5GXQC

The crystal structure of the nucleosome containing h3.6
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
108
structure length
108
Chain Sequence
b'RAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.6
publication title Crystal Structure and Characterization of Novel Human Histone H3 Variants, H3.6, H3.7, and H3.8
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 34
structure length 108
sequence length 108
chains with identical sequence G
ec nomenclature
pdb deposition date 2016-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5gxqC00
4H9OA 5BNVA 3UTBD 4KUDB 1BH9A 5B0ZC 5AV5C 3LELA 4J8UC 3WAAA 5JRGA 3MNND 4ZBJC 3REHB 1P3LB 3LZ1A 3AZED 4AWLB 1KX3A 3X1SD 3VH5A 3AV1B 4KGCB 4QLCC 5DNMB 3KWQB 4H9NB 4G92C 4H9SA 4H9QB 4J8VB 5AVBB 4R8PA 5B24D 5AVCB 1F66B 5B0ZA 3MGQA 3MGSC 5B1MC 3AZIB 5CPIC 4WU9A 5GT0D 3MGRB 3AV2B 4X23B 1BFMA 1S32A 5FUGA 4XUJC 1AOID 1P3KC 2FJ7D 3UTBC 3NQJA 3AZHB 5GSUD 3REIC 5AV9D 4KUDA 3MNNC 3AN2A 3WA9B 4NE3A 3WKJA 2NQBB 3WTPB 3AZEC 3X1SC 3W97B 4YS3B 3W96B 3AV1A 5B1MA 1P3BB 3UT9B 5DNMA 2HIOD 2YFVB 4Z5TD 2HUEC 4H9PA 3REKD 4H9QA 1P3KA 3LJAB 5B24C 1B6WA 4HGAB 2F8NK 2PYOB 5KDMB 4WU8D 1TZYD 2RVQD 3C1BB 5B40D 4Z66D 5B32B 3AZIA 5GT0C 3B6GD 4G91B 4X23A 4ZUXD 3KUYD 5BS7C 3REJD 1ID3D 3AZGD 1AOIC 1M18B 2FJ7C 1KX4D 5DNND 5GSUC 5E5AD 1EQZD 5B1LD 3WA9A 3AZKD 3O62B 2NQBA 3B6FB 3TU4B 3W97A 3W99D 5AV8B 3X1TB 1P3GB 2HIOC 1P3MD 4Z5TC 3B0CW 5CPJB 2YFVA 3REKC 1ZLAB 5B31B 2AROB 5CPKD 2JSSA 3W98B 4H9OB 5BNVB 3LJAA 4JJND 5C3IC 4EO5B 3X1VA 5AV9A 1P34A 5JRGB 5AY8D 4WU8C 1TZYC 2PYOA 1ULYA 3LZ1B 5B40C 1KX3B 4Z66C 4CAYA 3B6GC 5F99D 1ID3C 4ZUXC 3KUYC 2HIOA 4J8XD 4DRAA 4NE5A 1KX4C 4R8PB 2CWEA 3MGPB 3A6NB 1EQZC 3V9RA 5B1LC 5B0ZB 3MGQB 3AZJD 4J8UB 3AZKC 4ZBJB 4LD9D 3W99C 3TU4A 1WWIA 3R45A 1P3FD 4Z66A 1P3AD 1Q9CA 3B6GA 4QLCB 1P3MC 5FUGB 4XZQD 3REJA 5CP6D 4G92B 5CPKC 3AZGA 4H9RA 1KX4A 3W98A 5DNNA 4JJNC 5E5AA 3REID 3AN2B 5AY8C 3WKJB 5B0YA 1F1EA 3VH5W 3AYWD 3MGSB 3REHD 1P3LD 3W99A 5B1MB 5F99C 5CPIB 4H9PB 4J8XC 4J8WC 4XUJB 3KXBD 3KWQD 5GXQA 5CPKA 1HQ3D 1P3KB 3C1CA 1A7WA 3MGPA 3RELD 3UTBB 3A6NA 4JJNA 3AZJC 2BYMB 5AVCD 5AV5A 4J8UA 3AZMD 2F8NH 4LD9C 3AFAD 3AZEB 1P3FC 2L5AA 1P3AC 4XZQC 4QLCA 4CSRB 5CP6C 3AZLD 5B33D 3AV2D 3X1UD 3B0BA 2NZDC 5B24B 1R4VA 3AZFD 1M19D 3AYWC 3REHC 1P3LC 1TAFB 4WZSB 3UTAD 3MGSA 4AWLC 5CPIA 2F8NG 5GT3D 3W96D 4KGCC 1P3ID 5B32G 3KXBC 4XUJA 3KWQC 1M1AD 1AOIB 1HQ3C 4M6BA 5BO0B 3RELC 5GSUB 3UTBA 3X1VB 5AV9B 1P34B 3REIA 3AZND 1F66C 5AVCC 2BYMA 3AZMC 3MNNA 3AFAC 4CAYB 3AZEA 2F8ND 3X1SA 5B2JD 3C1BD 1P3PD 2HIOB 3MGRC 4Z5TB 4CSRA 4Z2MG 5B33C 3REKB 3AZLC 3AV2C 3LZ0D 3X1UC 3KXBA 2CV5D 1HQ3A 5B31G 3V9RB 5B24A 3AZFC 5C3IB 1M19C 4UUZA 1P3OD 4WU8B 1TZYB 3AZMA 1HTAA 1N1JA 3R45B 3WTPC 3UTAC 4Z66B 1TAFA 1KX5D 3B6FD 3W96C 5GT3C 4YS3C 3B6GB 5GT0A 1P3IC 1ID3B 4ZUXB 3REJB 3X1TD 3UT9C 2IO5B 3VH6W 5BS7A 3AZGB 1M1AC 4H9RB 5CPJD 4YM6D 1AOIA 3X1UA 1ZLAD 1KX4B 2FJ7A 5BO0A 5DNNB 2AROD 5E5AB 5GSUA 3B0DC 3MVDD 3AZNC 1EQZB 5B1LB 3AZFA 5B0YB 3AZKB 4KHAA 4HGAC 3LELD 3WAAD 5JRGD 3W99B 5B2JC 3C1BC 3LZ1D 1P3PC 5GT3A 1P3MB 4G91C 4Z5TA 3LZ0C 4J8WD 3REKA 1U35D 5GXQB 5CPKB 2CV5C 3C1CB 5AV6D 4JJNB 1P3OC 3AZNA 5AV5B 5AY8B 4WU8A 1TZYA 5B40A 5G49A 1KX5C 3B6FC 3B0CT 5F99B 3VH6T 4WU9D 3X1TC 1P3GC 4ZUXA 3KUYA 1ID3A 5B2ID 1S32D 5CPJC 4YM6C 3LZ0A 1ZLAC 5B31C 2AROC 2NZDD 3MVDC 1EQZA 5B1LA 4EO5C 3WAAC 3LELC 4KUDD 5JRGC 1WWSA 3AZKA 3AN2D 3LZ1C 1P3AB 3AV1D 4KGCD 4XZQB 1P3MA 5CP6B 1U35C 5DNMD 4H9SC 5AV6C 4DRBA 4J8VD 5AVBD 3REIB 3MNNB 1F66D 5AY8A 3MGQC 3AYWB 1BH8A 3X1SB 5F99A 3AZID 1KU5A 4WU9C 3MGRD 2BYKA 2HUEB 5B2IC 2YFWA 4X23D 3KXBB 4J8WA 4J8XA 1U35A 1S32C 1HQ3B 5AV6A 3RELB 3AZHD 3NQUB 4UUZB 4WV4B 3AZJA 4KUDC 3VH5T 3AZMB 3AN2C 3AFAB 3WKJC 3WA9D 1N1JB 4LD9A 4Z2MH 2NQBD 3WTPD 1P3FA 5GT0B 3AV1C 4YS3D 1P3AA 3W97D 2LY8A 1P3BD 4XZQA 5DNMC 3AZLB 5B33B 5CP6A 3UT9D 5B2IA 3X1UB 2FJ7B 5BNXA 4WNNB 4J8VC 5AVBC 2NZDA 3LJAD 3AZFB 1M19B 4KHAB 3X1VD 1P34D 2PYOD 3WTPE 3UTAB 3AYWA 3REHA 1P3LA 3AZIC 5GT3B 5B32D 4KGCA 1P3IB 4X23C 1M1AB 3KWQA 4H9NA 5JA4B 3RELA 5CHLB 1M18D 4J8VA 5AVBA 3B0DB 3AZHC 3AZNB 3NQUA 1F66A 5AVCA 3WA9C 3AFAA 5B40B 5G49B 2NQBC 3O62D 2F8NB 5B2JB 3W97C 3TU4D 4E45A 1P3PB 1JFIB 1P3BC 5AV8D 3KUYB 1P3GD 3MGRA 3AZLA 5B33A 3LZ0B 3AV2A 2CV5B 5B31D 4WNNA 4E44A 3W98D 3LJAC 3AZHA 1P3OB 3X1VC 5AV9C 1P34C 1M19A 2PYOC 5B0YD 3UTAA 1KX5B 3WTPA 1KX3D 5BT1D 5B32C 3W96A 4YS3A 1P3IA 1P3BA 3UT9A 1M1AA 4YM6B 1M18C 5GXQD 3VH6A 5JA4A 1H3OB 4R8PD 3C1CD 3MVDB 3MGPD 3A6ND 1BH9B 3LELB 3WAAB 5B0ZD 5AV5D 3MGQD 4J8UD 1BH8B 2RVQC 5KDMA 3O62C 1B67A 2F8NA 3TU4C 5B2JA 3C1BA 1P3PA 5AV8C 5B32A 1JFIA 2BYKB 2YFWB 4J8WB 4J8XB 4QLCD 1U35B 3REJC 2IO5C 3AZGC 2CV5A 5AV6B 3W98C 1M18A 5DNNC 5E5AC 3AZJB 1P3OA 4LD9B 5B0YC 3WKJD 4NE6A 1P3FB 3O62A 1KX3C 5BT1C 1KX5A 4NFTA 3B6FA 3KSYA 3MGSD 5B1MD 4WU9B 5CPID 5AV8A 3X1TA 1P3GA 5B2IB 1S32B 5BNXB 5CPJA 4YM6A 4XUJD 1ZLAA 5B31A 5GXQC 2NZDB 2AROA 4R8PC 3C1CC 3MGPC 1H3OA 1P3KD 3NQJB 3A6NC 3MVDA
chains in the Genus database with same CATH superfamily
4H9OA 5BNVA 3UTBD 4KUDB 1BH9A 2BG1A 5AV5C 2ZY2A 5B0ZC 3LELA 4J8UC 5JRGA 3MNND 3WAAA 4UPKA 4ZBJC 3REHB 1P3LB 3LZ1A 3AZED 4AWLB 1KX3A 3X1SD 3VH5A 3AV1B 4KGCB 4QLCC 5DNMB 3KWQB 4H9NB 4G92C 3EG5B 4H9SA 3EPLA 4H9QB 4J8VB 5AVBB 4R8PA 2Y2MA 5B24D 5AVCB 1F66B 5B0ZA 3MGQA 3MGSC 5B1MC 2Y2KA 5CPIC 3AZIB 4WU9A 5GT0D 3MGRB 3AV2B 4X23B 1BFMA 1S32A 5FUGA 4XUJC 3EPJA 1AOID 1P3KC 2FJ7D 3UTBC 3NQJA 3AZHB 5GSUD 3REIC 5AV9D 4KUDA 3MNNC 3AN2A 2ZY5A 3WA9B 4NE3A 3WKJA 2NQBB 3WTPB 3AZEC 3F6TA 2ZY4A 3X1SC 3W97B 4YS3B 3W96B 3AV1A 5B1MA 1P3BB 3UT9B 5DNMA 2HIOD 2YFVB 4Z5TD 2HUEC 4H9PA 3REKD 4H9QA 1P3KA 3LJAB 2Y2PA 5B24C 1B6WA 4HGAB 2F8NK 2PYOB 5KDMB 4WU8D 1TZYD 2RVQD 3C1BB 5B40D 4Z66D 1W2EA 5B32B 3AZIA 5GT0C 3B6GD 4G91B 4X23A 4ZUXD 3KUYD 5BS7C 3REJD 1ID3D 3AZGD 2XD5A 1AOIC 1M18B 2FJ7C 1KX4D 5DNND 5GSUC 5E5AD 1EQZD 5B1LD 3WA9A 3AZKD 3O62B 2NQBA 3B6FB 3TU4B 3W97A 3W99D 5AV8B 3X1TB 1P3GB 2HIOC 1P3MD 4Z5TC 3B0CW 5CPJB 2YFVA 3REKC 1ZLAB 5B31B 2AROB 5CPKD 2JSSA 2Y2IA 3W98B 4H9OB 5BNVB 3LJAA 4JJND 5C3IC 4EO5B 3X1VA 5AV9A 1P34A 5JRGB 5AY8D 4WU8C 1TZYC 2PYOA 1ULYA 3LZ1B 5B40C 1KX3B 4CAYA 4Z66C 3B6GC 5F99D 1ID3C 4ZUXC 3KUYC 2HIOA 4J8XD 4DRAA 4NE5A 1KX4C 4R8PB 2CWEA 3MGPB 3A6NB 1EQZC 3V9RA 5B1LC 5B0ZB 3MGQB 3AZJD 4J8UB 3AZKC 4ZBJB 4LD9D 3W99C 3TU4A 1WWIA 3R45A 1P3FD 4Z66A 1P3AD 2DF4C 1Q9CA 3B6GA 4QLCB 1P3MC 5FUGB 4XZQD 3REJA 5CP6D 4G92B 5CPKC 3AZGA 4H9RA 1KX4A 3W98A 5DNNA 4JJNC 5E5AA 3REID 2DQNC 3AN2B 5AY8C 3WKJB 3H0RC 5B0YA 3IP4C 1F1EA 3VH5W 3AYWD 3MGSB 3REHD 1P3LD 3W99A 5B1MB 5F99C 5CPIB 4H9PB 4J8XC 4J8WC 4XUJB 3KXBD 3KWQD 5GXQA 5CPKA 1HQ3D 1P3KB 3C1CA 1A7WA 3MGPA 3RELD 3UTBB 2JE5A 3A6NA 2Y2HA 4JJNA 3AZJC 2BYMB 5AVCD 5AV5A 4J8UA 3AZMD 2F8NH 4LD9C 2J8PA 3AFAD 3AZEB 1P3FC 2L5AA 1P3AC 4XZQC 4QLCA 4CSRB 5CP6C 1PZRA 3AZLD 5B33D 3AV2D 3X1UD 3B0BA 2NZDC 5B24B 1R4VA 3AZFD 1M19D 3AYWC 3REHC 1P3LC 1TAFB 4WZSB 3UTAD 3MGSA 4WJ3C 2RIQA 4AWLC 5CPIA 2F8NG 5GT3D 3W96D 4KGCC 1P3ID 5B32G 3KXBC 4XUJA 3KWQC 1M1AD 1AOIB 1HQ3C 4M6BA 5BO0B 2ZY3A 3RELC 5GSUB 3UTBA 3X1VB 5AV9B 1P34B 3REIA 3AZND 1F66C 5AVCC 2BYMA 3AZMC 3MNNA 3AFAC 4CAYB 3AZEA 2F8ND 3X1SA 5B2JD 3C1BD 1P3PD 2HIOB 3MGRC 4Z5TB 4CSRA 4Z2MG 5B33C 3REKB 3AZLC 3AV2C 3LZ0D 3X1UC 3KXBA 4DQYB 2CV5D 3A1IA 1HQ3A 5B31G 3V9RB 5B24A 3AZFC 5C3IB 1M19C 4UUZA 1P3OD 4WU8B 1TZYB 2Y2GA 1HTAA 3AZMA 1N1JA 3R45B 3WTPC 3UTAC 4Z66B 2ZM5A 1TAFA 1KX5D 3B6FD 3W96C 5GT3C 4YS3C 3B6GB 5GT0A 1P3IC 1ID3B 4ZUXB 3REJB 3X1TD 3UT9C 2IO5B 3VH6W 5BS7A 3AZGB 1M1AC 4H9RB 5CPJD 4YM6D 1AOIA 3X1UA 1ZLAD 1KX4B 2FJ7A 5BO0A 5DNNB 2AROD 5E5AB 3EPHA 5GSUA 3B0DC 3MVDD 3AZNC 1EQZB 5B1LB 3AZFA 5B0YB 3AZKB 4KHAA 4HGAC 3LELD 3FDDA 3WAAD 5JRGD 3W99B 5B2JC 3C1BC 3LZ1D 1P3PC 5GT3A 2UWXA 3H0LC 1P3MB 4G91C 4Z5TA 3LZ0C 4J8WD 3REKA 1U35D 5GXQB 5CPKB 2CV5C 3C1CB 5AV6D 4JJNB 1P3OC 3AZNA 5AV5B 5AY8B 4WU8A 1TZYA 5B40A 5G49A 1KX5C 3B6FC 3B0CT 5F99B 3P5JB 3VH6T 4WU9D 3X1TC 1P3GC 4ZUXA 3KUYA 1ID3A 3MVDA 5B2ID 1S32D 5CPJC 4YM6C 3LZ0A 1ZLAC 5B31C 2AROC 2NZDD 3MVDC 1EQZA 2VQRA 5B1LA 4EO5C 3WAAC 3LELC 4KUDD 5JRGC 1WWSA 3AZKA 3AN2D 2XD1A 3LZ1C 1P3AB 3AV1D 4KGCD 4XZQB 1P3MA 2G5IC 5CP6B 1U35C 5DNMD 4H9SC 5AV6C 4DRBA 2Y2OA 4J8VD 5AVBD 3AL0C 3REIB 3MNNB 1F66D 5AY8A 3MGQC 3AYWB 1BH8A 3X1SB 1T3UA 5F99A 3AZID 1KU5A 4WU9C 3MGRD 2BYKA 2HUEB 5B2IC 2YFWA 4X23D 3KXBB 4J8WA 4J8XA 1U35A 1S32C 1HQ3B 5AV6A 3RELB 3AZHD 3NQUB 4UUZB 4WV4B 3AZJA 4KUDC 3VH5T 3AZMB 3AN2C 3AFAB 3WKJC 3WA9D 1N1JB 4LD9A 4Z2MH 2NQBD 3WTPD 1P3FA 3EPKA 5GT0B 3AV1C 4YS3D 1P3AA 3W97D 2LY8A 1P3BD 4XZQA 5DNMC 3AZLB 5B33B 5CP6A 3UT9D 5B2IA 3X1UB 2FJ7B 5BNXA 4WNNB 4J8VC 5AVBC 2NZDA 3LJAD 3AZFB 1M19B 4KHAB 3X1VD 1P34D 2PYOD 2Y2LA 3WTPE 3UTAB 3AYWA 3REHA 1P3LA 3AZIC 5GT3B 5B32D 4KGCA 1P3IB 4X23C 1M1AB 2F2AC 3KFUG 3KWQA 4H9NA 1Z2CB 5JA4B 3RELA 5CHLB 1M18D 2W8SA 4J8VA 5AVBA 3B0DB 3AZHC 3AZNB 3NQUA 1F66A 2JCHA 5AVCA 3WA9C 3AFAA 5B40B 5G49B 2NQBC 3O62D 2F8NB 5B2JB 3W97C 3TU4D 4E45A 1P3PB 1JFIB 1P3BC 5AV8D 3KUYB 1P3GD 3MGRA 3AZLA 5B33A 3LZ0B 3AV2A 2CV5B 5B31D 4WNNA 4E44A 3W98D 3LJAC 3AZHA 1P3OB 3X1VC 5AV9C 1P34C 1M19A 2PYOC 2Y2QA 5B0YD 3UTAA 1KX5B 3WTPA 1KX3D 5BT1D 5B32C 3W96A 4YS3A 1P3IA 1P3BA 3UT9A 1M1AA 4YM6B 2FFFB 1M18C 5GXQD 3VH6A 5JA4A 1H3OB 4R8PD 3C1CD 3MVDB 3MGPD 3A6ND 1BH9B 3LELB 3WAAB 5B0ZD 5AV5D 3MGQD 4J8UD 1BH8B 2RVQC 5KDMA 3O62C 1B67A 2F8NA 3TU4C 5B2JA 3C1BA 1P3PA 5AV8C 3A1KA 5B32A 1JFIA 2BYKB 2YFWB 4J8WB 4J8XB 4QLCD 1U35B 3REJC 2G5HC 2IO5C 3AZGC 2CV5A 5AV6B 3H0MC 3W98C 1M18A 5DNNC 5E5AC 3AZJB 1P3OA 2Y2JA 4LD9B 5B0YC 3WKJD 4NE6A 1P3FB 3O62A 1KX3C 5BT1C 1KX5A 4NFTA 3B6FA 3KSYA 3MGSD 5B1MD 4WU9B 5CPID 5AV8A 3X1TA 1P3GA 5B2IB 1S32B 5BNXB 5CPJA 4YM6A 4XUJD 1ZLAA 5B31A 5GXQC 2NZDB 2AROA 4R8PC 3C1CC 3MGPC 1H3OA 1P3KD 3NQJB 3A6NC 2Y2NA
chains in the Genus database with same CATH topology
4H9OA 5BNVA 3UTBD 4KUDB 1BH9A 2BG1A 5AV5C 2ZY2A 5B0ZC 3LELA 4J8UC 5JRGA 3MNND 3WAAA 4UPKA 4ZBJC 3REHB 1P3LB 3LZ1A 3AZED 4AWLB 1KX3A 3X1SD 3VH5A 3AV1B 4KGCB 4QLCC 5DNMB 3KWQB 4H9NB 4G92C 3EG5B 4H9SA 3EPLA 4H9QB 4J8VB 5AVBB 4R8PA 2Y2MA 5B24D 5AVCB 1F66B 5B0ZA 3MGQA 3MGSC 5B1MC 2Y2KA 5CPIC 3AZIB 4WU9A 5GT0D 3MGRB 3AV2B 4X23B 1BFMA 1S32A 5FUGA 4XUJC 3EPJA 1AOID 1P3KC 2FJ7D 3UTBC 3NQJA 3AZHB 5GSUD 3REIC 5AV9D 4KUDA 3MNNC 3AN2A 2ZY5A 3WA9B 4NE3A 3WKJA 2NQBB 3WTPB 3AZEC 3F6TA 2ZY4A 3X1SC 3W97B 4YS3B 3W96B 3AV1A 5B1MA 1P3BB 3UT9B 5DNMA 2HIOD 2YFVB 4Z5TD 2HUEC 4H9PA 3REKD 4H9QA 1P3KA 3LJAB 2Y2PA 5B24C 1B6WA 4HGAB 2F8NK 2PYOB 5KDMB 4WU8D 1TZYD 2RVQD 3C1BB 5B40D 4Z66D 1W2EA 5B32B 3AZIA 5GT0C 3B6GD 4G91B 4X23A 4ZUXD 3KUYD 5BS7C 3REJD 1ID3D 3AZGD 2XD5A 1AOIC 1M18B 2FJ7C 1KX4D 5DNND 5GSUC 5E5AD 1EQZD 5B1LD 3WA9A 3AZKD 3O62B 2NQBA 3B6FB 3TU4B 3W97A 3W99D 5AV8B 3X1TB 1P3GB 2HIOC 1P3MD 4Z5TC 3B0CW 5CPJB 2YFVA 3REKC 1ZLAB 5B31B 2AROB 5CPKD 2JSSA 2Y2IA 3W98B 4H9OB 5BNVB 3LJAA 4JJND 5C3IC 4EO5B 3X1VA 5AV9A 1P34A 5JRGB 5AY8D 4WU8C 1TZYC 2PYOA 1ULYA 3LZ1B 5B40C 1KX3B 4CAYA 4Z66C 3B6GC 5F99D 1ID3C 4ZUXC 3KUYC 2HIOA 4J8XD 4DRAA 4NE5A 1KX4C 4R8PB 2CWEA 3MGPB 3A6NB 1EQZC 3V9RA 5B1LC 5B0ZB 3MGQB 3AZJD 4J8UB 3AZKC 4ZBJB 4LD9D 3W99C 3TU4A 1WWIA 3R45A 1P3FD 4Z66A 1P3AD 2DF4C 1Q9CA 3B6GA 4QLCB 1P3MC 5FUGB 4XZQD 3REJA 5CP6D 4G92B 5CPKC 3AZGA 4H9RA 1KX4A 3W98A 5DNNA 4JJNC 5E5AA 3REID 2DQNC 3AN2B 5AY8C 3WKJB 3H0RC 5B0YA 3IP4C 1F1EA 3VH5W 3AYWD 3MGSB 3REHD 1P3LD 3W99A 5B1MB 5F99C 5CPIB 4H9PB 4J8XC 4J8WC 4XUJB 3KXBD 3KWQD 5GXQA 5CPKA 1HQ3D 1P3KB 3C1CA 1A7WA 3MGPA 3RELD 3UTBB 2JE5A 3A6NA 2Y2HA 4JJNA 3AZJC 2BYMB 5AVCD 5AV5A 4J8UA 3AZMD 2F8NH 4LD9C 2J8PA 3AFAD 3AZEB 1P3FC 2L5AA 1P3AC 4XZQC 4QLCA 4CSRB 5CP6C 1PZRA 3AZLD 5B33D 3AV2D 3X1UD 3B0BA 2NZDC 5B24B 1R4VA 3AZFD 1M19D 3AYWC 3REHC 1P3LC 1TAFB 4WZSB 3UTAD 3MGSA 4WJ3C 2RIQA 4AWLC 5CPIA 2F8NG 5GT3D 3W96D 4KGCC 1P3ID 5B32G 3KXBC 4XUJA 3KWQC 1M1AD 1AOIB 1HQ3C 4M6BA 5BO0B 2ZY3A 3RELC 5GSUB 3UTBA 3X1VB 5AV9B 1P34B 3REIA 3AZND 1F66C 5AVCC 2BYMA 3AZMC 3MNNA 3AFAC 4CAYB 3AZEA 2F8ND 3X1SA 5B2JD 3C1BD 1P3PD 2HIOB 3MGRC 4Z5TB 4CSRA 4Z2MG 5B33C 3REKB 3AZLC 3AV2C 3LZ0D 3X1UC 3KXBA 4DQYB 2CV5D 3A1IA 1HQ3A 5B31G 3V9RB 5B24A 3AZFC 5C3IB 1M19C 4UUZA 1P3OD 4WU8B 1TZYB 2Y2GA 1HTAA 3AZMA 1N1JA 3R45B 3WTPC 3UTAC 4Z66B 2ZM5A 1TAFA 1KX5D 3B6FD 3W96C 5GT3C 4YS3C 3B6GB 5GT0A 1P3IC 1ID3B 4ZUXB 3REJB 3X1TD 3UT9C 2IO5B 3VH6W 5BS7A 3AZGB 1M1AC 4H9RB 5CPJD 4YM6D 1AOIA 3X1UA 1ZLAD 1KX4B 2FJ7A 5BO0A 5DNNB 2AROD 5E5AB 3EPHA 5GSUA 3B0DC 3MVDD 3AZNC 1EQZB 5B1LB 3AZFA 5B0YB 3AZKB 4KHAA 4HGAC 3LELD 3FDDA 3WAAD 5JRGD 3W99B 5B2JC 3C1BC 3LZ1D 1P3PC 5GT3A 2UWXA 3H0LC 1P3MB 4G91C 4Z5TA 3LZ0C 4J8WD 3REKA 1U35D 5GXQB 5CPKB 2CV5C 3C1CB 5AV6D 4JJNB 1P3OC 3AZNA 5AV5B 5AY8B 4WU8A 1TZYA 5B40A 5G49A 1KX5C 3B6FC 3B0CT 5F99B 3P5JB 3VH6T 4WU9D 3X1TC 1P3GC 4ZUXA 3KUYA 1ID3A 3MVDA 5B2ID 1S32D 5CPJC 4YM6C 3LZ0A 1ZLAC 5B31C 2AROC 2NZDD 3MVDC 1EQZA 2VQRA 5B1LA 4EO5C 3WAAC 3LELC 4KUDD 5JRGC 1WWSA 3AZKA 3AN2D 2XD1A 3LZ1C 1P3AB 3AV1D 4KGCD 4XZQB 1P3MA 2G5IC 5CP6B 1U35C 5DNMD 4H9SC 5AV6C 4DRBA 2Y2OA 4J8VD 5AVBD 3AL0C 3REIB 3MNNB 1F66D 5AY8A 3MGQC 3AYWB 1BH8A 3X1SB 1T3UA 5F99A 3AZID 1KU5A 4WU9C 3MGRD 2BYKA 2HUEB 5B2IC 2YFWA 4X23D 3KXBB 4J8WA 4J8XA 1U35A 1S32C 1HQ3B 5AV6A 3RELB 3AZHD 3NQUB 4UUZB 4WV4B 3AZJA 4KUDC 3VH5T 3AZMB 3AN2C 3AFAB 3WKJC 3WA9D 1N1JB 4LD9A 4Z2MH 2NQBD 3WTPD 1P3FA 3EPKA 5GT0B 3AV1C 4YS3D 1P3AA 3W97D 2LY8A 1P3BD 4XZQA 5DNMC 3AZLB 5B33B 5CP6A 3UT9D 5B2IA 3X1UB 2FJ7B 5BNXA 4WNNB 4J8VC 5AVBC 2NZDA 3LJAD 3AZFB 1M19B 4KHAB 3X1VD 1P34D 2PYOD 2Y2LA 3WTPE 3UTAB 3AYWA 3REHA 1P3LA 3AZIC 5GT3B 5B32D 4KGCA 1P3IB 4X23C 1M1AB 2F2AC 3KFUG 3KWQA 4H9NA 1Z2CB 5JA4B 3RELA 5CHLB 1M18D 2W8SA 4J8VA 5AVBA 3B0DB 3AZHC 3AZNB 3NQUA 1F66A 2JCHA 5AVCA 3WA9C 3AFAA 5B40B 5G49B 2NQBC 3O62D 2F8NB 5B2JB 3W97C 3TU4D 4E45A 1P3PB 1JFIB 1P3BC 5AV8D 3KUYB 1P3GD 3MGRA 3AZLA 5B33A 3LZ0B 3AV2A 2CV5B 5B31D 4WNNA 4E44A 3W98D 3LJAC 3AZHA 1P3OB 3X1VC 5AV9C 1P34C 1M19A 2PYOC 2Y2QA 5B0YD 3UTAA 1KX5B 3WTPA 1KX3D 5BT1D 5B32C 3W96A 4YS3A 1P3IA 1P3BA 3UT9A 1M1AA 4YM6B 2FFFB 1M18C 5GXQD 3VH6A 5JA4A 1H3OB 4R8PD 3C1CD 3MVDB 3MGPD 3A6ND 1BH9B 3LELB 3WAAB 5B0ZD 5AV5D 3MGQD 4J8UD 1BH8B 2RVQC 5KDMA 3O62C 1B67A 2F8NA 3TU4C 5B2JA 3C1BA 1P3PA 5AV8C 3A1KA 5B32A 1JFIA 2BYKB 2YFWB 4J8WB 4J8XB 4QLCD 1U35B 3REJC 2G5HC 2IO5C 3AZGC 2CV5A 5AV6B 3H0MC 3W98C 1M18A 5DNNC 5E5AC 3AZJB 1P3OA 2Y2JA 4LD9B 5B0YC 3WKJD 4NE6A 1P3FB 3O62A 1KX3C 5BT1C 1KX5A 4NFTA 3B6FA 3KSYA 3MGSD 5B1MD 4WU9B 5CPID 5AV8A 3X1TA 1P3GA 5B2IB 1S32B 5BNXB 5CPJA 4YM6A 4XUJD 1ZLAA 5B31A 5GXQC 2NZDB 2AROA 4R8PC 3C1CC 3MGPC 1H3OA 1P3KD 3NQJB 3A6NC 2Y2NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H9O A;  5BNV A;  3UTB D;  4KUD B;  1BH9 A;  5B0Z C;  5AV5 C;  3LEL A;  4J8U C;  3WAA A;  5JRG A;  3MNN D;  4ZBJ C;  3REH B;  1P3L B;  3LZ1 A;  3AZE D;  4AWL B;  1KX3 A;  3X1S D;  3VH5 A;  3AV1 B;  4KGC B;  4QLC C;  5DNM B;  3KWQ B;  4H9N B;  4G92 C;  4H9S A;  4H9Q B;  4J8V B;  5AVB B;  4R8P A;  5B24 D;  5AVC B;  1F66 B;  5B0Z A;  3MGQ A;  3MGS C;  5B1M C;  3AZI B;  5CPI C;  4WU9 A;  5GT0 D;  3MGR B;  3AV2 B;  4X23 B;  1BFM A;  1S32 A;  5FUG A;  4XUJ C;  1AOI D;  1P3K C;  2FJ7 D;  3UTB C;  3NQJ A;  3AZH B;  5GSU D;  3REI C;  5AV9 D;  4KUD A;  3MNN C;  3AN2 A;  3WA9 B;  4NE3 A;  3WKJ A;  2NQB B;  3WTP B;  3AZE C;  3X1S C;  3W97 B;  4YS3 B;  3W96 B;  3AV1 A;  5B1M A;  1P3B B;  3UT9 B;  5DNM A;  2HIO D;  2YFV B;  4Z5T D;  2HUE C;  4H9P A;  3REK D;  4H9Q A;  1P3K A;  3LJA B;  5B24 C;  1B6W A;  4HGA B;  2F8N K;  2PYO B;  5KDM B;  4WU8 D;  1TZY D;  2RVQ D;  3C1B B;  5B40 D;  4Z66 D;  5B32 B;  3AZI A;  5GT0 C;  3B6G D;  4G91 B;  4X23 A;  4ZUX D;  3KUY D;  5BS7 C;  3REJ D;  1ID3 D;  3AZG D;  1AOI C;  1M18 B;  2FJ7 C;  1KX4 D;  5DNN D;  5GSU C;  5E5A D;  1EQZ D;  5B1L D;  3WA9 A;  3AZK D;  3O62 B;  2NQB A;  3B6F B;  3TU4 B;  3W97 A;  3W99 D;  5AV8 B;  3X1T B;  1P3G B;  2HIO C;  1P3M D;  4Z5T C;  3B0C W;  5CPJ B;  2YFV A;  3REK C;  1ZLA B;  5B31 B;  2ARO B;  5CPK D;  2JSS A;  3W98 B;  4H9O B;  5BNV B;  3LJA A;  4JJN D;  5C3I C;  4EO5 B;  3X1V A;  5AV9 A;  1P34 A;  5JRG B;  5AY8 D;  4WU8 C;  1TZY C;  2PYO A;  1ULY A;  3LZ1 B;  5B40 C;  1KX3 B;  4Z66 C;  4CAY A;  3B6G C;  5F99 D;  1ID3 C;  4ZUX C;  3KUY C;  2HIO A;  4J8X D;  4DRA A;  4NE5 A;  1KX4 C;  4R8P B;  2CWE A;  3MGP B;  3A6N B;  1EQZ C;  3V9R A;  5B1L C;  5B0Z B;  3MGQ B;  3AZJ D;  4J8U B;  3AZK C;  4ZBJ B;  4LD9 D;  3W99 C;  3TU4 A;  1WWI A;  3R45 A;  1P3F D;  4Z66 A;  1P3A D;  1Q9C A;  3B6G A;  4QLC B;  1P3M C;  5FUG B;  4XZQ D;  3REJ A;  5CP6 D;  4G92 B;  5CPK C;  3AZG A;  4H9R A;  1KX4 A;  3W98 A;  5DNN A;  4JJN C;  5E5A A;  3REI D;  3AN2 B;  5AY8 C;  3WKJ B;  5B0Y A;  1F1E A;  3VH5 W;  3AYW D;  3MGS B;  3REH D;  1P3L D;  3W99 A;  5B1M B;  5F99 C;  5CPI B;  4H9P B;  4J8X C;  4J8W C;  4XUJ B;  3KXB D;  3KWQ D;  5GXQ A;  5CPK A;  1HQ3 D;  1P3K B;  3C1C A;  1A7W A;  3MGP A;  3REL D;  3UTB B;  3A6N A;  4JJN A;  3AZJ C;  2BYM B;  5AVC D;  5AV5 A;  4J8U A;  3AZM D;  2F8N H;  4LD9 C;  3AFA D;  3AZE B;  1P3F C;  2L5A A;  1P3A C;  4XZQ C;  4QLC A;  4CSR B;  5CP6 C;  3AZL D;  5B33 D;  3AV2 D;  3X1U D;  3B0B A;  2NZD C;  5B24 B;  1R4V A;  3AZF D;  1M19 D;  3AYW C;  3REH C;  1P3L C;  1TAF B;  4WZS B;  3UTA D;  3MGS A;  4AWL C;  5CPI A;  2F8N G;  5GT3 D;  3W96 D;  4KGC C;  1P3I D;  5B32 G;  3KXB C;  4XUJ A;  3KWQ C;  1M1A D;  1AOI B;  1HQ3 C;  4M6B A;  5BO0 B;  3REL C;  5GSU B;  3UTB A;  3X1V B;  5AV9 B;  1P34 B;  3REI A;  3AZN D;  1F66 C;  5AVC C;  2BYM A;  3AZM C;  3MNN A;  3AFA C;  4CAY B;  3AZE A;  2F8N D;  3X1S A;  5B2J D;  3C1B D;  1P3P D;  2HIO B;  3MGR C;  4Z5T B;  4CSR A;  4Z2M G;  5B33 C;  3REK B;  3AZL C;  3AV2 C;  3LZ0 D;  3X1U C;  3KXB A;  2CV5 D;  1HQ3 A;  5B31 G;  3V9R B;  5B24 A;  3AZF C;  5C3I B;  1M19 C;  4UUZ A;  1P3O D;  4WU8 B;  1TZY B;  3AZM A;  1HTA A;  1N1J A;  3R45 B;  3WTP C;  3UTA C;  4Z66 B;  1TAF A;  1KX5 D;  3B6F D;  3W96 C;  5GT3 C;  4YS3 C;  3B6G B;  5GT0 A;  1P3I C;  1ID3 B;  4ZUX B;  3REJ B;  3X1T D;  3UT9 C;  2IO5 B;  3VH6 W;  5BS7 A;  3AZG B;  1M1A C;  4H9R B;  5CPJ D;  4YM6 D;  1AOI A;  3X1U A;  1ZLA D;  1KX4 B;  2FJ7 A;  5BO0 A;  5DNN B;  2ARO D;  5E5A B;  5GSU A;  3B0D C;  3MVD D;  3AZN C;  1EQZ B;  5B1L B;  3AZF A;  5B0Y B;  3AZK B;  4KHA A;  4HGA C;  3LEL D;  3WAA D;  5JRG D;  3W99 B;  5B2J C;  3C1B C;  3LZ1 D;  1P3P C;  5GT3 A;  1P3M B;  4G91 C;  4Z5T A;  3LZ0 C;  4J8W D;  3REK A;  1U35 D;  5GXQ B;  5CPK B;  2CV5 C;  3C1C B;  5AV6 D;  4JJN B;  1P3O C;  3AZN A;  5AV5 B;  5AY8 B;  4WU8 A;  1TZY A;  5B40 A;  5G49 A;  1KX5 C;  3B6F C;  3B0C T;  5F99 B;  3VH6 T;  4WU9 D;  3X1T C;  1P3G C;  4ZUX A;  3KUY A;  1ID3 A;  5B2I D;  1S32 D;  5CPJ C;  4YM6 C;  3LZ0 A;  1ZLA C;  5B31 C;  2ARO C;  2NZD D;  3MVD C;  1EQZ A;  5B1L A;  4EO5 C;  3WAA C;  3LEL C;  4KUD D;  5JRG C;  1WWS A;  3AZK A;  3AN2 D;  3LZ1 C;  1P3A B;  3AV1 D;  4KGC D;  4XZQ B;  1P3M A;  5CP6 B;  1U35 C;  5DNM D;  4H9S C;  5AV6 C;  4DRB A;  4J8V D;  5AVB D;  3REI B;  3MNN B;  1F66 D;  5AY8 A;  3MGQ C;  3AYW B;  1BH8 A;  3X1S B;  5F99 A;  3AZI D;  1KU5 A;  4WU9 C;  3MGR D;  2BYK A;  2HUE B;  5B2I C;  2YFW A;  4X23 D;  3KXB B;  4J8W A;  4J8X A;  1U35 A;  1S32 C;  1HQ3 B;  5AV6 A;  3REL B;  3AZH D;  3NQU B;  4UUZ B;  4WV4 B;  3AZJ A;  4KUD C;  3VH5 T;  3AZM B;  3AN2 C;  3AFA B;  3WKJ C;  3WA9 D;  1N1J B;  4LD9 A;  4Z2M H;  2NQB D;  3WTP D;  1P3F A;  5GT0 B;  3AV1 C;  4YS3 D;  1P3A A;  3W97 D;  2LY8 A;  1P3B D;  4XZQ A;  5DNM C;  3AZL B;  5B33 B;  5CP6 A;  3UT9 D;  5B2I A;  3X1U B;  2FJ7 B;  5BNX A;  4WNN B;  4J8V C;  5AVB C;  2NZD A;  3LJA D;  3AZF B;  1M19 B;  4KHA B;  3X1V D;  1P34 D;  2PYO D;  3WTP E;  3UTA B;  3AYW A;  3REH A;  1P3L A;  3AZI C;  5GT3 B;  5B32 D;  4KGC A;  1P3I B;  4X23 C;  1M1A B;  3KWQ A;  4H9N A;  5JA4 B;  3REL A;  5CHL B;  1M18 D;  4J8V A;  5AVB A;  3B0D B;  3AZH C;  3AZN B;  3NQU A;  1F66 A;  5AVC A;  3WA9 C;  3AFA A;  5B40 B;  5G49 B;  2NQB C;  3O62 D;  2F8N B;  5B2J B;  3W97 C;  3TU4 D;  4E45 A;  1P3P B;  1JFI B;  1P3B C;  5AV8 D;  3KUY B;  1P3G D;  3MGR A;  3AZL A;  5B33 A;  3LZ0 B;  3AV2 A;  2CV5 B;  5B31 D;  4WNN A;  4E44 A;  3W98 D;  3LJA C;  3AZH A;  1P3O B;  3X1V C;  5AV9 C;  1P34 C;  1M19 A;  2PYO C;  5B0Y D;  3UTA A;  1KX5 B;  3WTP A;  1KX3 D;  5BT1 D;  5B32 C;  3W96 A;  4YS3 A;  1P3I A;  1P3B A;  3UT9 A;  1M1A A;  4YM6 B;  1M18 C;  5GXQ D;  3VH6 A;  5JA4 A;  1H3O B;  4R8P D;  3C1C D;  3MVD B;  3MGP D;  3A6N D;  1BH9 B;  3LEL B;  3WAA B;  5B0Z D;  5AV5 D;  3MGQ D;  4J8U D;  1BH8 B;  2RVQ C;  5KDM A;  3O62 C;  1B67 A;  2F8N A;  3TU4 C;  5B2J A;  3C1B A;  1P3P A;  5AV8 C;  5B32 A;  1JFI A;  2BYK B;  2YFW B;  4J8W B;  4J8X B;  4QLC D;  1U35 B;  3REJ C;  2IO5 C;  3AZG C;  2CV5 A;  5AV6 B;  3W98 C;  1M18 A;  5DNN C;  5E5A C;  3AZJ B;  1P3O A;  4LD9 B;  5B0Y C;  3WKJ D;  4NE6 A;  1P3F B;  3O62 A;  1KX3 C;  5BT1 C;  1KX5 A;  4NFT A;  3B6F A;  3KSY A;  3MGS D;  5B1M D;  4WU9 B;  5CPI D;  5AV8 A;  3X1T A;  1P3G A;  5B2I B;  1S32 B;  5BNX B;  5CPJ A;  4YM6 A;  4XUJ D;  1ZLA A;  5B31 A;  5GXQ C;  2NZD B;  2ARO A;  4R8P C;  3C1C C;  3MGP C;  1H3O A;  1P3K D;  3NQJ B;  3A6N C;  3MVD A; 
#chains in the Genus database with same CATH topology
 4H9O A;  5BNV A;  3UTB D;  4KUD B;  1BH9 A;  2BG1 A;  5AV5 C;  2ZY2 A;  5B0Z C;  3LEL A;  4J8U C;  5JRG A;  3MNN D;  3WAA A;  4UPK A;  4ZBJ C;  3REH B;  1P3L B;  3LZ1 A;  3AZE D;  4AWL B;  1KX3 A;  3X1S D;  3VH5 A;  3AV1 B;  4KGC B;  4QLC C;  5DNM B;  3KWQ B;  4H9N B;  4G92 C;  3EG5 B;  4H9S A;  3EPL A;  4H9Q B;  4J8V B;  5AVB B;  4R8P A;  2Y2M A;  5B24 D;  5AVC B;  1F66 B;  5B0Z A;  3MGQ A;  3MGS C;  5B1M C;  2Y2K A;  5CPI C;  3AZI B;  4WU9 A;  5GT0 D;  3MGR B;  3AV2 B;  4X23 B;  1BFM A;  1S32 A;  5FUG A;  4XUJ C;  3EPJ A;  1AOI D;  1P3K C;  2FJ7 D;  3UTB C;  3NQJ A;  3AZH B;  5GSU D;  3REI C;  5AV9 D;  4KUD A;  3MNN C;  3AN2 A;  2ZY5 A;  3WA9 B;  4NE3 A;  3WKJ A;  2NQB B;  3WTP B;  3AZE C;  3F6T A;  2ZY4 A;  3X1S C;  3W97 B;  4YS3 B;  3W96 B;  3AV1 A;  5B1M A;  1P3B B;  3UT9 B;  5DNM A;  2HIO D;  2YFV B;  4Z5T D;  2HUE C;  4H9P A;  3REK D;  4H9Q A;  1P3K A;  3LJA B;  2Y2P A;  5B24 C;  1B6W A;  4HGA B;  2F8N K;  2PYO B;  5KDM B;  4WU8 D;  1TZY D;  2RVQ D;  3C1B B;  5B40 D;  4Z66 D;  1W2E A;  5B32 B;  3AZI A;  5GT0 C;  3B6G D;  4G91 B;  4X23 A;  4ZUX D;  3KUY D;  5BS7 C;  3REJ D;  1ID3 D;  3AZG D;  2XD5 A;  1AOI C;  1M18 B;  2FJ7 C;  1KX4 D;  5DNN D;  5GSU C;  5E5A D;  1EQZ D;  5B1L D;  3WA9 A;  3AZK D;  3O62 B;  2NQB A;  3B6F B;  3TU4 B;  3W97 A;  3W99 D;  5AV8 B;  3X1T B;  1P3G B;  2HIO C;  1P3M D;  4Z5T C;  3B0C W;  5CPJ B;  2YFV A;  3REK C;  1ZLA B;  5B31 B;  2ARO B;  5CPK D;  2JSS A;  2Y2I A;  3W98 B;  4H9O B;  5BNV B;  3LJA A;  4JJN D;  5C3I C;  4EO5 B;  3X1V A;  5AV9 A;  1P34 A;  5JRG B;  5AY8 D;  4WU8 C;  1TZY C;  2PYO A;  1ULY A;  3LZ1 B;  5B40 C;  1KX3 B;  4CAY A;  4Z66 C;  3B6G C;  5F99 D;  1ID3 C;  4ZUX C;  3KUY C;  2HIO A;  4J8X D;  4DRA A;  4NE5 A;  1KX4 C;  4R8P B;  2CWE A;  3MGP B;  3A6N B;  1EQZ C;  3V9R A;  5B1L C;  5B0Z B;  3MGQ B;  3AZJ D;  4J8U B;  3AZK C;  4ZBJ B;  4LD9 D;  3W99 C;  3TU4 A;  1WWI A;  3R45 A;  1P3F D;  4Z66 A;  1P3A D;  2DF4 C;  1Q9C A;  3B6G A;  4QLC B;  1P3M C;  5FUG B;  4XZQ D;  3REJ A;  5CP6 D;  4G92 B;  5CPK C;  3AZG A;  4H9R A;  1KX4 A;  3W98 A;  5DNN A;  4JJN C;  5E5A A;  3REI D;  2DQN C;  3AN2 B;  5AY8 C;  3WKJ B;  3H0R C;  5B0Y A;  3IP4 C;  1F1E A;  3VH5 W;  3AYW D;  3MGS B;  3REH D;  1P3L D;  3W99 A;  5B1M B;  5F99 C;  5CPI B;  4H9P B;  4J8X C;  4J8W C;  4XUJ B;  3KXB D;  3KWQ D;  5GXQ A;  5CPK A;  1HQ3 D;  1P3K B;  3C1C A;  1A7W A;  3MGP A;  3REL D;  3UTB B;  2JE5 A;  3A6N A;  2Y2H A;  4JJN A;  3AZJ C;  2BYM B;  5AVC D;  5AV5 A;  4J8U A;  3AZM D;  2F8N H;  4LD9 C;  2J8P A;  3AFA D;  3AZE B;  1P3F C;  2L5A A;  1P3A C;  4XZQ C;  4QLC A;  4CSR B;  5CP6 C;  1PZR A;  3AZL D;  5B33 D;  3AV2 D;  3X1U D;  3B0B A;  2NZD C;  5B24 B;  1R4V A;  3AZF D;  1M19 D;  3AYW C;  3REH C;  1P3L C;  1TAF B;  4WZS B;  3UTA D;  3MGS A;  4WJ3 C;  2RIQ A;  4AWL C;  5CPI A;  2F8N G;  5GT3 D;  3W96 D;  4KGC C;  1P3I D;  5B32 G;  3KXB C;  4XUJ A;  3KWQ C;  1M1A D;  1AOI B;  1HQ3 C;  4M6B A;  5BO0 B;  2ZY3 A;  3REL C;  5GSU B;  3UTB A;  3X1V B;  5AV9 B;  1P34 B;  3REI A;  3AZN D;  1F66 C;  5AVC C;  2BYM A;  3AZM C;  3MNN A;  3AFA C;  4CAY B;  3AZE A;  2F8N D;  3X1S A;  5B2J D;  3C1B D;  1P3P D;  2HIO B;  3MGR C;  4Z5T B;  4CSR A;  4Z2M G;  5B33 C;  3REK B;  3AZL C;  3AV2 C;  3LZ0 D;  3X1U C;  3KXB A;  4DQY B;  2CV5 D;  3A1I A;  1HQ3 A;  5B31 G;  3V9R B;  5B24 A;  3AZF C;  5C3I B;  1M19 C;  4UUZ A;  1P3O D;  4WU8 B;  1TZY B;  2Y2G A;  1HTA A;  3AZM A;  1N1J A;  3R45 B;  3WTP C;  3UTA C;  4Z66 B;  2ZM5 A;  1TAF A;  1KX5 D;  3B6F D;  3W96 C;  5GT3 C;  4YS3 C;  3B6G B;  5GT0 A;  1P3I C;  1ID3 B;  4ZUX B;  3REJ B;  3X1T D;  3UT9 C;  2IO5 B;  3VH6 W;  5BS7 A;  3AZG B;  1M1A C;  4H9R B;  5CPJ D;  4YM6 D;  1AOI A;  3X1U A;  1ZLA D;  1KX4 B;  2FJ7 A;  5BO0 A;  5DNN B;  2ARO D;  5E5A B;  3EPH A;  5GSU A;  3B0D C;  3MVD D;  3AZN C;  1EQZ B;  5B1L B;  3AZF A;  5B0Y B;  3AZK B;  4KHA A;  4HGA C;  3LEL D;  3FDD A;  3WAA D;  5JRG D;  3W99 B;  5B2J C;  3C1B C;  3LZ1 D;  1P3P C;  5GT3 A;  2UWX A;  3H0L C;  1P3M B;  4G91 C;  4Z5T A;  3LZ0 C;  4J8W D;  3REK A;  1U35 D;  5GXQ B;  5CPK B;  2CV5 C;  3C1C B;  5AV6 D;  4JJN B;  1P3O C;  3AZN A;  5AV5 B;  5AY8 B;  4WU8 A;  1TZY A;  5B40 A;  5G49 A;  1KX5 C;  3B6F C;  3B0C T;  5F99 B;  3P5J B;  3VH6 T;  4WU9 D;  3X1T C;  1P3G C;  4ZUX A;  3KUY A;  1ID3 A;  3MVD A;  5B2I D;  1S32 D;  5CPJ C;  4YM6 C;  3LZ0 A;  1ZLA C;  5B31 C;  2ARO C;  2NZD D;  3MVD C;  1EQZ A;  2VQR A;  5B1L A;  4EO5 C;  3WAA C;  3LEL C;  4KUD D;  5JRG C;  1WWS A;  3AZK A;  3AN2 D;  2XD1 A;  3LZ1 C;  1P3A B;  3AV1 D;  4KGC D;  4XZQ B;  1P3M A;  2G5I C;  5CP6 B;  1U35 C;  5DNM D;  4H9S C;  5AV6 C;  4DRB A;  2Y2O A;  4J8V D;  5AVB D;  3AL0 C;  3REI B;  3MNN B;  1F66 D;  5AY8 A;  3MGQ C;  3AYW B;  1BH8 A;  3X1S B;  1T3U A;  5F99 A;  3AZI D;  1KU5 A;  4WU9 C;  3MGR D;  2BYK A;  2HUE B;  5B2I C;  2YFW A;  4X23 D;  3KXB B;  4J8W A;  4J8X A;  1U35 A;  1S32 C;  1HQ3 B;  5AV6 A;  3REL B;  3AZH D;  3NQU B;  4UUZ B;  4WV4 B;  3AZJ A;  4KUD C;  3VH5 T;  3AZM B;  3AN2 C;  3AFA B;  3WKJ C;  3WA9 D;  1N1J B;  4LD9 A;  4Z2M H;  2NQB D;  3WTP D;  1P3F A;  3EPK A;  5GT0 B;  3AV1 C;  4YS3 D;  1P3A A;  3W97 D;  2LY8 A;  1P3B D;  4XZQ A;  5DNM C;  3AZL B;  5B33 B;  5CP6 A;  3UT9 D;  5B2I A;  3X1U B;  2FJ7 B;  5BNX A;  4WNN B;  4J8V C;  5AVB C;  2NZD A;  3LJA D;  3AZF B;  1M19 B;  4KHA B;  3X1V D;  1P34 D;  2PYO D;  2Y2L A;  3WTP E;  3UTA B;  3AYW A;  3REH A;  1P3L A;  3AZI C;  5GT3 B;  5B32 D;  4KGC A;  1P3I B;  4X23 C;  1M1A B;  2F2A C;  3KFU G;  3KWQ A;  4H9N A;  1Z2C B;  5JA4 B;  3REL A;  5CHL B;  1M18 D;  2W8S A;  4J8V A;  5AVB A;  3B0D B;  3AZH C;  3AZN B;  3NQU A;  1F66 A;  2JCH A;  5AVC A;  3WA9 C;  3AFA A;  5B40 B;  5G49 B;  2NQB C;  3O62 D;  2F8N B;  5B2J B;  3W97 C;  3TU4 D;  4E45 A;  1P3P B;  1JFI B;  1P3B C;  5AV8 D;  3KUY B;  1P3G D;  3MGR A;  3AZL A;  5B33 A;  3LZ0 B;  3AV2 A;  2CV5 B;  5B31 D;  4WNN A;  4E44 A;  3W98 D;  3LJA C;  3AZH A;  1P3O B;  3X1V C;  5AV9 C;  1P34 C;  1M19 A;  2PYO C;  2Y2Q A;  5B0Y D;  3UTA A;  1KX5 B;  3WTP A;  1KX3 D;  5BT1 D;  5B32 C;  3W96 A;  4YS3 A;  1P3I A;  1P3B A;  3UT9 A;  1M1A A;  4YM6 B;  2FFF B;  1M18 C;  5GXQ D;  3VH6 A;  5JA4 A;  1H3O B;  4R8P D;  3C1C D;  3MVD B;  3MGP D;  3A6N D;  1BH9 B;  3LEL B;  3WAA B;  5B0Z D;  5AV5 D;  3MGQ D;  4J8U D;  1BH8 B;  2RVQ C;  5KDM A;  3O62 C;  1B67 A;  2F8N A;  3TU4 C;  5B2J A;  3C1B A;  1P3P A;  5AV8 C;  3A1K A;  5B32 A;  1JFI A;  2BYK B;  2YFW B;  4J8W B;  4J8X B;  4QLC D;  1U35 B;  3REJ C;  2G5H C;  2IO5 C;  3AZG C;  2CV5 A;  5AV6 B;  3H0M C;  3W98 C;  1M18 A;  5DNN C;  5E5A C;  3AZJ B;  1P3O A;  2Y2J A;  4LD9 B;  5B0Y C;  3WKJ D;  4NE6 A;  1P3F B;  3O62 A;  1KX3 C;  5BT1 C;  1KX5 A;  4NFT A;  3B6F A;  3KSY A;  3MGS D;  5B1M D;  4WU9 B;  5CPI D;  5AV8 A;  3X1T A;  1P3G A;  5B2I B;  1S32 B;  5BNX B;  5CPJ A;  4YM6 A;  4XUJ D;  1ZLA A;  5B31 A;  5GXQ C;  2NZD B;  2ARO A;  4R8P C;  3C1C C;  3MGP C;  1H3O A;  1P3K D;  3NQJ B;  3A6N C;  2Y2N A; 
#chains in the Genus database with same CATH homology
 4H9O A;  5BNV A;  3UTB D;  4KUD B;  1BH9 A;  2BG1 A;  5AV5 C;  2ZY2 A;  5B0Z C;  3LEL A;  4J8U C;  5JRG A;  3MNN D;  3WAA A;  4UPK A;  4ZBJ C;  3REH B;  1P3L B;  3LZ1 A;  3AZE D;  4AWL B;  1KX3 A;  3X1S D;  3VH5 A;  3AV1 B;  4KGC B;  4QLC C;  5DNM B;  3KWQ B;  4H9N B;  4G92 C;  3EG5 B;  4H9S A;  3EPL A;  4H9Q B;  4J8V B;  5AVB B;  4R8P A;  2Y2M A;  5B24 D;  5AVC B;  1F66 B;  5B0Z A;  3MGQ A;  3MGS C;  5B1M C;  2Y2K A;  5CPI C;  3AZI B;  4WU9 A;  5GT0 D;  3MGR B;  3AV2 B;  4X23 B;  1BFM A;  1S32 A;  5FUG A;  4XUJ C;  3EPJ A;  1AOI D;  1P3K C;  2FJ7 D;  3UTB C;  3NQJ A;  3AZH B;  5GSU D;  3REI C;  5AV9 D;  4KUD A;  3MNN C;  3AN2 A;  2ZY5 A;  3WA9 B;  4NE3 A;  3WKJ A;  2NQB B;  3WTP B;  3AZE C;  3F6T A;  2ZY4 A;  3X1S C;  3W97 B;  4YS3 B;  3W96 B;  3AV1 A;  5B1M A;  1P3B B;  3UT9 B;  5DNM A;  2HIO D;  2YFV B;  4Z5T D;  2HUE C;  4H9P A;  3REK D;  4H9Q A;  1P3K A;  3LJA B;  2Y2P A;  5B24 C;  1B6W A;  4HGA B;  2F8N K;  2PYO B;  5KDM B;  4WU8 D;  1TZY D;  2RVQ D;  3C1B B;  5B40 D;  4Z66 D;  1W2E A;  5B32 B;  3AZI A;  5GT0 C;  3B6G D;  4G91 B;  4X23 A;  4ZUX D;  3KUY D;  5BS7 C;  3REJ D;  1ID3 D;  3AZG D;  2XD5 A;  1AOI C;  1M18 B;  2FJ7 C;  1KX4 D;  5DNN D;  5GSU C;  5E5A D;  1EQZ D;  5B1L D;  3WA9 A;  3AZK D;  3O62 B;  2NQB A;  3B6F B;  3TU4 B;  3W97 A;  3W99 D;  5AV8 B;  3X1T B;  1P3G B;  2HIO C;  1P3M D;  4Z5T C;  3B0C W;  5CPJ B;  2YFV A;  3REK C;  1ZLA B;  5B31 B;  2ARO B;  5CPK D;  2JSS A;  2Y2I A;  3W98 B;  4H9O B;  5BNV B;  3LJA A;  4JJN D;  5C3I C;  4EO5 B;  3X1V A;  5AV9 A;  1P34 A;  5JRG B;  5AY8 D;  4WU8 C;  1TZY C;  2PYO A;  1ULY A;  3LZ1 B;  5B40 C;  1KX3 B;  4CAY A;  4Z66 C;  3B6G C;  5F99 D;  1ID3 C;  4ZUX C;  3KUY C;  2HIO A;  4J8X D;  4DRA A;  4NE5 A;  1KX4 C;  4R8P B;  2CWE A;  3MGP B;  3A6N B;  1EQZ C;  3V9R A;  5B1L C;  5B0Z B;  3MGQ B;  3AZJ D;  4J8U B;  3AZK C;  4ZBJ B;  4LD9 D;  3W99 C;  3TU4 A;  1WWI A;  3R45 A;  1P3F D;  4Z66 A;  1P3A D;  2DF4 C;  1Q9C A;  3B6G A;  4QLC B;  1P3M C;  5FUG B;  4XZQ D;  3REJ A;  5CP6 D;  4G92 B;  5CPK C;  3AZG A;  4H9R A;  1KX4 A;  3W98 A;  5DNN A;  4JJN C;  5E5A A;  3REI D;  2DQN C;  3AN2 B;  5AY8 C;  3WKJ B;  3H0R C;  5B0Y A;  3IP4 C;  1F1E A;  3VH5 W;  3AYW D;  3MGS B;  3REH D;  1P3L D;  3W99 A;  5B1M B;  5F99 C;  5CPI B;  4H9P B;  4J8X C;  4J8W C;  4XUJ B;  3KXB D;  3KWQ D;  5GXQ A;  5CPK A;  1HQ3 D;  1P3K B;  3C1C A;  1A7W A;  3MGP A;  3REL D;  3UTB B;  2JE5 A;  3A6N A;  2Y2H A;  4JJN A;  3AZJ C;  2BYM B;  5AVC D;  5AV5 A;  4J8U A;  3AZM D;  2F8N H;  4LD9 C;  2J8P A;  3AFA D;  3AZE B;  1P3F C;  2L5A A;  1P3A C;  4XZQ C;  4QLC A;  4CSR B;  5CP6 C;  1PZR A;  3AZL D;  5B33 D;  3AV2 D;  3X1U D;  3B0B A;  2NZD C;  5B24 B;  1R4V A;  3AZF D;  1M19 D;  3AYW C;  3REH C;  1P3L C;  1TAF B;  4WZS B;  3UTA D;  3MGS A;  4WJ3 C;  2RIQ A;  4AWL C;  5CPI A;  2F8N G;  5GT3 D;  3W96 D;  4KGC C;  1P3I D;  5B32 G;  3KXB C;  4XUJ A;  3KWQ C;  1M1A D;  1AOI B;  1HQ3 C;  4M6B A;  5BO0 B;  2ZY3 A;  3REL C;  5GSU B;  3UTB A;  3X1V B;  5AV9 B;  1P34 B;  3REI A;  3AZN D;  1F66 C;  5AVC C;  2BYM A;  3AZM C;  3MNN A;  3AFA C;  4CAY B;  3AZE A;  2F8N D;  3X1S A;  5B2J D;  3C1B D;  1P3P D;  2HIO B;  3MGR C;  4Z5T B;  4CSR A;  4Z2M G;  5B33 C;  3REK B;  3AZL C;  3AV2 C;  3LZ0 D;  3X1U C;  3KXB A;  4DQY B;  2CV5 D;  3A1I A;  1HQ3 A;  5B31 G;  3V9R B;  5B24 A;  3AZF C;  5C3I B;  1M19 C;  4UUZ A;  1P3O D;  4WU8 B;  1TZY B;  2Y2G A;  1HTA A;  3AZM A;  1N1J A;  3R45 B;  3WTP C;  3UTA C;  4Z66 B;  2ZM5 A;  1TAF A;  1KX5 D;  3B6F D;  3W96 C;  5GT3 C;  4YS3 C;  3B6G B;  5GT0 A;  1P3I C;  1ID3 B;  4ZUX B;  3REJ B;  3X1T D;  3UT9 C;  2IO5 B;  3VH6 W;  5BS7 A;  3AZG B;  1M1A C;  4H9R B;  5CPJ D;  4YM6 D;  1AOI A;  3X1U A;  1ZLA D;  1KX4 B;  2FJ7 A;  5BO0 A;  5DNN B;  2ARO D;  5E5A B;  3EPH A;  5GSU A;  3B0D C;  3MVD D;  3AZN C;  1EQZ B;  5B1L B;  3AZF A;  5B0Y B;  3AZK B;  4KHA A;  4HGA C;  3LEL D;  3FDD A;  3WAA D;  5JRG D;  3W99 B;  5B2J C;  3C1B C;  3LZ1 D;  1P3P C;  5GT3 A;  2UWX A;  3H0L C;  1P3M B;  4G91 C;  4Z5T A;  3LZ0 C;  4J8W D;  3REK A;  1U35 D;  5GXQ B;  5CPK B;  2CV5 C;  3C1C B;  5AV6 D;  4JJN B;  1P3O C;  3AZN A;  5AV5 B;  5AY8 B;  4WU8 A;  1TZY A;  5B40 A;  5G49 A;  1KX5 C;  3B6F C;  3B0C T;  5F99 B;  3P5J B;  3VH6 T;  4WU9 D;  3X1T C;  1P3G C;  4ZUX A;  3KUY A;  1ID3 A;  3MVD A;  5B2I D;  1S32 D;  5CPJ C;  4YM6 C;  3LZ0 A;  1ZLA C;  5B31 C;  2ARO C;  2NZD D;  3MVD C;  1EQZ A;  2VQR A;  5B1L A;  4EO5 C;  3WAA C;  3LEL C;  4KUD D;  5JRG C;  1WWS A;  3AZK A;  3AN2 D;  2XD1 A;  3LZ1 C;  1P3A B;  3AV1 D;  4KGC D;  4XZQ B;  1P3M A;  2G5I C;  5CP6 B;  1U35 C;  5DNM D;  4H9S C;  5AV6 C;  4DRB A;  2Y2O A;  4J8V D;  5AVB D;  3AL0 C;  3REI B;  3MNN B;  1F66 D;  5AY8 A;  3MGQ C;  3AYW B;  1BH8 A;  3X1S B;  1T3U A;  5F99 A;  3AZI D;  1KU5 A;  4WU9 C;  3MGR D;  2BYK A;  2HUE B;  5B2I C;  2YFW A;  4X23 D;  3KXB B;  4J8W A;  4J8X A;  1U35 A;  1S32 C;  1HQ3 B;  5AV6 A;  3REL B;  3AZH D;  3NQU B;  4UUZ B;  4WV4 B;  3AZJ A;  4KUD C;  3VH5 T;  3AZM B;  3AN2 C;  3AFA B;  3WKJ C;  3WA9 D;  1N1J B;  4LD9 A;  4Z2M H;  2NQB D;  3WTP D;  1P3F A;  3EPK A;  5GT0 B;  3AV1 C;  4YS3 D;  1P3A A;  3W97 D;  2LY8 A;  1P3B D;  4XZQ A;  5DNM C;  3AZL B;  5B33 B;  5CP6 A;  3UT9 D;  5B2I A;  3X1U B;  2FJ7 B;  5BNX A;  4WNN B;  4J8V C;  5AVB C;  2NZD A;  3LJA D;  3AZF B;  1M19 B;  4KHA B;  3X1V D;  1P34 D;  2PYO D;  2Y2L A;  3WTP E;  3UTA B;  3AYW A;  3REH A;  1P3L A;  3AZI C;  5GT3 B;  5B32 D;  4KGC A;  1P3I B;  4X23 C;  1M1A B;  2F2A C;  3KFU G;  3KWQ A;  4H9N A;  1Z2C B;  5JA4 B;  3REL A;  5CHL B;  1M18 D;  2W8S A;  4J8V A;  5AVB A;  3B0D B;  3AZH C;  3AZN B;  3NQU A;  1F66 A;  2JCH A;  5AVC A;  3WA9 C;  3AFA A;  5B40 B;  5G49 B;  2NQB C;  3O62 D;  2F8N B;  5B2J B;  3W97 C;  3TU4 D;  4E45 A;  1P3P B;  1JFI B;  1P3B C;  5AV8 D;  3KUY B;  1P3G D;  3MGR A;  3AZL A;  5B33 A;  3LZ0 B;  3AV2 A;  2CV5 B;  5B31 D;  4WNN A;  4E44 A;  3W98 D;  3LJA C;  3AZH A;  1P3O B;  3X1V C;  5AV9 C;  1P34 C;  1M19 A;  2PYO C;  2Y2Q A;  5B0Y D;  3UTA A;  1KX5 B;  3WTP A;  1KX3 D;  5BT1 D;  5B32 C;  3W96 A;  4YS3 A;  1P3I A;  1P3B A;  3UT9 A;  1M1A A;  4YM6 B;  2FFF B;  1M18 C;  5GXQ D;  3VH6 A;  5JA4 A;  1H3O B;  4R8P D;  3C1C D;  3MVD B;  3MGP D;  3A6N D;  1BH9 B;  3LEL B;  3WAA B;  5B0Z D;  5AV5 D;  3MGQ D;  4J8U D;  1BH8 B;  2RVQ C;  5KDM A;  3O62 C;  1B67 A;  2F8N A;  3TU4 C;  5B2J A;  3C1B A;  1P3P A;  5AV8 C;  3A1K A;  5B32 A;  1JFI A;  2BYK B;  2YFW B;  4J8W B;  4J8X B;  4QLC D;  1U35 B;  3REJ C;  2G5H C;  2IO5 C;  3AZG C;  2CV5 A;  5AV6 B;  3H0M C;  3W98 C;  1M18 A;  5DNN C;  5E5A C;  3AZJ B;  1P3O A;  2Y2J A;  4LD9 B;  5B0Y C;  3WKJ D;  4NE6 A;  1P3F B;  3O62 A;  1KX3 C;  5BT1 C;  1KX5 A;  4NFT A;  3B6F A;  3KSY A;  3MGS D;  5B1M D;  4WU9 B;  5CPI D;  5AV8 A;  3X1T A;  1P3G A;  5B2I B;  1S32 B;  5BNX B;  5CPJ A;  4YM6 A;  4XUJ D;  1ZLA A;  5B31 A;  5GXQ C;  2NZD B;  2ARO A;  4R8P C;  3C1C C;  3MGP C;  1H3O A;  1P3K D;  3NQJ B;  3A6N C;  2Y2N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...