 2AMQA 1QQ4A 4IC5A 1HAVB 2UUJB 2VIQA 5EJ1A 1GI5A 3U1JB 1HUTH 3E90B 2KCOA 1GG6B 2ZHDA 1GVKB 1V2UT 4LK4A 2ZDNA 1SGFA 4NFEA 1HYLA 2FI3E 1O2GH 4FUCA 1C1OA 5ESTE 2FZZA 3FZZA 1O3IA 1CHOG 1B7XB 1O34A 1TMTH 1EB2A 1AHTH 1K21H 2GX4A 2BMGB 1ANEA 3QZQA 1T31A 2W3IA 3T29A 1QFKH 2FIRH 5C5NA 3LU9B 1MD8A 1XXDA 2VIWA 1P02A 4GUXA 4BAMB 2AGGX 7ESTE 2VIOA 3RMOH 1BTYA 1F0RA 2AGEX 4H42U 3MO3A 2BD2A 1W0JD 2AH4X 3ZV8A 3BIUH 3SGAE 3S7KB 5GCHF 3MH6A 3OEHD 3KQEA 2RDLA 1P2QA 1FPCH 2ILNA 2Y5GA 4TYDA 1UK4A 1LHFH 3F1SB 3Q3XA 4ZHMU 2Z7FE 2R0LA 4D7GA 2KZ4A 1ETTH 2RCEA 4TT3D 4HZHA 2YNAA 3MTYA 3OTPA 5DPAA 3SU1A 2BVRH 1O5BB 3Q76A 1ZMLA 1FY3A 1TNIA 4D8NA 1CGHA 6CHAB 1K1MA 2VB0A 2ZCKP 3AASA 5G4BA 1W11U 1GI9B 1A46H 4GCHG 2C4FH 2ANKH 2GMTB 4U2WA 1DANH 3A8BA 1ZJDA 1C5YB 3MOCA 4K1EA 2VIVA 1V2VT 3BEFB 1F7ZA 1C5ZB 5PTPA 4GAWA 2UWLA 1GJ8B 1O3NA 1QJ1B 3MH5A 4JZDH 5DP8A 1F5RA 1C1SA 1PPZA 1SGPE 1SLVB 2JETB 2OXSA 3S7HB 2BVSH 1C5MD 3BV9B 3ZVAA 2ZZUH 5EW1H 3GCOA 4ZXYH 1L2EA 1UK3A 1AU8A 2BZ6H 2J94A 1SG8B 3K9XB 6GCHF 1FJSA 1EZSC 3GISB 3U9AH 3FP8E 2QAAA 1P2OA 4JZ1A 1LKAA 1ZGIA 2A5KA 4GHQA 1EP6A 3UQVA 4FVDA 1QL9A 3PTNA 1TRNA 1C1UH 5KEDA 1NFYA 3Q3KA 1O2LA 1A3BH 2VVVA 1ABJH 1BRAA 4WY3A 3QX5H 2GT7A 1JIMA 5DG6A 1A5IA 1P2MA 2F9UA 1AFEH 2CJIA 1GDNA 1IQMA 1EPTC 4XBDA 1HB0B 3SQEE 1DY8A 2BDCA 4TWWA 1MKWH 1O37A 3A8AA 1CGIE 1J17T 2ZGHA 4Y8XA 3RUOA 1IQJA 1MABB 2BD9A 2XCNA 1UCYK 1SGYE 4B74A 3GCNA 3Q3YA 2Q6FA 1BTUA 1ESBA 1P8VC 4Y79A 1ZPCA 2TRMA 3OTJE 3GY4A 4RN6A 4IMQA 1Z71A 2B8OH 1SGDE 4RSPA 4J1YA 1QB9A 3K6ZA 2VNTA 4CBNA 4GHTA 1SLWB 3KYGA 1MQ5A 3KNXA 1RTFB 4UONA 1BQYA 2FOCA 2PP6A 7GCHG 4H4FA 2XBVA 1SMFE 5A0AE 3LH1A 1F92A 3O8CA 3A8CA 1EJAA 1ZMNA 1QURH 3DSOA 1K1PA 1LVBA 2F9BH 2FX4A 4R8TB 1AI8H 4AFSA 1VGCC 2GCTC 3QTOH 4HGCA 1UTJA 4K60A 1SLUB 1EZXC 3UQOA 5EXNA 4OS2A 2UWPA 2CF9H 5EU8A 4CHAC 3ZZ3A 5A8YA 2KM0A 3P17H 4CRAA 2BY6X 1QL7A 3V0XA 3VPKA 3S9AA 2P59A 4B2CA 4B1TA 2FODA 2VVUA 1FN6A 1K1LA 1L0ZA 4MLFB 5L2YH 1NBME 1KDQA 1CT0E 1S5SA 1FQ3A 3CP7A 2A7JA 2HWLB 4Y8YA 2ZIQH 2RA0A 1F5KU 4XE4A 2F43B 4FUBA 2EY4C 2OQ5A 2QXIA 2VWOA 3AW1A 3FN8A 5L6NH 1SHHB 2BDAA 5DGJA 3W95A 3MYWA 2OC8A 2PUQH 2ASUB 4CR5A 1AZ8A 4H6TA 1C2JA 1ZTKA 1BDAA 4ZROA 2G52A 4CBOA 4WWYA 3ZV9A 2OD3B 1AB9C 2BM2A 3FOAA 1HXEH 1O33A 3PRDA 1UVOA 5FCRA 1H9IE 1G3DA 3LKWA 3TK9A 1O2UA 1BMNH 1ZSJA 1YCPK 1YGCH 3QGNB 1P05A 5C17A 1XKBC 1BCUH 2ZTYA 1MAXA 4MPVA 1ELAA 1K1JA 1YCPH 3LC3A 4U30A 1YPLH 2XWAA 2BD5A 3M5OA 3RXMA 4X8TH 4NIXA 4RT1A 2CXVA 5E0JA 1THSH 1OWEA 2ULLA 1KXEA 1OP8A 3BTEE 5JBCS 1MTNC 1O36A 4VGCB 4AYYB 2JETC 5CE1A 1GCTC 1W0KD 1HAIH 1PJPA 1O3JA 4NIWA 3SV2H 1G37A 4BAQB 4UD9H 1ELTA 2PW8H 3T27A 1TFXA 1P2IA 3F9HA 1O31A 1ELFA 2JH0D 1HAHH 1D6RA 1L1GA 1FLEE 2GDEH 1DWEH 1P06A 3URCA 5HIZA 1EOLA 4I33A 5TJXA 1B0FA 1MTSA 4DIHH 1T7CA 1S85A 1ELGA 4MDSA 4JYVH 2BDIA 3F68H 1KXDA 3MU1A 5JDUB 1DSTA 1GL0E 3PO1B 4ISHH 2V3HH 4XBBA 3TH3H 7GCHF 1O2WA 4NWKA 3W94A 3EQ0H 1XUGA 1EZQA 1YLNA 3F0PA 1ZHMA 2BY9X 3GY8A 2VH0A 2BLOA 1UVUH 3HATH 4FUJA 4I8HA 1HRTH 3TK6A 2QC2A 2GMTC 4H6SB 3VGCB 1IHTH 1JWTA 1DLKB 4JK6A 3D65E 3RXIA 2C90B 2K1QA 1NZQH 2XWBI 1RS0A 4BAOB 2FESH 4I8GA 2BD4A 3KQ5A 6LPRA 1WOFA 4O3TA 2O8WA 2ANYA 1UHBA 2C8ZB 3G01A 4XDEA 1S6FA 4ZKSU 3UWJH 3MHWU 3C1KA 4AORA 1MMJN 2P3UB 2SNWA 5T1VA 1C1TA 1ZZZA 2H5DA 1A2CH 2G5NA 1DXWA 2WV5A 1AKSB 2BLVA 3PMHB 3ZZ8A 3L33A 2FOFA 4YXWD 2W3KA 4HFPB 5T6FA 2A45B 2G81E 3BG8A 1HJAB 4NFFA 3ATKA 3SO3A 1C1QA 1C1NA 3A7WA 3VB5A 4Y6DA 3ATLA 5C1UA 1TA2A 5BRRE 1TQ0B 2G8TA 1GI6A 1HFDA 5DP5A 4UFEH 2BX3A 3AAVA 4FU9A 1QBVH 3LIWA 3ESTA 3TNSA 4B73A 4ABBA 3EDXB 4B2AA 1Z7KA 2BOKA 2GCTB 4TY7A 9LPRA 3U1IB 1QRZA 4KP0A 1LHCH 2R3YA 2Y7ZA 4NZQA 4X1QU 4F48B 1O2OA 1K9OE 1DFPA 3LGVA 2WPDD 1WV7H 3OEED 5F8ZA 1C1PA 2OINA 1FZZA 4A5TS 3FAOA 1LTOA 5ABWA 1TX6A 1S83A 2EA3A 3UFAA 1Y3VA 2O8TA 1FPHH 2HOBA 3FFGA 1ZSKA 1ZPZA 5SGAE 3U8RH 5JBBS 2F83A 3CS0A 1O3FA 1SFIA 3SU3A 3SU4A 2A1DB 2HVYB 4I7YH 1O5AB 1YF4A 4JZIA 2BVXH 2ZF0H 1MUEB 1EX3A 3A80A 1DE7H 1SGIB 1TE0A 4I8JA 3N7EA 2PSYA 1V2MT 3R0FA 1Z8JB 1Y3YA 1LVMA 4B76A 2Y5HA 1Q3XA 3O8BA 5C20A 1S82A 5A8XA 2ZDVH 3LT3A 7LPRA 3LGTA 5C67A 3N7OA 4WF8A 1P10A 3M35A 2F9NA 1GI1A 1UVPA 5EGMA 2J95A 2TGDA 2RFKC 3A7XA 1F5LA 1FIZA 1MTVA 4TSFD 4ZKRU 4WH6A 1GHXH 1KY9A 1FX0B 1S0QA 1T4VH 3QN7A 1XM1A 4R0IA 1GHAG 4B6EA 1YPMH 4NSVA 3BSQA 3I29A 2Z6BD 1UJ1A 5EQRA 3GY6A 2ZGCA 4B6FA 3M3SA 4AZ2B 2PKSB 2RDEA 2TGPZ 3TH2H 3O8DA 5EQQA 2VJ1A 2BB4A 4FOUC 4U01A 3UAIC 2J9NA 1TABE 2BYAX 2H1UA 4UDWH 2WPLS 2ZTXA 1ID5H 2JIZD 3RC6A 5KGOA 2L6OA 3QZRA 1MKXK 1GBKA 1BBRH 2WYJA 1VJAU 3LH3A 3P8OA 5E0HA 1ZHRA 1K1OA 4CHAB 2V35A 4LZ1H 2BDGA 1CBWB 4WMEA 1VITG 2QXJA 3BEUA 8ESTE 1EAUA 4MG3A 3RXJA 2A4RA 3JZ1B 2DE8A 1C5XB 2B7DH 2FMJA 1H9LB 1IQFA 2XNIA 3Q00A 3RXBA 1C5PA 2UUYA 4Y76A 1TRYA 2HPPH 1P2JA 1XUIA 2O9QA 1CU1A 2OBOA 4INLA 4IMZA 4E05H 2J92A 4U32A 3V3MA 1SR5C 2IPQX 1TOMH 3MO9A 2EEKA 2ZFTA 1OWKA 1NM6A 1QJ7B 4QT8C 4ZHAA 1TNGA 1O2IA 1FAKH 1KXFA 2A31A 5A2MH 2GJGA 4XD7D 1V2LT 3SUDA 1DX5M 2BD3A 3PWCA 3ODFA 4YO9A 3UNSA 3I78A 4JZFH 4A1XA 1MCTA 3RXSA 3RXVA 3MH7A 1GBEA 1RJXB 5DSFA 1MQ6A 3AAUA 4Q7YA 3RMLH 4AGKA 3N7DA 1HAPH 2Z9IA 2H9TH 4MVNA 1OPHB 1N1LA 4K1SA 1HAYB 2XNDD 2F9VA 3SNDA 2ZFRH 5FL7D 4X2WA 1QIXB 5EXMA 5HM9A 4D9RA 4I32A 2J2UA 3PV2A 3P6ZB 2KX4A 2HNTC 5JB8S 2TGAA 1GHZA 1DOJA 2AFQB 2AEIH 1TLDA 1KLJH 2OK5A 1L1JA 2ZFPH 1TNLA 3BTKE 4RKOB 3S69A 2ZG0H 3AK5A 1BTZA 1C2EA 1TBRH 2ZGBH 1FV9A 4M9FA 3ODDA 1GMCF 1G9IE 1CT4E 1V2RT 2GZ8A 2ZGXH 1IAUA 4X2YA 2HNTE 1ZGVA 1THRH 4FUHA 1BMMH 4K8BA 2ZPRA 3SOSA 2AGIX 1KXCA 2KCAA 1LQDB 2NU1E 1GHVH 1O39A 2ZQ2A 4M7GA 1B0EA 1QQUA 1XVMA 1XUKA 1W8BH 1Y5BT 5HKKD 3E0PB 2Y5FA 3MH4A 4OS5A 3QWCH 1NT1A 4AN7A 3EA9A 4GSOA 1Y8TA 1GBBA 1K2I1 5E2PA 2NWNA 4Y7AA 3TJVA 1G3CA 1SL3A 1EQ9A 2Q6DA 2GV6A 1NBMD 1AN1E 1BHXB 4IW4E 3BTME 4SGAE 2AYWA 1AUJA 3SUFA 3SU6A 2SGAA 3PM3A 1TAWA 5EPYA 3EGKH 2A32A 5LPEA 1AKSA 3GDUA 1FY5A 5FX6A 8LPRA 1W7XH 3HK3B 1NROH 1PQAA 5AVDA 1OS8A 1Z8IB 2VH6A 4YOJA 2STBE 3KGPA 2J98A 3RMNH 1OWDA 2YMSB 3MU5A 3RM0H 2TBSA 2UWOA 4XOJA 4JZEH 3LJJA 3GS9A 1L4DA 3LGYA 4OS7A 1IQEA 1NFUA 1O5GH 4ZCNA 1AE8H 2XC0A 1GBMA 2YMSC 4XFQA 1GJAB 1G3EA 2PR3A 1TA6A 4JMYA 4NG9H 2OC1A 2WV9A 2BY5X 1K0HA 3MO6A 3RXKA 2SFAA 1OWHA 1A0JA 1YLCA 4Z1MD 2A7HA 2JDID 1TWXB 4DG4A 3MQKC 1QGFA 3BG4B 1E1RD 3CENA 3DCLA 3PYHA 2ZI2H 4FUFA 1O2QA 2FTMA 3SJ9A 1TGNA 2GKVE 3TH4H 1SGCA 2FOGA 3HGPA 3QK1A 1HAOH 1W3CA 2W6JD 3VB4A 1H4WA 1O3GA 2G4TA 1OSSA 1MKXH 1AB9B 3GCTG 3TJNA 2D2DA 2R2MB 4IBLH 1H8IH 4NGAH 2IN2A 1BTWA 2JH6D 1O5CB 3ZZ4A 1FY8E 5IDKA 1BBRE 3DSGA 1HAXB 1DWDH 4KGAA 1C2DA 4NA9H 3NK8A 4ISLA 2C8WB 5L2ZH 2UUFB 2ZU1A 4K1TA 1AO5A 5T3HA 1O2YA 1G2LA 4WVPE 1AY6H 2J38A 3IWMA 5DP7A 2AMPA 2FI4E 5TCAA 1CA8B 5TCCA 5E0GA 1Y3XA 2Y6TA 2GT8A 4E7RG 3FP7E 3TJUA 3VXEH 1ANBA 3MI4A 1NFXA 3F0OA 3MNCA 4K3JA 2A2QH 1DPOA 1J9CH 2OTVA 1QBOA 1C4Y2 4E06H 1EZUC 3F3BA 4KTSA 2F3CE 1JRTA 1HIAB 1NS3A 1O3MA 1FI8A 4AGJA 5FXLA 3RXHA 1WUNH 1C1WH 3E16B 4KTCA 2A7CA 1WDIA 2ZHFH 1W10U 3MNXA 3NXPA 3SW2B 2PKAB 1TX8A 1C2MA 8GCHG 4I86A 2GDDA 1SOTA 3BTWE 1C2LA 5IYTA 2FOEA 1PPFE 3HGNA 1UTKA 3UPEA 3QLPH 3E6PH 1YWUA 2M2AA 1OOKB 1SOZA 1NRNH 2FTLE 2J97A 2NU3E 2QF3A 4Q4LA 2FI5E 1AFQC 3LONA 5CHAC 5K0HA 3LPRA 3OFND 1ETRH 1O2VA 2B5TB 2STAE 3VG8A 4BANB 1AVXA 1A5HA 5JBTA 1VITF 1D4PB 5CHBA 1C5TA 1KDQB 5EG4A 3SNBA 2LELA 4YTAA 2ANMH 2OBQA 4AFZA 2IJOB 2HPQH 5F03A 3ZYDA 1UTPA 2J5UA 3TLOA 3KEEA 4CR9A 3NZIA 2XCFA 1J15A 1ETSH 3DSPA 1EFRD 1O2KA 4MNYA 1V2WT 1CO7E 4GCHF 2C3SA 4MQAA 3H5CB 3LGWA 5GIBA 3EAJA 1CGJE 1GHBG 1MBMA 2WINI 1WQSA 3T25A 1FNIA 4TWYA 5EOKA 3OY5U 3ENSB 1KIGH 5J4QA 2PV9B 4XBCA 1QA0A 4DY7B 1SC8U 1WTGH 1HNEE 1WQVH 3NRLA 5C1YA 1TPSA 1GPZA 1VKYA 4WXVA 3RXDA 5FX5A 4I31A 4Z0KA 1SI5H 1K1NA 4ABAA 1M9UA 1GGDC 3NUMA 1W12U 4O03A 1RXPA 1H8DH 2QF4A 3B9FH 3SU5A 1Z6JH 1UTNA 4FETA 4NA7A 1HAVA 4DIIH 1JBUH 2TPIZ 1EAWA 2O8UA 2Z9LA 5F8TA 2C93B 1F2SE 3A87A 1RTLA 3RXFA 5JB9S 1TOCB 3SV6A 1LDTT 3A7TA 1ARBA 1GHAF 2WPJS 1YPHE 2M5TA 2KAIA 4INHA 3RXAA 4IGDA 1TONA 1HBTH 2BD8A 2Y7XA 5C0UA 4Y7BA 3QTVH 2WV4A 4ZHLU 1WAYB 3TK5A 2CK3D 3EE0B 2QE7D 1UCYH 1O5FH 1BTXA 3GYMA 2FWWA 1P2KA 3ZVEA 1IQKA 4IN2A 4GLYA 3GY5A 1MZAA 2GCHG 1CSOE 1GDQA 4NSYA 3OY6U 5FCKA 5FPTA 1INCA 1MBQA 1O3KA 1QNJA 2AMDA 2ODQA 2R9PA 3MNSA 2AERH 4BXWA 1BITA 3MU4A 1P9SA 1D3PB 1HXFH 3P8NA 3D62A 3A88A 2XXLA 2Z9JA 4OGYA 1BJUA 1OX1A 2FEQH 2QF5A 2XOKD 3FANA 4CH2B 2JKHA 2F9OA 2YMSD 1SB1H 3F6UH 2Z94A 2P8OB 4KELA 1SKYE 2IOTA 1FY1A 3SZEA 4MNVA 1PFXC 3M36A 1TYNA 1XUJA 2XC4A 1SGNE 1W7GH 1O3HA 4Z6AH 3GDSA 1AE5A 1GHBF 1GJ7B 2HLDD 5T6GA 2W5EA 2THFB 3F9EA 2BD7A 4FUEA 3BN9A 2GGVB 4YT6H 4AC9A 1O3DA 3P8FA 1AMHA 4A1TA 3SJIA 3ZZ5A 4ABJA 3KQBA 4BAHB 1O3BA 1TX7A 2Z3CA 3UWIA 3EA8A 2A5AA 1YBWA 1S0RA 2HVXA 1XXFA 1NPMA 1EASA 5JBAS 4Y0ZE 4YLUA 4ACBA 1E36B 1ZYOA 1A1RA 1CT2E 4UFDH 5FBIA 3DD2H 5LGOA 1P2NA 3QGJA 1FUJA 1EPTB 2AIQA 1YPHC 4NA8A 3BTTE 2F91A 4X8SH 1TNJA 4IS5A 4NWLA 3UIRA 1C1RA 2CHAB 3GY7A 1TPAE 1PYTC 1E79D 2QCYA 4FVBA 1GJ5H 2WZQA 1KLTA 4FUDA 4MPXA 1SGFG 1BTPA 1G30B 3B23B 1TNKA 8KME2 3H7OA 4AB8A 1TPOA 1EATA 1EAIA 3PLPA 3PLKA 3TGKE 5A09A 2ZC9H 3VXFH 1PQ8A 1ZHPA 4AOQA 1EUFA 4ZXXH 1NC6A 2ZQ1A 4DOQA 3SJKA 3VB7A 1MTNB 3PMBB 3CS7A 3WWFA 5AFYH 1PPGE 4TY6A 1ZSLA 3OE7D 2QGRA 2Y82A 1N8OB 1HIAA 4JYTA 1GJ9B 1GWAA 2V7QD 3P8GA 4ABGA 3STJA 4I8KA 5HM2A 1DS2E 1NESE 4Q7XA 1LVOA 1P3CA 3IITA 1W0YH 3PMJA 7KMEH 1MTWA 3C27B 4FUIA 1G3BA 1UK2A 1EJNA 1GI3A 2JH5D 1TRMA 3OU0A 1NU9A 3RU4T 2VIDA 1N6XA 2LPRA 1PPCE 1OXGA 2PGQB 4X1SU 4ZKNU 2ZU2A 1HPGA 3ZZ7A 3D23A 2EI7A 3F2GA 3KF2A 3VFEA 1Y5UT 5B6LA 1QTFA 5L30H 4HTCH 4WJG2 1OKXA 2BY8X 2XBWA 3DHKH 1XUHA 1YP9A 4E7NA 1MU8B 4BTUB 1JMOH 2B9LA 3ITIA 1QZ8A 1SFQB 1J16A 3DFJA 2Q1JA 3BF6H 3SV9A 2KCPA 2ALPA 1BHXF 4OS1A 4JYUH 4UFGH 1TNHA 4BTIB 2QYIA 1ZTLA 1THPB 1VITH 1JIRA 1E35B 1H1BA 5HXFA 2AIPA 4AX9H 5EODA 3AVZA 4UEHH 3ZZ9A 4FUGA 1GBHA 6GCHG 1BT7A 1YPEH 2BOHB 1ANCA 2R0KA 3HPTB 1SVPA 3BTGE 2HGTH 1MZDA 1GL1A 1KXAA 1DICA 1FXYA 1C5QA 4WH8A 3LC5A 4ABDA 1QB6A 3OAAD 3QUMP 1MTUA 1HAGE 2VGCC 4ASHA 3SHCH 1LHGH 1UTOA 4A6LA 1EXFA 1VJ9U 1Y59T 3GCHC 1TQ7B 1TMBH 2PLXA 3UR9A 1EP5A 1BRCE 3OX7U 3URDA 4JK5A 4X6PA 4RKJB 2XBXA 4AFQA 4X0WU 2WPKS 2WHXA 1F0SA 1OYTH 3M7QA 1XX9A 3PWBA 2BZAA 5BPEA 5C94A 1P04A 2BDHA 1DUAA 1FMGA 1YC0A 5HYOA 1KXBA 4UFFH 4XSKU 3SN8A 2ZP0H 1Z8GA 1E0FD 3A89A 4IN1A 4HG6A 3WY8A 4BAKB 1H9HE 2Q6GA 3T2NA 4AFUA 3ATMA 4UE7H 1UVSH 2PWXA 4LOYH 1AZZA 1MCVA 4YESB 3PV5A 1FDPA 5GCHG 3TU7H 3TJOA 1Q2WA 1RRKA 3SORA 4A92A 1HV7A 2A4OA 2GCHF 3M5LA 4CRDA 1SGRE 4YM9A 1HGTH 5GXPA 1ELCA 1QL8A 1GBTA 1ELBA 3E8LA 4B2BA 1TMUH 4FU7A 3SV7A 2Y80A 1A0HB 1O2XA 3UR6A 5GWZA 2F9PA 1D9IA 2HLCA 1SGQE 2SGEE 3A7YA 3HK6B 2XRCA 1NN6A 1P9UA 3BEIB 1P12E 1BTHH 1C2FA 3ZYEA 3SJ8A 4ZMAH 4ABFA 2ZU4A 1GBDA 4O97A 3RXTA 1TIOA 1O35A 1RD3B 2VWLA 2FOAA 3JZ2B 4OGXA 2PGBB 2PKAA 3UB0A 3VB3A 1TBZH 3E3TA 1COWD 1ORFA 2FYQA 2Z9KA 1GVLA 2OC0A 3TPIZ 2CMYA 3ZZDA 1ESAA 3S9BA 1UTMA 3QO6A 1VZQH 3ZVCA 4CRGA 3GYLB 5DP4A 1MU6B 1QY6A 3I77A 4RI0A 2ODPA 2ZHQH 1ZLRA 2P3FH 3RXLA 1TGCA 2OLGA 5AF9H 4A7IB 1ZOMA 3ZZCA 1C5WB 2GP9B 4O9VA 5EQSA 3U8OH 2BXTH 2FDAA 1BOQA 3TIUA 5HMAA 4DGJA 3W1EA 1DDJA 2P93A 1XKAC 1TGTA 3V13A 3S9CA 1GDUA 4KKDA 1CHGA 3MU8A 4YOIA 4BOHA 1LPKB 2AHME 2SGQE 5C2ZA 1BIOA 3HKJB 2ZEBA 2G4UA 2P94A 2BQ7B 2JJ2D 3RXGA 4X6OA 2WPMS 3PRBA 2D1JA 2VINA 5EPNA 3NCLA 3SYJA 6ESTA 5I25A 1KMHB 2WSSD 3K6YA 5EIYA 1WXRA 2PFEA 5GJ4B 3F9GA 1ZMJA 1GJ6A 1BMAA 2FYRA 5DP6A 3SI3H 2J34A 3GOVB 1NTPA 1AWHB 3K2UA 1P3EA 2P3TB 2ANWA 4SGBE 3GICB 1UCYE 1FAXA 2H9EH 1C1VH 3M3TA 2KR7A 1A3EH 3RXRA 2ZU3A 1W2KH 3CNRA 1O3AA 4WXIA 1GJDB 5C0TA 2VVCA 5LPRA 1BJVA 1IQNA 1BA8B 2KFWA 3P92A 3A85A 4BTTB 5FPSA 2ZNKH 1LMWB 2V3OH 1OHHD 2VWNA 4DW2U 1C5SA 5FAHA 2L74A 2PUXB 2V6NA 1E1QD 1O3PB 1KSNA 1U6QA 3WWBA 2BY7X 2ZPSA 3UUZA 1DT2A 1GMDG 3A7ZA 1LKBA 3IG6B 1C5VA 2FO9A 1JRSA 1KLIH 2Y81A 2XTTB 3SQHE 2TIOA 1H8HD 2NU0E 2KAIB 1GI0A 1V2TT 1YKTA 4X2XA 5F8XA 1JOUB 2P8OC 1UW7A 1RIWC 1PPHE 2GV7A 3KQDA 1O5DH 3MNBA 4ACAA 4TPYA 1O2NA 3RXCA 2GD4B 3V7TA 5KECA 3M5NA 1C4V2 3A7VA 1OWIA 1YLDA 3BTFE 2QV1A 2WYGA 5FBEA 2PKSC 5GDSH 1QHRB 3GCTF 1DY9A 3EA7A 2R3UA 3MMGA 2Z3EA 5J4SA 2ZHWH 1QJ6B 1W14U 2WPIS 2QA9E 4X1NU 3K65B 1S6LA 4RT0A 1P11E 1N6YA 3KL6A 3SUEA 3E91A 1WYKA 2FM2A 3NKKA 1AFQB 2FLRH 4FXGH 5CHAB 3LGUA 1SGEE 1D3QB 2ZDMA 1CA0B 1QB1A 1A61H 2BHGA 1NRPH 1YCPM 4MTBA 4GVUA 5JPMH 4DT4A 1LHEH 3NPSA 5HGGA 2G51A 3MWIU 4HI3A 4K8YA 2OP9A 1GJCB 4B75A 1BMLA 1O38A 1MAYA 2ZO3H 2B0FA 2YNBA 2VBCA 5LPFA 3KIDU 1VR1H 1A5GH 1GI8B 1O5EH 1P03A 3F2HA 1ELVA 2V0BA 1HJAC 1O3OA 1Q31A 3LOXA 2R2WU 3KYFA 1P0SH 4X1RU 1AGJA 1C9TA 3F9FA 4D9QA 1VGCB 1BRBE 4JCNA 1UO6A 2ZGJA 1P57B 3GY3A 3A84A 1EPTA 4PROA 1PYTD 3SI4H 1ZRBA 1HDTH 1Z1IA 2QF0A 1E38B 2D8WA 1WU1A 4MNWA 5E8EH 3P95A 4VGCC 3SNAA 4YZUA 5A0BA 1T8MA 1J14A 2FS9A 1P01A 1QBNA 2BQWB 3RXQA 2A5IA 1KTSB 3N99A 3PLBA 2XBYA 1O2PA 2ZCLP 4X2VA 1QA7A 2FLBH 2HNTF 2VU8E 5GPIB 4DT7B 4YOGA 1DVAH 4Q80A 4X6NA 3H7TA 1D3DB 1Y3WA 1C5RA 3GDVA 1T8OA 2ZCHP 3M61U 5I46H 4DURA 3ELAH 3WW7A 1SQTA 1LQEA 1F0UA 3PO1C 3RC4A 1C9PA 2V3MA 1Z6EA 2QY0B 2DUCA 3VEQB 3PTBA 1QRWA 2VIPA 4BNRA 1A7SA 9ESTA 1GMCG 1RGQA 1AVGH 2P95A 5DJ7A 1HJ8A 2NU4E 2FOMB 1C2HA 3MFJA 1G36A 3SHAH 1ANDA 3L3TA 4BXSA 2EI6A 5DP3A 1BUIA 5HIYA 4NCYA 2QXHA 1AQ7A 2ZFSA 1YPGH 2OCVB 2K8IA 3NWUA 1EJMA 1LCYA 2BTCE 1ACBE 1GMHF 2FP7B 2QN5T 3DA9B 1AVWA 1CE5A 5EW2H 2ZU5A 2ZHEH 1UTLM 1VCWA 3SNEA 3M7TA 4ZUHA 1GMDF 1O2SA 3T26A 3FKSD 4Y10E 1D3TB 3FZDA 2ZFQH 3U69H 3SU0A 2IJD1 4WMFA 4ABIA 5A8ZA 2C8XB 2SGFE 4DCDA 4CRBA 1K22H 4KTUA 3SV8A 3V12A 3ATIA 3F2FA 3RU4D 1ZJKA 1XVOA 1W13U 2ZA5A 1H8ED 1SGTA 1V2JT 4I8LA 3BTDE 1HJ9A 1DWCH 3A81A 4Q7ZA 2PHBA 4ASUD 4GPGA 3TNTA 5H4IB 1EOJA 2FOHA 1V2ST 1L1NA 2W7SA
chains in the Genus database with same CATH topology
4LZ4B 3D49H 5DP9A 2J4IA 1BZXE 3KN2A 2Z3DA 1C1MA 1GBLA 1Y3UA 3E1XB 5DK1A 2RG3A 1DM4B 1GCTB 1TB6H 3BTHE 3OSYA 3UNRA 4ZKOU 1GBIA 1MH0A 2HRVA 2ZFFH 3LDXH 3RXOA 1UMAH 1OYQA 3ZVGA 2QXGA 4YT7H 2CF8H 1V2NT 2BXUH 1SPJA 2ZTZA 1UTQA 1QR3E 1CQQA 1K28D 4YLQH 5FHTA 3T28A 2ODYB 2ZWLH 1VCQA 4LXBH 1FIWA 2VWMA 1T32A 4ABHA 1QRXA 5ESBA 2XC5A 4Y0YE 1AWFH 4ISNA 3S0NA 2G55A 4ISOA 1O3LA 1ZPBA 1IOEA 1K1IA 1O2ZA 3LJOA 4K2YA 3RLYH 1S84A 3RLWH 2LNCA 1T8LA 1XMNB 1MD7A 1WCZA 3EYDA 1TPPA 3UOUA 8GCHF 3TVJB 2H9HA 3BTQE 4X6MA 4CRCA 4ZH8A 1HAZB 1T8NA 1SQAA 1G32B 1DITH 3RXEA 1Z8RA 2FPZA 2W26A 1FY4A 1O2MA 2GTBA 3ZZ6A 1L4ZA 1C5OH 1C5NH 4MPUA 3B8JA 1HCGA 3BIVH 4AYVB 2PSXA 1UVTH 2ZKSA 1TGSZ 4AG1A 1G2MA 1GI7B 2EC9H 2FOBA 3VB6A 1DWBH 2GZ7A 1C2IA 1VCPA 1V2QT 1GBAA 4AG2A 1WTHD 2G00A 1DXPA 2ZECA 3M7UA 4MPWA 2H2ZA 3UOPA 1FONA 2OUAA 3DUXH 1BRUP 1AIXH 2ALVA 5E2OA 3ZVFA 4D76A 2VGCB 2A4GA 3PV4A 1GI4A 1ESTA 2A4QA 3U8TH 3M5MA 3SBKA 3DT0H 5K7RA 4NIYA 1IQLA 1PPEE 1MKWK 1GBFA 4FU8A 2AS9A 5T6DA 2BQ6B 3TGJE 3O8RA 4X8VH 1CHOF 4THNH 2C8YB 2QIQA 2ZPQA 3PMAB 1O2TA 1DLEA 1GI2A 1YPKH 1EB1H 1T4UH 2SNVA 5C1XA 4CRFA 1FN8A 1V3XA 1KTTB 3ATWA 5FPYA 1NU7B 1GHYH 4OS6A 1V2PT 1QCPA 1LPZB 2A2XH 3PB1E 2SGDE 2OQUA 3SU2A 3U98H 5LH8A 1ZTJA 2CN0H 5C3NA 2WUCA 1C4U2 1CVWH 1NRSH 1C5LH 1O0DH 3RXPA 1RTKA 4CREA 2BX4A 1LO6A 2P16A 5JYIA 1Y5AT 1SHYA 1PQ5A 1SSXA 2UUKB 2DE9A 2I6SA 5EXLA 3A83A 2NU2E 4NZLA 4X1PU 3A86A 3R3GB 3ZVBA 1F0TA 5AHGH 3DFLA 1LVYA 3UTUH 3A8DA 1IQHA 3STIA 3RXUA 3SZNA 1AD8H 1O32A 3L6PA 3GCHB 2GZ9A 4Y8ZA 2OC7A 3RC5A 2BLQA 5AFZH 1ABIH 2CV3A 1O2RA 2RA3A 1W0ZU 1IQGA 1B5GH 1OWJA 1ZR0A 1TALA 1WBGB 2XW9A 4DJZB 4X8UH 4D7FA 4Y11E 4INKA 3T62A 4ZAEA 5ETXA 4K5ZA 2ZDLA 2I6QA 4Y71A 3ZZBA 2O8MA 3AW0A 2YOLA 3OYPA 3RU4E 1PPBH 1BB0B 4NIVA 1C2GA 3RMMH 1CBWC 1V2OT 3RP2A 1ELEE 1YPJH 2G5VA 1GJ4H 5DKMA 2WUBA 3KHVA 2A0QB 2BLWA 1CA0C 1DUEA 4WMDA 1O30A 4OS4A 3SGQE 1GVZA 3MU0A 1GBCA 1OP0A 1Z1JA 1XUFA 3RDZA 1P09A 4MNXA 3TITA 2GVFA 1JXPA 1S81A 4ESTE 1IHSH 1C5UA 3RM2H 3E0NB 3T5FH 4ABEA 3P70B 1HLTH 1GMHG 3UNQA 4F49A 1SBWA 2WPHS 3M37A 5B6OA 5A0CA 3TGIE 3GY2A 5F6MA 3A82A 1NY22 3VGCC 2Z9GA 1C2KA 1GG6C 1O3CA 1GJBB 4CH8B 3Q77A 3SGBE 1E37B 1SLXB 1J8AA 3SJOA 1EAXA 2CHAC 1LPGB 2IPHA 2H6MA 4F4OC 2BDYA 2SGPE 1A4WH 4TPIZ 1V6DA 1RFNA 2FXRA 1X7AC 2ZDKA 4AB9A 4J2YB 2XYAA 3KQCA 1NRRH 2CGAA 4B71A 1TGBA 4K69A 2FS8A 1WSSH 2W7UA 1O3EA 3SUGA 1A0LA 2ZDAH 1OP2A 1GCDA 1S6HA 1V2KT 1ELDE 1E34B 1DSUA 2D26C 2PTNA 3ZZAA 2H5CA 5C5OA 1EKBB 3FP6E 3FVFB 1N8OC 3UY9A 1UHBB 5CMXH 1RIWB 2HALA 1YM0A 4ISIH 1NO9H 2ESTE 3BG4C 3HKIB 1BBRK 3M3VA 3PROA 1AUTC 3QDZB 5DO4H 1ZRKA 1TBQH 1SQOA 4IC6A 1KYNA 4DVAU 2EI8A 2O8LA 1LHDH 3ZVDA 2BDBA 3LGIA 1PQ7A 1NFWA 1O2JA 3KCGH 1GBJA 1GGDB 1YYY1 1IQIA 4A1VA 2FX6A 1GHWH 6CHAC 2TGTA 1O2HA 1NRQH 4O3UA 3SNCA 1ARCA 1D6WA 3UREA 4Q2KA 2PTCE 2AMQA 1QQ4A 4IC5A 1HAVB 2UUJB 2VIQA 1GI5A 3U1JB 1HUTH 3E90B 1GG6B 2ZHDA 1GVKB 1V2UT 4LK4A 2ZDNA 1SGFA 4NFEA 1HYLA 2FI3E 1O2GH 4FUCA 1C1OA 5ESTE 2FZZA 3FZZA 1O3IA 1CHOG 1B7XB 1O34A 1TMTH 1EB2A 1AHTH 1K21H 2GX4A 2BMGB 1ANEA 3QZQA 1T31A 2W3IA 3T29A 1QFKH 2FIRH 5C5NA 3LU9B 1MD8A 1XXDA 2VIWA 1P02A 4GUXA 4BAMB 2AGGX 7ESTE 2VIOA 3RMOH 1BTYA 1F0RA 2AGEX 4H42U 3MO3A 2BD2A 2AH4X 3ZV8A 3BIUH 3SGAE 3S7KB 5GCHF 3MH6A 3KQEA 2RDLA 1P2QA 1FPCH 2ILNA 2Y5GA 4TYDA 1UK4A 1LHFH 3F1SB 3Q3XA 4ZHMU 2Z7FE 2R0LA 4D7GA 1ETTH 2RCEA 4HZHA 2YNAA 3MTYA 5DPAA 3SU1A 2BVRH 1O5BB 3Q76A 1ZMLA 1FY3A 1TNIA 4D8NA 1CGHA 6CHAB 1K1MA 2VB0A 2ZCKP 3AASA 5G4BA 1W11U 1GI9B 1A46H 4GCHG 2C4FH 2ANKH 2GMTB 4U2WA 1DANH 3A8BA 1ZJDA 1C5YB 3MOCA 4K1EA 2VIVA 1V2VT 3BEFB 1F7ZA 1C5ZB 5PTPA 4GAWA 2UWLA 1GJ8B 1O3NA 1QJ1B 3MH5A 4JZDH 5DP8A 1F5RA 1C1SA 1PPZA 1SGPE 1SLVB 2JETB 2OXSA 3S7HB 2BVSH 1C5MD 3BV9B 3ZVAA 2ZZUH 5EW1H 3GCOA 4ZXYH 1L2EA 1UK3A 1AU8A 2BZ6H 2J94A 1SG8B 3K9XB 6GCHF 1FJSA 1EZSC 3GISB 3U9AH 3FP8E 2QAAA 1P2OA 4JZ1A 1LKAA 1ZGIA 2A5KA 4GHQA 1EP6A 3UQVA 4FVDA 1QL9A 3PTNA 1TRNA 1C1UH 1NFYA 3Q3KA 1O2LA 1A3BH 2VVVA 1ABJH 1BRAA 4WY3A 3QX5H 2GT7A 1JIMA 5DG6A 1A5IA 1P2MA 2F9UA 1AFEH 2CJIA 1GDNA 1IQMA 1EPTC 4XBDA 1HB0B 3SQEE 1DY8A 2BDCA 4TWWA 1MKWH 1O37A 3A8AA 1CGIE 1J17T 2ZGHA 4Y8XA 3RUOA 1IQJA 2BD9A 2XCNA 1UCYK 1SGYE 4B74A 3GCNA 3Q3YA 2Q6FA 1BTUA 1ESBA 1P8VC 4Y79A 1ZPCA 2TRMA 3OTJE 3GY4A 4RN6A 4IMQA 1Z71A 2B8OH 1SGDE 4RSPA 4J1YA 1QB9A 3K6ZA 2VNTA 4CBNA 4GHTA 1SLWB 1MQ5A 3KNXA 1RTFB 4UONA 1BQYA 2FOCA 7GCHG 4H4FA 2XBVA 1SMFE 5A0AE 3LH1A 1F92A 3O8CA 3A8CA 1EJAA 1ZMNA 1QURH 1K1PA 1LVBA 2F9BH 2FX4A 4R8TB 1AI8H 4AFSA 1VGCC 2GCTC 3QTOH 4HGCA 1UTJA 4K60A 1SLUB 1EZXC 3UQOA 5EXNA 4OS2A 2UWPA 2CF9H 5EU8A 4CHAC 3ZZ3A 5A8YA 3P17H 4CRAA 2BY6X 1QL7A 3V0XA 3VPKA 3S9AA 2P59A 4B2CA 4B1TA 2FODA 2VVUA 1FN6A 1K1LA 1L0ZA 4MLFB 5L2YH 1KDQA 1CT0E 1S5SA 1FQ3A 3CP7A 2A7JA 2HWLB 4Y8YA 2ZIQH 2RA0A 1F5KU 4XE4A 4FUBA 2OQ5A 2QXIA 2VWOA 3AW1A 5L6NH 1SHHB 2BDAA 5DGJA 3W95A 3MYWA 2OC8A 2PUQH 2ASUB 4CR5A 1AZ8A 4H6TA 1C2JA 1ZTKA 1BDAA 4ZROA 2G52A 4CBOA 4WWYA 3ZV9A 2OD3B 1AB9C 2BM2A 1HXEH 1O33A 1UVOA 5FCRA 1H9IE 1G3DA 3LKWA 3TK9A 1O2UA 1BMNH 1ZSJA 1YCPK 1YGCH 3QGNB 1P05A 1XKBC 1BCUH 2ZTYA 1MAXA 4MPVA 1ELAA 1K1JA 1YCPH 3LC3A 4U30A 1YPLH 2XWAA 2BD5A 3M5OA 3RXMA 4X8TH 4NIXA 2CXVA 5E0JA 1THSH 1OWEA 2ULLA 1KXEA 1OP8A 3BTEE 5JBCS 1MTNC 1O36A 4VGCB 4AYYB 2JETC 5CE1A 1GCTC 1HAIH 1PJPA 1O3JA 4NIWA 3SV2H 1G37A 4BAQB 4UD9H 1ELTA 2PW8H 3T27A 1TFXA 1P2IA 3F9HA 1O31A 1ELFA 2JH0D 1HAHH 1D6RA 1L1GA 1FLEE 2GDEH 1DWEH 1P06A 3URCA 1EOLA 4I33A 5TJXA 1B0FA 1MTSA 4DIHH 1T7CA 1S85A 1ELGA 4MDSA 4JYVH 2BDIA 3F68H 1KXDA 3MU1A 5JDUB 1DSTA 1GL0E 3PO1B 4ISHH 2V3HH 4XBBA 3TH3H 7GCHF 1O2WA 4NWKA 3W94A 3EQ0H 1XUGA 1EZQA 1ZHMA 2BY9X 3GY8A 2VH0A 2BLOA 1UVUH 3HATH 4FUJA 4I8HA 1HRTH 3TK6A 2QC2A 2GMTC 4H6SB 3VGCB 1IHTH 1JWTA 1DLKB 4JK6A 3D65E 3RXIA 2C90B 2K1QA 1NZQH 2XWBI 1RS0A 4BAOB 2FESH 4I8GA 2BD4A 6LPRA 1WOFA 4O3TA 2O8WA 2ANYA 1UHBA 2C8ZB 3G01A 4XDEA 1S6FA 4ZKSU 3UWJH 3MHWU 3C1KA 4AORA 1MMJN 2P3UB 2SNWA 1C1TA 1ZZZA 2H5DA 1A2CH 2G5NA 1DXWA 2WV5A 1AKSB 2BLVA 3PMHB 3ZZ8A 3L33A 2FOFA 2W3KA 4HFPB 5T6FA 2A45B 2G81E 3BG8A 1HJAB 4NFFA 3ATKA 3SO3A 1C1QA 1C1NA 3A7WA 3VB5A 4Y6DA 3ATLA 5C1UA 1TA2A 5BRRE 1TQ0B 2G8TA 1GI6A 1HFDA 5DP5A 4UFEH 2BX3A 3AAVA 4FU9A 1QBVH 3LIWA 3ESTA 3TNSA 4B73A 4ABBA 3EDXB 4B2AA 1Z7KA 2BOKA 2GCTB 4TY7A 9LPRA 3U1IB 1QRZA 4KP0A 1LHCH 2R3YA 2Y7ZA 4NZQA 4X1QU 1O2OA 1K9OE 1DFPA 3LGVA 1WV7H 5F8ZA 1C1PA 2OINA 1FZZA 4A5TS 3FAOA 1LTOA 5ABWA 1TX6A 1S83A 2EA3A 3UFAA 1Y3VA 2O8TA 1FPHH 2HOBA 3FFGA 1ZSKA 1ZPZA 5SGAE 3U8RH 5JBBS 2F83A 3CS0A 1O3FA 1SFIA 3SU3A 3SU4A 2A1DB 4I7YH 1O5AB 1YF4A 4JZIA 2BVXH 2ZF0H 1MUEB 1EX3A 3A80A 1DE7H 1SGIB 1TE0A 4I8JA 2PSYA 1V2MT 3R0FA 1Z8JB 1Y3YA 1LVMA 4B76A 2Y5HA 1Q3XA 3O8BA 5C20A 1S82A 5A8XA 2ZDVH 3LT3A 7LPRA 3LGTA 5C67A 3N7OA 4WF8A 1P10A 3M35A 2F9NA 1GI1A 1UVPA 5EGMA 2J95A 2TGDA 3A7XA 1F5LA 1FIZA 1MTVA 4ZKRU 4WH6A 1GHXH 1KY9A 1S0QA 1T4VH 3QN7A 1XM1A 4R0IA 1GHAG 1YPMH 4NSVA 3BSQA 3I29A 2Z6BD 1UJ1A 5EQRA 3GY6A 2ZGCA 3M3SA 4AZ2B 2PKSB 2TGPZ 3TH2H 3O8DA 5EQQA 2VJ1A 2BB4A 4U01A 2J9NA 1TABE 2BYAX 2H1UA 4UDWH 2WPLS 2ZTXA 1ID5H 3RC6A 3QZRA 1MKXK 1GBKA 1BBRH 2WYJA 1VJAU 3LH3A 3P8OA 5E0HA 1ZHRA 1K1OA 4CHAB 2V35A 4LZ1H 2BDGA 1CBWB 4WMEA 1VITG 2QXJA 3BEUA 8ESTE 1EAUA 4MG3A 3RXJA 2A4RA 3JZ1B 2DE8A 1C5XB 2B7DH 2FMJA 1H9LB 1IQFA 2XNIA 3Q00A 3RXBA 1C5PA 2UUYA 4Y76A 1TRYA 2HPPH 1P2JA 1XUIA 2O9QA 1CU1A 2OBOA 4INLA 4IMZA 4E05H 2J92A 4U32A 3V3MA 1SR5C 1TOMH 3MO9A 2EEKA 2ZFTA 1OWKA 1NM6A 1QJ7B 4QT8C 4ZHAA 1TNGA 1O2IA 1FAKH 1KXFA 2A31A 5A2MH 1V2LT 3SUDA 1DX5M 2BD3A 3PWCA 3ODFA 4YO9A 3UNSA 3I78A 4JZFH 4A1XA 1MCTA 3RXSA 3RXVA 3MH7A 1GBEA 1RJXB 1MQ6A 3AAUA 4Q7YA 3RMLH 4AGKA 1HAPH 2Z9IA 2H9TH 4MVNA 1OPHB 1N1LA 4K1SA 1HAYB 2F9VA 3SNDA 2ZFRH 4X2WA 1QIXB 5EXMA 5HM9A 4D9RA 4I32A 2J2UA 3P6ZB 2HNTC 5JB8S 2TGAA 1GHZA 1DOJA 2AFQB 2AEIH 1TLDA 1KLJH 1L1JA 2ZFPH 1TNLA 3BTKE 4RKOB 3S69A 2ZG0H 1BTZA 1C2EA 1TBRH 2ZGBH 1FV9A 3ODDA 1GMCF 1G9IE 1CT4E 1V2RT 2GZ8A 2ZGXH 1IAUA 4X