5GXQC

The crystal structure of the nucleosome containing h3.6
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
108
structure length
108
Chain Sequence
b'RAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure and Characterization of Novel Human Histone H3 Variants, H3.6, H3.7, and H3.8
pubmed doi rcsb
molecule keywords Histone H3.6
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 34
structure length 108
sequence length 108
chains with identical sequence G
ec nomenclature
pdb deposition date 2016-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5gxqC00
5C3IB 3W96D 3KXBB 3X1SD 4JJNA 2HIOC 3AZGC 3RELD 4CSRA 5B31A 4Z5TB 3AFAB 4WV4B 4KUDC 5B40B 4XUJA 4R8PC 3KSYA 1TZYD 2JSSA 5B1LA 5GSUB 4WU8D 3WA9D 5B0ZD 3C1CC 4H9SA 4NE3A 1M1AD 4J8UD 3WAAB 1S32B 3MGPB 3W99B 3AZFC 1TAFA 1ID3D 4X23C 1M19A 1P3LB 3KXBA 3B6FD 4JJNC 3A6NC 3X1TA 3MGRB 4J8WA 4XUJC 3AZND 5CPJB 2NQBB 1KX3D 3B0BA 4ZUXD 2RVQC 2CWEA 5GSUA 5B1LC 1KX4B 4KGCD 3AZGD 5GT0B 5JRGB 2PYOD 1BH9A 1KX5C 3O62B 3UTAD 5DNMD 3W99A 2F8NH 3AN2A 3AZHD 4Z66B 3MVDD 3MGSB 3AZMB 5B1MD 1ULYA 5AVCB 3C1CD 3WTPD 5B31G 5AVBD 3X1TC 1P3AC 1P3BC 1P3MB 3MGRA 3MGQA 4J8WC 5AV9B 3B0DC 1U35A 1KX4A 4JJND 3MNNA 4G92B 5GT0A 5JRGA 3AZKB 5B31D 3O62A 2RVQD 4NFTA 5B1LD 3AN2C 5B2IB 4H9OB 1AOIB 4AWLC 1B6WA 3VH6W 3MGQC 1M19D 3KXBD 3B6GB 3C1BB 3X1TD 3B0CW 3MNNC 5AV5A 3AZKA 3LJAB 5CPIB 3VH6T 4CAYB 5AY8A 1M18B 3KWQB 3REKB 5GSUD 3AZLB 4G91C 3LZ1B 3AZJB 4HGAC 3KUYB 3AV1C 4DRAA 3WAAD 1S32D 3W99D 3REIB 3REJA 2FJ7B 3AN2D 4YS3B 4WU8A 5B0YB 1P3PB 1F66B 5GXQA 3V9RB 4LD9A 2AROB 3MGRD 1HQ3C 4CAYA 2NQBD 3MGQD 1ID3A 5AY8C 3REKA 2IO5C 3WTPE 3W96C 1U35D 3X1SC 1KX4D 3B6FA 3MNND 5JRGD 5GT0D 3RELC 3AZNA 3O62D 1KX3A 1BFMA 2FJ7A 4ZUXA 4NE6A 1TZYC 5JA4A 3REJC 4YS3A 4KGCA 4WU8C 5B0ZC 1P3PA 1WWSA 1M1AC 5BNXA 3V9RA 5GXQC 5DNMA 4R8PB 1P3GB 1P3MD 3AZHA 4Z2MH 5BS7A 4LD9C 3MVDA 1WWIA 1P34A 1H3OA 1ID3C 5AV9D 5B1MA 2BYKB 3B6FC 5AV6B 3AZKD 2NZDA 4KHAB 5AV5D 1BH8B 5AY8D 4H9QB 3AZNC 4XZQB 3W97B 1KX3C 3NQJA 4ZUXC 1P3FA 5GT3B 4KGCC 5DNNB 1P3KB 5AV8A 2HUEC 4H9PB 2PYOC 3UTAC 5DNMC 3REJD 3AZHC 3NQUA 3MVDC 1P34C 2BYKA 5B1MC 3W98A 3B6GD 3WTPC 5AV6A 3C1BD 5GXQD 5AVBC 5CP6B 3LJAD 2NZDC 3AV2B 3UTBB 4LD9D 4H9QA 1M18D 3UT9B 1P3IB 3REKD 5GT3A 5DNNA 3R45B 3X1UB 1EQZB 1P3KA 4Z5TA 5KDMB 3AFAA 3LELB 3AZJD 5B31C 4H9PA 5B40A 5AV8C 3KUYD 3AZEB 4WU9B 5B24B 1P3OB 5B32B 3REID 2FJ7D 4YS3D 1P3PD 5BO0B 3W98C 2F8NK 4EO5C 4H9SC 5CP6A 3WAAA 1S32A 5F99B 3MGPA 3AV2A 3AZIB 3TU4B 1P34D 1P3LA 4ZBJC 1M19C 5C3IC 3KXBC 3LZ0B 3R45A 3X1UA 5KDMA 4AWLB 2NZDD 4Z5TC 3AFAC 4J8VB 5B40C 5CPJA 2NQBA 1P3FD 5GSUC 1N1JB 5AV8D 5BO0A 4DRBA 5F99A 2L5AA 1P3GD 3WAAC 3WKJB 1S32C 3AYWB 3MGPC 3W99C 3VH5W 3AZIA 4Z66A 3MGSA 3TU4A 3AZMA 2F8NB 5AVCA 2YFWB 5BNVB 3LZ0A 3W98D 5AV6D 3AV1B 1ZLAB 1P3MA 3VH5T 4QLCB 3MGRC 4H9NB 5CPJC 2NQBC 5AV9A 2BYMB 5GT3D 1U35C 4Z2MG 4YM6B 1N1JA 5DNND 1KX4C 3REHB 1P3KD 4Z5TD 5JRGC 5GT0C 3AFAD 4J8XB 5B40D 5B2JB 1HQ3B 3O62C 2IO5B 5B2IA 3W96B 1A7WA 4H9OA 4Z66C 2F8NA 3MGSC 3AZMC 2YFWA 5BNVA 5AVCC 1AOIA 5CP6D 2CV5B 3MGPD 3AV2D 1P3MC 4QLCA 4H9NA 2BYMA 3UT9D 1P3ID 1P3LD 5AV9C 3WA9B 3B6GA 3X1UD 3C1BA 4G92C 3LJAA 4UUZB 3LELD 3AZKC 4J8UB 5AV5C 5B2JA 5CPIA 5CPJD 1M18A 4WZSB 4WU9D 5B24D 3AZED 1P3OD 3X1VB 3KWQA 1HTAA 3AZLA 5B33B 3LZ1A 5E5AB 3AZJA 3KUYA 1AOIC 5CPKB 5F99D 3REIA 3AZID 4Z66D 3MGSD 3TU4D 2HIOB 3AZMD 3AZGB 5AVCD 3VH6A 5B0YA 3LZ0D 1F66A 3B6GC 4KUDB 3C1BC 4UUZA 4J8VD 2AROA 3LJAC 3UTAB 5CPIC 1M18C 3X1VA 4E44A 3KWQC 3REKC 2F8NG 3C1CB 3AZLC 5E5AA 3LZ1C 3AZJC 3AZFB 4WNNB 2YFVB 3KUYC 3WKJD 4X23B 3AYWD 3REIC 2FJ7C 5B2ID 4YS3C 2HIOA 2F8ND 4JJNB 3A6NB 4KUDA 1AOID 1P3PC 4R8PA 4XUJB 1P3GA 1ZLAD 2AROC 4QLCD 5B1LB 5BS7C 1KX5B 4KHAA 5CPID 1BH8A 2YFVA 4E45A 5B2JD 3W97A 4XZQA 4X23A 1F1EA 3KWQD 3AZLD 1P3FC 3LZ1D 3A6NA 3X1TB 1P3AB 1P3BB 4J8WB 2CV5D 1P3GC 5BT1D 3B0DB 5B0YD 1F66D 1KX5A 1BH9B 5AV6C 3UTBA 2AROD 3AN2B 3W97C 3UT9A 1P3IA 4XZQC 3X1VD 5B33D 5GT3C 1EQZA 4H9RB 5E5AD 5DNNC 3LELA 1P3AA 1P3BA 1P3KC 3AZEA 4WU9A 5B24A 5CPKD 1P3OA 5B32A 3MGQB 1U35B 2HIOD 3MNNB 4KUDD 1Q9CA 4R8PD 5CP6C 3AV2C 3UTBC 1JFIB 4G91B 4M6BA 5FUGB 3UT9C 1P3IC 1P3LC 1KU5A 4H9RA 1R4VA 4HGAB 3X1UC 1B67A 1EQZC 4J8VA 3LELC 3AZFD 3W97D 4XZQD 3AZEC 5B24C 4X23D 4WU9C 5B32C 1P3OC 3A6ND 5AV5B 4XUJD 3WKJA 5AY8B 5F99C 3AYWA 1JFIA 3AZIC 3X1SB 3TU4C 5FUGA 3RELB 3LZ0C 3AV1A 1KX5D 1ZLAA 4J8VC 3UTBD 1TZYB 3REJB 5B32G 4WU8B 2LY8A 5B0ZB 4YM6A 1EQZD 3REHA 1M1AB 5GXQB 1P3AD 4J8XA 1P3BD 1HQ3A 4LD9B 4J8WD 5B32D 1ID3B 3WKJC 3AYWC 3W96A 3X1SA 5B2IC 3B6FB 3RELA 3VH5A 3B0CT 2CV5A 3AZNB 1ZLAC 1KX3B 1TZYA 4ZUXB 4QLCC 5JA4B 4KGCB 3WA9A 5B0ZA 2HUEB 4YM6C 2PYOB 1M1AA 3REHC 4J8UA 5BNXB 5DNMB 4J8XC 5B2JC 5G49B 3AZHB 3MVDB 1P34B 1H3OB 5B1MB 5B33A 3WTPB 5AVBB 2NZDB 5CPKA 2CV5C 5BT1C 3NQJB 4NE5A 1P3FB 3AZGA 3WA9C 4CSRB 5B31B 5AV8B 5B0YC 2PYOA 3AV1D 1F66C 3UTAA 4J8UC 5CHLB 5G49A 3X1VC 3NQUB 3C1CA 3WTPA 4YM6D 5B33C 3W98B 5E5AC 5AVBA 4EO5B 3REHD 4J8XD 3AZFA 4WNNA 1HQ3D 5CPKC 1TAFB 4ZBJB 1M19B
chains in the Genus database with same CATH superfamily
5C3IB 3W96D 3KXBB 3X1SD 4JJNA 2HIOC 3AZGC 2Y2QA 3RELD 4CSRA 5B31A 4Z5TB 3AFAB 4WV4B 4KUDC 5B40B 4XUJA 4R8PC 3KSYA 1TZYD 2JSSA 5B1LA 5GSUB 4WU8D 3WA9D 5B0ZD 3C1CC 4H9SA 4NE3A 1M1AD 4J8UD 3WAAB 1S32B 3MGPB 3W99B 3AZFC 2G5IC 1TAFA 1ID3D 4X23C 1M19A 1P3LB 3KXBA 3B6FD 4JJNC 3A6NC 3X1TA 3MGRB 4J8WA 4XUJC 3AZND 5CPJB 2NQBB 1KX3D 3B0BA 4ZUXD 2RVQC 2CWEA 5GSUA 5B1LC 1KX4B 4KGCD 3AZGD 5GT0B 5JRGB 2PYOD 1BH9A 2JCHA 1KX5C 3O62B 3UTAD 2VQRA 5DNMD 3W99A 2F8NH 3AN2A 3AZHD 4Z66B 3MVDD 3MGSB 2JE5A 3AZMB 3H0MC 5B1MD 1ULYA 5AVCB 3C1CD 3F6TA 3WTPD 5B31G 5AVBD 3X1TC 1P3AC 1P3BC 1P3MB 3MGRA 3MGQA 4J8WC 3H0RC 5AV9B 3B0DC 1U35A 2Y2LA 1KX4A 4JJND 3MNNA 4G92B 5GT0A 5JRGA 3AZKB 5B31D 3O62A 2RVQD 4NFTA 5B1LD 3AN2C 5B2IB 2UWXA 4H9OB 1AOIB 4AWLC 1B6WA 3H0LC 3VH6W 3MGQC 1M19D 3KXBD 3B6GB 3C1BB 3X1TD 3B0CW 3MNNC 5AV5A 3AZKA 3LJAB 5CPIB 3VH6T 4CAYB 5AY8A 1M18B 3KWQB 3REKB 5GSUD 3AZLB 4G91C 3LZ1B 2ZY2A 3AZJB 4HGAC 3KUYB 3AV1C 4DRAA 3WAAD 1S32D 3W99D 3REIB 3REJA 2FJ7B 3AN2D 4YS3B 4WU8A 5B0YB 1P3PB 1F66B 5GXQA 3V9RB 4LD9A 2AROB 3MGRD 1HQ3C 4CAYA 2NQBD 3MGQD 1ID3A 5AY8C 3REKA 2IO5C 3W96C 3WTPE 1U35D 3X1SC 1KX4D 3B6FA 3MNND 5JRGD 5GT0D 3RELC 3AZNA 3O62D 1KX3A 1BFMA 2FJ7A 4ZUXA 4NE6A 1TZYC 5JA4A 3REJC 4YS3A 4KGCA 4WU8C 2F2AC 2Y2JA 5B0ZC 1P3PA 1WWSA 1M1AC 5BNXA 3V9RA 5GXQC 5DNMA 4R8PB 1P3GB 2ZM5A 1P3MD 3AZHA 4Z2MH 5BS7A 4LD9C 3MVDA 1WWIA 1P34A 1H3OA 1ID3C 5AV9D 5B1MA 2BYKB 3B6FC 5AV6B 3AZKD 2NZDA 4KHAB 5AV5D 1BH8B 5AY8D 4H9QB 3AZNC 4XZQB 3W97B 1KX3C 3NQJA 4ZUXC 1P3FA 5GT3B 4KGCC 3EPKA 5DNNB 1P3KB 5AV8A 2HUEC 4H9PB 2PYOC 3UTAC 5DNMC 3REJD 3AZHC 3FDDA 3NQUA 3MVDC 1P34C 2BG1A 2BYKA 2Y2NA 5B1MC 3W98A 3B6GD 3WTPC 5AV6A 3C1BD 5GXQD 5AVBC 5CP6B 3LJAD 2NZDC 3AV2B 3UTBB 4LD9D 4H9QA 1M18D 3UT9B 1P3IB 3REKD 5GT3A 5DNNA 3R45B 3X1UB 1EQZB 1P3KA 4Z5TA 5KDMB 3AFAA 3LELB 3AZJD 5B31C 2DQNC 4H9PA 5B40A 5AV8C 3KUYD 3AZEB 4WU9B 5B24B 1P3OB 5B32B 3REID 2FJ7D 4YS3D 1P3PD 5BO0B 3W98C 2Y2GA 2F8NK 4EO5C 4H9SC 5CP6A 3WAAA 1S32A 5F99B 3MGPA 3AV2A 3AZIB 3TU4B 1P34D 1P3LA 4ZBJC 1M19C 5C3IC 3KXBC 3LZ0B 3R45A 3X1UA 5KDMA 4AWLB 2NZDD 4Z5TC 3AFAC 4J8VB 5B40C 5CPJA 2NQBA 2Y2PA 1P3FD 5GSUC 2Y2IA 1N1JB 5AV8D 5BO0A 4DRBA 5F99A 2L5AA 1P3GD 3WAAC 3WKJB 1S32C 3AYWB 3MGPC 3W99C 3VH5W 3AZIA 4Z66A 3MGSA 3TU4A 2ZY3A 3AZMA 2F8NB 1T3UA 5AVCA 2YFWB 5BNVB 3LZ0A 3W98D 5AV6D 3AV1B 1ZLAB 1P3MA 3VH5T 3EPHA 4QLCB 3MGRC 4H9NB 5CPJC 2NQBC 5AV9A 2BYMB 5GT3D 1U35C 3EG5B 4Z2MG 4YM6B 1N1JA 5DNND 1KX4C 3REHB 1P3KD 4Z5TD 5JRGC 5GT0C 3AFAD 4J8XB 5B40D 5B2JB 1HQ3B 3O62C 2IO5B 5B2IA 3W96B 1A7WA 4H9OA 4Z66C 2F8NA 3MGSC 3AZMC 2YFWA 5BNVA 5AVCC 1AOIA 5CP6D 2CV5B 3MGPD 3AV2D 1P3MC 4QLCA 4H9NA 3A1KA 2BYMA 3UT9D 1P3ID 1P3LD 5AV9C 3WA9B 3B6GA 3X1UD 3C1BA 4G92C 3LJAA 4UUZB 3LELD 3AZKC 4J8UB 5AV5C 5B2JA 5CPIA 5CPJD 1M18A 4WZSB 4WU9D 5B24D 3AZED 1P3OD 3X1VB 3KWQA 1HTAA 3AZLA 5B33B 3LZ1A 5E5AB 3AZJA 3KUYA 1AOIC 1W2EA 5CPKB 5F99D 3REIA 2J8PA 3AZID 3A1IA 2W8SA 4Z66D 3MGSD 3TU4D 2HIOB 3AZMD 3AZGB 5AVCD 2Y2MA 3VH6A 5B0YA 2DF4C 3LZ0D 1F66A 3B6GC 4KUDB 3C1BC 4UUZA 4J8VD 2AROA 3LJAC 3UTAB 5CPIC 1M18C 3X1VA 4E44A 3KWQC 3REKC 2F8NG 3C1CB 3AZLC 5E5AA 3LZ1C 3IP4C 3AZJC 3AZFB 4WNNB 2YFVB 3KUYC 3WKJD 4X23B 3AYWD 3REIC 2FJ7C 5B2ID 4YS3C 2HIOA 2F8ND 4JJNB 3A6NB 4KUDA 1AOID 1P3PC 4R8PA 4XUJB 1P3GA 1ZLAD 3EPLA 2AROC 4QLCD 5B1LB 5BS7C 1KX5B 4KHAA 5CPID 1BH8A 2YFVA 4E45A 5B2JD 3W97A 4XZQA 4X23A 1F1EA 3KWQD 3AZLD 1P3FC 3LZ1D 3A6NA 2ZY4A 3X1TB 1P3AB 1P3BB 3KFUG 3AL0C 4J8WB 2CV5D 1P3GC 5BT1D 3B0DB 5B0YD 1F66D 2RIQA 1KX5A 1BH9B 5AV6C 3UTBA 2AROD 3AN2B 3W97C 3UT9A 1P3IA 2XD1A 4XZQC 3X1VD 3EPJA 5B33D 5GT3C 1EQZA 4H9RB 5E5AD 5DNNC 3LELA 1P3AA 1P3BA 1P3KC 3AZEA 4WU9A 5B24A 5CPKD 1P3OA 5B32A 3MGQB 1U35B 2HIOD 3MNNB 4DQYB 4KUDD 1Q9CA 4R8PD 5CP6C 3AV2C 3UTBC 1JFIB 4G91B 4M6BA 4UPKA 5FUGB 3UT9C 1P3IC 1P3LC 1KU5A 4H9RA 1R4VA 4HGAB 3X1UC 1B67A 1EQZC 4J8VA 3LELC 3AZFD 3W97D 4XZQD 3AZEC 5B24C 4X23D 4WU9C 5B32C 1P3OC 3P5JB 2Y2HA 3A6ND 5AV5B 4XUJD 3WKJA 5AY8B 5F99C 3AYWA 1JFIA 3AZIC 3X1SB 3TU4C 5FUGA 2XD5A 3RELB 1Z2CB 3LZ0C 3AV1A 1KX5D 1ZLAA 4J8VC 3UTBD 1TZYB 3REJB 5B32G 4WU8B 2LY8A 5B0ZB 4YM6A 1EQZD 2G5HC 2Y2OA 3REHA 1M1AB 5GXQB 1P3AD 4J8XA 1P3BD 1HQ3A 2Y2KA 4LD9B 4J8WD 5B32D 1ID3B 3WKJC 3AYWC 3W96A 3X1SA 5B2IC 3B6FB 3RELA 2ZY5A 3VH5A 3B0CT 2CV5A 3AZNB 1ZLAC 1KX3B 1TZYA 4ZUXB 4QLCC 5JA4B 4KGCB 3WA9A 2FFFB 5B0ZA 2HUEB 1PZRA 4YM6C 2PYOB 1M1AA 3REHC 4J8UA 5BNXB 5DNMB 4J8XC 5B2JC 5G49B 3AZHB 3MVDB 1P34B 1H3OB 5B1MB 5B33A 4WJ3C 3WTPB 5AVBB 2NZDB 5CPKA 2CV5C 5BT1C 3NQJB 4NE5A 1P3FB 3AZGA 3WA9C 4CSRB 5B31B 5AV8B 5B0YC 2PYOA 3AV1D 1F66C 3UTAA 4J8UC 5CHLB 5G49A 3X1VC 3NQUB 3C1CA 3WTPA 4YM6D 5B33C 3W98B 5E5AC 5AVBA 4EO5B 3REHD 4J8XD 3AZFA 4WNNA 1HQ3D 5CPKC 1TAFB 4ZBJB 1M19B
chains in the Genus database with same CATH topology
5C3IB 3W96D 3KXBB 3X1SD 4JJNA 2HIOC 3AZGC 2Y2QA 3RELD 4CSRA 5B31A 4Z5TB 3AFAB 4WV4B 4KUDC 5B40B 4XUJA 4R8PC 3KSYA 1TZYD 2JSSA 5B1LA 5GSUB 4WU8D 3WA9D 5B0ZD 3C1CC 4H9SA 4NE3A 1M1AD 4J8UD 3WAAB 1S32B 3MGPB 3W99B 3AZFC 2G5IC 1TAFA 1ID3D 4X23C 1M19A 1P3LB 3KXBA 3B6FD 4JJNC 3A6NC 3X1TA 3MGRB 4J8WA 4XUJC 3AZND 5CPJB 2NQBB 1KX3D 3B0BA 4ZUXD 2RVQC 2CWEA 5GSUA 5B1LC 1KX4B 4KGCD 3AZGD 5GT0B 5JRGB 2PYOD 1BH9A 2JCHA 1KX5C 3O62B 3UTAD 2VQRA 5DNMD 3W99A 2F8NH 3AN2A 3AZHD 4Z66B 3MVDD 3MGSB 2JE5A 3AZMB 3H0MC 5B1MD 1ULYA 5AVCB 3C1CD 3F6TA 3WTPD 5B31G 5AVBD 3X1TC 1P3AC 1P3BC 1P3MB 3MGRA 3MGQA 4J8WC 3H0RC 5AV9B 3B0DC 1U35A 2Y2LA 1KX4A 4JJND 3MNNA 4G92B 5GT0A 5JRGA 3AZKB 5B31D 3O62A 2RVQD 4NFTA 5B1LD 3AN2C 5B2IB 2UWXA 4H9OB 1AOIB 4AWLC 1B6WA 3H0LC 3VH6W 3MGQC 1M19D 3KXBD 3B6GB 3C1BB 3X1TD 3B0CW 3MNNC 5AV5A 3AZKA 3LJAB 5CPIB 3VH6T 4CAYB 5AY8A 1M18B 3KWQB 3REKB 5GSUD 3AZLB 4G91C 3LZ1B 2ZY2A 3AZJB 4HGAC 3KUYB 3AV1C 4DRAA 3WAAD 1S32D 3W99D 3REIB 3REJA 2FJ7B 3AN2D 4YS3B 4WU8A 5B0YB 1P3PB 1F66B 5GXQA 3V9RB 4LD9A 2AROB 3MGRD 1HQ3C 4CAYA 2NQBD 3MGQD 1ID3A 5AY8C 3REKA 2IO5C 3W96C 3WTPE 1U35D 3X1SC 1KX4D 3B6FA 3MNND 5JRGD 5GT0D 3RELC 3AZNA 3O62D 1KX3A 1BFMA 2FJ7A 4ZUXA 4NE6A 1TZYC 5JA4A 3REJC 4YS3A 4KGCA 4WU8C 2F2AC 2Y2JA 5B0ZC 1P3PA 1WWSA 1M1AC 5BNXA 3V9RA 5GXQC 5DNMA 4R8PB 1P3GB 2ZM5A 1P3MD 3AZHA 4Z2MH 5BS7A 4LD9C 3MVDA 1WWIA 1P34A 1H3OA 1ID3C 5AV9D 5B1MA 2BYKB 3B6FC 5AV6B 3AZKD 2NZDA 4KHAB 5AV5D 1BH8B 5AY8D 4H9QB 3AZNC 4XZQB 3W97B 1KX3C 3NQJA 4ZUXC 1P3FA 5GT3B 4KGCC 3EPKA 5DNNB 1P3KB 5AV8A 2HUEC 4H9PB 2PYOC 3UTAC 5DNMC 3REJD 3AZHC 3FDDA 3NQUA 3MVDC 1P34C 2BG1A 2BYKA 2Y2NA 5B1MC 3W98A 3B6GD 3WTPC 5AV6A 3C1BD 5GXQD 5AVBC 5CP6B 3LJAD 2NZDC 3AV2B 3UTBB 4LD9D 4H9QA 1M18D 3UT9B 1P3IB 3REKD 5GT3A 5DNNA 3R45B 3X1UB 1EQZB 1P3KA 4Z5TA 5KDMB 3AFAA 3LELB 3AZJD 5B31C 2DQNC 4H9PA 5B40A 5AV8C 3KUYD 3AZEB 4WU9B 5B24B 1P3OB 5B32B 3REID 2FJ7D 4YS3D 1P3PD 5BO0B 3W98C 2Y2GA 2F8NK 4EO5C 4H9SC 5CP6A 3WAAA 1S32A 5F99B 3MGPA 3AV2A 3AZIB 3TU4B 1P34D 1P3LA 4ZBJC 1M19C 5C3IC 3KXBC 3LZ0B 3R45A 3X1UA 5KDMA 4AWLB 2NZDD 4Z5TC 3AFAC 4J8VB 5B40C 5CPJA 2NQBA 2Y2PA 1P3FD 5GSUC 2Y2IA 1N1JB 5AV8D 5BO0A 4DRBA 5F99A 2L5AA 1P3GD 3WAAC 3WKJB 1S32C 3AYWB 3MGPC 3W99C 3VH5W 3AZIA 4Z66A 3MGSA 3TU4A 2ZY3A 3AZMA 2F8NB 1T3UA 5AVCA 2YFWB 5BNVB 3LZ0A 3W98D 5AV6D 3AV1B 1ZLAB 1P3MA 3VH5T 3EPHA 4QLCB 3MGRC 4H9NB 5CPJC 2NQBC 5AV9A 2BYMB 5GT3D 1U35C 3EG5B 4Z2MG 4YM6B 1N1JA 5DNND 1KX4C 3REHB 1P3KD 4Z5TD 5JRGC 5GT0C 3AFAD 4J8XB 5B40D 5B2JB 1HQ3B 3O62C 2IO5B 5B2IA 3W96B 1A7WA 4H9OA 4Z66C 2F8NA 3MGSC 3AZMC 2YFWA 5BNVA 5AVCC 1AOIA 5CP6D 2CV5B 3MGPD 3AV2D 1P3MC 4QLCA 4H9NA 3A1KA 2BYMA 3UT9D 1P3ID 1P3LD 5AV9C 3WA9B 3B6GA 3X1UD 3C1BA 4G92C 3LJAA 4UUZB 3LELD 3AZKC 4J8UB 5AV5C 5B2JA 5CPIA 5CPJD 1M18A 4WZSB 4WU9D 5B24D 3AZED 1P3OD 3X1VB 3KWQA 1HTAA 3AZLA 5B33B 3LZ1A 5E5AB 3AZJA 3KUYA 1AOIC 1W2EA 5CPKB 5F99D 3REIA 2J8PA 3AZID 3A1IA 2W8SA 4Z66D 3MGSD 3TU4D 2HIOB 3AZMD 3AZGB 5AVCD 2Y2MA 3VH6A 5B0YA 2DF4C 3LZ0D 1F66A 3B6GC 4KUDB 3C1BC 4UUZA 4J8VD 2AROA 3LJAC 3UTAB 5CPIC 1M18C 3X1VA 4E44A 3KWQC 3REKC 2F8NG 3C1CB 3AZLC 5E5AA 3LZ1C 3IP4C 3AZJC 3AZFB 4WNNB 2YFVB 3KUYC 3WKJD 4X23B 3AYWD 3REIC 2FJ7C 5B2ID 4YS3C 2HIOA 2F8ND 4JJNB 3A6NB 4KUDA 1AOID 1P3PC 4R8PA 4XUJB 1P3GA 1ZLAD 3EPLA 2AROC 4QLCD 5B1LB 5BS7C 1KX5B 4KHAA 5CPID 1BH8A 2YFVA 4E45A 5B2JD 3W97A 4XZQA 4X23A 1F1EA 3KWQD 3AZLD 1P3FC 3LZ1D 3A6NA 2ZY4A 3X1TB 1P3AB 1P3BB 3KFUG 3AL0C 4J8WB 2CV5D 1P3GC 5BT1D 3B0DB 5B0YD 1F66D 2RIQA 1KX5A 1BH9B 5AV6C 3UTBA 2AROD 3AN2B 3W97C 3UT9A 1P3IA 2XD1A 4XZQC 3X1VD 3EPJA 5B33D 5GT3C 1EQZA 4H9RB 5E5AD 5DNNC 3LELA 1P3AA 1P3BA 1P3KC 3AZEA 4WU9A 5B24A 5CPKD 1P3OA 5B32A 3MGQB 1U35B 2HIOD 3MNNB 4DQYB 4KUDD 1Q9CA 4R8PD 5CP6C 3AV2C 3UTBC 1JFIB 4G91B 4M6BA 4UPKA 5FUGB 3UT9C 1P3IC 1P3LC 1KU5A 4H9RA 1R4VA 4HGAB 3X1UC 1B67A 1EQZC 4J8VA 3LELC 3AZFD 3W97D 4XZQD 3AZEC 5B24C 4X23D 4WU9C 5B32C 1P3OC 3P5JB 2Y2HA 3A6ND 5AV5B 4XUJD 3WKJA 5AY8B 5F99C 3AYWA 1JFIA 3AZIC 3X1SB 3TU4C 5FUGA 2XD5A 3RELB 1Z2CB 3LZ0C 3AV1A 1KX5D 1ZLAA 4J8VC 3UTBD 1TZYB 3REJB 5B32G 4WU8B 2LY8A 5B0ZB 4YM6A 1EQZD 2G5HC 2Y2OA 3REHA 1M1AB 5GXQB 1P3AD 4J8XA 1P3BD 1HQ3A 2Y2KA 4LD9B 4J8WD 5B32D 1ID3B 3WKJC 3AYWC 3W96A 3X1SA 5B2IC 3B6FB 3RELA 2ZY5A 3VH5A 3B0CT 2CV5A 3AZNB 1ZLAC 1KX3B 1TZYA 4ZUXB 4QLCC 5JA4B 4KGCB 3WA9A 2FFFB 5B0ZA 2HUEB 1PZRA 4YM6C 2PYOB 1M1AA 3REHC 4J8UA 5BNXB 5DNMB 4J8XC 5B2JC 5G49B 3AZHB 3MVDB 1P34B 1H3OB 5B1MB 5B33A 4WJ3C 3WTPB 5AVBB 2NZDB 5CPKA 2CV5C 5BT1C 3NQJB 4NE5A 1P3FB 3AZGA 3WA9C 4CSRB 5B31B 5AV8B 5B0YC 2PYOA 3AV1D 1F66C 3UTAA 4J8UC 5CHLB 5G49A 3X1VC 3NQUB 3C1CA 3WTPA 4YM6D 5B33C 3W98B 5E5AC 5AVBA 4EO5B 3REHD 4J8XD 3AZFA 4WNNA 1HQ3D 5CPKC 1TAFB 4ZBJB 1M19B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C3I B;  3W96 D;  3KXB B;  3X1S D;  4JJN A;  2HIO C;  3AZG C;  3REL D;  4CSR A;  5B31 A;  4Z5T B;  3AFA B;  4WV4 B;  4KUD C;  5B40 B;  4XUJ A;  4R8P C;  3KSY A;  1TZY D;  2JSS A;  5B1L A;  5GSU B;  4WU8 D;  3WA9 D;  5B0Z D;  3C1C C;  4H9S A;  4NE3 A;  1M1A D;  4J8U D;  3WAA B;  1S32 B;  3MGP B;  3W99 B;  3AZF C;  1TAF A;  1ID3 D;  4X23 C;  1M19 A;  1P3L B;  3KXB A;  3B6F D;  4JJN C;  3A6N C;  3X1T A;  3MGR B;  4J8W A;  4XUJ C;  3AZN D;  5CPJ B;  2NQB B;  1KX3 D;  3B0B A;  4ZUX D;  2RVQ C;  2CWE A;  5GSU A;  5B1L C;  1KX4 B;  4KGC D;  3AZG D;  5GT0 B;  5JRG B;  2PYO D;  1BH9 A;  1KX5 C;  3O62 B;  3UTA D;  5DNM D;  3W99 A;  2F8N H;  3AN2 A;  3AZH D;  4Z66 B;  3MVD D;  3MGS B;  3AZM B;  5B1M D;  1ULY A;  5AVC B;  3C1C D;  3WTP D;  5B31 G;  5AVB D;  3X1T C;  1P3A C;  1P3B C;  1P3M B;  3MGR A;  3MGQ A;  4J8W C;  5AV9 B;  3B0D C;  1U35 A;  1KX4 A;  4JJN D;  3MNN A;  4G92 B;  5GT0 A;  5JRG A;  3AZK B;  5B31 D;  3O62 A;  2RVQ D;  4NFT A;  5B1L D;  3AN2 C;  5B2I B;  4H9O B;  1AOI B;  4AWL C;  1B6W A;  3VH6 W;  3MGQ C;  1M19 D;  3KXB D;  3B6G B;  3C1B B;  3X1T D;  3B0C W;  3MNN C;  5AV5 A;  3AZK A;  3LJA B;  5CPI B;  3VH6 T;  4CAY B;  5AY8 A;  1M18 B;  3KWQ B;  3REK B;  5GSU D;  3AZL B;  4G91 C;  3LZ1 B;  3AZJ B;  4HGA C;  3KUY B;  3AV1 C;  4DRA A;  3WAA D;  1S32 D;  3W99 D;  3REI B;  3REJ A;  2FJ7 B;  3AN2 D;  4YS3 B;  4WU8 A;  5B0Y B;  1P3P B;  1F66 B;  5GXQ A;  3V9R B;  4LD9 A;  2ARO B;  3MGR D;  1HQ3 C;  4CAY A;  2NQB D;  3MGQ D;  1ID3 A;  5AY8 C;  3REK A;  2IO5 C;  3WTP E;  3W96 C;  1U35 D;  3X1S C;  1KX4 D;  3B6F A;  3MNN D;  5JRG D;  5GT0 D;  3REL C;  3AZN A;  3O62 D;  1KX3 A;  1BFM A;  2FJ7 A;  4ZUX A;  4NE6 A;  1TZY C;  5JA4 A;  3REJ C;  4YS3 A;  4KGC A;  4WU8 C;  5B0Z C;  1P3P A;  1WWS A;  1M1A C;  5BNX A;  3V9R A;  5GXQ C;  5DNM A;  4R8P B;  1P3G B;  1P3M D;  3AZH A;  4Z2M H;  5BS7 A;  4LD9 C;  3MVD A;  1WWI A;  1P34 A;  1H3O A;  1ID3 C;  5AV9 D;  5B1M A;  2BYK B;  3B6F C;  5AV6 B;  3AZK D;  2NZD A;  4KHA B;  5AV5 D;  1BH8 B;  5AY8 D;  4H9Q B;  3AZN C;  4XZQ B;  3W97 B;  1KX3 C;  3NQJ A;  4ZUX C;  1P3F A;  5GT3 B;  4KGC C;  5DNN B;  1P3K B;  5AV8 A;  2HUE C;  4H9P B;  2PYO C;  3UTA C;  5DNM C;  3REJ D;  3AZH C;  3NQU A;  3MVD C;  1P34 C;  2BYK A;  5B1M C;  3W98 A;  3B6G D;  3WTP C;  5AV6 A;  3C1B D;  5GXQ D;  5AVB C;  5CP6 B;  3LJA D;  2NZD C;  3AV2 B;  3UTB B;  4LD9 D;  4H9Q A;  1M18 D;  3UT9 B;  1P3I B;  3REK D;  5GT3 A;  5DNN A;  3R45 B;  3X1U B;  1EQZ B;  1P3K A;  4Z5T A;  5KDM B;  3AFA A;  3LEL B;  3AZJ D;  5B31 C;  4H9P A;  5B40 A;  5AV8 C;  3KUY D;  3AZE B;  4WU9 B;  5B24 B;  1P3O B;  5B32 B;  3REI D;  2FJ7 D;  4YS3 D;  1P3P D;  5BO0 B;  3W98 C;  2F8N K;  4EO5 C;  4H9S C;  5CP6 A;  3WAA A;  1S32 A;  5F99 B;  3MGP A;  3AV2 A;  3AZI B;  3TU4 B;  1P34 D;  1P3L A;  4ZBJ C;  1M19 C;  5C3I C;  3KXB C;  3LZ0 B;  3R45 A;  3X1U A;  5KDM A;  4AWL B;  2NZD D;  4Z5T C;  3AFA C;  4J8V B;  5B40 C;  5CPJ A;  2NQB A;  1P3F D;  5GSU C;  1N1J B;  5AV8 D;  5BO0 A;  4DRB A;  5F99 A;  2L5A A;  1P3G D;  3WAA C;  3WKJ B;  1S32 C;  3AYW B;  3MGP C;  3W99 C;  3VH5 W;  3AZI A;  4Z66 A;  3MGS A;  3TU4 A;  3AZM A;  2F8N B;  5AVC A;  2YFW B;  5BNV B;  3LZ0 A;  3W98 D;  5AV6 D;  3AV1 B;  1ZLA B;  1P3M A;  3VH5 T;  4QLC B;  3MGR C;  4H9N B;  5CPJ C;  2NQB C;  5AV9 A;  2BYM B;  5GT3 D;  1U35 C;  4Z2M G;  4YM6 B;  1N1J A;  5DNN D;  1KX4 C;  3REH B;  1P3K D;  4Z5T D;  5JRG C;  5GT0 C;  3AFA D;  4J8X B;  5B40 D;  5B2J B;  1HQ3 B;  3O62 C;  2IO5 B;  5B2I A;  3W96 B;  1A7W A;  4H9O A;  4Z66 C;  2F8N A;  3MGS C;  3AZM C;  2YFW A;  5BNV A;  5AVC C;  1AOI A;  5CP6 D;  2CV5 B;  3MGP D;  3AV2 D;  1P3M C;  4QLC A;  4H9N A;  2BYM A;  3UT9 D;  1P3I D;  1P3L D;  5AV9 C;  3WA9 B;  3B6G A;  3X1U D;  3C1B A;  4G92 C;  3LJA A;  4UUZ B;  3LEL D;  3AZK C;  4J8U B;  5AV5 C;  5B2J A;  5CPI A;  5CPJ D;  1M18 A;  4WZS B;  4WU9 D;  5B24 D;  3AZE D;  1P3O D;  3X1V B;  3KWQ A;  1HTA A;  3AZL A;  5B33 B;  3LZ1 A;  5E5A B;  3AZJ A;  3KUY A;  1AOI C;  5CPK B;  5F99 D;  3REI A;  3AZI D;  4Z66 D;  3MGS D;  3TU4 D;  2HIO B;  3AZM D;  3AZG B;  5AVC D;  3VH6 A;  5B0Y A;  3LZ0 D;  1F66 A;  3B6G C;  4KUD B;  3C1B C;  4UUZ A;  4J8V D;  2ARO A;  3LJA C;  3UTA B;  5CPI C;  1M18 C;  3X1V A;  4E44 A;  3KWQ C;  3REK C;  2F8N G;  3C1C B;  3AZL C;  5E5A A;  3LZ1 C;  3AZJ C;  3AZF B;  4WNN B;  2YFV B;  3KUY C;  3WKJ D;  4X23 B;  3AYW D;  3REI C;  2FJ7 C;  5B2I D;  4YS3 C;  2HIO A;  2F8N D;  4JJN B;  3A6N B;  4KUD A;  1AOI D;  1P3P C;  4R8P A;  4XUJ B;  1P3G A;  1ZLA D;  2ARO C;  4QLC D;  5B1L B;  5BS7 C;  1KX5 B;  4KHA A;  5CPI D;  1BH8 A;  2YFV A;  4E45 A;  5B2J D;  3W97 A;  4XZQ A;  4X23 A;  1F1E A;  3KWQ D;  3AZL D;  1P3F C;  3LZ1 D;  3A6N A;  3X1T B;  1P3A B;  1P3B B;  4J8W B;  2CV5 D;  1P3G C;  5BT1 D;  3B0D B;  5B0Y D;  1F66 D;  1KX5 A;  1BH9 B;  5AV6 C;  3UTB A;  2ARO D;  3AN2 B;  3W97 C;  3UT9 A;  1P3I A;  4XZQ C;  3X1V D;  5B33 D;  5GT3 C;  1EQZ A;  4H9R B;  5E5A D;  5DNN C;  3LEL A;  1P3A A;  1P3B A;  1P3K C;  3AZE A;  4WU9 A;  5B24 A;  5CPK D;  1P3O A;  5B32 A;  3MGQ B;  1U35 B;  2HIO D;  3MNN B;  4KUD D;  1Q9C A;  4R8P D;  5CP6 C;  3AV2 C;  3UTB C;  1JFI B;  4G91 B;  4M6B A;  5FUG B;  3UT9 C;  1P3I C;  1P3L C;  1KU5 A;  4H9R A;  1R4V A;  4HGA B;  3X1U C;  1B67 A;  1EQZ C;  4J8V A;  3LEL C;  3AZF D;  3W97 D;  4XZQ D;  3AZE C;  5B24 C;  4X23 D;  4WU9 C;  5B32 C;  1P3O C;  3A6N D;  5AV5 B;  4XUJ D;  3WKJ A;  5AY8 B;  5F99 C;  3AYW A;  1JFI A;  3AZI C;  3X1S B;  3TU4 C;  5FUG A;  3REL B;  3LZ0 C;  3AV1 A;  1KX5 D;  1ZLA A;  4J8V C;  3UTB D;  1TZY B;  3REJ B;  5B32 G;  4WU8 B;  2LY8 A;  5B0Z B;  4YM6 A;  1EQZ D;  3REH A;  1M1A B;  5GXQ B;  1P3A D;  4J8X A;  1P3B D;  1HQ3 A;  4LD9 B;  4J8W D;  5B32 D;  1ID3 B;  3WKJ C;  3AYW C;  3W96 A;  3X1S A;  5B2I C;  3B6F B;  3REL A;  3VH5 A;  3B0C T;  2CV5 A;  3AZN B;  1ZLA C;  1KX3 B;  1TZY A;  4ZUX B;  4QLC C;  5JA4 B;  4KGC B;  3WA9 A;  5B0Z A;  2HUE B;  4YM6 C;  2PYO B;  1M1A A;  3REH C;  4J8U A;  5BNX B;  5DNM B;  4J8X C;  5B2J C;  5G49 B;  3AZH B;  3MVD B;  1P34 B;  1H3O B;  5B1M B;  5B33 A;  3WTP B;  5AVB B;  2NZD B;  5CPK A;  2CV5 C;  5BT1 C;  3NQJ B;  4NE5 A;  1P3F B;  3AZG A;  3WA9 C;  4CSR B;  5B31 B;  5AV8 B;  5B0Y C;  2PYO A;  3AV1 D;  1F66 C;  3UTA A;  4J8U C;  5CHL B;  5G49 A;  3X1V C;  3NQU B;  3C1C A;  3WTP A;  4YM6 D;  5B33 C;  3W98 B;  5E5A C;  5AVB A;  4EO5 B;  3REH D;  4J8X D;  3AZF A;  4WNN A;  1HQ3 D;  5CPK C;  1TAF B;  4ZBJ B;  1M19 B; 
#chains in the Genus database with same CATH topology
 5C3I B;  3W96 D;  3KXB B;  3X1S D;  4JJN A;  2HIO C;  3AZG C;  2Y2Q A;  3REL D;  4CSR A;  5B31 A;  4Z5T B;  3AFA B;  4WV4 B;  4KUD C;  5B40 B;  4XUJ A;  4R8P C;  3KSY A;  1TZY D;  2JSS A;  5B1L A;  5GSU B;  4WU8 D;  3WA9 D;  5B0Z D;  3C1C C;  4H9S A;  4NE3 A;  1M1A D;  4J8U D;  3WAA B;  1S32 B;  3MGP B;  3W99 B;  3AZF C;  2G5I C;  1TAF A;  1ID3 D;  4X23 C;  1M19 A;  1P3L B;  3KXB A;  3B6F D;  4JJN C;  3A6N C;  3X1T A;  3MGR B;  4J8W A;  4XUJ C;  3AZN D;  5CPJ B;  2NQB B;  1KX3 D;  3B0B A;  4ZUX D;  2RVQ C;  2CWE A;  5GSU A;  5B1L C;  1KX4 B;  4KGC D;  3AZG D;  5GT0 B;  5JRG B;  2PYO D;  1BH9 A;  2JCH A;  1KX5 C;  3O62 B;  3UTA D;  2VQR A;  5DNM D;  3W99 A;  2F8N H;  3AN2 A;  3AZH D;  4Z66 B;  3MVD D;  3MGS B;  2JE5 A;  3AZM B;  3H0M C;  5B1M D;  1ULY A;  5AVC B;  3C1C D;  3F6T A;  3WTP D;  5B31 G;  5AVB D;  3X1T C;  1P3A C;  1P3B C;  1P3M B;  3MGR A;  3MGQ A;  4J8W C;  3H0R C;  5AV9 B;  3B0D C;  1U35 A;  2Y2L A;  1KX4 A;  4JJN D;  3MNN A;  4G92 B;  5GT0 A;  5JRG A;  3AZK B;  5B31 D;  3O62 A;  2RVQ D;  4NFT A;  5B1L D;  3AN2 C;  5B2I B;  2UWX A;  4H9O B;  1AOI B;  4AWL C;  1B6W A;  3H0L C;  3VH6 W;  3MGQ C;  1M19 D;  3KXB D;  3B6G B;  3C1B B;  3X1T D;  3B0C W;  3MNN C;  5AV5 A;  3AZK A;  3LJA B;  5CPI B;  3VH6 T;  4CAY B;  5AY8 A;  1M18 B;  3KWQ B;  3REK B;  5GSU D;  3AZL B;  4G91 C;  3LZ1 B;  2ZY2 A;  3AZJ B;  4HGA C;  3KUY B;  3AV1 C;  4DRA A;  3WAA D;  1S32 D;  3W99 D;  3REI B;  3REJ A;  2FJ7 B;  3AN2 D;  4YS3 B;  4WU8 A;  5B0Y B;  1P3P B;  1F66 B;  5GXQ A;  3V9R B;  4LD9 A;  2ARO B;  3MGR D;  1HQ3 C;  4CAY A;  2NQB D;  3MGQ D;  1ID3 A;  5AY8 C;  3REK A;  2IO5 C;  3W96 C;  3WTP E;  1U35 D;  3X1S C;  1KX4 D;  3B6F A;  3MNN D;  5JRG D;  5GT0 D;  3REL C;  3AZN A;  3O62 D;  1KX3 A;  1BFM A;  2FJ7 A;  4ZUX A;  4NE6 A;  1TZY C;  5JA4 A;  3REJ C;  4YS3 A;  4KGC A;  4WU8 C;  2F2A C;  2Y2J A;  5B0Z C;  1P3P A;  1WWS A;  1M1A C;  5BNX A;  3V9R A;  5GXQ C;  5DNM A;  4R8P B;  1P3G B;  2ZM5 A;  1P3M D;  3AZH A;  4Z2M H;  5BS7 A;  4LD9 C;  3MVD A;  1WWI A;  1P34 A;  1H3O A;  1ID3 C;  5AV9 D;  5B1M A;  2BYK B;  3B6F C;  5AV6 B;  3AZK D;  2NZD A;  4KHA B;  5AV5 D;  1BH8 B;  5AY8 D;  4H9Q B;  3AZN C;  4XZQ B;  3W97 B;  1KX3 C;  3NQJ A;  4ZUX C;  1P3F A;  5GT3 B;  4KGC C;  3EPK A;  5DNN B;  1P3K B;  5AV8 A;  2HUE C;  4H9P B;  2PYO C;  3UTA C;  5DNM C;  3REJ D;  3AZH C;  3FDD A;  3NQU A;  3MVD C;  1P34 C;  2BG1 A;  2BYK A;  2Y2N A;  5B1M C;  3W98 A;  3B6G D;  3WTP C;  5AV6 A;  3C1B D;  5GXQ D;  5AVB C;  5CP6 B;  3LJA D;  2NZD C;  3AV2 B;  3UTB B;  4LD9 D;  4H9Q A;  1M18 D;  3UT9 B;  1P3I B;  3REK D;  5GT3 A;  5DNN A;  3R45 B;  3X1U B;  1EQZ B;  1P3K A;  4Z5T A;  5KDM B;  3AFA A;  3LEL B;  3AZJ D;  5B31 C;  2DQN C;  4H9P A;  5B40 A;  5AV8 C;  3KUY D;  3AZE B;  4WU9 B;  5B24 B;  1P3O B;  5B32 B;  3REI D;  2FJ7 D;  4YS3 D;  1P3P D;  5BO0 B;  3W98 C;  2Y2G A;  2F8N K;  4EO5 C;  4H9S C;  5CP6 A;  3WAA A;  1S32 A;  5F99 B;  3MGP A;  3AV2 A;  3AZI B;  3TU4 B;  1P34 D;  1P3L A;  4ZBJ C;  1M19 C;  5C3I C;  3KXB C;  3LZ0 B;  3R45 A;  3X1U A;  5KDM A;  4AWL B;  2NZD D;  4Z5T C;  3AFA C;  4J8V B;  5B40 C;  5CPJ A;  2NQB A;  2Y2P A;  1P3F D;  5GSU C;  2Y2I A;  1N1J B;  5AV8 D;  5BO0 A;  4DRB A;  5F99 A;  2L5A A;  1P3G D;  3WAA C;  3WKJ B;  1S32 C;  3AYW B;  3MGP C;  3W99 C;  3VH5 W;  3AZI A;  4Z66 A;  3MGS A;  3TU4 A;  2ZY3 A;  3AZM A;  2F8N B;  1T3U A;  5AVC A;  2YFW B;  5BNV B;  3LZ0 A;  3W98 D;  5AV6 D;  3AV1 B;  1ZLA B;  1P3M A;  3VH5 T;  3EPH A;  4QLC B;  3MGR C;  4H9N B;  5CPJ C;  2NQB C;  5AV9 A;  2BYM B;  5GT3 D;  1U35 C;  3EG5 B;  4Z2M G;  4YM6 B;  1N1J A;  5DNN D;  1KX4 C;  3REH B;  1P3K D;  4Z5T D;  5JRG C;  5GT0 C;  3AFA D;  4J8X B;  5B40 D;  5B2J B;  1HQ3 B;  3O62 C;  2IO5 B;  5B2I A;  3W96 B;  1A7W A;  4H9O A;  4Z66 C;  2F8N A;  3MGS C;  3AZM C;  2YFW A;  5BNV A;  5AVC C;  1AOI A;  5CP6 D;  2CV5 B;  3MGP D;  3AV2 D;  1P3M C;  4QLC A;  4H9N A;  3A1K A;  2BYM A;  3UT9 D;  1P3I D;  1P3L D;  5AV9 C;  3WA9 B;  3B6G A;  3X1U D;  3C1B A;  4G92 C;  3LJA A;  4UUZ B;  3LEL D;  3AZK C;  4J8U B;  5AV5 C;  5B2J A;  5CPI A;  5CPJ D;  1M18 A;  4WZS B;  4WU9 D;  5B24 D;  3AZE D;  1P3O D;  3X1V B;  3KWQ A;  1HTA A;  3AZL A;  5B33 B;  3LZ1 A;  5E5A B;  3AZJ A;  3KUY A;  1AOI C;  1W2E A;  5CPK B;  5F99 D;  3REI A;  2J8P A;  3AZI D;  3A1I A;  2W8S A;  4Z66 D;  3MGS D;  3TU4 D;  2HIO B;  3AZM D;  3AZG B;  5AVC D;  2Y2M A;  3VH6 A;  5B0Y A;  2DF4 C;  3LZ0 D;  1F66 A;  3B6G C;  4KUD B;  3C1B C;  4UUZ A;  4J8V D;  2ARO A;  3LJA C;  3UTA B;  5CPI C;  1M18 C;  3X1V A;  4E44 A;  3KWQ C;  3REK C;  2F8N G;  3C1C B;  3AZL C;  5E5A A;  3LZ1 C;  3IP4 C;  3AZJ C;  3AZF B;  4WNN B;  2YFV B;  3KUY C;  3WKJ D;  4X23 B;  3AYW D;  3REI C;  2FJ7 C;  5B2I D;  4YS3 C;  2HIO A;  2F8N D;  4JJN B;  3A6N B;  4KUD A;  1AOI D;  1P3P C;  4R8P A;  4XUJ B;  1P3G A;  1ZLA D;  3EPL A;  2ARO C;  4QLC D;  5B1L B;  5BS7 C;  1KX5 B;  4KHA A;  5CPI D;  1BH8 A;  2YFV A;  4E45 A;  5B2J D;  3W97 A;  4XZQ A;  4X23 A;  1F1E A;  3KWQ D;  3AZL D;  1P3F C;  3LZ1 D;  3A6N A;  2ZY4 A;  3X1T B;  1P3A B;  1P3B B;  3KFU G;  3AL0 C;  4J8W B;  2CV5 D;  1P3G C;  5BT1 D;  3B0D B;  5B0Y D;  1F66 D;  2RIQ A;  1KX5 A;  1BH9 B;  5AV6 C;  3UTB A;  2ARO D;  3AN2 B;  3W97 C;  3UT9 A;  1P3I A;  2XD1 A;  4XZQ C;  3X1V D;  3EPJ A;  5B33 D;  5GT3 C;  1EQZ A;  4H9R B;  5E5A D;  5DNN C;  3LEL A;  1P3A A;  1P3B A;  1P3K C;  3AZE A;  4WU9 A;  5B24 A;  5CPK D;  1P3O A;  5B32 A;  3MGQ B;  1U35 B;  2HIO D;  3MNN B;  4DQY B;  4KUD D;  1Q9C A;  4R8P D;  5CP6 C;  3AV2 C;  3UTB C;  1JFI B;  4G91 B;  4M6B A;  4UPK A;  5FUG B;  3UT9 C;  1P3I C;  1P3L C;  1KU5 A;  4H9R A;  1R4V A;  4HGA B;  3X1U C;  1B67 A;  1EQZ C;  4J8V A;  3LEL C;  3AZF D;  3W97 D;  4XZQ D;  3AZE C;  5B24 C;  4X23 D;  4WU9 C;  5B32 C;  1P3O C;  3P5J B;  2Y2H A;  3A6N D;  5AV5 B;  4XUJ D;  3WKJ A;  5AY8 B;  5F99 C;  3AYW A;  1JFI A;  3AZI C;  3X1S B;  3TU4 C;  5FUG A;  2XD5 A;  3REL B;  1Z2C B;  3LZ0 C;  3AV1 A;  1KX5 D;  1ZLA A;  4J8V C;  3UTB D;  1TZY B;  3REJ B;  5B32 G;  4WU8 B;  2LY8 A;  5B0Z B;  4YM6 A;  1EQZ D;  2G5H C;  2Y2O A;  3REH A;  1M1A B;  5GXQ B;  1P3A D;  4J8X A;  1P3B D;  1HQ3 A;  2Y2K A;  4LD9 B;  4J8W D;  5B32 D;  1ID3 B;  3WKJ C;  3AYW C;  3W96 A;  3X1S A;  5B2I C;  3B6F B;  3REL A;  2ZY5 A;  3VH5 A;  3B0C T;  2CV5 A;  3AZN B;  1ZLA C;  1KX3 B;  1TZY A;  4ZUX B;  4QLC C;  5JA4 B;  4KGC B;  3WA9 A;  2FFF B;  5B0Z A;  2HUE B;  1PZR A;  4YM6 C;  2PYO B;  1M1A A;  3REH C;  4J8U A;  5BNX B;  5DNM B;  4J8X C;  5B2J C;  5G49 B;  3AZH B;  3MVD B;  1P34 B;  1H3O B;  5B1M B;  5B33 A;  4WJ3 C;  3WTP B;  5AVB B;  2NZD B;  5CPK A;  2CV5 C;  5BT1 C;  3NQJ B;  4NE5 A;  1P3F B;  3AZG A;  3WA9 C;  4CSR B;  5B31 B;  5AV8 B;  5B0Y C;  2PYO A;  3AV1 D;  1F66 C;  3UTA A;  4J8U C;  5CHL B;  5G49 A;  3X1V C;  3NQU B;  3C1C A;  3WTP A;  4YM6 D;  5B33 C;  3W98 B;  5E5A C;  5AVB A;  4EO5 B;  3REH D;  4J8X D;  3AZF A;  4WNN A;  1HQ3 D;  5CPK C;  1TAF B;  4ZBJ B;  1M19 B; 
#chains in the Genus database with same CATH homology
 5C3I B;  3W96 D;  3KXB B;  3X1S D;  4JJN A;  2HIO C;  3AZG C;  2Y2Q A;  3REL D;  4CSR A;  5B31 A;  4Z5T B;  3AFA B;  4WV4 B;  4KUD C;  5B40 B;  4XUJ A;  4R8P C;  3KSY A;  1TZY D;  2JSS A;  5B1L A;  5GSU B;  4WU8 D;  3WA9 D;  5B0Z D;  3C1C C;  4H9S A;  4NE3 A;  1M1A D;  4J8U D;  3WAA B;  1S32 B;  3MGP B;  3W99 B;  3AZF C;  2G5I C;  1TAF A;  1ID3 D;  4X23 C;  1M19 A;  1P3L B;  3KXB A;  3B6F D;  4JJN C;  3A6N C;  3X1T A;  3MGR B;  4J8W A;  4XUJ C;  3AZN D;  5CPJ B;  2NQB B;  1KX3 D;  3B0B A;  4ZUX D;  2RVQ C;  2CWE A;  5GSU A;  5B1L C;  1KX4 B;  4KGC D;  3AZG D;  5GT0 B;  5JRG B;  2PYO D;  1BH9 A;  2JCH A;  1KX5 C;  3O62 B;  3UTA D;  2VQR A;  5DNM D;  3W99 A;  2F8N H;  3AN2 A;  3AZH D;  4Z66 B;  3MVD D;  3MGS B;  2JE5 A;  3AZM B;  3H0M C;  5B1M D;  1ULY A;  5AVC B;  3C1C D;  3F6T A;  3WTP D;  5B31 G;  5AVB D;  3X1T C;  1P3A C;  1P3B C;  1P3M B;  3MGR A;  3MGQ A;  4J8W C;  3H0R C;  5AV9 B;  3B0D C;  1U35 A;  2Y2L A;  1KX4 A;  4JJN D;  3MNN A;  4G92 B;  5GT0 A;  5JRG A;  3AZK B;  5B31 D;  3O62 A;  2RVQ D;  4NFT A;  5B1L D;  3AN2 C;  5B2I B;  2UWX A;  4H9O B;  1AOI B;  4AWL C;  1B6W A;  3H0L C;  3VH6 W;  3MGQ C;  1M19 D;  3KXB D;  3B6G B;  3C1B B;  3X1T D;  3B0C W;  3MNN C;  5AV5 A;  3AZK A;  3LJA B;  5CPI B;  3VH6 T;  4CAY B;  5AY8 A;  1M18 B;  3KWQ B;  3REK B;  5GSU D;  3AZL B;  4G91 C;  3LZ1 B;  2ZY2 A;  3AZJ B;  4HGA C;  3KUY B;  3AV1 C;  4DRA A;  3WAA D;  1S32 D;  3W99 D;  3REI B;  3REJ A;  2FJ7 B;  3AN2 D;  4YS3 B;  4WU8 A;  5B0Y B;  1P3P B;  1F66 B;  5GXQ A;  3V9R B;  4LD9 A;  2ARO B;  3MGR D;  1HQ3 C;  4CAY A;  2NQB D;  3MGQ D;  1ID3 A;  5AY8 C;  3REK A;  2IO5 C;  3W96 C;  3WTP E;  1U35 D;  3X1S C;  1KX4 D;  3B6F A;  3MNN D;  5JRG D;  5GT0 D;  3REL C;  3AZN A;  3O62 D;  1KX3 A;  1BFM A;  2FJ7 A;  4ZUX A;  4NE6 A;  1TZY C;  5JA4 A;  3REJ C;  4YS3 A;  4KGC A;  4WU8 C;  2F2A C;  2Y2J A;  5B0Z C;  1P3P A;  1WWS A;  1M1A C;  5BNX A;  3V9R A;  5GXQ C;  5DNM A;  4R8P B;  1P3G B;  2ZM5 A;  1P3M D;  3AZH A;  4Z2M H;  5BS7 A;  4LD9 C;  3MVD A;  1WWI A;  1P34 A;  1H3O A;  1ID3 C;  5AV9 D;  5B1M A;  2BYK B;  3B6F C;  5AV6 B;  3AZK D;  2NZD A;  4KHA B;  5AV5 D;  1BH8 B;  5AY8 D;  4H9Q B;  3AZN C;  4XZQ B;  3W97 B;  1KX3 C;  3NQJ A;  4ZUX C;  1P3F A;  5GT3 B;  4KGC C;  3EPK A;  5DNN B;  1P3K B;  5AV8 A;  2HUE C;  4H9P B;  2PYO C;  3UTA C;  5DNM C;  3REJ D;  3AZH C;  3FDD A;  3NQU A;  3MVD C;  1P34 C;  2BG1 A;  2BYK A;  2Y2N A;  5B1M C;  3W98 A;  3B6G D;  3WTP C;  5AV6 A;  3C1B D;  5GXQ D;  5AVB C;  5CP6 B;  3LJA D;  2NZD C;  3AV2 B;  3UTB B;  4LD9 D;  4H9Q A;  1M18 D;  3UT9 B;  1P3I B;  3REK D;  5GT3 A;  5DNN A;  3R45 B;  3X1U B;  1EQZ B;  1P3K A;  4Z5T A;  5KDM B;  3AFA A;  3LEL B;  3AZJ D;  5B31 C;  2DQN C;  4H9P A;  5B40 A;  5AV8 C;  3KUY D;  3AZE B;  4WU9 B;  5B24 B;  1P3O B;  5B32 B;  3REI D;  2FJ7 D;  4YS3 D;  1P3P D;  5BO0 B;  3W98 C;  2Y2G A;  2F8N K;  4EO5 C;  4H9S C;  5CP6 A;  3WAA A;  1S32 A;  5F99 B;  3MGP A;  3AV2 A;  3AZI B;  3TU4 B;  1P34 D;  1P3L A;  4ZBJ C;  1M19 C;  5C3I C;  3KXB C;  3LZ0 B;  3R45 A;  3X1U A;  5KDM A;  4AWL B;  2NZD D;  4Z5T C;  3AFA C;  4J8V B;  5B40 C;  5CPJ A;  2NQB A;  2Y2P A;  1P3F D;  5GSU C;  2Y2I A;  1N1J B;  5AV8 D;  5BO0 A;  4DRB A;  5F99 A;  2L5A A;  1P3G D;  3WAA C;  3WKJ B;  1S32 C;  3AYW B;  3MGP C;  3W99 C;  3VH5 W;  3AZI A;  4Z66 A;  3MGS A;  3TU4 A;  2ZY3 A;  3AZM A;  2F8N B;  1T3U A;  5AVC A;  2YFW B;  5BNV B;  3LZ0 A;  3W98 D;  5AV6 D;  3AV1 B;  1ZLA B;  1P3M A;  3VH5 T;  3EPH A;  4QLC B;  3MGR C;  4H9N B;  5CPJ C;  2NQB C;  5AV9 A;  2BYM B;  5GT3 D;  1U35 C;  3EG5 B;  4Z2M G;  4YM6 B;  1N1J A;  5DNN D;  1KX4 C;  3REH B;  1P3K D;  4Z5T D;  5JRG C;  5GT0 C;  3AFA D;  4J8X B;  5B40 D;  5B2J B;  1HQ3 B;  3O62 C;  2IO5 B;  5B2I A;  3W96 B;  1A7W A;  4H9O A;  4Z66 C;  2F8N A;  3MGS C;  3AZM C;  2YFW A;  5BNV A;  5AVC C;  1AOI A;  5CP6 D;  2CV5 B;  3MGP D;  3AV2 D;  1P3M C;  4QLC A;  4H9N A;  3A1K A;  2BYM A;  3UT9 D;  1P3I D;  1P3L D;  5AV9 C;  3WA9 B;  3B6G A;  3X1U D;  3C1B A;  4G92 C;  3LJA A;  4UUZ B;  3LEL D;  3AZK C;  4J8U B;  5AV5 C;  5B2J A;  5CPI A;  5CPJ D;  1M18 A;  4WZS B;  4WU9 D;  5B24 D;  3AZE D;  1P3O D;  3X1V B;  3KWQ A;  1HTA A;  3AZL A;  5B33 B;  3LZ1 A;  5E5A B;  3AZJ A;  3KUY A;  1AOI C;  1W2E A;  5CPK B;  5F99 D;  3REI A;  2J8P A;  3AZI D;  3A1I A;  2W8S A;  4Z66 D;  3MGS D;  3TU4 D;  2HIO B;  3AZM D;  3AZG B;  5AVC D;  2Y2M A;  3VH6 A;  5B0Y A;  2DF4 C;  3LZ0 D;  1F66 A;  3B6G C;  4KUD B;  3C1B C;  4UUZ A;  4J8V D;  2ARO A;  3LJA C;  3UTA B;  5CPI C;  1M18 C;  3X1V A;  4E44 A;  3KWQ C;  3REK C;  2F8N G;  3C1C B;  3AZL C;  5E5A A;  3LZ1 C;  3IP4 C;  3AZJ C;  3AZF B;  4WNN B;  2YFV B;  3KUY C;  3WKJ D;  4X23 B;  3AYW D;  3REI C;  2FJ7 C;  5B2I D;  4YS3 C;  2HIO A;  2F8N D;  4JJN B;  3A6N B;  4KUD A;  1AOI D;  1P3P C;  4R8P A;  4XUJ B;  1P3G A;  1ZLA D;  3EPL A;  2ARO C;  4QLC D;  5B1L B;  5BS7 C;  1KX5 B;  4KHA A;  5CPI D;  1BH8 A;  2YFV A;  4E45 A;  5B2J D;  3W97 A;  4XZQ A;  4X23 A;  1F1E A;  3KWQ D;  3AZL D;  1P3F C;  3LZ1 D;  3A6N A;  2ZY4 A;  3X1T B;  1P3A B;  1P3B B;  3KFU G;  3AL0 C;  4J8W B;  2CV5 D;  1P3G C;  5BT1 D;  3B0D B;  5B0Y D;  1F66 D;  2RIQ A;  1KX5 A;  1BH9 B;  5AV6 C;  3UTB A;  2ARO D;  3AN2 B;  3W97 C;  3UT9 A;  1P3I A;  2XD1 A;  4XZQ C;  3X1V D;  3EPJ A;  5B33 D;  5GT3 C;  1EQZ A;  4H9R B;  5E5A D;  5DNN C;  3LEL A;  1P3A A;  1P3B A;  1P3K C;  3AZE A;  4WU9 A;  5B24 A;  5CPK D;  1P3O A;  5B32 A;  3MGQ B;  1U35 B;  2HIO D;  3MNN B;  4DQY B;  4KUD D;  1Q9C A;  4R8P D;  5CP6 C;  3AV2 C;  3UTB C;  1JFI B;  4G91 B;  4M6B A;  4UPK A;  5FUG B;  3UT9 C;  1P3I C;  1P3L C;  1KU5 A;  4H9R A;  1R4V A;  4HGA B;  3X1U C;  1B67 A;  1EQZ C;  4J8V A;  3LEL C;  3AZF D;  3W97 D;  4XZQ D;  3AZE C;  5B24 C;  4X23 D;  4WU9 C;  5B32 C;  1P3O C;  3P5J B;  2Y2H A;  3A6N D;  5AV5 B;  4XUJ D;  3WKJ A;  5AY8 B;  5F99 C;  3AYW A;  1JFI A;  3AZI C;  3X1S B;  3TU4 C;  5FUG A;  2XD5 A;  3REL B;  1Z2C B;  3LZ0 C;  3AV1 A;  1KX5 D;  1ZLA A;  4J8V C;  3UTB D;  1TZY B;  3REJ B;  5B32 G;  4WU8 B;  2LY8 A;  5B0Z B;  4YM6 A;  1EQZ D;  2G5H C;  2Y2O A;  3REH A;  1M1A B;  5GXQ B;  1P3A D;  4J8X A;  1P3B D;  1HQ3 A;  2Y2K A;  4LD9 B;  4J8W D;  5B32 D;  1ID3 B;  3WKJ C;  3AYW C;  3W96 A;  3X1S A;  5B2I C;  3B6F B;  3REL A;  2ZY5 A;  3VH5 A;  3B0C T;  2CV5 A;  3AZN B;  1ZLA C;  1KX3 B;  1TZY A;  4ZUX B;  4QLC C;  5JA4 B;  4KGC B;  3WA9 A;  2FFF B;  5B0Z A;  2HUE B;  1PZR A;  4YM6 C;  2PYO B;  1M1A A;  3REH C;  4J8U A;  5BNX B;  5DNM B;  4J8X C;  5B2J C;  5G49 B;  3AZH B;  3MVD B;  1P34 B;  1H3O B;  5B1M B;  5B33 A;  4WJ3 C;  3WTP B;  5AVB B;  2NZD B;  5CPK A;  2CV5 C;  5BT1 C;  3NQJ B;  4NE5 A;  1P3F B;  3AZG A;  3WA9 C;  4CSR B;  5B31 B;  5AV8 B;  5B0Y C;  2PYO A;  3AV1 D;  1F66 C;  3UTA A;  4J8U C;  5CHL B;  5G49 A;  3X1V C;  3NQU B;  3C1C A;  3WTP A;  4YM6 D;  5B33 C;  3W98 B;  5E5A C;  5AVB A;  4EO5 B;  3REH D;  4J8X D;  3AZF A;  4WNN A;  1HQ3 D;  5CPK C;  1TAF B;  4ZBJ B;  1M19 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...