5GXQC

The crystal structure of the nucleosome containing h3.6
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
108
structure length
108
Chain Sequence
RAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure and Characterization of Novel Human Histone H3 Variants, H3.6, H3.7, and H3.8
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
molecule keywords Histone H3.6
total genus 34
structure length 108
sequence length 108
chains with identical sequence G
ec nomenclature
pdb deposition date 2016-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5gxqC00
4UUZB 1HQ3A 5B0YC 2NQBC 4J8VD 4CAYA 5JA4B 5CP6A 2YFWB 2BYMA 3AYWA 3AN2D 3O62B 4H9PA 5E5AD 3WA9A 1P34D 1ULYA 3KWQA 5CPKA 5B40C 3AZEA 3WKJC 2FJ7C 5BNVB 5FUGA 1P3OD 5B31G 3WAAC 3B6FA 1TAFB 5BS7C 1EQZB 1HQ3C 5CPIA 3MNNC 5B33B 4KUDA 4H9SC 4NFTA 1KX3A 1P3PA 3B0CT 5B1LC 4KGCB 3AZGD 3R45B 3AFAA 3V9RA 4YM6D 4Z5TD 4KHAA 3UTBD 4NE3A 3MGRB 1P3ID 4E44A 3AZKB 4ZUXB 3X1TC 4CAYB 5E5AB 3AZKD 1M19B 1KX4D 5G49A 2YFWA 3WAAD 3O62A 4H9PB 3MVDA 3MGSB 3KWQB 5GSUB 3AZGA 3W98C 5JRGA 2HIOB 1P3KA 2JSSA 1KU5A 4ZBJC 4XZQD 5DNMD 5BT1C 4J8UA 3REHA 2IO5B 5KDMA 1M18A 4H9NA 1F1EA 1EQZA 3AZHB 1P3PD 3MGQD 3TU4C 2NQBD 1ZLAD 1S32C 1KX3B 3MGSC 3LZ0A 3R45A 3AFAB 4HGAB 3V9RB 3O62D 3LELA 3WTPA 3AZND 1F66D 1U35B 2FJ7B 4ZUXA 4H9OB 3WAAB 5E5AA 5AVBB 3WA9D 4CSRB 3AYWD 1AOID 5GT3B 1HQ3B 5AV9B 3MVDB 3MGSA 2NQBA 5DNND 3LZ0C 5CP6B 3MGPD 2HUEC 3AV2D 4KGCC 1ID3D 4R8PB 3AZMC 5KDMB 1M18B 3LZ1B 4H9NB 4R8PD 4H9RA 5B2JA 3AYWC 1ZLAB 3AZHA 3W97C 3WA9C 3AN2B 5GT3C 5BNVA 5FUGB 5AV9C 5B0ZA 4J8WB 1BFMA 3B6FB 5CPKC 4JJNA 3AZEC 1TAFA 4WU9D 2F8ND 1TZYD 4XUJB 4AWLC 3LZ0B 3MGSD 5C3IC 2FJ7A 2HIOC 1P3IA 3RELB 4H9OA 3WAAA 2IO5C 4XZQC 4CSRA 1ID3C 3MGPC 5GT3A 4X23D 3AZKA 5AV9A 5AV8D 4JJND 4JJNC 3REJB 2YFVB 5B0ZD 4WV4B 3X1SA 2NQBB 5B32A 5AV6D 1P3BA 5B2IB 4YS3A 3AFAC 3X1UB 3B6FD 3LZ1A 5B2ID 5DNMA 1P3OA 4H9RB 5B2JB 1ZLAA 2HIOA 5JRGB 1P3KB 4Z5TC 4J8UB 5BO0A 3AZGC 3KWQD 5B31B 3B0DB 1P3MA 3REHC 4XUJA 3X1VA 1EQZC 3X1UC 4WU9C 5AVCB 5B33C 5CPJA 5JRGC 1P3KC 3UTBA 1S32A 1P3IB 3LELB 3WTPB 3W97D 5AV6C 1P3OC 1M18C 5B31C 1U35A 3KXBC 2F8NH 3AN2C 1F66B 2AROA 3MGRC 2YFVA 4J8WD 3REJA 3AZNB 3B6GA 4EO5B 1P3MC 1BH9B 5B40D 4ZUXC 3UTAB 2L5AA 5B2JD 5AVCC 4J8XC 3X1VC 1N1JB 4G92C 4YS3B 3KUYD 3AZFC 3X1UA 1M19C 3AV2A 4J8UD 3WTPC 3C1BD 5DNMB 3VH5W 1P3OB 5C3IB 3KXBB 3UTBC 4R8PA 3AZHD 5GSUC 5B0YD 5B31A 4XZQB 1TZYC 4ZBJB 4DRAA 3AZMA 3AN2A 3AZJD 4Z66D 5B0ZB 4J8WA 4JJNB 2CWEA 4WNNB 5AVCA 3WTPD 5CPJB 3UTBB 5BT1D 3NQJA 2F8NB 4ZUXD 3LZ0D 1M1AD 5AV5C 1F66A 2AROB 3RELA 3AZLC 3AZNA 1P3GC 3B6GB 3W98D 1BH9A 5B31D 1AOIC 5F99A 5AVBC 5GT0D 1ID3A 2F8NG 3AV2B 3MGPA 5B33D 3X1SB 3AZKC 5B32B 1P3BB 5B2IA 3C1CC 2LY8A 3MVDD 1P3IC 1P3GB 4XZQA 3REHD 3AZMB 5CPJD 3LZ1C 5BO0B 4J8VA 3LJAC 1KX5D 3X1VD 4EO5C 1P3MB 4WNNA 1U35D 3B6FC 2BYKB 4WU8B 1P3BC 4YS3C 3X1VB 2CV5D 3KXBD 1P34C 4H9SA 1S32B 1KX3C 3WKJD 4HGAC 5B32D 5AV6A 3X1SD 1P3BD 1ID3B 4J8VC 5B1MC 1U35C 4KUDD 4DRBA 3MGPB 3VH6T 3UTAA 3NQUA 5AV8A 4YM6C 1N1JA 3LZ1D 3LJAD 5CPJC 1KX5C 4J8XA 1BH8A 4Z2MH 3AZFA 3KXBA 3UT9A 3MVDC 3AV1C 2NZDD 3W96D 3AZJA 5GXQD 1HQ3D 4R8PC 4J8UC 1AOIB 4QLCA 2BYKA 3AZIA 1TZYA 3B0BA 5AY8A 3AV2C 4H9QA 4X23C 4J8WC 4E45A 3C1CB 1P3GD 3NQJB 2F8NA 1M18D 1P3AD 5AV6B 4G91C 1M1AB 3LJAB 5AV5A 1F66C 3X1UD 3AZNC 3AZLA 3W96C 5F99B 5B40A 4QLCD 3AZID 4WU8C 4WU8D 5AY8C 3VH5A 4Z66C 4LD9A 4J8XB 1BH8B 3AZFB 2F8NK 5BS7A 5CPIC 1P3GA 3AZJB 3MNNA 5B2IC 1AOIA 4Z2MG 3C1BC 3W99D 5B2JC 5AVCD 4M6BA 1B6WA 4J8VB 4KGCD 3VH6W 4Z66B 4Z5TB 5B0ZC 3MGRD 4WU8A 4YM6B 1P3MD 3C1CA 3B0DC 4XUJD 3WTPE 4LD9C 3REIC 1JFIA 1P3LD 3UTAD 5JRGD 1P3KD 5GT0A 5F99D 3O62C 1P34A 3LJAA 1P3FC 3VH5T 1EQZD 1S32D 3WKJB 3W98A 5CP6D 3W99A 4LD9B 3NQUB 3REJD 5B1MA 5AV8B 5B24A 3TU4D 3X1SC 3UTAC 5B32C 3MNNB 4G92B 1KX5A 3REID 3AFAD 3UT9B 5B1LB 5DNMC 5GT0C 1KX3D 4Z5TA 2PYOB 4QLCB 3AZIB 5GXQB 5AV8C 4YM6A 2NZDB 4YS3D 1TZYB 3W99C 5AY8B 4H9QB 4NE5A 3X1TB 1JFIB 5DNNA 5BNXA 2HIOD 3X1TD 1P3AA 5B0YB 1H3OB 5GT0B 3B0CW 3A6ND 4QLCC 1Q9CA 3AZIC 3W99B 1M1AA 5AV5B 5CPKD 2AROC 3AZLB 3B6GC 5B40B 3MNND 3W97A 3AZHC 3W96A 3REIB 3UT9D 1KX5B 5DNNC 2FJ7D 3KUYC 3AZFD 4J8XD 2PYOA 3A6NA 5GXQA 2NZDA 4Z66A 3C1BA 5DNNB 3MGQB 5BNXB 3VH6A 5B0YA 1P3AB 3AV1D 4X23B 4UUZA 1KX4A 1WWSA 1A7WA 1R4VA 5CP6C 1P3LB 5B1LD 1P34B 5JA4A 3A6NC 2RVQD 4G91B 2PYOD 3KWQC 2BYMB 3MGQC 3AYWB 1M19D 1ZLAC 3W98B 3WKJA 3WA9B 1P3FA 5B1MD 4KUDC 1P3PC 5F99C 3REIA 3W96B 3AZEB 5CHLB 5B1MB 4LD9D 5B24B 4XUJC 4AWLB 1P3LC 3TU4B 1KX4C 3A6NB 4WU9A 5B1LA 5B33A 4KUDB 1P3PB 3REKB 3AV1B 3MGQA 5B24C 5CPID 3REKD 2RVQC 4KHAB 4NE6A 3X1TA 3MGRA 3REJC 1B67A 1KX4B 2CV5A 5AY8D 1P3LA 1H3OA 3KUYB 5B32G 1M19A 1P3FD 3REKC 5G49B 5AVBD 3KSYA 5B24D 2HUEB 1P3FB 5GSUA 3AZGB 1WWIA 3REHB 1M1AC 3W97B 3AZMD 3AZLD 1P3AC 5AV5D 3TU4A 5CPKB 4WU9B 2CV5C 5E5AC 3LELC 3UT9C 1HTAA 5CPIB 3REKA 3AV1A 3AZJC 2PYOC 2AROD 3B6GD 5GXQC 3RELC 3C1BB 4WZSB 3RELD 2NZDC 4KGCA 5GSUD 3AZED 2CV5B 5AV9D 3KUYA 5GT3D 4X23A 5AVBA 3C1CD 3LELD
chains in the Genus database with same CATH superfamily
4UUZB 1HQ3A 5B0YC 2NQBC 4J8VD 3EPKA 4CAYA 5JA4B 2Y2IA 5CP6A 2YFWB 2BYMA 3AYWA 3AN2D 3O62B 4H9PA 5E5AD 3WA9A 1P34D 1ULYA 3KWQA 5CPKA 2ZM5A 5B40C 3AZEA 3WKJC 2FJ7C 5BNVB 5FUGA 1P3OD 5B31G 3WAAC 3B6FA 1TAFB 2ZY3A 5BS7C 1EQZB 1HQ3C 5CPIA 3KFUG 3MNNC 5B33B 4KUDA 4H9SC 4NFTA 1KX3A 1P3PA 3B0CT 5B1LC 3A1KA 3AZGD 4KGCB 3R45B 3AFAA 3V9RA 4YM6D 4Z5TD 4KHAA 3UTBD 4NE3A 3H0RC 3MGRB 1P3ID 4E44A 3AZKB 4ZUXB 3X1TC 4CAYB 5E5AB 3AZKD 1M19B 1KX4D 5G49A 2YFWA 3WAAD 3O62A 4H9PB 3FDDA 2Y2OA 3MVDA 3MGSB 3KWQB 5GSUB 3AZGA 3W98C 2HIOB 5JRGA 1P3KA 2JSSA 1KU5A 4ZBJC 4XZQD 5DNMD 5BT1C 4J8UA 3REHA 2IO5B 5KDMA 1M18A 1F1EA 4H9NA 1EQZA 3AZHB 1P3PD 3MGQD 3TU4C 2NQBD 1ZLAD 1S32C 1KX3B 3MGSC 3LZ0A 3R45A 3AFAB 4HGAB 3V9RB 3O62D 3LELA 3WTPA 3AZND 1F66D 1U35B 2FJ7B 4ZUXA 2F2AC 4H9OB 3WAAB 5E5AA 5AVBB 3WA9D 4CSRB 3AYWD 2Y2PA 1AOID 5GT3B 1HQ3B 2VQRA 5AV9B 3EPLA 2FFFB 3MVDB 3MGSA 2NQBA 2XD1A 5DNND 3LZ0C 5CP6B 3MGPD 2HUEC 3AV2D 4KGCC 1ID3D 4R8PB 3AZMC 5KDMB 1M18B 3LZ1B 4H9NB 4R8PD 4H9RA 5B2JA 3AYWC 1ZLAB 3AZHA 3W97C 3WA9C 3AN2B 5GT3C 5BNVA 5FUGB 5AV9C 5B0ZA 4J8WB 1BFMA 3B6FB 5CPKC 4JJNA 3AZEC 1TAFA 4WU9D 2F8ND 1TZYD 4XUJB 4AWLC 3LZ0B 3P5JB 3MGSD 5C3IC 2FJ7A 1Z2CB 2G5HC 2HIOC 1P3IA 3RELB 4H9OA 3WAAA 2IO5C 4XZQC 4CSRA 1ID3C 3MGPC 5GT3A 4X23D 3AZKA 5AV9A 2ZY4A 5AV8D 4JJND 4JJNC 3REJB 2YFVB 5B0ZD 4WV4B 3X1SA 2NQBB 5B32A 5AV6D 1P3BA 5B2IB 4YS3A 3AFAC 3X1UB 3B6FD 3LZ1A 5B2ID 5DNMA 1P3OA 4H9RB 5B2JB 1ZLAA 2HIOA 5JRGB 1P3KB 4Z5TC 4J8UB 5BO0A 3AZGC 3KWQD 5B31B 3B0DB 1P3MA 3REHC 4XUJA 2RIQA 3X1VA 2Y2MA 1EQZC 3X1UC 4WU9C 5AVCB 5B33C 5CPJA 5JRGC 1P3KC 3UTBA 1S32A 1P3IB 4WJ3C 3LELB 3WTPB 3W97D 5AV6C 1P3OC 1M18C 5B31C 1U35A 3KXBC 2F8NH 3AN2C 1F66B 2AROA 3MGRC 2YFVA 4J8WD 3REJA 3AZNB 3B6GA 4EO5B 1P3MC 1BH9B 5B40D 4ZUXC 3UTAB 2L5AA 5B2JD 5AVCC 4J8XC 3X1VC 1N1JB 4G92C 4YS3B 3KUYD 3AZFC 3X1UA 1M19C 3AV2A 4J8UD 3WTPC 3C1BD 5DNMB 3VH5W 1P3OB 2Y2GA 3EG5B 5C3IB 3KXBB 3UTBC 4R8PA 3AZHD 5GSUC 5B0YD 5B31A 4XZQB 1TZYC 4ZBJB 4DRAA 3AZMA 3AN2A 3AZJD 4Z66D 2Y2HA 5B0ZB 4J8WA 3H0LC 4JJNB 2DF4C 2CWEA 4WNNB 5AVCA 3WTPD 5CPJB 3UTBB 5BT1D 3NQJA 2F8NB 2DQNC 4ZUXD 3LZ0D 1M1AD 4UPKA 5AV5C 1F66A 2AROB 3RELA 3AZLC 3AZNA 1P3GC 3B6GB 3W98D 1BH9A 5B31D 1AOIC 5F99A 5AVBC 5GT0D 1ID3A 2F8NG 3AV2B 3MGPA 5B33D 3X1SB 3AZKC 5B32B 1P3BB 5B2IA 3C1CC 2LY8A 3MVDD 1P3IC 1P3GB 4XZQA 3REHD 3AZMB 5CPJD 3LZ1C 5BO0B 4J8VA 3LJAC 1KX5D 3X1VD 4EO5C 1P3MB 4WNNA 1U35D 3B6FC 2BYKB 4WU8B 1P3BC 4YS3C 3X1VB 2CV5D 3KXBD 1P34C 4H9SA 1S32B 1KX3C 3WKJD 3H0MC 4HGAC 5B32D 5AV6A 3X1SD 1P3BD 1ID3B 4J8VC 5B1MC 3EPJA 1U35C 4KUDD 4DRBA 3MGPB 3VH6T 3UTAA 3NQUA 5AV8A 4YM6C 1N1JA 3LZ1D 3LJAD 5CPJC 1KX5C 3EPHA 4J8XA 1BH8A 4Z2MH 3AZFA 3KXBA 3UT9A 3MVDC 3AV1C 2NZDD 3W96D 3AZJA 5GXQD 1HQ3D 4R8PC 4J8UC 1AOIB 4QLCA 2BYKA 3AZIA 2UWXA 1TZYA 3B0BA 5AY8A 3AV2C 4H9QA 4X23C 4J8WC 4E45A 3C1CB 1P3GD 3NQJB 2F8NA 2Y2LA 1M18D 1P3AD 5AV6B 4G91C 1M1AB 2JE5A 3LJAB 5AV5A 1F66C 3X1UD 3AZNC 3AZLA 3W96C 5F99B 5B40A 4QLCD 3AZID 4WU8C 4WU8D 5AY8C 3VH5A 4Z66C 4LD9A 4J8XB 1BH8B 3AZFB 2F8NK 5BS7A 5CPIC 1P3GA 3AZJB 3MNNA 5B2IC 2Y2KA 1AOIA 4Z2MG 3C1BC 2W8SA 3W99D 5B2JC 5AVCD 4M6BA 1B6WA 4J8VB 4KGCD 3VH6W 4Z66B 4Z5TB 5B0ZC 3MGRD 4WU8A 4YM6B 1P3MD 3C1CA 3B0DC 4XUJD 3WTPE 4LD9C 3F6TA 3REIC 1JFIA 1P3LD 3UTAD 5JRGD 1P3KD 5GT0A 5F99D 3O62C 1P34A 2Y2QA 3LJAA 1P3FC 3VH5T 1EQZD 1S32D 3WKJB 3W98A 5CP6D 3AL0C 3W99A 4LD9B 3NQUB 3REJD 5B1MA 5AV8B 5B24A 3TU4D 3X1SC 3UTAC 5B32C 3MNNB 4G92B 1KX5A 3REID 3AFAD 3UT9B 5B1LB 5DNMC 5GT0C 1KX3D 4Z5TA 1W2EA 2PYOB 4QLCB 3AZIB 5GXQB 5AV8C 4YM6A 2NZDB 4YS3D 1TZYB 3W99C 5AY8B 4H9QB 4NE5A 3X1TB 2XD5A 1JFIB 5DNNA 5BNXA 2HIOD 3X1TD 1P3AA 1PZRA 1H3OB 5B0YB 5GT0B 3B0CW 3A6ND 4QLCC 1Q9CA 3AZIC 3W99B 1M1AA 5AV5B 5CPKD 2AROC 3AZLB 3B6GC 5B40B 3MNND 3W97A 3AZHC 3W96A 3REIB 3UT9D 1KX5B 5DNNC 2FJ7D 3KUYC 3AZFD 4J8XD 2PYOA 2Y2NA 3A6NA 5GXQA 2NZDA 4Z66A 3C1BA 5DNNB 3MGQB 5BNXB 2Y2JA 3VH6A 5B0YA 1P3AB 3AV1D 4X23B 4UUZA 1KX4A 1WWSA 1A7WA 1R4VA 5CP6C 1P3LB 5B1LD 1P34B 5JA4A 3A6NC 2RVQD 4G91B 2PYOD 3KWQC 3A1IA 2BYMB 3MGQC 3AYWB 1M19D 1ZLAC 3W98B 3WKJA 4DQYB 1P3FA 5B1MD 3WA9B 4KUDC 1P3PC 5F99C 3REIA 2BG1A 3W96B 3AZEB 5CHLB 5B1MB 4LD9D 5B24B 4XUJC 4AWLB 1P3LC 3TU4B 1KX4C 3A6NB 4WU9A 5B1LA 5B33A 2J8PA 2ZY2A 4KUDB 1P3PB 3REKB 3AV1B 3MGQA 5B24C 3IP4C 5CPID 3REKD 2RVQC 4KHAB 4NE6A 3X1TA 3MGRA 3REJC 1B67A 1KX4B 2CV5A 5AY8D 1P3LA 1H3OA 3KUYB 5B32G 1M19A 1P3FD 3REKC 5G49B 5AVBD 2JCHA 3KSYA 5B24D 2HUEB 1P3FB 5GSUA 3AZGB 1WWIA 3REHB 1M1AC 3W97B 3AZMD 3AZLD 1P3AC 5AV5D 2ZY5A 3TU4A 5CPKB 2G5IC 4WU9B 2CV5C 5E5AC 1T3UA 3LELC 3UT9C 1HTAA 5CPIB 3REKA 3AV1A 3AZJC 2PYOC 2AROD 3B6GD 5GXQC 3RELC 3C1BB 4WZSB 3RELD 2NZDC 4KGCA 5GSUD 3AZED 2CV5B 5AV9D 3KUYA 5GT3D 4X23A 5AVBA 3C1CD 3LELD
chains in the Genus database with same CATH topology
4UUZB 1HQ3A 5B0YC 2NQBC 4J8VD 3EPKA 4CAYA 5JA4B 2Y2IA 5CP6A 2YFWB 2BYMA 3AYWA 3AN2D 3O62B 4H9PA 5E5AD 3WA9A 1P34D 1ULYA 3KWQA 5CPKA 2ZM5A 5B40C 3AZEA 3WKJC 2FJ7C 5BNVB 5FUGA 1P3OD 5B31G 3WAAC 3B6FA 1TAFB 2ZY3A 5BS7C 1EQZB 1HQ3C 5CPIA 3KFUG 3MNNC 5B33B 4KUDA 4H9SC 4NFTA 1KX3A 1P3PA 3B0CT 5B1LC 3A1KA 3AZGD 4KGCB 3R45B 3AFAA 3V9RA 4YM6D 4Z5TD 4KHAA 3UTBD 4NE3A 3H0RC 3MGRB 1P3ID 4E44A 3AZKB 4ZUXB 3X1TC 4CAYB 5E5AB 3AZKD 1M19B 1KX4D 5G49A 2YFWA 3WAAD 3O62A 4H9PB 3FDDA 2Y2OA 3MVDA 3MGSB 3KWQB 5GSUB 3AZGA 3W98C 2HIOB 5JRGA 1P3KA 2JSSA 1KU5A 4ZBJC 4XZQD 5DNMD 5BT1C 4J8UA 3REHA 2IO5B 5KDMA 1M18A 1F1EA 4H9NA 1EQZA 3AZHB 1P3PD 3MGQD 3TU4C 2NQBD 1ZLAD 1S32C 1KX3B 3MGSC 3LZ0A 3R45A 3AFAB 4HGAB 3V9RB 3O62D 3LELA 3WTPA 3AZND 1F66D 1U35B 2FJ7B 4ZUXA 2F2AC 4H9OB 3WAAB 5E5AA 5AVBB 3WA9D 4CSRB 3AYWD 2Y2PA 1AOID 5GT3B 1HQ3B 2VQRA 5AV9B 3EPLA 2FFFB 3MVDB 3MGSA 2NQBA 2XD1A 5DNND 3LZ0C 5CP6B 3MGPD 2HUEC 3AV2D 4KGCC 1ID3D 4R8PB 3AZMC 5KDMB 1M18B 3LZ1B 4H9NB 4R8PD 4H9RA 5B2JA 3AYWC 1ZLAB 3AZHA 3W97C 3WA9C 3AN2B 5GT3C 5BNVA 5FUGB 5AV9C 5B0ZA 4J8WB 1BFMA 3B6FB 5CPKC 4JJNA 3AZEC 1TAFA 4WU9D 2F8ND 1TZYD 4XUJB 4AWLC 3LZ0B 3P5JB 3MGSD 5C3IC 2FJ7A 1Z2CB 2G5HC 2HIOC 1P3IA 3RELB 4H9OA 3WAAA 2IO5C 4XZQC 4CSRA 1ID3C 3MGPC 5GT3A 4X23D 3AZKA 5AV9A 2ZY4A 5AV8D 4JJND 4JJNC 3REJB 2YFVB 5B0ZD 4WV4B 3X1SA 2NQBB 5B32A 5AV6D 1P3BA 5B2IB 4YS3A 3AFAC 3X1UB 3B6FD 3LZ1A 5B2ID 5DNMA 1P3OA 4H9RB 5B2JB 1ZLAA 2HIOA 5JRGB 1P3KB 4Z5TC 4J8UB 5BO0A 3AZGC 3KWQD 5B31B 3B0DB 1P3MA 3REHC 4XUJA 2RIQA 3X1VA 2Y2MA 1EQZC 3X1UC 4WU9C 5AVCB 5B33C 5CPJA 5JRGC 1P3KC 3UTBA 1S32A 1P3IB 4WJ3C 3LELB 3WTPB 3W97D 5AV6C 1P3OC 1M18C 5B31C 1U35A 3KXBC 2F8NH 3AN2C 1F66B 2AROA 3MGRC 2YFVA 4J8WD 3REJA 3AZNB 3B6GA 4EO5B 1P3MC 1BH9B 5B40D 4ZUXC 3UTAB 2L5AA 5B2JD 5AVCC 4J8XC 3X1VC 1N1JB 4G92C 4YS3B 3KUYD 3AZFC 3X1UA 1M19C 3AV2A 4J8UD 3WTPC 3C1BD 5DNMB 3VH5W 1P3OB 2Y2GA 3EG5B 5C3IB 3KXBB 3UTBC 4R8PA 3AZHD 5GSUC 5B0YD 5B31A 4XZQB 1TZYC 4ZBJB 4DRAA 3AZMA 3AN2A 3AZJD 4Z66D 2Y2HA 5B0ZB 4J8WA 3H0LC 4JJNB 2DF4C 2CWEA 4WNNB 5AVCA 3WTPD 5CPJB 3UTBB 5BT1D 3NQJA 2F8NB 2DQNC 4ZUXD 3LZ0D 1M1AD 4UPKA 5AV5C 1F66A 2AROB 3RELA 3AZLC 3AZNA 1P3GC 3B6GB 3W98D 1BH9A 5B31D 1AOIC 5F99A 5AVBC 5GT0D 1ID3A 2F8NG 3AV2B 3MGPA 5B33D 3X1SB 3AZKC 5B32B 1P3BB 5B2IA 3C1CC 2LY8A 3MVDD 1P3IC 1P3GB 4XZQA 3REHD 3AZMB 5CPJD 3LZ1C 5BO0B 4J8VA 3LJAC 1KX5D 3X1VD 4EO5C 1P3MB 4WNNA 1U35D 3B6FC 2BYKB 4WU8B 1P3BC 4YS3C 3X1VB 2CV5D 3KXBD 1P34C 4H9SA 1S32B 1KX3C 3WKJD 3H0MC 4HGAC 5B32D 5AV6A 3X1SD 1P3BD 1ID3B 4J8VC 5B1MC 3EPJA 1U35C 4KUDD 4DRBA 3MGPB 3VH6T 3UTAA 3NQUA 5AV8A 4YM6C 1N1JA 3LZ1D 3LJAD 5CPJC 1KX5C 3EPHA 4J8XA 1BH8A 4Z2MH 3AZFA 3KXBA 3UT9A 3MVDC 3AV1C 2NZDD 3W96D 3AZJA 5GXQD 1HQ3D 4R8PC 4J8UC 1AOIB 4QLCA 2BYKA 3AZIA 2UWXA 1TZYA 3B0BA 5AY8A 3AV2C 4H9QA 4X23C 4J8WC 4E45A 3C1CB 1P3GD 3NQJB 2F8NA 2Y2LA 1M18D 1P3AD 5AV6B 4G91C 1M1AB 2JE5A 3LJAB 5AV5A 1F66C 3X1UD 3AZNC 3AZLA 3W96C 5F99B 5B40A 4QLCD 3AZID 4WU8C 4WU8D 5AY8C 3VH5A 4Z66C 4LD9A 4J8XB 1BH8B 3AZFB 2F8NK 5BS7A 5CPIC 1P3GA 3AZJB 3MNNA 5B2IC 2Y2KA 1AOIA 4Z2MG 3C1BC 2W8SA 3W99D 5B2JC 5AVCD 4M6BA 1B6WA 4J8VB 4KGCD 3VH6W 4Z66B 4Z5TB 5B0ZC 3MGRD 4WU8A 4YM6B 1P3MD 3C1CA 3B0DC 4XUJD 3WTPE 4LD9C 3F6TA 3REIC 1JFIA 1P3LD 3UTAD 5JRGD 1P3KD 5GT0A 5F99D 3O62C 1P34A 2Y2QA 3LJAA 1P3FC 3VH5T 1EQZD 1S32D 3WKJB 3W98A 5CP6D 3AL0C 3W99A 4LD9B 3NQUB 3REJD 5B1MA 5AV8B 5B24A 3TU4D 3X1SC 3UTAC 5B32C 3MNNB 4G92B 1KX5A 3REID 3AFAD 3UT9B 5B1LB 5DNMC 5GT0C 1KX3D 4Z5TA 1W2EA 2PYOB 4QLCB 3AZIB 5GXQB 5AV8C 4YM6A 2NZDB 4YS3D 1TZYB 3W99C 5AY8B 4H9QB 4NE5A 3X1TB 2XD5A 1JFIB 5DNNA 5BNXA 2HIOD 3X1TD 1P3AA 1PZRA 1H3OB 5B0YB 5GT0B 3B0CW 3A6ND 4QLCC 1Q9CA 3AZIC 3W99B 1M1AA 5AV5B 5CPKD 2AROC 3AZLB 3B6GC 5B40B 3MNND 3W97A 3AZHC 3W96A 3REIB 3UT9D 1KX5B 5DNNC 2FJ7D 3KUYC 3AZFD 4J8XD 2PYOA 2Y2NA 3A6NA 5GXQA 2NZDA 4Z66A 3C1BA 5DNNB 3MGQB 5BNXB 2Y2JA 3VH6A 5B0YA 1P3AB 3AV1D 4X23B 4UUZA 1KX4A 1WWSA 1A7WA 1R4VA 5CP6C 1P3LB 5B1LD 1P34B 5JA4A 3A6NC 2RVQD 4G91B 2PYOD 3KWQC 3A1IA 2BYMB 3MGQC 3AYWB 1M19D 1ZLAC 3W98B 3WKJA 4DQYB 1P3FA 5B1MD 3WA9B 4KUDC 1P3PC 5F99C 3REIA 2BG1A 3W96B 3AZEB 5CHLB 5B1MB 4LD9D 5B24B 4XUJC 4AWLB 1P3LC 3TU4B 1KX4C 3A6NB 4WU9A 5B1LA 5B33A 2J8PA 2ZY2A 4KUDB 1P3PB 3REKB 3AV1B 3MGQA 5B24C 3IP4C 5CPID 3REKD 2RVQC 4KHAB 4NE6A 3X1TA 3MGRA 3REJC 1B67A 1KX4B 2CV5A 5AY8D 1P3LA 1H3OA 3KUYB 5B32G 1M19A 1P3FD 3REKC 5G49B 5AVBD 2JCHA 3KSYA 5B24D 2HUEB 1P3FB 5GSUA 3AZGB 1WWIA 3REHB 1M1AC 3W97B 3AZMD 3AZLD 1P3AC 5AV5D 2ZY5A 3TU4A 5CPKB 2G5IC 4WU9B 2CV5C 5E5AC 1T3UA 3LELC 3UT9C 1HTAA 5CPIB 3REKA 3AV1A 3AZJC 2PYOC 2AROD 3B6GD 5GXQC 3RELC 3C1BB 4WZSB 3RELD 2NZDC 4KGCA 5GSUD 3AZED 2CV5B 5AV9D 3KUYA 5GT3D 4X23A 5AVBA 3C1CD 3LELD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UUZ B;  1HQ3 A;  5B0Y C;  2NQB C;  4J8V D;  4CAY A;  5JA4 B;  5CP6 A;  2YFW B;  2BYM A;  3AYW A;  3AN2 D;  3O62 B;  4H9P A;  5E5A D;  3WA9 A;  1P34 D;  1ULY A;  3KWQ A;  5CPK A;  5B40 C;  3AZE A;  3WKJ C;  2FJ7 C;  5BNV B;  5FUG A;  1P3O D;  5B31 G;  3WAA C;  3B6F A;  1TAF B;  5BS7 C;  1EQZ B;  1HQ3 C;  5CPI A;  3MNN C;  5B33 B;  4KUD A;  4H9S C;  4NFT A;  1KX3 A;  1P3P A;  3B0C T;  5B1L C;  4KGC B;  3AZG D;  3R45 B;  3AFA A;  3V9R A;  4YM6 D;  4Z5T D;  4KHA A;  3UTB D;  4NE3 A;  3MGR B;  1P3I D;  4E44 A;  3AZK B;  4ZUX B;  3X1T C;  4CAY B;  5E5A B;  3AZK D;  1M19 B;  1KX4 D;  5G49 A;  2YFW A;  3WAA D;  3O62 A;  4H9P B;  3MVD A;  3MGS B;  3KWQ B;  5GSU B;  3AZG A;  3W98 C;  5JRG A;  2HIO B;  1P3K A;  2JSS A;  1KU5 A;  4ZBJ C;  4XZQ D;  5DNM D;  5BT1 C;  4J8U A;  3REH A;  2IO5 B;  5KDM A;  1M18 A;  4H9N A;  1F1E A;  1EQZ A;  3AZH B;  1P3P D;  3MGQ D;  3TU4 C;  2NQB D;  1ZLA D;  1S32 C;  1KX3 B;  3MGS C;  3LZ0 A;  3R45 A;  3AFA B;  4HGA B;  3V9R B;  3O62 D;  3LEL A;  3WTP A;  3AZN D;  1F66 D;  1U35 B;  2FJ7 B;  4ZUX A;  4H9O B;  3WAA B;  5E5A A;  5AVB B;  3WA9 D;  4CSR B;  3AYW D;  1AOI D;  5GT3 B;  1HQ3 B;  5AV9 B;  3MVD B;  3MGS A;  2NQB A;  5DNN D;  3LZ0 C;  5CP6 B;  3MGP D;  2HUE C;  3AV2 D;  4KGC C;  1ID3 D;  4R8P B;  3AZM C;  5KDM B;  1M18 B;  3LZ1 B;  4H9N B;  4R8P D;  4H9R A;  5B2J A;  3AYW C;  1ZLA B;  3AZH A;  3W97 C;  3WA9 C;  3AN2 B;  5GT3 C;  5BNV A;  5FUG B;  5AV9 C;  5B0Z A;  4J8W B;  1BFM A;  3B6F B;  5CPK C;  4JJN A;  3AZE C;  1TAF A;  4WU9 D;  2F8N D;  1TZY D;  4XUJ B;  4AWL C;  3LZ0 B;  3MGS D;  5C3I C;  2FJ7 A;  2HIO C;  1P3I A;  3REL B;  4H9O A;  3WAA A;  2IO5 C;  4XZQ C;  4CSR A;  1ID3 C;  3MGP C;  5GT3 A;  4X23 D;  3AZK A;  5AV9 A;  5AV8 D;  4JJN D;  4JJN C;  3REJ B;  2YFV B;  5B0Z D;  4WV4 B;  3X1S A;  2NQB B;  5B32 A;  5AV6 D;  1P3B A;  5B2I B;  4YS3 A;  3AFA C;  3X1U B;  3B6F D;  3LZ1 A;  5B2I D;  5DNM A;  1P3O A;  4H9R B;  5B2J B;  1ZLA A;  2HIO A;  5JRG B;  1P3K B;  4Z5T C;  4J8U B;  5BO0 A;  3AZG C;  3KWQ D;  5B31 B;  3B0D B;  1P3M A;  3REH C;  4XUJ A;  3X1V A;  1EQZ C;  3X1U C;  4WU9 C;  5AVC B;  5B33 C;  5CPJ A;  5JRG C;  1P3K C;  3UTB A;  1S32 A;  1P3I B;  3LEL B;  3WTP B;  3W97 D;  5AV6 C;  1P3O C;  1M18 C;  5B31 C;  1U35 A;  3KXB C;  2F8N H;  3AN2 C;  1F66 B;  2ARO A;  3MGR C;  2YFV A;  4J8W D;  3REJ A;  3AZN B;  3B6G A;  4EO5 B;  1P3M C;  1BH9 B;  5B40 D;  4ZUX C;  3UTA B;  2L5A A;  5B2J D;  5AVC C;  4J8X C;  3X1V C;  1N1J B;  4G92 C;  4YS3 B;  3KUY D;  3AZF C;  3X1U A;  1M19 C;  3AV2 A;  4J8U D;  3WTP C;  3C1B D;  5DNM B;  3VH5 W;  1P3O B;  5C3I B;  3KXB B;  3UTB C;  4R8P A;  3AZH D;  5GSU C;  5B0Y D;  5B31 A;  4XZQ B;  1TZY C;  4ZBJ B;  4DRA A;  3AZM A;  3AN2 A;  3AZJ D;  4Z66 D;  5B0Z B;  4J8W A;  4JJN B;  2CWE A;  4WNN B;  5AVC A;  3WTP D;  5CPJ B;  3UTB B;  5BT1 D;  3NQJ A;  2F8N B;  4ZUX D;  3LZ0 D;  1M1A D;  5AV5 C;  1F66 A;  2ARO B;  3REL A;  3AZL C;  3AZN A;  1P3G C;  3B6G B;  3W98 D;  1BH9 A;  5B31 D;  1AOI C;  5F99 A;  5AVB C;  5GT0 D;  1ID3 A;  2F8N G;  3AV2 B;  3MGP A;  5B33 D;  3X1S B;  3AZK C;  5B32 B;  1P3B B;  5B2I A;  3C1C C;  2LY8 A;  3MVD D;  1P3I C;  1P3G B;  4XZQ A;  3REH D;  3AZM B;  5CPJ D;  3LZ1 C;  5BO0 B;  4J8V A;  3LJA C;  1KX5 D;  3X1V D;  4EO5 C;  1P3M B;  4WNN A;  1U35 D;  3B6F C;  2BYK B;  4WU8 B;  1P3B C;  4YS3 C;  3X1V B;  2CV5 D;  3KXB D;  1P34 C;  4H9S A;  1S32 B;  1KX3 C;  3WKJ D;  4HGA C;  5B32 D;  5AV6 A;  3X1S D;  1P3B D;  1ID3 B;  4J8V C;  5B1M C;  1U35 C;  4KUD D;  4DRB A;  3MGP B;  3VH6 T;  3UTA A;  3NQU A;  5AV8 A;  4YM6 C;  1N1J A;  3LZ1 D;  3LJA D;  5CPJ C;  1KX5 C;  4J8X A;  1BH8 A;  4Z2M H;  3AZF A;  3KXB A;  3UT9 A;  3MVD C;  3AV1 C;  2NZD D;  3W96 D;  3AZJ A;  5GXQ D;  1HQ3 D;  4R8P C;  4J8U C;  1AOI B;  4QLC A;  2BYK A;  3AZI A;  1TZY A;  3B0B A;  5AY8 A;  3AV2 C;  4H9Q A;  4X23 C;  4J8W C;  4E45 A;  3C1C B;  1P3G D;  3NQJ B;  2F8N A;  1M18 D;  1P3A D;  5AV6 B;  4G91 C;  1M1A B;  3LJA B;  5AV5 A;  1F66 C;  3X1U D;  3AZN C;  3AZL A;  3W96 C;  5F99 B;  5B40 A;  4QLC D;  3AZI D;  4WU8 C;  4WU8 D;  5AY8 C;  3VH5 A;  4Z66 C;  4LD9 A;  4J8X B;  1BH8 B;  3AZF B;  2F8N K;  5BS7 A;  5CPI C;  1P3G A;  3AZJ B;  3MNN A;  5B2I C;  1AOI A;  4Z2M G;  3C1B C;  3W99 D;  5B2J C;  5AVC D;  4M6B A;  1B6W A;  4J8V B;  4KGC D;  3VH6 W;  4Z66 B;  4Z5T B;  5B0Z C;  3MGR D;  4WU8 A;  4YM6 B;  1P3M D;  3C1C A;  3B0D C;  4XUJ D;  3WTP E;  4LD9 C;  3REI C;  1JFI A;  1P3L D;  3UTA D;  5JRG D;  1P3K D;  5GT0 A;  5F99 D;  3O62 C;  1P34 A;  3LJA A;  1P3F C;  3VH5 T;  1EQZ D;  1S32 D;  3WKJ B;  3W98 A;  5CP6 D;  3W99 A;  4LD9 B;  3NQU B;  3REJ D;  5B1M A;  5AV8 B;  5B24 A;  3TU4 D;  3X1S C;  3UTA C;  5B32 C;  3MNN B;  4G92 B;  1KX5 A;  3REI D;  3AFA D;  3UT9 B;  5B1L B;  5DNM C;  5GT0 C;  1KX3 D;  4Z5T A;  2PYO B;  4QLC B;  3AZI B;  5GXQ B;  5AV8 C;  4YM6 A;  2NZD B;  4YS3 D;  1TZY B;  3W99 C;  5AY8 B;  4H9Q B;  4NE5 A;  3X1T B;  1JFI B;  5DNN A;  5BNX A;  2HIO D;  3X1T D;  1P3A A;  5B0Y B;  1H3O B;  5GT0 B;  3B0C W;  3A6N D;  4QLC C;  1Q9C A;  3AZI C;  3W99 B;  1M1A A;  5AV5 B;  5CPK D;  2ARO C;  3AZL B;  3B6G C;  5B40 B;  3MNN D;  3W97 A;  3AZH C;  3W96 A;  3REI B;  3UT9 D;  1KX5 B;  5DNN C;  2FJ7 D;  3KUY C;  3AZF D;  4J8X D;  2PYO A;  3A6N A;  5GXQ A;  2NZD A;  4Z66 A;  3C1B A;  5DNN B;  3MGQ B;  5BNX B;  3VH6 A;  5B0Y A;  1P3A B;  3AV1 D;  4X23 B;  4UUZ A;  1KX4 A;  1WWS A;  1A7W A;  1R4V A;  5CP6 C;  1P3L B;  5B1L D;  1P34 B;  5JA4 A;  3A6N C;  2RVQ D;  4G91 B;  2PYO D;  3KWQ C;  2BYM B;  3MGQ C;  3AYW B;  1M19 D;  1ZLA C;  3W98 B;  3WKJ A;  3WA9 B;  1P3F A;  5B1M D;  4KUD C;  1P3P C;  5F99 C;  3REI A;  3W96 B;  3AZE B;  5CHL B;  5B1M B;  4LD9 D;  5B24 B;  4XUJ C;  4AWL B;  1P3L C;  3TU4 B;  1KX4 C;  3A6N B;  4WU9 A;  5B1L A;  5B33 A;  4KUD B;  1P3P B;  3REK B;  3AV1 B;  3MGQ A;  5B24 C;  5CPI D;  3REK D;  2RVQ C;  4KHA B;  4NE6 A;  3X1T A;  3MGR A;  3REJ C;  1B67 A;  1KX4 B;  2CV5 A;  5AY8 D;  1P3L A;  1H3O A;  3KUY B;  5B32 G;  1M19 A;  1P3F D;  3REK C;  5G49 B;  5AVB D;  3KSY A;  5B24 D;  2HUE B;  1P3F B;  5GSU A;  3AZG B;  1WWI A;  3REH B;  1M1A C;  3W97 B;  3AZM D;  3AZL D;  1P3A C;  5AV5 D;  3TU4 A;  5CPK B;  4WU9 B;  2CV5 C;  5E5A C;  3LEL C;  3UT9 C;  1HTA A;  5CPI B;  3REK A;  3AV1 A;  3AZJ C;  2PYO C;  2ARO D;  3B6G D;  5GXQ C;  3REL C;  3C1B B;  4WZS B;  3REL D;  2NZD C;  4KGC A;  5GSU D;  3AZE D;  2CV5 B;  5AV9 D;  3KUY A;  5GT3 D;  4X23 A;  5AVB A;  3C1C D;  3LEL D; 
#chains in the Genus database with same CATH topology
 4UUZ B;  1HQ3 A;  5B0Y C;  2NQB C;  4J8V D;  3EPK A;  4CAY A;  5JA4 B;  2Y2I A;  5CP6 A;  2YFW B;  2BYM A;  3AYW A;  3AN2 D;  3O62 B;  4H9P A;  5E5A D;  3WA9 A;  1P34 D;  1ULY A;  3KWQ A;  5CPK A;  2ZM5 A;  5B40 C;  3AZE A;  3WKJ C;  2FJ7 C;  5BNV B;  5FUG A;  1P3O D;  5B31 G;  3WAA C;  3B6F A;  1TAF B;  2ZY3 A;  5BS7 C;  1EQZ B;  1HQ3 C;  5CPI A;  3KFU G;  3MNN C;  5B33 B;  4KUD A;  4H9S C;  4NFT A;  1KX3 A;  1P3P A;  3B0C T;  5B1L C;  3A1K A;  3AZG D;  4KGC B;  3R45 B;  3AFA A;  3V9R A;  4YM6 D;  4Z5T D;  4KHA A;  3UTB D;  4NE3 A;  3H0R C;  3MGR B;  1P3I D;  4E44 A;  3AZK B;  4ZUX B;  3X1T C;  4CAY B;  5E5A B;  3AZK D;  1M19 B;  1KX4 D;  5G49 A;  2YFW A;  3WAA D;  3O62 A;  4H9P B;  3FDD A;  2Y2O A;  3MVD A;  3MGS B;  3KWQ B;  5GSU B;  3AZG A;  3W98 C;  2HIO B;  5JRG A;  1P3K A;  2JSS A;  1KU5 A;  4ZBJ C;  4XZQ D;  5DNM D;  5BT1 C;  4J8U A;  3REH A;  2IO5 B;  5KDM A;  1M18 A;  1F1E A;  4H9N A;  1EQZ A;  3AZH B;  1P3P D;  3MGQ D;  3TU4 C;  2NQB D;  1ZLA D;  1S32 C;  1KX3 B;  3MGS C;  3LZ0 A;  3R45 A;  3AFA B;  4HGA B;  3V9R B;  3O62 D;  3LEL A;  3WTP A;  3AZN D;  1F66 D;  1U35 B;  2FJ7 B;  4ZUX A;  2F2A C;  4H9O B;  3WAA B;  5E5A A;  5AVB B;  3WA9 D;  4CSR B;  3AYW D;  2Y2P A;  1AOI D;  5GT3 B;  1HQ3 B;  2VQR A;  5AV9 B;  3EPL A;  2FFF B;  3MVD B;  3MGS A;  2NQB A;  2XD1 A;  5DNN D;  3LZ0 C;  5CP6 B;  3MGP D;  2HUE C;  3AV2 D;  4KGC C;  1ID3 D;  4R8P B;  3AZM C;  5KDM B;  1M18 B;  3LZ1 B;  4H9N B;  4R8P D;  4H9R A;  5B2J A;  3AYW C;  1ZLA B;  3AZH A;  3W97 C;  3WA9 C;  3AN2 B;  5GT3 C;  5BNV A;  5FUG B;  5AV9 C;  5B0Z A;  4J8W B;  1BFM A;  3B6F B;  5CPK C;  4JJN A;  3AZE C;  1TAF A;  4WU9 D;  2F8N D;  1TZY D;  4XUJ B;  4AWL C;  3LZ0 B;  3P5J B;  3MGS D;  5C3I C;  2FJ7 A;  1Z2C B;  2G5H C;  2HIO C;  1P3I A;  3REL B;  4H9O A;  3WAA A;  2IO5 C;  4XZQ C;  4CSR A;  1ID3 C;  3MGP C;  5GT3 A;  4X23 D;  3AZK A;  5AV9 A;  2ZY4 A;  5AV8 D;  4JJN D;  4JJN C;  3REJ B;  2YFV B;  5B0Z D;  4WV4 B;  3X1S A;  2NQB B;  5B32 A;  5AV6 D;  1P3B A;  5B2I B;  4YS3 A;  3AFA C;  3X1U B;  3B6F D;  3LZ1 A;  5B2I D;  5DNM A;  1P3O A;  4H9R B;  5B2J B;  1ZLA A;  2HIO A;  5JRG B;  1P3K B;  4Z5T C;  4J8U B;  5BO0 A;  3AZG C;  3KWQ D;  5B31 B;  3B0D B;  1P3M A;  3REH C;  4XUJ A;  2RIQ A;  3X1V A;  2Y2M A;  1EQZ C;  3X1U C;  4WU9 C;  5AVC B;  5B33 C;  5CPJ A;  5JRG C;  1P3K C;  3UTB A;  1S32 A;  1P3I B;  4WJ3 C;  3LEL B;  3WTP B;  3W97 D;  5AV6 C;  1P3O C;  1M18 C;  5B31 C;  1U35 A;  3KXB C;  2F8N H;  3AN2 C;  1F66 B;  2ARO A;  3MGR C;  2YFV A;  4J8W D;  3REJ A;  3AZN B;  3B6G A;  4EO5 B;  1P3M C;  1BH9 B;  5B40 D;  4ZUX C;  3UTA B;  2L5A A;  5B2J D;  5AVC C;  4J8X C;  3X1V C;  1N1J B;  4G92 C;  4YS3 B;  3KUY D;  3AZF C;  3X1U A;  1M19 C;  3AV2 A;  4J8U D;  3WTP C;  3C1B D;  5DNM B;  3VH5 W;  1P3O B;  2Y2G A;  3EG5 B;  5C3I B;  3KXB B;  3UTB C;  4R8P A;  3AZH D;  5GSU C;  5B0Y D;  5B31 A;  4XZQ B;  1TZY C;  4ZBJ B;  4DRA A;  3AZM A;  3AN2 A;  3AZJ D;  4Z66 D;  2Y2H A;  5B0Z B;  4J8W A;  3H0L C;  4JJN B;  2DF4 C;  2CWE A;  4WNN B;  5AVC A;  3WTP D;  5CPJ B;  3UTB B;  5BT1 D;  3NQJ A;  2F8N B;  2DQN C;  4ZUX D;  3LZ0 D;  1M1A D;  4UPK A;  5AV5 C;  1F66 A;  2ARO B;  3REL A;  3AZL C;  3AZN A;  1P3G C;  3B6G B;  3W98 D;  1BH9 A;  5B31 D;  1AOI C;  5F99 A;  5AVB C;  5GT0 D;  1ID3 A;  2F8N G;  3AV2 B;  3MGP A;  5B33 D;  3X1S B;  3AZK C;  5B32 B;  1P3B B;  5B2I A;  3C1C C;  2LY8 A;  3MVD D;  1P3I C;  1P3G B;  4XZQ A;  3REH D;  3AZM B;  5CPJ D;  3LZ1 C;  5BO0 B;  4J8V A;  3LJA C;  1KX5 D;  3X1V D;  4EO5 C;  1P3M B;  4WNN A;  1U35 D;  3B6F C;  2BYK B;  4WU8 B;  1P3B C;  4YS3 C;  3X1V B;  2CV5 D;  3KXB D;  1P34 C;  4H9S A;  1S32 B;  1KX3 C;  3WKJ D;  3H0M C;  4HGA C;  5B32 D;  5AV6 A;  3X1S D;  1P3B D;  1ID3 B;  4J8V C;  5B1M C;  3EPJ A;  1U35 C;  4KUD D;  4DRB A;  3MGP B;  3VH6 T;  3UTA A;  3NQU A;  5AV8 A;  4YM6 C;  1N1J A;  3LZ1 D;  3LJA D;  5CPJ C;  1KX5 C;  3EPH A;  4J8X A;  1BH8 A;  4Z2M H;  3AZF A;  3KXB A;  3UT9 A;  3MVD C;  3AV1 C;  2NZD D;  3W96 D;  3AZJ A;  5GXQ D;  1HQ3 D;  4R8P C;  4J8U C;  1AOI B;  4QLC A;  2BYK A;  3AZI A;  2UWX A;  1TZY A;  3B0B A;  5AY8 A;  3AV2 C;  4H9Q A;  4X23 C;  4J8W C;  4E45 A;  3C1C B;  1P3G D;  3NQJ B;  2F8N A;  2Y2L A;  1M18 D;  1P3A D;  5AV6 B;  4G91 C;  1M1A B;  2JE5 A;  3LJA B;  5AV5 A;  1F66 C;  3X1U D;  3AZN C;  3AZL A;  3W96 C;  5F99 B;  5B40 A;  4QLC D;  3AZI D;  4WU8 C;  4WU8 D;  5AY8 C;  3VH5 A;  4Z66 C;  4LD9 A;  4J8X B;  1BH8 B;  3AZF B;  2F8N K;  5BS7 A;  5CPI C;  1P3G A;  3AZJ B;  3MNN A;  5B2I C;  2Y2K A;  1AOI A;  4Z2M G;  3C1B C;  2W8S A;  3W99 D;  5B2J C;  5AVC D;  4M6B A;  1B6W A;  4J8V B;  4KGC D;  3VH6 W;  4Z66 B;  4Z5T B;  5B0Z C;  3MGR D;  4WU8 A;  4YM6 B;  1P3M D;  3C1C A;  3B0D C;  4XUJ D;  3WTP E;  4LD9 C;  3F6T A;  3REI C;  1JFI A;  1P3L D;  3UTA D;  5JRG D;  1P3K D;  5GT0 A;  5F99 D;  3O62 C;  1P34 A;  2Y2Q A;  3LJA A;  1P3F C;  3VH5 T;  1EQZ D;  1S32 D;  3WKJ B;  3W98 A;  5CP6 D;  3AL0 C;  3W99 A;  4LD9 B;  3NQU B;  3REJ D;  5B1M A;  5AV8 B;  5B24 A;  3TU4 D;  3X1S C;  3UTA C;  5B32 C;  3MNN B;  4G92 B;  1KX5 A;  3REI D;  3AFA D;  3UT9 B;  5B1L B;  5DNM C;  5GT0 C;  1KX3 D;  4Z5T A;  1W2E A;  2PYO B;  4QLC B;  3AZI B;  5GXQ B;  5AV8 C;  4YM6 A;  2NZD B;  4YS3 D;  1TZY B;  3W99 C;  5AY8 B;  4H9Q B;  4NE5 A;  3X1T B;  2XD5 A;  1JFI B;  5DNN A;  5BNX A;  2HIO D;  3X1T D;  1P3A A;  1PZR A;  1H3O B;  5B0Y B;  5GT0 B;  3B0C W;  3A6N D;  4QLC C;  1Q9C A;  3AZI C;  3W99 B;  1M1A A;  5AV5 B;  5CPK D;  2ARO C;  3AZL B;  3B6G C;  5B40 B;  3MNN D;  3W97 A;  3AZH C;  3W96 A;  3REI B;  3UT9 D;  1KX5 B;  5DNN C;  2FJ7 D;  3KUY C;  3AZF D;  4J8X D;  2PYO A;  2Y2N A;  3A6N A;  5GXQ A;  2NZD A;  4Z66 A;  3C1B A;  5DNN B;  3MGQ B;  5BNX B;  2Y2J A;  3VH6 A;  5B0Y A;  1P3A B;  3AV1 D;  4X23 B;  4UUZ A;  1KX4 A;  1WWS A;  1A7W A;  1R4V A;  5CP6 C;  1P3L B;  5B1L D;  1P34 B;  5JA4 A;  3A6N C;  2RVQ D;  4G91 B;  2PYO D;  3KWQ C;  3A1I A;  2BYM B;  3MGQ C;  3AYW B;  1M19 D;  1ZLA C;  3W98 B;  3WKJ A;  4DQY B;  1P3F A;  5B1M D;  3WA9 B;  4KUD C;  1P3P C;  5F99 C;  3REI A;  2BG1 A;  3W96 B;  3AZE B;  5CHL B;  5B1M B;  4LD9 D;  5B24 B;  4XUJ C;  4AWL B;  1P3L C;  3TU4 B;  1KX4 C;  3A6N B;  4WU9 A;  5B1L A;  5B33 A;  2J8P A;  2ZY2 A;  4KUD B;  1P3P B;  3REK B;  3AV1 B;  3MGQ A;  5B24 C;  3IP4 C;  5CPI D;  3REK D;  2RVQ C;  4KHA B;  4NE6 A;  3X1T A;  3MGR A;  3REJ C;  1B67 A;  1KX4 B;  2CV5 A;  5AY8 D;  1P3L A;  1H3O A;  3KUY B;  5B32 G;  1M19 A;  1P3F D;  3REK C;  5G49 B;  5AVB D;  2JCH A;  3KSY A;  5B24 D;  2HUE B;  1P3F B;  5GSU A;  3AZG B;  1WWI A;  3REH B;  1M1A C;  3W97 B;  3AZM D;  3AZL D;  1P3A C;  5AV5 D;  2ZY5 A;  3TU4 A;  5CPK B;  2G5I C;  4WU9 B;  2CV5 C;  5E5A C;  1T3U A;  3LEL C;  3UT9 C;  1HTA A;  5CPI B;  3REK A;  3AV1 A;  3AZJ C;  2PYO C;  2ARO D;  3B6G D;  5GXQ C;  3REL C;  3C1B B;  4WZS B;  3REL D;  2NZD C;  4KGC A;  5GSU D;  3AZE D;  2CV5 B;  5AV9 D;  3KUY A;  5GT3 D;  4X23 A;  5AVB A;  3C1C D;  3LEL D; 
#chains in the Genus database with same CATH homology
 4UUZ B;  1HQ3 A;  5B0Y C;  2NQB C;  4J8V D;  3EPK A;  4CAY A;  5JA4 B;  2Y2I A;  5CP6 A;  2YFW B;  2BYM A;  3AYW A;  3AN2 D;  3O62 B;  4H9P A;  5E5A D;  3WA9 A;  1P34 D;  1ULY A;  3KWQ A;  5CPK A;  2ZM5 A;  5B40 C;  3AZE A;  3WKJ C;  2FJ7 C;  5BNV B;  5FUG A;  1P3O D;  5B31 G;  3WAA C;  3B6F A;  1TAF B;  2ZY3 A;  5BS7 C;  1EQZ B;  1HQ3 C;  5CPI A;  3KFU G;  3MNN C;  5B33 B;  4KUD A;  4H9S C;  4NFT A;  1KX3 A;  1P3P A;  3B0C T;  5B1L C;  3A1K A;  3AZG D;  4KGC B;  3R45 B;  3AFA A;  3V9R A;  4YM6 D;  4Z5T D;  4KHA A;  3UTB D;  4NE3 A;  3H0R C;  3MGR B;  1P3I D;  4E44 A;  3AZK B;  4ZUX B;  3X1T C;  4CAY B;  5E5A B;  3AZK D;  1M19 B;  1KX4 D;  5G49 A;  2YFW A;  3WAA D;  3O62 A;  4H9P B;  3FDD A;  2Y2O A;  3MVD A;  3MGS B;  3KWQ B;  5GSU B;  3AZG A;  3W98 C;  2HIO B;  5JRG A;  1P3K A;  2JSS A;  1KU5 A;  4ZBJ C;  4XZQ D;  5DNM D;  5BT1 C;  4J8U A;  3REH A;  2IO5 B;  5KDM A;  1M18 A;  1F1E A;  4H9N A;  1EQZ A;  3AZH B;  1P3P D;  3MGQ D;  3TU4 C;  2NQB D;  1ZLA D;  1S32 C;  1KX3 B;  3MGS C;  3LZ0 A;  3R45 A;  3AFA B;  4HGA B;  3V9R B;  3O62 D;  3LEL A;  3WTP A;  3AZN D;  1F66 D;  1U35 B;  2FJ7 B;  4ZUX A;  2F2A C;  4H9O B;  3WAA B;  5E5A A;  5AVB B;  3WA9 D;  4CSR B;  3AYW D;  2Y2P A;  1AOI D;  5GT3 B;  1HQ3 B;  2VQR A;  5AV9 B;  3EPL A;  2FFF B;  3MVD B;  3MGS A;  2NQB A;  2XD1 A;  5DNN D;  3LZ0 C;  5CP6 B;  3MGP D;  2HUE C;  3AV2 D;  4KGC C;  1ID3 D;  4R8P B;  3AZM C;  5KDM B;  1M18 B;  3LZ1 B;  4H9N B;  4R8P D;  4H9R A;  5B2J A;  3AYW C;  1ZLA B;  3AZH A;  3W97 C;  3WA9 C;  3AN2 B;  5GT3 C;  5BNV A;  5FUG B;  5AV9 C;  5B0Z A;  4J8W B;  1BFM A;  3B6F B;  5CPK C;  4JJN A;  3AZE C;  1TAF A;  4WU9 D;  2F8N D;  1TZY D;  4XUJ B;  4AWL C;  3LZ0 B;  3P5J B;  3MGS D;  5C3I C;  2FJ7 A;  1Z2C B;  2G5H C;  2HIO C;  1P3I A;  3REL B;  4H9O A;  3WAA A;  2IO5 C;  4XZQ C;  4CSR A;  1ID3 C;  3MGP C;  5GT3 A;  4X23 D;  3AZK A;  5AV9 A;  2ZY4 A;  5AV8 D;  4JJN D;  4JJN C;  3REJ B;  2YFV B;  5B0Z D;  4WV4 B;  3X1S A;  2NQB B;  5B32 A;  5AV6 D;  1P3B A;  5B2I B;  4YS3 A;  3AFA C;  3X1U B;  3B6F D;  3LZ1 A;  5B2I D;  5DNM A;  1P3O A;  4H9R B;  5B2J B;  1ZLA A;  2HIO A;  5JRG B;  1P3K B;  4Z5T C;  4J8U B;  5BO0 A;  3AZG C;  3KWQ D;  5B31 B;  3B0D B;  1P3M A;  3REH C;  4XUJ A;  2RIQ A;  3X1V A;  2Y2M A;  1EQZ C;  3X1U C;  4WU9 C;  5AVC B;  5B33 C;  5CPJ A;  5JRG C;  1P3K C;  3UTB A;  1S32 A;  1P3I B;  4WJ3 C;  3LEL B;  3WTP B;  3W97 D;  5AV6 C;  1P3O C;  1M18 C;  5B31 C;  1U35 A;  3KXB C;  2F8N H;  3AN2 C;  1F66 B;  2ARO A;  3MGR C;  2YFV A;  4J8W D;  3REJ A;  3AZN B;  3B6G A;  4EO5 B;  1P3M C;  1BH9 B;  5B40 D;  4ZUX C;  3UTA B;  2L5A A;  5B2J D;  5AVC C;  4J8X C;  3X1V C;  1N1J B;  4G92 C;  4YS3 B;  3KUY D;  3AZF C;  3X1U A;  1M19 C;  3AV2 A;  4J8U D;  3WTP C;  3C1B D;  5DNM B;  3VH5 W;  1P3O B;  2Y2G A;  3EG5 B;  5C3I B;  3KXB B;  3UTB C;  4R8P A;  3AZH D;  5GSU C;  5B0Y D;  5B31 A;  4XZQ B;  1TZY C;  4ZBJ B;  4DRA A;  3AZM A;  3AN2 A;  3AZJ D;  4Z66 D;  2Y2H A;  5B0Z B;  4J8W A;  3H0L C;  4JJN B;  2DF4 C;  2CWE A;  4WNN B;  5AVC A;  3WTP D;  5CPJ B;  3UTB B;  5BT1 D;  3NQJ A;  2F8N B;  2DQN C;  4ZUX D;  3LZ0 D;  1M1A D;  4UPK A;  5AV5 C;  1F66 A;  2ARO B;  3REL A;  3AZL C;  3AZN A;  1P3G C;  3B6G B;  3W98 D;  1BH9 A;  5B31 D;  1AOI C;  5F99 A;  5AVB C;  5GT0 D;  1ID3 A;  2F8N G;  3AV2 B;  3MGP A;  5B33 D;  3X1S B;  3AZK C;  5B32 B;  1P3B B;  5B2I A;  3C1C C;  2LY8 A;  3MVD D;  1P3I C;  1P3G B;  4XZQ A;  3REH D;  3AZM B;  5CPJ D;  3LZ1 C;  5BO0 B;  4J8V A;  3LJA C;  1KX5 D;  3X1V D;  4EO5 C;  1P3M B;  4WNN A;  1U35 D;  3B6F C;  2BYK B;  4WU8 B;  1P3B C;  4YS3 C;  3X1V B;  2CV5 D;  3KXB D;  1P34 C;  4H9S A;  1S32 B;  1KX3 C;  3WKJ D;  3H0M C;  4HGA C;  5B32 D;  5AV6 A;  3X1S D;  1P3B D;  1ID3 B;  4J8V C;  5B1M C;  3EPJ A;  1U35 C;  4KUD D;  4DRB A;  3MGP B;  3VH6 T;  3UTA A;  3NQU A;  5AV8 A;  4YM6 C;  1N1J A;  3LZ1 D;  3LJA D;  5CPJ C;  1KX5 C;  3EPH A;  4J8X A;  1BH8 A;  4Z2M H;  3AZF A;  3KXB A;  3UT9 A;  3MVD C;  3AV1 C;  2NZD D;  3W96 D;  3AZJ A;  5GXQ D;  1HQ3 D;  4R8P C;  4J8U C;  1AOI B;  4QLC A;  2BYK A;  3AZI A;  2UWX A;  1TZY A;  3B0B A;  5AY8 A;  3AV2 C;  4H9Q A;  4X23 C;  4J8W C;  4E45 A;  3C1C B;  1P3G D;  3NQJ B;  2F8N A;  2Y2L A;  1M18 D;  1P3A D;  5AV6 B;  4G91 C;  1M1A B;  2JE5 A;  3LJA B;  5AV5 A;  1F66 C;  3X1U D;  3AZN C;  3AZL A;  3W96 C;  5F99 B;  5B40 A;  4QLC D;  3AZI D;  4WU8 C;  4WU8 D;  5AY8 C;  3VH5 A;  4Z66 C;  4LD9 A;  4J8X B;  1BH8 B;  3AZF B;  2F8N K;  5BS7 A;  5CPI C;  1P3G A;  3AZJ B;  3MNN A;  5B2I C;  2Y2K A;  1AOI A;  4Z2M G;  3C1B C;  2W8S A;  3W99 D;  5B2J C;  5AVC D;  4M6B A;  1B6W A;  4J8V B;  4KGC D;  3VH6 W;  4Z66 B;  4Z5T B;  5B0Z C;  3MGR D;  4WU8 A;  4YM6 B;  1P3M D;  3C1C A;  3B0D C;  4XUJ D;  3WTP E;  4LD9 C;  3F6T A;  3REI C;  1JFI A;  1P3L D;  3UTA D;  5JRG D;  1P3K D;  5GT0 A;  5F99 D;  3O62 C;  1P34 A;  2Y2Q A;  3LJA A;  1P3F C;  3VH5 T;  1EQZ D;  1S32 D;  3WKJ B;  3W98 A;  5CP6 D;  3AL0 C;  3W99 A;  4LD9 B;  3NQU B;  3REJ D;  5B1M A;  5AV8 B;  5B24 A;  3TU4 D;  3X1S C;  3UTA C;  5B32 C;  3MNN B;  4G92 B;  1KX5 A;  3REI D;  3AFA D;  3UT9 B;  5B1L B;  5DNM C;  5GT0 C;  1KX3 D;  4Z5T A;  1W2E A;  2PYO B;  4QLC B;  3AZI B;  5GXQ B;  5AV8 C;  4YM6 A;  2NZD B;  4YS3 D;  1TZY B;  3W99 C;  5AY8 B;  4H9Q B;  4NE5 A;  3X1T B;  2XD5 A;  1JFI B;  5DNN A;  5BNX A;  2HIO D;  3X1T D;  1P3A A;  1PZR A;  1H3O B;  5B0Y B;  5GT0 B;  3B0C W;  3A6N D;  4QLC C;  1Q9C A;  3AZI C;  3W99 B;  1M1A A;  5AV5 B;  5CPK D;  2ARO C;  3AZL B;  3B6G C;  5B40 B;  3MNN D;  3W97 A;  3AZH C;  3W96 A;  3REI B;  3UT9 D;  1KX5 B;  5DNN C;  2FJ7 D;  3KUY C;  3AZF D;  4J8X D;  2PYO A;  2Y2N A;  3A6N A;  5GXQ A;  2NZD A;  4Z66 A;  3C1B A;  5DNN B;  3MGQ B;  5BNX B;  2Y2J A;  3VH6 A;  5B0Y A;  1P3A B;  3AV1 D;  4X23 B;  4UUZ A;  1KX4 A;  1WWS A;  1A7W A;  1R4V A;  5CP6 C;  1P3L B;  5B1L D;  1P34 B;  5JA4 A;  3A6N C;  2RVQ D;  4G91 B;  2PYO D;  3KWQ C;  3A1I A;  2BYM B;  3MGQ C;  3AYW B;  1M19 D;  1ZLA C;  3W98 B;  3WKJ A;  4DQY B;  1P3F A;  5B1M D;  3WA9 B;  4KUD C;  1P3P C;  5F99 C;  3REI A;  2BG1 A;  3W96 B;  3AZE B;  5CHL B;  5B1M B;  4LD9 D;  5B24 B;  4XUJ C;  4AWL B;  1P3L C;  3TU4 B;  1KX4 C;  3A6N B;  4WU9 A;  5B1L A;  5B33 A;  2J8P A;  2ZY2 A;  4KUD B;  1P3P B;  3REK B;  3AV1 B;  3MGQ A;  5B24 C;  3IP4 C;  5CPI D;  3REK D;  2RVQ C;  4KHA B;  4NE6 A;  3X1T A;  3MGR A;  3REJ C;  1B67 A;  1KX4 B;  2CV5 A;  5AY8 D;  1P3L A;  1H3O A;  3KUY B;  5B32 G;  1M19 A;  1P3F D;  3REK C;  5G49 B;  5AVB D;  2JCH A;  3KSY A;  5B24 D;  2HUE B;  1P3F B;  5GSU A;  3AZG B;  1WWI A;  3REH B;  1M1A C;  3W97 B;  3AZM D;  3AZL D;  1P3A C;  5AV5 D;  2ZY5 A;  3TU4 A;  5CPK B;  2G5I C;  4WU9 B;  2CV5 C;  5E5A C;  1T3U A;  3LEL C;  3UT9 C;  1HTA A;  5CPI B;  3REK A;  3AV1 A;  3AZJ C;  2PYO C;  2ARO D;  3B6G D;  5GXQ C;  3REL C;  3C1B B;  4WZS B;  3REL D;  2NZD C;  4KGC A;  5GSU D;  3AZE D;  2CV5 B;  5AV9 D;  3KUY A;  5GT3 D;  4X23 A;  5AVB A;  3C1C D;  3LEL D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...