5GXPA

Cationic trypsin with gol/pge as dimer at ph 4.6
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Cationic Trypsin With GOL/PGE as Dimer at pH 4.6
rcsb
molecule tags Hydrolase
total genus 56
structure length 223
sequence length 223
chains with identical sequence B
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2016-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5gxpA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5gxpA02
3U1JB 2ZNKH 1DUAA 1O3MA 1GHBF 2CMYA 3GY6A 3LC3A 2OC7A 5FBIA 1O3FA 1ZMJA 4JK5A 1KLIH 2XBWA 2XTTB 2OBQA 2Z94A 4AFZA 1O5AB 5A8ZA 1LKBA 1OP0A 4X2WA 2JETC 1GJCB 4NA8A 2XNIA 4AGKA 3RXKA 1GJ7B 2ZPRA 1Y5AT 4AFUA 1C5YB 1UTKA 3BIVH 1XX9A 1WYKA 1LHFH 2VB0A 2ZHFH 4NG9H 1O35A 1C2KA 4JZ1A 1GDUA 3HGPA 3QWCH 4HTCH 8LPRA 1EZXC 5T3HA 2ZEBA 5BPEA 3LPRA 4IN2A 2GV7A 1DITH 1GI6A 1MH0A 4U32A 4WH8A 4TY6A 1DLEA 2R2MB 4I7YH 8GCHF 2ULLA 3VPKA 5BRRE 1MBMA 2ZF0H 3I77A 1SG8B 2Z9JA 5DP3A 4OS5A 1N8OB 1IQEA 1C4U2 4OS1A 1INCA 2SNVA 4U2WA 4WWYA 1YPHE 2P3UB 3ITIA 4J2YB 2IPHA 1P02A 2A4RA 3MWIU 4RKJB 3VGCC 1GG6C 3RXIA 2PUXB 3GDVA 1O2MA 2C93B 3E0PB 2TIOA 1C2EA 1C5XB 1SMFE 1UJ1A 2ZP0H 2NU1E 1YGCH 3PLBA 2V3HH 1FV9A 1NU7B 5I25A 4YOJA 3SJ8A 1IHTH 1SLXB 4ABFA 2ZPSA 1D3DB 1O3OA 1EASA 2FI5E 2W26A 1TPAE 1HAZB 3D65E 4HZHA 1G2MA 1GBLA 2BZ6H 4CR9A 2GZ8A 2FM2A 2J9NA 2ALVA 2AFQB 3SV8A 3V0XA 5GWZA 1TE0A 5LH8A 2GT8A 3F9HA 2P94A 1YPKH 1ZMLA 1K22H 1NO9H 5LPFA 1D3TB 1P57B 3LGYA 2UWLA 1C5RA 3OY5U 1CBWB 1CVWH 2OC0A 1GDQA 1TBQH 2OQUA 1O3LA 2Q6FA 2ZTYA 2GV6A 4FUCA 1T31A 6GCHG 3SNDA 1P12E 5FXLA 4CRFA 1NN6A 4DVAU 4WMDA 3K65B 1A0LA 3MNCA 2VIQA 1AMHA 1Y3YA 3RP2A 4A7IB 3RMNH 3TPIZ 1S83A 1A5HA 4SGAE 1WTGH 3JZ1B 2PTNA 4ZKSU 4MDSA 4NFFA 2ZWLH 1UCYK 1MTNB 3TU7H 1SGNE 3A80A 4B71A 1SFQB 1DT2A 4PROA 1EPTB 1ESAA 1K1IA 3SNCA 2Z9IA 4Y71A 4JZEH 2ZFPH 5A0AE 2VVVA 1WQVH 2A5AA 3AW1A 4JZDH 1AFQB 3RXRA 1GI8B 4MQAA 1GI2A 1T8MA 1E36B 3O8RA 4MNYA 4D9RA 1G2LA 4YM9A 4UE7H 3SJOA 1SL3A 3ATIA 1C5OH 1ORFA 3FZDA 1AO5A 4IC6A 1A61H 3VB7A 2HALA 1NFWA 5E0GA 2H1UA 2RDLA 1SGQE 4NZQA 4AFSA 3VXFH 1BRBE 2G51A 4CH2B 2AH4X 2JKHA 1GBJA 4UONA 1ANCA 1OKXA 3P6ZB 2A4OA 1FLEE 1FNIA 3M35A 4F49A 1AFEH 5HXFA 3TK5A 4B74A 4Y8XA 5JDUB 5FPSA 1ELVA 2AEIH 1PPEE 1YPHC 3UWJH 2FS8A 2BVXH 1DWEH 6LPRA 1BUIA 3IG6B 3E91A 4E05H 1CA8B 3EYDA 2QF0A 3D23A 1JIRA 1TPSA 4KP0A 5A8YA 1EP6A 2OQ5A 3NKKA 1XUIA 2FODA 2ZCHP 1TALA 1E0FD 3QZRA 1WTHD 3A8CA 4XE4A 1ELTA 4TPIZ 3RXDA 1A5GH 2VH6A 2HPPH 3PV4A 4ABGA 5F8TA 2WUBA 2WYGA 1FN8A 4NGAH 1UVPA 2XXLA 4CR5A 3TGIE 4JYTA 7GCHG 1NU9A 1BMAA 1ZSKA 3TH3H 4DT7B 3GISB 1L4DA 3LOXA 1W0YH 2D26C 4NIYA 3PROA 1P10A 1MTVA 1ZGVA 2FX6A 1AUTC 1P05A 2VWMA 1P01A 2ZQ1A 1GHYH 2BB4A 1XXFA 3STJA 1EOLA 3MU4A 4OGXA 3Q3XA 1O2JA 2WPIS 1TYNA 1LHDH 1C5QA 1GBFA 1QB6A 7LPRA 1GHZA 2B9LA 1LHGH 3Q3KA 1A46H 1DOJA 5DG6A 3LKWA 1JMOH 4A1XA 1NS3A 4K1SA 1TNLA 1MU6B 4UDWH 1MTNC 2B7DH 4TPYA 3V3MA 1P04A 2STAE 2WPKS 1AI8H 1FY5A 5I46H 1MAYA 3QGNB 4O03A 2UUJB 1AFQC 1P2NA 1GBDA 1A0HB 3M7TA 1AZZA 1BCUH 1S0RA 2FLRH 2BLQA 3E6PH 2Z3CA 1UVSH 1CU1A 4A5TS 2AMQA 1ESTA 1UK3A 2BYAX 3A84A 2AGEX 1GJAB 3VFEA 2O8LA 1AWHB 1ANBA 6GCHF 5G4BA 3SU3A 1F5RA 3M3VA 2BVRH 2NU3E 3UUZA 3ZVCA 3QK1A 1SPJA 3UNQA 3CS7A 1ABIH 1A5IA 3A87A 2UWOA 1CA0B 1FY3A 5DP6A 4JK6A 4CRAA 2J95A 5GIBA 1A4WH 4B1TA 1FXYA 1K1PA 2RCEA 1L2EA 1BTUA 1KLJH 1HJ9A 1P09A 4AYVB 2TGTA 3MU0A 4RN6A 3RMOH 4FXGH 2AMDA 3T5FH 1QY6A 3DT0H 1H8DH 4B2AA 1FY8E 3SU5A 1EKBB 1FN6A 5GJ4B 1E37B 7KMEH 1NRNH 4OS2A 1C9PA 3BTFE 1NFUA 1T8OA 3ZZ3A 1O5BB 2B0FA 3KN2A 8KME2 1O2GH 4Y8YA 3UOUA 1N6YA 1AB9C 3S9AA 1SGFA 1O2VA 1D6RA 3EAJA 1O2YA 2R0LA 4X2VA 3BEUA 1DWBH 2ZC9H 1Z8RA 1HIAB 2ODQA 5DGJA 1O3BA 1P9UA 1V2TT 4MNVA 1N6XA 2G4TA 1XUGA 1SHHB 5HM2A 1O3CA 1WU1A 1CO7E 2LNCA 2R9PA 1O5EH 4GPGA 4Y79A 1KDQB 3RMLH 3T28A 2ZA5A 4X6OA 1O3AA 1SC8U 4D76A 3TH2H 1SQTA 2M5TA 2FYQA 3SU4A 2G52A 3P95A 1W7GH 5T6GA 2BX4A 1DSTA 3MU5A 3MO9A 2A0QB 1SR5C 1V2QT 1L1GA 2EC9H 1RTLA 3P8OA 2HLCA 1P03A 1V2WT 2J34A 7GCHF 5DP7A 1GJDB 3MO6A 1OYTH 3QUMP 3KQCA 4ISNA 4CBNA 2TGAA 4FUFA 1K2I1 1ETTH 1ELGA 3K6YA 1C5ZB 2VIPA 1DS2E 1SB1H 1QA7A 3PM3A 5C5OA 1SGTA 5EPYA 1BQYA 1QQ4A 3RU4T 1K1OA 4ASHA 3SU2A 4INLA 3EA9A 1GBEA 4X1RU 2W7SA 1TNGA 1V6DA 1F2SE 2XWAA 1RS0A 4D8NA 3RC6A 4BAHB 4NIWA 3U8OH 1W8BH 1ANEA 5FPTA 1IQGA 3DUXH 1SLUB 1C2HA 1CA0C 3VEQB 3OSYA 1IQNA 1QRWA 1F5LA 1A2CH 1GBHA 1KXDA 1TRYA 1WCZA 9ESTA 5FHTA 2XYAA 1H9IE 5C67A 1F0UA 4O3TA 1J17T 2JH0D 3SGBE 3PMBB 3VB3A 2OP9A 1O3EA 5SGAE 1ZTJA 1RGQA 5F8ZA 2A32A 1ZR0A 3AASA 1KIGH 2F9BH 2ZGCA 3M5LA 3F9EA 3RM2H 1GMCG 3A7TA 1NC6A 1QCPA 1S6FA 1BMNH 1C2IA 1OWHA 3ZZAA 4YLUA 1QA0A 3K9XB 3QLPH 1BDAA 1SHYA 3RM0H 1O0DH 3LDXH 3MU1A 4K1TA 3A7XA 2QF3A 4FUIA 2BD8A 3KQDA 1GCTC 3LU9B 3SU6A 4CRCA 1FAXA 3SQEE 3C1KA 1A7SA 4X6MA 3H5CB 2BD7A 3S7KB 5FAHA 1DXPA 3LGIA 1Z8IB 4SGBE 1SGFG 3F1SB 4IMQA 1MQ6A 1YC0A 1TNHA 2ESTE 1D9IA 5JBAS 2GCHG 3UPEA 2XC4A 3T26A 2ZU1A 2FLBH 1P2JA 2Y82A 2R0KA 1ZOMA 3SU0A 5JB8S 3D49H 1S6HA 1XUKA 1SOTA 2IJOB 1MD8A 1P2KA 2O8MA 3BF6H 2VIDA 3UR6A 1GI1A 1K1JA 4WF8A 1C1WH 4U30A 1W11U 1GBIA 1EZUC 1BBRE 4TYDA 4FU8A 1C2FA 3NXPA 3PO1C 2CN0H 1O3DA 1DXWA 1BMLA 1MBQA 3U8TH 1HAPH 2EI8A 2VIWA 2Z3EA 3RXVA 2HNTF 3LGVA 1AY6H 1KXCA 1UVOA 1ID5H 5JBBS 5JBTA 1OWKA 3D62A 4BTUB 2XCFA 4JZIA 1C5NH 2ZG0H 2XCNA 3VGCB 3ESTA 1GG6B 2BQ7B 5LPRA 4R8TB 1O2WA 1QJ6B 1L4ZA 2EA3A 1O2SA 2ZFRH 1WOFA 2P95A 1BTZA 2FOMB 2FPZA 1KLTA 3F6UH 1YPGH 1ZHMA 1G32B 3B23B 4LK4A 1V2JT 2P8OB 2TGPZ 3B8JA 3BG4B 4Q80A 1O3NA 2SGQE 1HFDA 1V2RT 2F9NA 4LOYH 1L0ZA 4MTBA 1GDNA 4GHQA 1EUFA 4DURA 4VGCB 2VH0A 5DKMA 4CRDA 1ZRBA 1TA6A 5AFZH 3O8CA 3M37A 3AVZA 2BX3A 1H9LB 4BXWA 2ANWA 2OXSA 3A8DA 1ZHRA 4IGDA 1AKSB 4WXVA 1QJ1B 5B6OA 3RLYH 2FOCA 1PFXC 3ZZ4A 3TLOA 3LONA 1QIXB 4FUHA 3QGJA 1K1NA 3T27A 1NRQH 1XUHA 2QN5T 1NM6A 4I8KA 1TBRH 5EQSA 3RXBA 4WVPE 4IW4E 1YM0A 3BTME 2P3TB 2PR3A 4YESB 5C5NA 1E38B 1P11E 1LHCH 4X1SU 3GY2A 1W7XH 1THPB 3E16B 3PMJA 4WY3A 3ZZ8A 1O2XA 3I78A 4MPXA 1BJUA 2BDBA 4ISOA 5K7RA 3EDXB 4ZHLU 3HK6B 3UR9A 4X1PU 1RFNA 1GMCF 3PLPA 2QIQA 4X8VH 1O39A 3PWBA 1THSH 2J4IA 3M5MA 1K21H 1XVOA 4FUBA 4ZXXH 2CXVA 2PUQH 1PPBH 1ZSLA 1C5VA 1KXAA 1TX6A 2I6SA 2BDIA 1FY1A 1AWFH 1IQMA 1UTJA 2DE8A 2OINA 3KHVA 3U69H 3BTHE 1O36A 3LGUA 4RKOB 2O8TA 2G5NA 1QTFA 4JZFH 1GL0E 5AFYH 2VWLA 1JRTA 2GCHF 4GVUA 4JCNA 2W5EA 1OOKB 1C1OA 1KYNA 2VGCB 3S9CA 3OYPA 1QBOA 3EGKH 4FUEA 2UUFB 2CF9H 4X1QU 1HAVA 1O2PA 1SLVB 4MPWA 2GT7A 4UFGH 1GI9B 1HGTH 2PKAB 4X2XA 2FZZA 2ZGBH 3GYMA 2UUKB 4DJZB 3S0NA 3UNRA 4AX9H 1G3EA 2P8OC 2ILNA 1CHGA 3BG4C 2BDHA 4NFEA 5HYOA 1BTXA 1VCPA 1QNJA 1PPZA 1KSNA 1MMJN 2LPRA 4K5ZA 4ZUHA 1NY22 2WPMS 4VGCC 5GPIB 3SV9A 2ANYA 1UTQA 1NZQH 1AZ8A 5C1UA 2GD4B 3TJNA 4THNH 1TRMA 2C8ZB 3KCGH 5EXNA 1TONA 5GCHG 4UFFH 1FY4A 2FOBA 1GI0A 1O5FH 3M7QA 1TQ0B 2R2WU 3BV9B 1G30B 1BBRK 3BTEE 4Z0KA 4KTSA 3HK3B 2KAIA 1LPGB 1W2KH 4OGYA 6CHAC 3SBKA 1TAWA 4U01A 4ZXYH 1C1MA 1HV7A 5AHGH 1Z8GA 2J94A 1MZDA 2QXGA 3TNSA 1RRKA 2FEQH 3SGAE 2GZ9A 1WUNH 1O2OA 5FPYA 1MTUA 1FONA 1O34A 1BRCE 4HGCA 1IQIA 1TFXA 1E34B 3ZZ9A 2V6NA 4JYVH 1W12U 2F9PA 2WYJA 3GDSA 3KL6A 3LJJA 4ABBA 5GXPA 1YYY1 1O2ZA 1GHXH 2GX4A 5EG4A 1CT4E 3RLWH 1IQJA 4GAWA 1AHTH 2FMJA 4KGAA 1UHBA 3Q76A 4K69A 1NT1A 3F68H 2PLXA 3UQOA 3RXLA 1HYLA 2WPHS 2AS9A 3QN7A 2ZFTA 5C20A 2A5IA 2V35A 1YCPK 4FUDA 1ZPCA 3LH1A 1HNEE 4Q7ZA 4TWWA 4BANB 1NROH 3LC5A 1TGTA 2BY7X 1EQ9A 1YLDA 3WY8A 2Y5GA 3TGJE 2BY6X 1MZAA 2ZFSA 2OTVA 3NUMA 2VGCC 2XC0A 3GY5A 5JYIA 1QRXA 4MLFB 4BTIB 2QGRA 2G8TA 3SW2B 3TNTA 1J9CH 1MKXK 5HM9A 1MCTA 3L6PA 1TX7A 2OBOA 2QY0B 1DE7H 1D4PB 2O8UA 2OCVB 1AN1E 1BZXE 1UCYH 1SGPE 2DE9A 1BHXB 1UTMA 4A92A 1QJ7B 2C90B 4E7RG 3C27B 4AG1A 4MNWA 2ZU2A 3PTBA 1OXGA 4HI3A 1WSSH 1OX1A 1AB9B 4D7GA 2PHBA 1T7CA 5T6FA 2J2UA 5JB9S 4ABHA 3A7ZA 1HXEH 2G55A 2G4UA 3MH6A 3U8RH 2Z6BD 2GKVE 4CHAC 5EPNA 1KXFA 1YCPH 1QR3E 5FCRA 1SGDE 2Z3DA 4DW2U 2BDCA 1V3XA 1V2VT 1SVPA 1Z71A 3QX5H 2C8WB 1CT2E 1V2NT 1BRUP 3V12A 5E0JA 1ZSJA 4ABEA 4E7NA 1DUEA 1V2MT 4UFEH 2FOHA 2GCTB 3RXFA 4ZAEA 1PPFE 5ABWA 5AVDA 1PJPA 4ZKRU 5EGMA 1P2QA 2ZZUH 1A0JA 4XBCA 3M5OA 4DCDA 2FOGA 3UY9A 1QL8A 1O32A 2A7CA 1F0RA 1Z1JA 5GCHF 5JPMH 3UQVA 1VR1H 1BJVA 2ZGHA 2NU4E 4LXBH 1LMWB 3K6ZA 1IHSH 2A2XH 5C3NA 3T29A 5CHAB 1W13U 2BD3A 1C1NA 3GY7A 1WAYB 2BQ6B 1J16A 1GBCA 3QDZB 2V3OH 3PWCA 5J4QA 4JYUH 1Q2WA 3M3TA 2BOKA 2V0BA 2VVCA 2Y7ZA 5DP5A 1LCYA 1BTHH 1LKAA 1YBWA 4ESTE 1TMTH 4YT7H 1P9SA 1DVAH 1BRAA 5EW1H 1O2LA 3SN8A 1WV7H 2WPJS 2CHAB 1YLCA 1OP8A 3PB1E 5FCKA 1Z1IA 4Q7YA 4LZ1H 1V2KT 2FOEA 2QA9E 3SGQE 3TITA 1RIWB 1A3BH 2Y7XA 1ZLRA 2QXJA 1S81A 3ZYEA 1OYQA 4IBLH 4Y8ZA 1NFYA 2HGTH 1P3EA 4MNXA 1ZYOA 1J15A 1D6WA 1IQHA 4XFQA 2RA0A 4Y76A 1HCGA 3LGWA 1C2JA 3SI4H 2VNTA 1TWXB 3L3TA 1NPMA 1GCTB 2SGAA 3A89A 3RXQA 4A6LA 3A8AA 1NESE 2B5TB 3SOSA 1YP9A 4QT8C 1HXFH 2UUYA 1O30A 2ZTZA 4X8TH 1DSUA 3ATWA 3I29A 2C8XB 2P3FH 3ZZ5A 4X8UH 3M61U 4DGJA 4X6NA 1DY9A 3PTNA 2ZO3H 5L30H 1SGCA 2O8WA 1Z7KA 3QTVH 2H9EH 3ZZ6A 2WINI 1P06A 2FX4A 1JRSA 4OS7A 1ZPZA 4K3JA 2F9OA 2GCTC 1S82A 4IN1A 2ZDVH 2YNAA 4Z6AH 2XBYA 2HVXA 2P93A 1YCPM 3PO1B 1ZJKA 3E90B 5TCAA 1AE5A 1C5PA 4ABAA 1J14A 2ASUB 4NIVA 1DY8A 3MHWU 5JBCS 1Z6EA 2ZU5A 2Y81A 1HAXB 2BY9X 4OS4A 1GCDA 1FMGA 4BAOB 1YKTA 3NK8A 1C5UA 3SV7A 4BAKB 1GI7B 1Y3XA 1EJNA 1ZRKA 5CHAC 1GJ4H 2RG3A 3DA9B 3MOCA 3ODDA 1SI5H 1TIOA 3V13A 1X7AC 3SNAA 4ZKOU 1YF4A 3TGKE 2IN2A 4A1VA 4Y7AA 1VITG 3MH4A 3GOVB 2F91A 4NIXA 3SORA 5TCCA 3URDA 3VB6A 2BQWB 5CMXH 5IDKA 2TRMA 1LVBA 2BHGA 4BTTB 1O38A 3V7TA 2CHAC 1C5LH 1YPJH 2FP7B 2J92A 1GGDB 1RIWC 1CQQA 3SNBA 2PSXA 4I32A 1XXDA 2D1JA 4O3UA 1O2UA 3LJOA 2C3SA 2FOAA 1YPMH 4LZ4B 2QV1A 1KXBA 3BIUH 2ZDAH 3RXAA 1EP5A 2G81E 1NTPA 1C1RA 4ISHH 5A0BA 3BEFB 4NCYA 2A4QA 3CENA 1ZHPA 3RC4A 1IAUA 5CE1A 4ABDA 3KF2A 1C5WB 1EAIA 1AVGH 1UTNA 2PV9B 1ZTLA 5LGOA 4ZHMU 3QZQA 4YOIA 1RTFB 4X0WU 1LVOA 3ATLA 1O37A 1QB1A 2GDEH 4B2CA 3RUOA 1FDPA 1O2TA 3ZYDA 5FX6A 1M9UA 2BXTH 1O5DH 4R0IA 3Q77A 4Y0YE 4YZUA 2A31A 3AAUA 1HDTH 1EAXA 1ARCA 3SQHE 1OS8A 1VJ9U 4Y6DA 4ZHAA 3F9GA 5A09A 2ZI2H 3P70B 1THRH 1AE8H 1BITA 5A2MH 3T25A 3E3TA 2HNTC 1ELAA 1CGHA 2PKAA 1QQUA 3KEEA 3ZZBA 1DWCH 1EAWA 1C2DA 3ELAH 1JOUB 4WJG2 4B75A 3ZVGA 2ZDKA 4AORA 3H7OA 4WMFA 1GHWH 1EXFA 1ABJH 3KNXA 4J1YA 2FTLE 3SNEA 5TJXA 2GZ7A 1ZZZA 2ZKSA 1LTOA 3MFJA 3T2NA 1HJ8A 3GICB 3RXGA 1OSSA 1A1RA 1LPKB 5F8XA 5AF9H 4K60A 4ABJA 5EW2H 5C2ZA 1FJSA 3BTTE 1GJ8B 2Y6TA 3P8GA 1GHAF 2ALPA 1U6QA 2BDYA 1WQSA 2SGFE 1C1PA 1ELBA 2FIRH 2BD9A 1MAXA 1BB0B 1P2MA 3E1XB 1Y3VA 2R3UA 2ODYB 1ZPBA 1HAIH 1PPCE 1TBZH 3GYLB 1XUJA 5L2ZH 3W95A 5DP9A 1W14U 1GGDC 3ATMA 1VCWA 2SGEE 1K1MA 1ELFA 1OWIA 1NRRH 1Y5BT 4I8HA 4AOQA 3SUGA 4DIIH 2ANKH 3G01A 2A7JA 1CE5A 1F0SA 1TOCB 1GJBB 1GVZA 3SJIA 2WV5A 3M36A 2OC1A 4JMYA 1HAGE 3A82A 3DFJA 1G3CA 4BAQB 1B7XB 2GVFA 1SQAA 4OS6A 3QTOH 1EPTA 6CHAB 2GMTC 3MNSA 1O5CB 3BTWE 1GBBA 1IQFA 4O9VA 4I8JA 1Y8TA 1C4V2 1WBGB 1DANH 3PMHB 1VITF 3SHCH 2GP9B 1YPEH 4UFDH 1HUTH 5ETXA 2AGGX 1XM1A 2XBVA 1DPOA 4K8BA 1HB0B 1SGEE 1AVWA 4AN7A 1TGCA 1FPCH 3CP7A 1Y59T 2BD4A 3TJUA 1QFKH 3UIRA 4YOGA 1AGJA 2CV3A 4FU9A 3VB4A 3NZIA 4K2YA 1O3IA 3LIWA 2Y80A 4UD9H 2OUAA 3RXEA 2TPIZ 4IS5A 2JH5D 1IOEA 1PPGE 2FTMA 4IMZA 2I6QA 1ELCA 2BXUH 1FQ3A 4Y0ZE 2XW9A 1HJAB 1RJXB 4CRGA 3ODFA 1LHEH 1TMUH 4BXSA 1SFIA 3N7OA 1C5MD 2ZQ2A 1GMDF 2FI4E 2HRVA 1QGFA 2Z7FE 1LQDB 3GCOA 1KTSB 1O2IA 1TNIA 1NFXA 3GDUA 4MVNA 1CHOF 2ZHDA 4IC5A 1GVKB 3KGPA 5DP8A 2PGBB 3TVJB 1G36A 3L33A 4KELA 1GMHF 1LVYA 3PMAB 1P3CA 2AERH 3UOPA 2GTBA 3OU0A 4DY7B 1W3CA 1C5SA 2F9VA 4GUXA 1UVUH 2K1QA 4AB9A 1E35B 2SGPE 2R3YA 1QBVH 2ZDMA 4NWLA 2FOFA 1PYTD 4Y11E 1EAUA 4CH8B 1ACBE 4BAMB 1FIZA 3EE0B 1B5GH 1O2HA 1UTOA 1UK4A 1OPHB 2BZAA 3M7UA 3GCHB 2C4FH 4TY7A 3UNSA 1Y5UT 1DX5M 1VITH 3H7TA 4CHAB 1HAOH 2FDAA 3NPSA 3AW0A 1NRPH 1B0FA 2H9HA 4X6PA 1O2RA 1PQAA 1AU8A 5C1XA 2A2QH 2J38A 1C1UH 4B76A 3BTQE 1EJMA 2DUCA 3RXHA 3IITA 1S5SA 3ZZDA 4GCHF 1OP2A 4H42U 3TK6A 2QC2A 1DDJA 1UTPA 2SGDE 3RXCA 1KTTB 1O31A 1S84A 1FIWA 1JWTA 3HKJB 3FP6E 1QB9A 4AG2A 1O2KA 3NCLA 3RXOA 1G9IE 3HATH 2NU2E 1O5GH 1C5TA 2Q1JA 1MD7A 3BSQA 4RSPA 5FBEA 8ESTE 1K1LA 3Q00A 5HGGA 3PYHA 5DP4A 3ZV9A 1QHRB 1SGIB 1GI3A 3M5NA 2WUCA 1TRNA 4WXIA 2ZFQH 4Y10E 2YNBA 1L1JA 5EQQA 4ZROA 5FX5A 1QL7A 1XMNB 2G5VA 3SHAH 4DIHH 2Q6DA 4X8SH 1HJAC 5E2PA 3S69A 2BOHB 3P8FA 1SSXA 2BLOA 1GWAA 2AIPA 3W94A 1T4VH 1KY9A 3K2UA 3BTGE 1BBRH 2WV4A 2CGAA 3FANA 1AD8H 2W3KA 1GHVH 1XVMA 2VWOA 2A5KA 1OWJA 5A0CA 2O9QA 3BN9A 2ZGJA 2P16A 3M3SA 5K0HA 1AUJA 1SGYE 2THFB 3MI4A 4H4FA 4INKA 3URCA 4XDEA 1HIAA 1AVXA 1N8OC 3FP8E 1UVTH 4NA7A 1ZGIA 3ZVFA 2ZTXA 4CREA 2TBSA 3SU1A 3GY3A 4GHTA 2EI7A 3R0FA 4ZH8A 1O3KA 1KDQA 1TLDA 1EOJA 1MUEB 1GBAA 2H6MA 2CJIA 1H9HE 2ZU4A 2W7UA 1F92A 1BOQA 3DD2H 5EODA 2OC8A 1HRTH 3TJOA 1TPPA 4YO9A 3GCHC 4ABIA 5DPAA 2PTCE 1CGIE 1PQ5A 3UTUH 1DICA 1RTKA 1T8LA 1D3PB 5IYTA 4KKDA 4YTAA 2IOTA 3OX7U 4GSOA 3ZZCA 3OTJE 2A7HA 3RDZA 3A83A 1ESBA 3O8BA 6ESTA 1F0TA 3TIUA 2BLVA 1HAVB 1SOZA 1S85A 1LO6A 2CF8H 4M7GA 5PTPA 2F3CE 1FUJA 3ZV8A 1EZSC 3RXPA 3VXEH 4ZMAH 1GJ6A 3STIA 1CBWC 3LT3A 2AIQA 1MKXH 4FUGA 4YT6H 1CT0E 3JZ2B 3LH3A 2XC5A 4DG4A 4UEHH 1GPZA 3F9FA 1GBTA 3DFLA 1AQ7A 4B2BA 4D9QA 3UFAA 2QCYA 1C9TA 1W0ZU 3T62A 3U9AH 3MU8A 1TOMH 3SV6A 1MKWK 3QO6A 1LDTT 1C1QA 2F9UA 1VCQA 2G00A 1Z8JB 4MG3A 3TH4H 3VB5A 1JIMA 2KAIB 1EPTC 1SLWB 5GDSH 1MTWA 2AMPA 1V2UT 4AGJA 1C2LA 2Z9GA 1VZQH 1S0QA 1ARBA 2XRCA 2HPQH 2BMGB 1V2OT 1O3JA 2ZDNA 4D7FA 4NSYA 1EJAA 4AYYB 4WMEA 2OLGA 1UTLM 1Q31A 1HPGA 2FO9A 1O33A 1MU8B 4B73A 3RU4D 1UK2A 2BD2A 2W3IA 3MNXA 1HAHH 2VIOA 4CBOA 3SJKA 2PKSB 3RXMA 4DOQA 3FVFB 4XOJA 2RA3A 2ZIQH 4Q2KA 1TABE 4BNRA 1ZMNA 2Y5FA 3HGNA 3RXSA 1BTPA 3ZVAA 1UHBB 1ELEE 2ZFFH 1CGJE 4FUJA 4MPUA 3R3GB 3EA7A 1O2QA 3A8BA 3E0NB 2Q6GA 1XKBC 4I33A 1ZTKA 4XSKU 1GJ9B 1MKWH 3CS0A 4K1EA 4AB8A 3ZVEA 2VINA 4X2YA 1DM4B 2BTCE 1NRSH 4TWYA 3GY8A 1ETSH 3ATKA 5F03A 5ESBA 4XBBA 4YLQH 2Z9LA 3LGTA 5EXLA 2H9TH 1BHXF 1SBWA 1EZQA 2A4GA 2ZHEH 1TGBA 2ZHWH 2BLWA 4NSVA 1VGCB 4FVDA 1H1BA 2BY8X 3S9BA 1FZZA 2PW8H 1GHAG 5HMAA 4A1TA 2ZPQA 1Z6JH 1Q3XA 2A45B 2PFEA 2VJ1A 2FYRA 1IQKA 4ZKNU 2HNTE 4CRBA 1MCVA 1DWDH 1GJ5H 3RXJA 2QAAA 3TJVA 1O3PB 2QYIA 4O97A 1TB6H 2HOBA 4FU7A 1OWDA 2BVSH 4FVBA 1ZJDA 3OY6U 1DLKB 1P0SH 3GCNA 1XUFA 3NWUA 5C1YA 3GCTG 2FXRA 1C2MA 1RXPA 2VU8E 2ZU3A 4NZLA 3KQBA 1B0EA 1FAKH 2AYWA 4F4OC 2SNWA 3FZZA 3EQ0H 1BA8B 1KXEA 3P8NA 4INHA 1T8NA 2QXIA 4KTCA 1T32A 1V2PT 3SUDA 1QURH 3A7VA 2QXHA 1TMBH 1SQOA 1AKSA 5ESTE 2FWWA 1H8IH 3BTDE 4NA9H 2JH6D 1EATA 4I31A 2XWBI 2GDDA 1LQEA 1N1LA 5DJ7A 1LVMA 3A7YA 4WH6A 3DHKH 3U1IB 2PGQB 1JXPA 3P92A 1C4Y2 2PKSC 1JBUH 3RXUA 1GHBG 5EOKA 1G3BA 1QBNA 3ENSB 5DK1A 1GBMA 1TGSZ 2PWXA 5EU8A 3MH7A 2B8OH 5T6DA 1ANDA 1EX3A 1W10U 3SUFA 1MTSA 1QRZA 1PPHE 1K9OE 1BTYA 2EI6A 2BY5X 3MMGA 4MPVA 1O3HA 2OD3B 4XBDA 1RD3B 2GMTB 3SZNA 1TPOA 2ODPA 3GY4A 1PYTC 3MO3A 1TX8A 1PQ8A 4E06H 3RXTA 7ESTE 2BDAA 2FI3E 3A88A 3P17H 4AZ2B 1BTWA 2ZCLP 5H4IB 1GMDG 1TQ7B 2ZECA 1FI8A 3KQEA 3U98H 1BT7A 1CHOG 1D3QB 3HKIB 2NU0E 2WPLS 1VGCC 1A3EH 1HLTH 2HWLB 2NWNA 1MQ5A 4K8YA 2PSYA 1PQ7A 8GCHG 4ISIH 2GGVB 1J8AA 4BOHA 5E0HA 3S7HB 1GMHG 3E8LA 1H4WA 5L2YH 3HPTB 1SGRE 1L1NA 5EQRA 5DO4H 3ZVBA 1Y3WA 1ETRH 2XBXA 2D2DA 3ZZ7A 2JETB 4Q7XA 4X1NU 3O8DA 2BD5A 1OWEA 5LPEA 1TNJA 1O3GA 1TNKA 1F7ZA 1DFPA 1FPHH 1P2OA 1GI4A 3MNBA 1ELDE 1C1TA 1TA2A 1YPLH 5EXMA 3A81A 1P8VC 1P2IA 2ZGXH 1HAYB 1V2ST 1UO6A 3MYWA 5E2OA 1K28D 2ZCKP 3BG8A 5J4SA 4KTUA 5F6MA 2D8WA 1C2GA 3A85A 3A86A 2BM2A 2H2ZA 3Q3YA 1CSOE 3SUEA 1IQLA 1BMMH 1LPZB 3IWMA 1T4UH 2ZDLA 1GBKA 1GL1A 2BDGA 3TK9A 2SFAA 3A7WA 4GCHG 9LPRA 1V2LT 1UCYE 4NWKA 3FP7E 4H6TA 5E8EH 3ZVDA 1TGNA 2C8YB 3RU4E 2Y5HA 3EA8A 1G3DA 1UMAH 3UREA 3PLKA 1BIOA 1EB1H 3SV2H 3BTKE 4Y7BA 5A8XA 2FS9A 4H6SB 2YOLA 2STBE 4I8GA 1QL9A 2VIVA 2Z9KA 1Y3UA 3B9FH 1GVLA 1EB2A 4GLYA 3GCTF 1G37A 1GI5A 5L6NH 3AAVA 2F83A 2A1DB 2ZHQH 3MH5A 1HBTH 1O2NA 1AIXH 2P59A 3SI3H 2VWNA 2VVUA 3UWIA 4ISLA 1XKAC 3SJ9A 2ANMH 1VJAU 4HFPB 3RC5A 4AFQA 1C1VH 3SO3A 2UWPA 2H5DA 2EEKA 3FAOA 2AGIX 3KIDU 2FESH 2TGDA 3MTYA 1F5KU 3RMMH 3BEIB 2H5CA 3FFGA 1C1SA 4I8LA
chains in the Genus database with same CATH superfamily
3U1JB 2ZNKH 1NBMD 1DUAA 1O3MA 5CDFE 1GHBF 2CMYA 1BMFD 3GY6A 3LC3A 2OC7A 5FBIA 1O3FA 1ZMJA 4JK5A 1KLIH 2XBWA 2XTTB 2OBQA 2Z94A 4AFZA 1O5AB 5A8ZA 1LKBA 1OP0A 2EQNA 4X2WA 2JETC 2KR7A 1GJCB 4NA8A 2XNIA 3KQ5A 4AGKA 3RXKA 1GJ7B 2ZPRA 1Y5AT 3KYGA 4AFUA 1C5YB 2J98B 1UTKA 3BIVH 1XX9A 1WYKA 1LHFH 2VB0A 2ZHFH 4NG9H 1O35A 1C2KA 1OHHD 4JZ1A 1GDUA 4OM9A 3HGPA 3QWCH 4HTCH 8LPRA 1EZXC 3OFND 5T3HA 2ZEBA 5BPEA 3LPRA 4IN2A 2GV7A 1DITH 1GI6A 1MH0A 4U32A 4WH8A 4TY6A 1DLEA 2R2MB 4I7YH 8GCHF 2ULLA 3VPKA 5BRRE 1MBMA 2ZF0H 3I77A 1SG8B 2Z9JA 5DP3A 4OS5A 1N8OB 1IQEA 1C4U2 4OS1A 1INCA 2SNVA 4U2WA 4WWYA 1YPHE 2P3UB 3ITIA 4J2YB 5HKKD 2IPHA 1P02A 2A4RA 3MWIU 4RKJB 3VGCC 1GG6C 3RXIA 2PUXB 3GDVA 2KCOA 1O2MA 2C93B 3E0PB 2TIOA 1C2EA 1C5XB 1SMFE 1UJ1A 2ZP0H 2NU1E 1YGCH 3PLBA 2V3HH 1FV9A 1NU7B 5I25A 4YOJA 3SJ8A 1IHTH 1SLXB 4ABFA 2ZPSA 1D3DB 1O3OA 1EASA 2FI5E 2W26A 1TPAE 1HAZB 3D65E 4HZHA 1G2MA 1GBLA 2BZ6H 4CR9A 2GZ8A 2FM2A 2J9NA 2ALVA 2AFQB 3SV8A 3V0XA 5GWZA 1TE0A 5LH8A 2GT8A 3F9HA 2P94A 1YPKH 1ZMLA 1K22H 1NO9H 5LPFA 1D3TB 1P57B 3LGYA 2UWLA 1C5RA 1YLNA 1CBWB 1CVWH 2OC0A 3OY5U 1GDQA 1TBQH 2OQUA 1O3LA 2Q6FA 2ZTYA 2GV6A 4FUCA 1T31A 6GCHG 3SNDA 1P12E 5FXLA 4CRFA 1NN6A 4DVAU 4WMDA 3K65B 1A0LA 3MNCA 2VIQA 1AMHA 1Y3YA 3RP2A 4A7IB 3RMNH 3TPIZ 1S83A 1A5HA 4SGAE 1WTGH 3JZ1B 2PTNA 4ZKSU 4MDSA 4NFFA 2ZWLH 2JIZD 1UCYK 1MTNB 3TU7H 1SGNE 3A80A 4B71A 1SFQB 1DT2A 4PROA 1EPTB 1ESAA 1K1IA 3SNCA 2Z9IA 4Y71A 4JZEH 4YXWD 2ZFPH 5A0AE 2VVVA 1WQVH 2A5AA 3AW1A 4JZDH 1AFQB 3RXRA 1GI8B 4MQAA 1GI2A 1T8MA 1E36B 3O8RA 4MNYA 4B6EA 5T1VA 4D9RA 1G2LA 4YM9A 4XRNA 4UE7H 3SJOA 1SL3A 3ATIA 1C5OH 1ORFA 3FZDA 1AO5A 4IC6A 1A61H 3VB7A 2HALA 1NFWA 5E0GA 2H1UA 2RDLA 1SGQE 4NZQA 4AFSA 3VXFH 1BRBE 2G51A 4CH2B 2AH4X 2JKHA 1GBJA 4UONA 1ANCA 1OKXA 3H09A 3P6ZB 2A4OA 1FLEE 1FNIA 3M35A 4F49A 1AFEH 5HXFA 3TK5A 4B74A 4Y8XA 5JDUB 5FPSA 1ELVA 2AEIH 1PPEE 1YPHC 3UWJH 2FS8A 2BVXH 1DWEH 6LPRA 1BUIA 3IG6B 3E91A 4E05H 1CA8B 3EYDA 2QF0A 3D23A 1JIRA 1TPSA 4KP0A 5A8YA 1EP6A 2OQ5A 3NKKA 1XUIA 2FODA 2ZCHP 1TALA 1E0FD 3QZRA 1WTHD 3A8CA 4XE4A 1ELTA 4TPIZ 3RXDA 4P02A 1A5GH 2VH6A 2HPPH 3PV4A 4ABGA 5F8TA 2WUBA 2WYGA 1FN8A 4NGAH 1UVPA 2XXLA 4CR5A 3TGIE 4JYTA 1H8HD 7GCHG 1NU9A 1BMAA 1ZSKA 3SYJA 3TH3H 4DT7B 3GISB 4F55A 1L4DA 3LOXA 1W0YH 2D26C 4NIYA 3PROA 1P10A 1MTVA 1ZGVA 2FX6A 1AUTC 1P05A 2VWMA 1P01A 2ZQ1A 1GHYH 2W6ID 2BB4A 1XXFA 4TSFD 1NBME 3STJA 1EOLA 3MU4A 5HIYA 4OGXA 3Q3XA 1O2JA 2WPIS 1TYNA 1LHDH 1C5QA 1GBFA 1QB6A 7LPRA 1GHZA 2B9LA 1LHGH 3Q3KA 1A46H 1DOJA 5DG6A 3LKWA 1JMOH 4A1XA 1NS3A 4K1SA 1TNLA 1MU6B 4UDWH 1MTNC 2B7DH 4TPYA 3V3MA 1P04A 2STAE 2WPKS 1AI8H 1FY5A 5I46H 1MAYA 3QGNB 4O03A 2UUJB 3DSGA 1AFQC 1P2NA 1A0HB 1GBDA 3M7TA 1AZZA 1BCUH 1S0RA 2FLRH 2BLQA 3E6PH 2Z3CA 1UVSH 1CU1A 4A5TS 2AMQA 1ESTA 1UK3A 2BYAX 3A84A 2AGEX 1GJAB 3VFEA 2O8LA 1AWHB 1ANBA 6GCHF 5G4BA 3SU3A 1F5RA 3M3VA 2BVRH 2NU3E 3UUZA 3ZVCA 3QK1A 1SPJA 2XNDD 1SKYE 3UNQA 3CS7A 1ABIH 1A5IA 3A87A 2UWOA 1CA0B 1FY3A 5DP6A 4JK6A 4CRAA 2J95A 5GIBA 1A4WH 4B1TA 1FXYA 1K1PA 2RCEA 1L2EA 5GNDA 1BTUA 1KLJH 1HJ9A 1P09A 2KZ4A 4AYVB 2TGTA 3MU0A 4RN6A 3RMOH 4FXGH 2AMDA 3T5FH 1QY6A 3DT0H 1H8DH 4B2AA 1FY8E 3SU5A 1EKBB 1FN6A 5GJ4B 1E37B 7KMEH 1NRNH 4OS2A 1C9PA 3BTFE 1NFUA 1T8OA 3ZZ3A 1O5BB 2B0FA 3KN2A 8KME2 1O2GH 4Y8YA 3UOUA 1N6YA 4RT0A 1AB9C 3S9AA 1SGFA 1O2VA 2WZQA 1D6RA 3EAJA 1O2YA 2R0LA 4X2VA 3BEUA 1DWBH 2ZC9H 1Z8RA 1HIAB 2ODQA 5DGJA 1O3BA 1P9UA 1V2TT 4MNVA 1N6XA 2G4TA 1XUGA 1SHHB 5HM2A 1O3CA 1WU1A 1CO7E 2LNCA 2R9PA 1O5EH 4GPGA 4Y79A 1KDQB 3RMLH 3T28A 2ZA5A 4X6OA 1O3AA 1SC8U 4D76A 3TH2H 1SQTA 2M5TA 3CNRA 2FYQA 2V3MA 3SU4A 2G52A 3P95A 1W7GH 5T6GA 2BX4A 1DSTA 3MU5A 3MO9A 2A0QB 1SR5C 1V2QT 1L1GA 2EC9H 1RTLA 3P8OA 2HLCA 2J34A 1P03A 1V2WT 2LP6A 7GCHF 5DP7A 1GJDB 3MO6A 1OYTH 3QUMP 3KQCA 4ISNA 4CBNA 2TGAA 4FUFA 1K2I1 1ETTH 1ELGA 5B6LA 3K6YA 1C5ZB 2VIPA 1DS2E 1SB1H 1QA7A 3PM3A 5C5OA 1SGTA 5EPYA 1BQYA 1QQ4A 3RU4T 1K1OA 4ASHA 3SU2A 4INLA 3EA9A 1GBEA 4X1RU 2W7SA 1TNGA 1V6DA 1F2SE 2XWAA 1RS0A 4D8NA 3RC6A 4BAHB 4NIWA 3U8OH 1W8BH 1ANEA 5FPTA 1IQGA 3DUXH 1SLUB 2KCAA 1C2HA 1CA0C 3VEQB 3OSYA 1IQNA 1QRWA 1F5LA 1A2CH 1GBHA 1KXDA 1W0KD 2JDID 1TRYA 2YMSB 3UAIC 1WCZA 3FO8D 5FHTA 9ESTA 2XYAA 1H9IE 5C67A 1F0UA 4O3TA 1J17T 2JH0D 3SGBE 3PMBB 3VB3A 3FOAA 2OP9A 1O3EA 5SGAE 1ZTJA 1RGQA 5EJZA 5F8ZA 2A32A 1ZR0A 3AASA 1KIGH 2F9BH 2ZGCA 3M5LA 3F9EA 1K0HA 3RM2H 1GMCG 3A7TA 1NC6A 1QCPA 1S6FA 1BMNH 1C2IA 1OWHA 5KECA 3OE7D 3ZZAA 4YLUA 1QA0A 3K9XB 3QLPH 1BDAA 1SHYA 3RM0H 1O0DH 3LDXH 2HVYB 3MU1A 4K1TA 3A7XA 2QF3A 4FUIA 2BD8A 3KQDA 1GCTC 3LU9B 3SU6A 4CRCA 1FAXA 3SQEE 3C1KA 1A7SA 4X6MA 3H5CB 2BD7A 3S7KB 5FAHA 1DXPA 3LGIA 1Z8IB 4SGBE 1SGFG 3F1SB 4IMQA 1MQ6A 1YC0A 3N7DA 1TNHA 2ESTE 1D9IA 5JBAS 3W1EA 2GCHG 3UPEA 2XC4A 3T26A 2ZU1A 2FLBH 1P2JA 2Y82A 2R0KA 1ZOMA 1SQRA 3SU0A 5JB8S 1FX0B 3D49H 1S6HA 1XUKA 1SOTA 2IJOB 1MD8A 1P2KA 2O8MA 3BF6H 2VIDA 3UR6A 1GI1A 1K1JA 4WF8A 1C1WH 4U30A 2WV9A 1W11U 1GBIA 1EZUC 1BBRE 4TYDA 4FU8A 1C2FA 3NXPA 1E1RD 3PO1C 2CN0H 1O3DA 1DXWA 1BMLA 1MBQA 3U8TH 1HAPH 2EI8A 2VIWA 2Z3EA 3RXVA 2HNTF 3LGVA 1AY6H 1KXCA 1UVOA 4AC9A 1ID5H 5JBBS 5JBTA 1OWKA 3D62A 4BTUB 2XCFA 4JZIA 1C5NH 2ZG0H 2XCNA 3SZEA 3VGCB 3ESTA 1GG6B 2BQ7B 3KYFA 4R8TB 1O2WA 1QJ6B 1L4ZA 2EA3A 5LPRA 1O2SA 2ZFRH 1WOFA 2P95A 1BTZA 2FOMB 2FPZA 1KLTA 3F6UH 1YPGH 1ZHMA 1G32B 3B23B 4LK4A 1UW7A 1V2JT 2P8OB 2TGPZ 3B8JA 3BG4B 4Q80A 1O3NA 2SGQE 1HFDA 1V2RT 2F9NA 4LOYH 1L0ZA 4MTBA 1GDNA 4GHQA 1EUFA 4DURA 4VGCB 2VH0A 5DKMA 4CRDA 1ZRBA 1TA6A 5AFZH 3O8CA 3M37A 3AVZA 2BX3A 1H9LB 4BXWA 2ANWA 2OXSA 3A8DA 1ZHRA 4IGDA 1AKSB 4WXVA 1QJ1B 5B6OA 3RLYH 2FOCA 1PFXC 3ZZ4A 3TLOA 3LONA 1QIXB 4FUHA 3QGJA 1K1NA 3T27A 1NRQH 1XUHA 2QN5T 1NM6A 4I8KA 1TBRH 5EQSA 3RXBA 4WVPE 4IW4E 1YM0A 3BTME 2P3TB 2PR3A 4YESB 5C5NA 1E38B 1P11E 3PRBA 1LHCH 4X1SU 3GY2A 1W7XH 1THPB 3E16B 3PMJA 4WY3A 2F43B 3ZZ8A 1O2XA 3I78A 4MPXA 1BJUA 3WWFA 2BDBA 4ISOA 5K7RA 3EDXB 4ZHLU 3HK6B 3UR9A 4X1PU 5C17A 1RFNA 1GMCF 3PLPA 2QIQA 4X8VH 1O39A 3PWBA 1THSH 2J4IA 3M5MA 1K21H 1XVOA 4FUBA 4ZXXH 2CXVA 2PUQH 1PPBH 1ZSLA 1C5VA 1KXAA 1TX6A 2I6SA 2BDIA 1FY1A 1AWFH 1IQMA 1UTJA 2DE8A 2OINA 3KHVA 3U69H 3BTHE 1O36A 3LGUA 4RKOB 2O8TA 2G5NA 1QTFA 4JZFH 1GL0E 5AFYH 2VWLA 1JRTA 2GCHF 4GVUA 2QF4A 2W5EA 1OOKB 4JCNA 1C1OA 3ZIAD 1KYNA 2M2AA 2VGCB 3S9CA 3OYPA 1QBOA 3EGKH 4FUEA 2UUFB 2CF9H 4X1QU 1HAVA 1O2PA 1SLVB 4MPWA 2GT7A 4UFGH 1GI9B 1HGTH 2PKAB 4X2XA 2FZZA 2ZGBH 3GYMA 2UUKB 4DJZB 3S0NA 3UNRA 4AX9H 1G3EA 2P8OC 2ILNA 1CHGA 3BG4C 2BDHA 4NFEA 5HYOA 4FOUC 1BTXA 1VCPA 1QNJA 1PPZA 3PV2A 1KSNA 2WPDD 1MMJN 2LPRA 4K5ZA 4ZUHA 1NY22 2WPMS 4VGCC 5GPIB 3SV9A 2ANYA 1UTQA 1NZQH 1AZ8A 2PP6A 5C1UA 2GD4B 3TJNA 4THNH 1TRMA 2C8ZB 3KCGH 5EXNA 1TONA 2WSSD 5GCHG 4UFFH 1FY4A 2FOBA 1GI0A 1O5FH 2QF5A 3M7QA 1TQ0B 2R2WU 3BV9B 5FL7D 1G30B 1BBRK 3BTEE 4Z0KA 4KTSA 3HK3B 2KAIA 1LPGB 1W2KH 4OGYA 6CHAC 3SBKA 1TAWA 4U01A 4ZXYH 1C1MA 1HV7A 5AHGH 1Z8GA 2J94A 1MZDA 2QXGA 3TNSA 1RRKA 2FEQH 3SGAE 2GZ9A 1WUNH 2HLDD 1O2OA 4Q63A 5FPYA 1MTUA 1FONA 1O34A 1BRCE 4HGCA 3OAAD 1IQIA 1TFXA 1E34B 3ZZ9A 2V6NA 4JYVH 1W12U 2F9PA 2WYJA 3GDSA 3KL6A 3LJJA 4ABBA 5GXPA 3WWBA 1YYY1 1O2ZA 1GHXH 2GX4A 3DCLA 5EG4A 5CHBA 1CT4E 3RLWH 1IQJA 4GAWA 1AHTH 2FMJA 4KGAA 1UHBA 3Q76A 4K69A 1NT1A 2KM0A 3F68H 2PLXA 3UQOA 3RXLA 1HYLA 2WPHS 2AS9A 3QN7A 2ZFTA 5C20A 2A5IA 2V35A 1YCPK 4FUDA 1ZPCA 3LH1A 1HNEE 4Q7ZA 4TWWA 4BANB 1NROH 3LC5A 1TGTA 5DSFA 2BY7X 1EQ9A 1YLDA 3WY8A 2Y5GA 3TGJE 2BY6X 1MZAA 2ZFSA 2OTVA 3NUMA 2VGCC 2XC0A 3GY5A 5JYIA 1QRXA 4MLFB 4BTIB 2QGRA 2G8TA 3SW2B 3TNTA 1J9CH 1MKXK 5HM9A 1MCTA 3L6PA 1TX7A 2OBOA 2QY0B 1DE7H 1D4PB 2O8UA 2OCVB 1AN1E 1BZXE 1UCYH 1SGPE 2DE9A 2WHXA 1BHXB 1UTMA 4A92A 1QJ7B 2C90B 2K0QA 4E7RG 3C27B 4AG1A 4MNWA 2ZU2A 3PTBA 2LELA 1OXGA 4HI3A 1WSSH 1OX1A 1AB9B 4D7GA 2PHBA 1T7CA 5T6FA 2J2UA 5JB9S 4F48B 4ABHA 3A7ZA 1HXEH 2G55A 2G4UA 3MH6A 3U8RH 2Z6BD 2GKVE 4CHAC 5EPNA 1KXFA 1YCPH 1QR3E 5FCRA 1SGDE 2Z3DA 1S6LA 4DW2U 2BDCA 1V3XA 1V2VT 1SVPA 1Z71A 3QX5H 2C8WB 1CT2E 1V2NT 1BRUP 3V12A 5E0JA 1ZSJA 4ABEA 4E7NA 1DUEA 1V2MT 4RT1A 4UFEH 2FOHA 2GCTB 3RXFA 4ZAEA 1PPFE 5ABWA 5AVDA 1PJPA 4ZKRU 5EGMA 1P2QA 2ZZUH 1A0JA 4XBCA 3M5OA 4DCDA 2FOGA 3UY9A 1QL8A 1O32A 2A7CA 1F0RA 1Z1JA 5GCHF 5JPMH 3UQVA 1VR1H 1BJVA 2ZGHA 2NU4E 4LXBH 1LMWB 3K6ZA 1IHSH 2L6OA 2A2XH 5C3NA 3T29A 5CHAB 1W13U 2BD3A 1C1NA 3GY7A 1WAYB 2BQ6B 1J16A 1GBCA 3QDZB 2V3OH 3PWCA 5J4QA 4JYUH 1Q2WA 3M3TA 2BOKA 2V0BA 2VVCA 2Y7ZA 5DP5A 2XOKD 1LCYA 1BTHH 4Q4LA 1LKAA 1YBWA 4ESTE 1TMTH 4YT7H 1P9SA 1DVAH 1BRAA 5EW1H 1O2LA 3SN8A 1WV7H 2WPJS 2CHAB 1YLCA 1OP8A 3PB1E 5FCKA 1Z1IA 4Q7YA 4LZ1H 1V2KT 2FOEA 3UB0A 2QA9E 3SGQE 3TITA 1RIWB 1A3BH 2Y7XA 1ZLRA 2QXJA 1S81A 3ZYEA 1MABB 1OYQA 4IBLH 4Y8ZA 3PV5A 1NFYA 2HGTH 1P3EA 4MNXA 1ZYOA 1J15A 1D6WA 1IQHA 4XFQA 2RA0A 4Y76A 1HCGA 3LGWA 1C2JA 3SI4H 2VNTA 1TWXB 3L3TA 1NPMA 1GCTB 2SGAA 3A89A 3RXQA 4ACBA 4A6LA 3A8AA 1NESE 2B5TB 3SOSA 5HIZA 1YP9A 4QT8C 1HXFH 2UUYA 1O30A 2ZTZA 4X8TH 1DSUA 3ATWA 3I29A 2C8XB 2P3FH 3ZZ5A 4X8UH 3M61U 4DGJA 4X6NA 1DY9A 3PTNA 2ZO3H 5L30H 1SGCA 2O8WA 1Z7KA 3QTVH 2H9EH 3ZZ6A 2WINI 1P06A 2FX4A 1JRSA 4I86A 4OS7A 1ZPZA 4K3JA 2F9OA 2GCTC 2J5UA 1S82A 4IN1A 2ZDVH 2YNAA 4Z6AH 2XBYA 2HVXA 2P93A 1YCPM 3PO1B 1ZJKA 3E90B 5TCAA 1AE5A 1C5PA 4ABAA 1J14A 2ASUB 4NIVA 1DY8A 3MHWU 5JBCS 1Z6EA 2ZU5A 2Y81A 1HAXB 2BY9X 4OS4A 1GCDA 1FMGA 4BAOB 1YKTA 3NK8A 1C5UA 3SV7A 4BAKB 1GI7B 2F4LA 1Y3XA 1EJNA 4ASUD 1ZRKA 5CHAC 1GJ4H 2RG3A 3DA9B 3MOCA 3ODDA 1SI5H 1TIOA 3V13A 1X7AC 3SNAA 4ZKOU 2KCPA 1YF4A 3TGKE 3PRDA 2IN2A 4A1VA 4Y7AA 3MQKC 1VITG 3MH4A 3GOVB 2F91A 4NIXA 3SORA 5TCCA 3URDA 3VB6A 2BQWB 5CMXH 5IDKA 2TRMA 1LVBA 2BHGA 4BTTB 1O38A 3V7TA 2CHAC 1C5LH 1YPJH 1W0JD 2RDEA 2FP7B 2J92A 1GGDB 1RIWC 1CQQA 3SNBA 5C94A 2PSXA 4I32A 1XXDA 2D1JA 4O3UA 1O2UA 3LJOA 2C3SA 2FOAA 1YPMH 4LZ4B 2QV1A 1KXBA 1YWUA 3BIUH 2ZDAH 3RXAA 1EP5A 2G81E 1NTPA 1C1RA 4ISHH 5A0BA 3BEFB 4HG6A 4NCYA 2A4QA 3CENA 1ZHPA 3RC4A 1IAUA 5CE1A 4ABDA 3KF2A 2JJ2D 1C5WB 1EAIA 1AVGH 1UTNA 2J98A 2PV9B 1ZTLA 5LGOA 4ZHMU 3QZQA 4YOIA 1RTFB 4X0WU 2K8IA 1LVOA 3ATLA 1O37A 1QB1A 4B6FA 2GDEH 4B2CA 3RUOA 1FDPA 1O2TA 3ZYDA 5FX6A 3U28C 1M9UA 2BXTH 1O5DH 4R0IA 3Q77A 4Y0YE 4YZUA 2A31A 3AAUA 1HDTH 1EAXA 1ARCA 3SQHE 1OS8A 1VJ9U 4Y6DA 4ZHAA 3F9GA 5A09A 2ZI2H 3P70B 1THRH 1AE8H 1BITA 1E79D 5A2MH 3T25A 3E3TA 2HNTC 1ELAA 1QZ8A 1CGHA 2PKAA 1QQUA 3KEEA 3ZZBA 1DWCH 1EAWA 1C2DA 3ELAH 2IPQX 1JOUB 4WJG2 4B75A 3ZVGA 2ZDKA 4AORA 3H7OA 4WMFA 1GHWH 1EXFA 1ABJH 3KNXA 4J1YA 2FTLE 3SNEA 5TJXA 2GZ7A 1ZZZA 2ZKSA 1LTOA 3MFJA 3T2NA 1HJ8A 3GICB 3RXGA 1OSSA 1A1RA 1LPKB 5F8XA 5AF9H 4K60A 4ABJA 5EW2H 5C2ZA 1FJSA 3BTTE 1GJ8B 2Y6TA 3P8GA 1GHAF 2ALPA 1U6QA 2BDYA 1WQSA 2SGFE 1C1PA 1ELBA 2FIRH 2BD9A 1MAXA 1BB0B 1P2MA 3E1XB 1Y3VA 5EIYA 2R3UA 2ODYB 1ZPBA 1HAIH 1PPCE 1TBZH 3GYLB 1XUJA 5L2ZH 3GS9A 2V7QD 3W95A 1W14U 5DP9A 1GGDC 3ATMA 1VCWA 2SGEE 1K1MA 1ELFA 1OWIA 1NRRH 1Y5BT 4I8HA 4AOQA 3SUGA 4XD7D 4DIIH 2ANKH 3G01A 2A7JA 1CE5A 1F0SA 1TOCB 1GJBB 1GVZA 3SJIA 2WV5A 3M36A 2OC1A 4JMYA 1HAGE 3A82A 3DFJA 1G3CA 4BAQB 1B7XB 2GVFA 1SQAA 4OS6A 3QTOH 1EPTA 6CHAB 2GMTC 1H8ED 3MNSA 1O5CB 3OEED 3BTWE 1GBBA 1IQFA 4O9VA 4I8JA 1Y8TA 1C4V2 1WBGB 1DANH 3PMHB 1VITF 3SHCH 2GP9B 1YPEH 4UFDH 1HUTH 5ETXA 1WXRA 2AGGX 1XM1A 2XBVA 4DT4A 1DPOA 4K8BA 1HB0B 3OTPA 1SGEE 1AVWA 4AN7A 1TGCA 1FPCH 3CP7A 1Y59T 2BD4A 3TJUA 1QFKH 3UIRA 4YOGA 1AGJA 2CV3A 4FU9A 3VB4A 3NZIA 4K2YA 1O3IA 3LIWA 2Y80A 4UD9H 2OUAA 3RXEA 2TPIZ 1KMHB 4IS5A 2JH5D 3WW7A 1IOEA 1PPGE 2FTMA 4IMZA 2I6QA 1ELCA 2BXUH 1FQ3A 4Y0ZE 2XW9A 1HJAB 1RJXB 4M9FA 4CRGA 3ODFA 1LHEH 1TMUH 4BXSA 1SFIA 3N7OA 1C5MD 2ZQ2A 1GMDF 2FI4E 2HRVA 1QGFA 2Z7FE 1LQDB 3GCOA 1KTSB 1O2IA 1TNIA 1NFXA 3GDUA 4MVNA 1CHOF 2ZHDA 2W6JD 4IC5A 1GVKB 3KGPA 5DP8A 2PGBB 3TVJB 1G36A 3L33A 4KELA 1GMHF 1LVYA 3PMAB 1P3CA 2AERH 3UOPA 3VG8A 2GTBA 3OU0A 4DY7B 1W3CA 1C5SA 2F9VA 4TT3D 4GUXA 1UVUH 2K1QA 2KCYA 1E35B 4AB9A 2SGPE 2R3YA 1QBVH 2ZDMA 4NWLA 2FOFA 3F2GA 1PYTD 4Y11E 1EAUA 4CH8B 1ACBE 4BAMB 1FIZA 4FETA 3EE0B 1B5GH 1O2HA 1UTOA 1UK4A 2AHME 1OPHB 2BZAA 3M7UA 3GCHB 2C4FH 4TY7A 3UNSA 1Y5UT 1DX5M 1VITH 3H7TA 4CHAB 1HAOH 2FDAA 3NPSA 1WDIA 3AW0A 1NRPH 1B0FA 2H9HA 4X6PA 1O2RA 1PQAA 2OK5A 1AU8A 5C1XA 2A2QH 2J38A 1C1UH 4B76A 3BTQE 1EJMA 2DUCA 3RXHA 3IITA 1S5SA 3ZZDA 4GCHF 1OP2A 4H42U 3TK6A 2QC2A 1DDJA 1UTPA 2SGDE 3RXCA 1KTTB 1O31A 1S84A 1FIWA 1JWTA 3HKJB 2L74A 3FP6E 1QB9A 4AG2A 1O2KA 1YY3A 3NCLA 3RXOA 1G9IE 3HATH 2NU2E 1O5GH 1C5TA 2Q1JA 1MD7A 3BSQA 4RSPA 5FBEA 8ESTE 1K1LA 3Q00A 5HGGA 3PYHA 5DP4A 3ZV9A 1QHRB 2J97A 1SGIB 1GI3A 3M5NA 2WUCA 1TRNA 4WXIA 2ZFQH 4Y10E 2YNBA 1L1JA 5EQQA 4ZROA 5FX5A 1QL7A 1XMNB 2G5VA 3SHAH 4DIHH 2Q6DA 4X8SH 1HJAC 5E2PA 3S69A 2BOHB 3P8FA 1SSXA 2BLOA 1GWAA 2AIPA 3W94A 1T4VH 1KY9A 3K2UA 3BTGE 1BBRH 3OEHD 2WV4A 2CGAA 3FANA 1AD8H 2W3KA 1GHVH 1XVMA 2VWOA 2A5KA 1OWJA 3N99A 5A0CA 2O9QA 3DSPA 3NRLA 3BN9A 2ZGJA 2P16A 3M3SA 5K0HA 1AUJA 1SGYE 2THFB 3MI4A 4H4FA 4INKA 3URCA 4XDEA 1HIAA 1AVXA 1N8OC 3FP8E 1UVTH 4NA7A 1ZGIA 3ZVFA 2YMSD 2ZTXA 2TBSA 4CREA 3SU1A 3GY3A 4GHTA 2EI7A 3R0FA 4ZH8A 1O3KA 1KDQA 1TLDA 1EOJA 1MUEB 1GBAA 2H6MA 2CJIA 1H9HE 2ZU4A 2W7UA 1F92A 1BOQA 3DD2H 5EODA 2OC8A 1HRTH 3TJOA 1TPPA 4YO9A 3GCHC 4ABIA 5DPAA 2PTCE 1CGIE 1PQ5A 3UTUH 1DICA 1RTKA 1T8LA 1D3PB 5IYTA 4KKDA 4YTAA 2IOTA 3OX7U 4GSOA 3ZZCA 3OTJE 2A7HA 3RDZA 3A83A 1ESBA 3O8BA 6ESTA 1F0TA 3TIUA 2BLVA 1HAVB 1SOZA 1S85A 1LO6A 2CF8H 4M7GA 5PTPA 2F3CE 1FUJA 3ZV8A 1EZSC 3RXPA 3VXEH 4ZMAH 1GJ6A 3STIA 4ACAA 1CBWC 3LT3A 2AIQA 1MKXH 4FUGA 4YT6H 1CT0E 3JZ2B 3LH3A 3F0OA 2XC5A 4DG4A 4UEHH 1GPZA 3F9FA 1GBTA 3DFLA 1AQ7A 4B2BA 4D9QA 3UFAA 2QCYA 1C9TA 1W0ZU 3T62A 3U9AH 3MU8A 1TOMH 3SV6A 1MKWK 3QO6A 1LDTT 1C1QA 2F9UA 1VCQA 2G00A 1Z8JB 4MG3A 3TH4H 3VB5A 1JIMA 2KAIB 1EPTC 1SLWB 5GDSH 1MTWA 2AMPA 1V2UT 4AGJA 1C2LA 2Z9GA 1VZQH 1S0QA 3FN8A 1EFRD 1ARBA 2XRCA 2HPQH 2BMGB 1V2OT 1O3JA 2ZDNA 2EY4C 4D7FA 4NSYA 1EJAA 4RI0A 1E1QD 4AYYB 4WMEA 2OLGA 1UTLM 1Q31A 1HPGA 2FO9A 1O33A 1MU8B 4B73A 3RU4D 1UK2A 2BD2A 2W3IA 3F2HA 3MNXA 1HAHH 2VIOA 4CBOA 3SJKA 2PKSB 3RXMA 4DOQA 5KGOA 3FVFB 4XOJA 2RA3A 2ZIQH 4Q2KA 2VBCA 1TABE 4BNRA 1ZMNA 2Y5FA 3HGNA 3RXSA 1BTPA 3ZVAA 1UHBB 1ELEE 2ZFFH 1CGJE 4FUJA 4MPUA 3R3GB 3EA7A 1O2QA 3A8BA 3E0NB 2Q6GA 1XKBC 4I33A 1ZTKA 4XSKU 1GJ9B 1MKWH 3CS0A 4K1EA 4AB8A 3ZVEA 2VINA 4X2YA 1DM4B 2BTCE 1NRSH 4TWYA 3GY8A 1ETSH 3ATKA 5F03A 3EE7A 5ESBA 4XBBA 4YLQH 2Z9LA 2JJ1D 3LGTA 5EXLA 2H9TH 1BHXF 1SBWA 1EZQA 2A4GA 2ZHEH 1TGBA 2ZHWH 2BLWA 4NSVA 4P00A 1VGCB 4FVDA 1H1BA 2BY8X 5C0UA 3S9BA 1FZZA 2PW8H 1GHAG 5HMAA 4A1TA 2ZPQA 4ZCNA 1Z6JH 1Q3XA 2A45B 2KX4A 2PFEA 2VJ1A 2FYRA 1IQKA 4ZKNU 2HNTE 4CRBA 1MCVA 1DWDH 1GJ5H 3RXJA 2QAAA 3TJVA 1O3PB 2QYIA 4O97A 1TB6H 2HOBA 4FU7A 5EJ1A 1OWDA 2BVSH 4FVBA 1ZJDA 3OY6U 1DLKB 1P0SH 3GCNA 1XUFA 3NWUA 5C1YA 3GCTG 3FKSD 2RFKC 2FXRA 1C2MA 1RXPA 2VU8E 2ZU3A 4NZLA 3KQBA 1B0EA 1FAKH 2KFWA 3AK5A 2AYWA 4F4OC 2IJD1 2SNWA 3FZZA 3EQ0H 1BA8B 1KXEA 3P8NA 4INHA 1T8NA 2QXIA 4KTCA 1T32A 1V2PT 3SUDA 1QURH 3A7VA 5C0TA 2QXHA 1TMBH 1SQOA 1AKSA 5ESTE 2FWWA 1H8IH 3BTDE 4NA9H 2JH6D 1EATA 4I31A 2XWBI 2GDDA 1LQEA 1N1LA 5DJ7A 1LVMA 3A7YA 4WH6A 3DHKH 3U1IB 2PGQB 1JXPA 3P92A 1C4Y2 2PKSC 1JBUH 3RXUA 1GHBG 5EOKA 1G3BA 1QBNA 3ENSB 5DK1A 1GBMA 1TGSZ 2PWXA 5EU8A 3MH7A 2B8OH 5T6DA 1ANDA 1EX3A 1W10U 3SUFA 1MTSA 1QRZA 1PPHE 1K9OE 1BTYA 2EI6A 2BY5X 3MMGA 4MPVA 3F0PA 1O3HA 2OD3B 4XBDA 1RD3B 2GMTB 3SZNA 1TPOA 2ODPA 3GY4A 5EJLA 1PYTC 3MO3A 1TX8A 3N7EA 1PQ8A 4E06H 3RXTA 7ESTE 2BDAA 2FI3E 3A88A 3P17H 4AZ2B 1BTWA 2ZCLP 5H4IB 1GMDG 1TQ7B 2ZECA 1FI8A 3KQEA 3U98H 1BT7A 1CHOG 1D3QB 3HKIB 2NU0E 2WPLS 1VGCC 1A3EH 1HLTH 2HWLB 3F3BA 1MQ5A 2NWNA 4K8YA 2PSYA 1PQ7A 8GCHG 4ISIH 2GGVB 1J8AA 4BOHA 5KEDA 5E0HA 3S7HB 1GMHG 3E8LA 1H4WA 5L2YH 3HPTB 1SGRE 1L1NA 5EQRA 5DO4H 3ZVBA 1Y3WA 1ETRH 2XBXA 2D2DA 3ZZ7A 2JETB 4Q7XA 4X1NU 3O8DA 2BD5A 1OWEA 5LPEA 1TNJA 1O3GA 1VKYA 1TNKA 1F7ZA 1DFPA 1FPHH 1P2OA 1GI4A 3DSOA 3MNBA 1ELDE 1C1TA 1TA2A 1YPLH 5EXMA 3A81A 1P8VC 4Z1MD 1P2IA 2ZGXH 1HAYB 1V2ST 1UO6A 3MYWA 5E2OA 1K28D 2ZCKP 3BG8A 5J4SA 4KTUA 5F6MA 2D8WA 1C2GA 3A85A 3A86A 2BM2A 2H2ZA 2QE7D 3Q3YA 1CSOE 3SUEA 1IQLA 1COWD 1BMMH 1LPZB 3IWMA 1T4UH 2ZDLA 1GBKA 1GL1A 2BDGA 3TK9A 2SFAA 3A7WA 4GCHG 9LPRA 1V2LT 1UCYE 4NWKA 3FP7E 4H6TA 5E8EH 3ZVDA 1TGNA 2C8YB 3RU4E 2Y5HA 3EA8A 1G3DA 1UMAH 3UREA 3PLKA 1BIOA 1EB1H 3SV2H 3BTKE 4Y7BA 5IK2D 5A8XA 2FS9A 4H6SB 2YOLA 2STBE 5DN6D 2GJGA 4I8GA 1QL9A 2VIVA 2Z9KA 1Y3UA 3B9FH 1GVLA 1EB2A 4GLYA 3GCTF 1G37A 1GI5A 5L6NH 3AAVA 2F83A 2YMSC 3F2FA 2A1DB 2ZHQH 3MH5A 5F53A 1HBTH 1O2NA 1AIXH 2P59A 3SI3H 2VWNA 2VVUA 3UWIA 4ISLA 1XKAC 3SJ9A 2ANMH 1VJAU 4HFPB 3RC5A 4AFQA 1C1VH 3SO3A 2UWPA 2H5DA 2EEKA 3FAOA 2AGIX 3KIDU 2FESH 2TGDA 3MTYA 1F5KU 3RMMH 3BEIB 2H5CA 3FFGA 1C1SA 4I8LA 2CK3D
chains in the Genus database with same CATH topology
3U1JB 2ZNKH 1DUAA 1O3MA 1GHBF 2CMYA 3GY6A 3LC3A 2OC7A 5FBIA 1O3FA 1ZMJA 4JK5A 1KLIH 2XBWA 2XTTB 2OBQA 2Z94A 4AFZA 1O5AB 5A8ZA 1LKBA 1OP0A 4X2WA 2JETC 1GJCB 4NA8A 2XNIA 4AGKA 3RXKA 1GJ7B 2ZPRA 1Y5AT 4AFUA 1C5YB 1UTKA 3BIVH 1XX9A 1WYKA 1LHFH 2VB0A 2ZHFH 4NG9H 1O35A 1C2KA 4JZ1A 1GDUA 3HGPA 3QWCH 4HTCH 8LPRA 1EZXC 5T3HA 2ZEBA 5BPEA 3LPRA 4IN2A 2GV7A 1DITH 1GI6A 1MH0A 4U32A 4WH8A 4TY6A 1DLEA 2R2MB 4I7YH 8GCHF 2ULLA 3VPKA 5BRRE 1MBMA 2ZF0H 3I77A 1SG8B 2Z9JA 5DP3A 4OS5A 1N8OB 1IQEA 1C4U2 4OS1A 1INCA 2SNVA 4U2WA 4WWYA 1YPHE 2P3UB 3ITIA 4J2YB 2IPHA 1P02A 2A4RA 3MWIU 4RKJB 3VGCC 1GG6C 3RXIA 2PUXB 3GDVA 1O2MA 2C93B 3E0PB 2TIOA 1C2EA 1C5XB 1SMFE 1UJ1A 2ZP0H 2NU1E 1YGCH 3PLBA 2V3HH 1FV9A 1NU7B 5I25A 4YOJA 3SJ8A 1IHTH 1SLXB 4ABFA 2ZPSA 1D3DB 1O3OA 1EASA 2FI5E 2W26A 1TPAE 1HAZB 3D65E 4HZHA 1G2MA 1GBLA 2BZ6H 4CR9A 2GZ8A 2FM2A 2J9NA 2ALVA 2AFQB 3SV8A 3V0XA 5GWZA 1TE0A 5LH8A 2GT8A 3F9HA 2P94A 1YPKH 1ZMLA 1K22H 1NO9H 5LPFA 1D3TB 1P57B 3LGYA 2UWLA 1C5RA 3OY5U 1CBWB 1CVWH 2OC0A 1GDQA 1TBQH 2OQUA 1O3LA 2Q6FA 2ZTYA 2GV6A 4FUCA 1T31A 6GCHG 3SNDA 1P12E 5FXLA 4CRFA 1NN6A 4DVAU 4WMDA 3K65B 1A0LA 3MNCA 2VIQA 1AMHA 1Y3YA 3RP2A 4A7IB 3RMNH 3TPIZ 1S83A 1A5HA 4SGAE 1WTGH 3JZ1B 2PTNA 4ZKSU 4MDSA 4NFFA 2ZWLH 1UCYK 1MTNB 3TU7H 1SGNE 3A80A 4B71A 1SFQB 1DT2A 4PROA 1EPTB 1ESAA 1K1IA 3SNCA 2Z9IA 4Y71A 4JZEH 2ZFPH 5A0AE 2VVVA 1WQVH 2A5AA 3AW1A 4JZDH 1AFQB 3RXRA 1GI8B 4MQAA 1GI2A 1T8MA 1E36B 3O8RA 4MNYA 4D9RA 1G2LA 4YM9A 4UE7H 3SJOA 1SL3A 3ATIA 1C5OH 1ORFA 3FZDA 1AO5A 4IC6A 1A61H 3VB7A 2HALA 1NFWA 5E0GA 2H1UA 2RDLA 1SGQE 4NZQA 4AFSA 3VXFH 1BRBE 2G51A 4CH2B 2AH4X 2JKHA 1GBJA 4UONA 1ANCA 1OKXA 3P6ZB 2A4OA 1FLEE 1FNIA 3M35A 4F49A 1AFEH 5HXFA 3TK5A 4B74A 4Y8XA 5JDUB 5FPSA 1ELVA 2AEIH 1PPEE 1YPHC 3UWJH 2FS8A 2BVXH 1DWEH 6LPRA 1BUIA 3IG6B 3E91A 4E05H 1CA8B 3EYDA 2QF0A 3D23A 1JIRA 1TPSA 4KP0A 5A8YA 1EP6A 2OQ5A 3NKKA 1XUIA 2FODA 2ZCHP 1TALA 1E0FD 3QZRA 1WTHD 3A8CA 4XE4A 1ELTA 4TPIZ 3RXDA 1A5GH 2VH6A 2HPPH 3PV4A 4ABGA 5F8TA 2WUBA 2WYGA 1FN8A 4NGAH 1UVPA 2XXLA 4CR5A 3TGIE 4JYTA 7GCHG 1NU9A 1BMAA 1ZSKA 3TH3H 4DT7B 3GISB 1L4DA 3LOXA 1W0YH 2D26C 4NIYA 3PROA 1P10A 1MTVA 1ZGVA 2FX6A 1AUTC 1P05A 2VWMA 1P01A 2ZQ1A 1GHYH 2BB4A 1XXFA 3STJA 1EOLA 3MU4A 4OGXA 3Q3XA 1O2JA 2WPIS 1TYNA 1LHDH 1C5QA 1GBFA 1QB6A 7LPRA 1GHZA 2B9LA 1LHGH 3Q3KA 1A46H 1DOJA 5DG6A 3LKWA 1JMOH 4A1XA 1NS3A 4K1SA 1TNLA 1MU6B 4UDWH 1MTNC 2B7DH 4TPYA 3V3MA 1P04A 2STAE 2WPKS 1AI8H 1FY5A 5I46H 1MAYA 3QGNB 4O03A 2UUJB 1AFQC 1P2NA 1GBDA 1A0HB 3M7TA 1AZZA 1BCUH 1S0RA 2FLRH 2BLQA 3E6PH 2Z3CA 1UVSH 1CU1A 4A5TS 2AMQA 1ESTA 1UK3A 2BYAX 3A84A 2AGEX 1GJAB 3VFEA 2O8LA 1AWHB 1ANBA 6GCHF 5G4BA 3SU3A 1F5RA 3M3VA 2BVRH 2NU3E 3UUZA 3ZVCA 3QK1A 1SPJA 3UNQA 3CS7A 1ABIH 1A5IA 3A87A 2UWOA 1CA0B 1FY3A 5DP6A 4JK6A 4CRAA 2J95A 5GIBA 1A4WH 4B1TA 1FXYA 1K1PA 2RCEA 1L2EA 1BTUA 1KLJH 1HJ9A 1P09A 4AYVB 2TGTA 3MU0A 4RN6A 3RMOH 4FXGH 2AMDA 3T5FH 1QY6A 3DT0H 1H8DH 4B2AA 1FY8E 3SU5A 1EKBB 1FN6A 5GJ4B 1E37B 7KMEH 1NRNH 4OS2A 1C9PA 3BTFE 1NFUA 1T8OA 3ZZ3A 1O5BB 2B0FA 3KN2A 8KME2 1O2GH 4Y8YA 3UOUA 1N6YA 1AB9C 3S9AA 1SGFA 1O2VA 1D6RA 3EAJA 1O2YA 2R0LA 4X2VA 3BEUA 1DWBH 2ZC9H 1Z8RA 1HIAB 2ODQA 5DGJA 1O3BA 1P9UA 1V2TT 4MNVA 1N6XA 2G4TA 1XUGA 1SHHB 5HM2A 1O3CA 1WU1A 1CO7E 2LNCA 2R9PA 1O5EH 4GPGA 4Y79A 1KDQB 3RMLH 3T28A 2ZA5A 4X6OA 1O3AA 1SC8U 4D76A 3TH2H 1SQTA 2M5TA 2FYQA 3SU4A 2G52A 3P95A 1W7GH 5T6GA 2BX4A 1DSTA 3MU5A 3MO9A 2A0QB 1SR5C 1V2QT 1L1GA 2EC9H 1RTLA 3P8OA 2HLCA 1P03A 1V2WT 2J34A 7GCHF 5DP7A 1GJDB 3MO6A 1OYTH 3QUMP 3KQCA 4ISNA 4CBNA 2TGAA 4FUFA 1K2I1 1ETTH 1ELGA 3K6YA 1C5ZB 2VIPA 1DS2E 1SB1H 1QA7A 3PM3A 5C5OA 1SGTA 5EPYA 1BQYA 1QQ4A 3RU4T 1K1OA 4ASHA 3SU2A 4INLA 3EA9A 1GBEA 4X1RU 2W7SA 1TNGA 1V6DA 1F2SE 2XWAA 1RS0A 4D8NA 3RC6A 4BAHB 4NIWA 3U8OH 1W8BH 1ANEA 5FPTA 1IQGA 3DUXH 1SLUB 1C2HA 1CA0C 3VEQB 3OSYA 1IQNA 1QRWA 1F5LA 1A2CH 1GBHA 1KXDA 1TRYA 1WCZA 9ESTA 5FHTA 2XYAA 1H9IE 5C67A 1F0UA 4O3TA 1J17T 2JH0D 3SGBE 3PMBB 3VB3A 2OP9A 1O3EA 5SGAE 1ZTJA 1RGQA 5F8ZA 2A32A 1ZR0A 3AASA 1KIGH 2F9BH 2ZGCA 3M5LA 3F9EA 3RM2H 1GMCG 3A7TA 1NC6A 1QCPA 1S6FA 1BMNH 1C2IA 1OWHA 3ZZAA 4YLUA 1QA0A 3K9XB 3QLPH 1BDAA 1SHYA 3RM0H 1O0DH 3LDXH 3MU1A 4K1TA 3A7XA 2QF3A 4FUIA 2BD8A 3KQDA 1GCTC 3LU9B 3SU6A 4CRCA 1FAXA 3SQEE 3C1KA 1A7SA 4X6MA 3H5CB 2BD7A 3S7KB 5FAHA 1DXPA 3LGIA 1Z8IB 4SGBE 1SGFG 3F1SB 4IMQA 1MQ6A 1YC0A 1TNHA 2ESTE 1D9IA 5JBAS 2GCHG 3UPEA 2XC4A 3T26A 2ZU1A 2FLBH 1P2JA 2Y82A 2R0KA 1ZOMA 3SU0A 5JB8S 3D49H 1S6HA 1XUKA 1SOTA 2IJOB 1MD8A 1P2KA 2O8MA 3BF6H 2VIDA 3UR6A 1GI1A 1K1JA 4WF8A 1C1WH 4U30A 1W11U 1GBIA 1EZUC 1BBRE 4TYDA 4FU8A 1C2FA 3NXPA 3PO1C 2CN0H 1O3DA 1DXWA 1BMLA 1MBQA 3U8TH 1HAPH 2EI8A 2VIWA 2Z3EA 3RXVA 2HNTF 3LGVA 1AY6H 1KXCA 1UVOA 1ID5H 5JBBS 5JBTA 1OWKA 3D62A 4BTUB 2XCFA 4JZIA 1C5NH 2ZG0H 2XCNA 3VGCB 3ESTA 1GG6B 2BQ7B 5LPRA 4R8TB 1O2WA 1QJ6B 1L4ZA 2EA3A 1O2SA 2ZFRH 1WOFA 2P95A 1BTZA 2FOMB 2FPZA 1KLTA 3F6UH 1YPGH 1ZHMA 1G32B 3B23B 4LK4A 1V2JT 2P8OB 2TGPZ 3B8JA 3BG4B 4Q80A 1O3NA 2SGQE 1HFDA 1V2RT 2F9NA 4LOYH 1L0ZA 4MTBA 1GDNA 4GHQA 1EUFA 4DURA 4VGCB 2VH0A 5DKMA 4CRDA 1ZRBA 1TA6A 5AFZH 3O8CA 3M37A 3AVZA 2BX3A 1H9LB 4BXWA 2ANWA 2OXSA 3A8DA 1ZHRA 4IGDA 1AKSB 4WXVA 1QJ1B 5B6OA 3RLYH 2FOCA 1PFXC 3ZZ4A 3TLOA 3LONA 1QIXB 4FUHA 3QGJA 1K1NA 3T27A 1NRQH 1XUHA 2QN5T 1NM6A 4I8KA 1TBRH 5EQSA 3RXBA 4WVPE 4IW4E 1YM0A 3BTME 2P3TB 2PR3A 4YESB 5C5NA 1E38B 1P11E 1LHCH 4X1SU 3GY2A 1W7XH 1THPB 3E16B 3PMJA 4WY3A 3ZZ8A 1O2XA 3I78A 4MPXA 1BJUA 2BDBA 4ISOA 5K7RA 3EDXB 4ZHLU 3HK6B 3UR9A 4X1PU 1RFNA 1GMCF 3PLPA 2QIQA 4X8VH 1O39A 3PWBA 1THSH 2J4IA 3M5MA 1K21H 1XVOA 4FUBA 4ZXXH 2CXVA 2PUQH 1PPBH 1ZSLA 1C5VA 1KXAA 1TX6A 2I6SA 2BDIA 1FY1A 1AWFH 1IQMA 1UTJA 2DE8A 2OINA 3KHVA 3U69H 3BTHE 1O36A 3LGUA 4RKOB 2O8TA 2G5NA 1QTFA 4JZFH 1GL0E 5AFYH 2VWLA 1JRTA 2GCHF 4GVUA 4JCNA 2W5EA 1OOKB 1C1OA 1KYNA 2VGCB 3S9CA 3OYPA 1QBOA 3EGKH 4FUEA 2UUFB 2CF9H 4X1QU 1HAVA 1O2PA 1SLVB 4MPWA 2GT7A 4UFGH 1GI9B 1HGTH 2PKAB 4X2XA 2FZZA 2ZGBH 3GYMA 2UUKB 4DJZB 3S0NA 3UNRA 4AX9H 1G3EA 2P8OC 2ILNA 1CHGA 3BG4C 2BDHA 4NFEA 5HYOA 1BTXA 1VCPA 1QNJA 1PPZA 1KSNA 1MMJN 2LPRA 4K5ZA 4ZUHA 1NY22 2WPMS 4VGCC 5GPIB 3SV9A 2ANYA 1UTQA 1NZQH 1AZ8A 5C1UA 2GD4B 3TJNA 4THNH 1TRMA 2C8ZB 3KCGH 5EXNA 1TONA 5GCHG 4UFFH 1FY4A 2FOBA 1GI0A 1O5FH 3M7QA 1TQ0B 2R2WU 3BV9B 1G30B 1BBRK 3BTEE 4Z0KA 4KTSA 3HK3B 2KAIA 1LPGB 1W2KH 4OGYA 6CHAC 3SBKA 1TAWA 4U01A 4ZXYH 1C1MA 1HV7A 5AHGH 1Z8GA 2J94A 1MZDA 2QXGA 3TNSA 1RRKA 2FEQH 3SGAE 2GZ9A 1WUNH 1O2OA 5FPYA 1MTUA 1FONA 1O34A 1BRCE 4HGCA 1IQIA 1TFXA 1E34B 3ZZ9A 2V6NA 4JYVH 1W12U 2F9PA 2WYJA 3GDSA 3KL6A 3LJJA 4ABBA 5GXPA 1YYY1 1O2ZA 1GHXH 2GX4A 5EG4A 1CT4E 3RLWH 1IQJA 4GAWA 1AHTH 2FMJA 4KGAA 1UHBA 3Q76A 4K69A 1NT1A 3F68H 2PLXA 3UQOA 3RXLA 1HYLA 2WPHS 2AS9A 3QN7A 2ZFTA 5C20A 2A5IA 2V35A 1YCPK 4FUDA 1ZPCA 3LH1A 1HNEE 4Q7ZA 4TWWA 4BANB 1NROH 3LC5A 1TGTA 2BY7X 1EQ9A 1YLDA 3WY8A 2Y5GA 3TGJE 2BY6X 1MZAA 2ZFSA 2OTVA 3NUMA 2VGCC 2XC0A 3GY5A 5JYIA 1QRXA 4MLFB 4BTIB 2QGRA 2G8TA 3SW2B 3TNTA 1J9CH 1MKXK 5HM9A 1MCTA 3L6PA 1TX7A 2OBOA 2QY0B 1DE7H 1D4PB 2O8UA 2OCVB 1AN1E 1BZXE 1UCYH 1SGPE 2DE9A 1BHXB 1UTMA 4A92A 1QJ7B 2C90B 4E7RG 3C27B 4AG1A 4MNWA 2ZU2A 3PTBA 1OXGA 4HI3A 1WSSH 1OX1A 1AB9B 4D7GA 2PHBA 1T7CA 5T6FA 2J2UA 5JB9S 4ABHA 3A7ZA 1HXEH 2G55A 2G4UA 3MH6A 3U8RH 2Z6BD 2GKVE 4CHAC 5EPNA 1KXFA 1YCPH 1QR3E 5FCRA 1SGDE 2Z3DA 4DW2U 2BDCA 1V3XA 1V2VT 1SVPA 1Z71A 3QX5H 2C8WB 1CT2E 1V2NT 1BRUP 3V12A 5E0JA 1ZSJA 4ABEA 4E7NA 1DUEA 1V2MT 4UFEH 2FOHA 2GCTB 3RXFA 4ZAEA 1PPFE 5ABWA 5AVDA 1PJPA 4ZKRU 5EGMA 1P2QA 2ZZUH 1A0JA 4XBCA 3M5OA 4DCDA 2FOGA 3UY9A 1QL8A 1O32A 2A7CA 1F0RA 1Z1JA 5GCHF 5JPMH 3UQVA 1VR1H 1BJVA 2ZGHA 2NU4E 4LXBH 1LMWB 3K6ZA 1IHSH 2A2XH 5C3NA 3T29A 5CHAB 1W13U 2BD3A 1C1NA 3GY7A 1WAYB 2BQ6B 1J16A 1GBCA 3QDZB 2V3OH 3PWCA 5J4QA 4JYUH 1Q2WA 3M3TA 2BOKA 2V0BA 2VVCA 2Y7ZA 5DP5A 1LCYA 1BTHH 1LKAA 1YBWA 4ESTE 1TMTH 4YT7H 1P9SA 1DVAH 1BRAA 5EW1H 1O2LA 3SN8A 1WV7H