5GY3A

The crystal structure of endoglucanase cel10, a family 8 glycosyl hydrolase from klebsiella pneumoniae
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
310
structure length
310
Chain Sequence
b'DTAWERYKARFMMPDGRIIDTANGNVSHTEGQGFAMLLAVANNDRPAFDKLWQWTDSTLRDKSNGLFYWRYNPVAPDPIADKNNASDGDTLIAWALLRAQKQWQDKRYAIASDAITASLLKYTVVTFAGRQVMLPGVKGFNLNDHLNLNPSYFIFPAWRAFAERTHLTAWRTLQTDGQALLGQMGWGKSHLPSDWVALRADGKMLPAKEWPPRMSFDAIRIPLYLSWADPQSALLAPWKAWMQSYPRLQTPAWINVSTNEVAPWYMAGGLLAVRDLTLGEPQEAPQIDDKDDYYSASLKQLVWLAKQDQR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glucanase
publication title The crystal structure of the endoglucanase Cel10, a family 8 glycosyl hydrolase from Klebsiella pneumoniae
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Hydrolase
total genus 108
structure length 310
sequence length 310
ec nomenclature ec 3.2.1.-:
pdb deposition date 2016-09-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.10 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 5gy3A00
2RI9A 5CA3A 3S4DA 4AYOA 4ZG8A 1H14A 2A8ZA 3A3VA 3K11A 2EABA 3WC3A 1IS9A 2OKXA 1ULVA 3RENA 3X17A 4KTRA 3RX8A 1WU4A 3AFJA 3W7XA 4WVBA 3RX5A 3W5MA 1GAIA 1V5DA 5GW7A 4CJ0A 3WKGA 2FV1A 1KSDA 1G9JA 3E73A 5M7YA 3QWTA 2B4FA 3W7WA 1KWFA 1G9GA 2WYNA 3QXFA 3S4CA 2DRRA 5M7IA 4AYPA 1V7WA 4TXTA 3RSYA 3WIWA 1UT9A 3PMMA 1WU6A 5E2JA 3D3IA 4Q88A 3QFZA 2D5JA 1K72A 1H54A 5DGQA 2D8LA 4CE7A 3QRYA 1KFGA 3WKFA 1XWTA 2EACA 3H2WA 3WIRA 1FMIA 3H7LA 3W5NA 4AYQA 4J5TA 4WU0A 4TF4A 4DODA 2ZBLA 4XUVA 3ANKA 3GLYA 1CEMA 4JJJA 1FO2A 4L6XA 1LF6A 4EL8A 1V7XA 2DRQA 1AYXA 1FBWA 2DRSA 4L0GA 1GLMA 3QPFA 1VD5A 2GZ6A 5DGRA 4CJ1A 2JJBA 2P0VA 2XFGA 2AFAA 1G6IA 3EZ8A 2Z07A 4AYRA 3TF4A 4Q2BA 5CD2A 1G87A 1NC5A 2VN7A 3QFYA 3QT3A 2YIKA 1IA6A 1HCUA 1LF9A 3RRSA 4FUSA 1DOGA 1V5CA 1KREA 1DL2A 3P2CA 1F9OA 1L2AA 2GH4A 3E6UA 1RQ5A 1XW2A 4DOEA 4ZH5A 1FBOA 2FV0A 1NXCA 2FBAA 3RX7A 1AGMA 3ACTA 2DROA 3W7SA 3WKIA 1WZZA 3WUXA 1KRFA 2F6DA 1L1YA 3QXQA 2FUZA 4Z4JA 3QT9A 2QNOA 5CZLA 2ZZRA 1FAEA 3VW5A 3W7UA 2JF4A 3H3KA 2EADA 1F9DA 1TF4A 2NVPA 5KKBA 5MEHA 1XWQA 4Z4LA 2VN4A 1CLCA 1H12A 2CQSA 1KSCA 3ANIA 1GA2A 2RGKA 3WIQA 3ON6A 3W7TA 3QSPA 3VXDA 4KTPA 2EAEA 3WKHA 1IA7A 1GAHA 3CIHA 5GY3A 1JS4A 1KKTA 2JG0A 3GZKA 3S4BA 1V7VA 1FP3A 2AHFA 3ANJA 3S4AA 1X9DA 2AHGA 1WU5A 2CQTA 4WVAA 3QDEA 1UG9A 1FCEA 3EQAA 4WVCA 1KS8A 3T33A 1H13A 3QG0A 3ACSA 1FO3A 2RI8A 3GT5A
chains in the Genus database with same CATH superfamily
2A8ZA 1HM3A 3X17A 4KTRA 1LXKA 3E32B 3SDRA 2B39A 4KKIA 3RX8A 2FUQA 1RWFA 2A73B 3RX5A 3DPYB 1TNOB 1G9JA 5M7YA 4ONTA 5IKHA 1H3CA 3W7WA 1KWFA 5ILKA 2WYNA 3QXFA 3S4CA 1RWGA 1V7WA 4F10A 1N23A 1H54A 2H6FB 3NNBA 4CE7A 1XWTA 4FNVA 4OK4A 1N7RA 4WU0A 1CEMA 2WIIB 4GTPB 1V7XA 2DRQA 4MBGB 1JCQB 1TNUB 2XQWA 1GSZA 1O79A 1JCRB 2H6IB 3C72B 5DGRA 2XFGA 1N20A 4Q2BA 3KLSA 2XWJB 1OJPA 2YIKA 3DSSB 1N4RB 1N4SB 1DOGA 1V5CA 4FUSA 5ILYA 4V1SA 3P5RA 3M77A 1F9OA 1GXNA 1SA5B 1L2AA 2GH4A 5JPMB 4GAXA 2WINB 1F1SA 1RQ5A 4DOEA 4OZWA 1FBOA 2BRPA 3ACTA 2DROA 3G4DA 3PZ4B 5FO9B 1WZZA 4L9PB 3QXQA 4BOJA 2QNOA 2ONGA 4LNVA 2E22A 2ZZRA 1FAEA 3W7UA 3Q7FB 3Q7AB 4MMHA 2EADA 1RWCA 1TF4A 4YCRA 2NVPA 2WDAA 1XWQA 2VN4A 1CLCA 1N22A 3Q79B 2CQSA 4M76A 3ANIA 1GA2A 1HX9A 3ON6A 3QSPA 3HXCB 1GAHA 4FJQA 3KSQB 1JS4A 1FP3A 4EHMB 3HXEB 1LTXB 4WVAA 1UG9A 2V3PA 2I07B 3EQAA 3DSVB 4V1RA 3QG0A 3EU5B 2RI8A 4OZVA 1TN7B 1N7OA 1KZOB 2RI9A 3M73A 4ZG8A 5IK9A 3A3VA 1IS9A 3RENA 4LIXA 2G02A 3W7XA 3AFJA 5ILIA 1N1ZA 1W3YA 5GW7A 1TN6B 4CJ0A 2FV1A 1O6RA 2GOXA 2XWBB 4OJZA 1OJMA 4TXTA 3WIWA 1UT9A 1QAZA 5E2JA 3D3IA 3NFVA 3QFZA 2WY7A 2D5JA 5IK6A 3SDQA 4D4BA 3WKFA 3H2WA 3WIRA 3H7LA 3W5NA 4DODA 2ZBLA 2PN5A 3GLYA 1CB8A 4EL8A 1N7PA 3LZ9A 4ZRQA 2DRSA 4L0GA 1GLMA 2GZ6A 2JJBA 5JPNB 3PYAA 1G6IA 1GXMA 3EZ8A 2Z07A 3TF4A 5CD2A 1NC5A 2VN7A 1IA6A 1FT1B 3RRSA 5IM1A 5ILDA 1SQCA 1DL2A 2J5CA 3DSTB 3CU7A 4D4AA 3Q78B 3M75A 1HMUA 3SDUA 3E6UA 4GTMB 2BRWA 4GTRB 2FV0A 1W6KA 1NXCA 5IL8A 1AGMA 4MMIA 1TNBB 1O1RB 3PYBA 3M02A 3Q73B 1KRFA 2F6DA 3SDVA 3E7JA 5EAUA 1H3BA 1F9GA 4Z4JA 2V8IA 4C1SA 5ILJA 3H3KA 1F9DA 1SA4B 3K7XA 1HN0A 3M01A 3SFYB 3W7TA 3WKHA 3G6JB 1IA7A 1C3DA 4D4DA 3GZKA 3S4BA 1X9DA 2AHGA 4LNBB 1TNYB 5DHIA 3EUVB 4WVCA 3S9VA 3T33A 1DCEB 3DSUB 1C82A 5CA3A 3S4DA 1H14A 3K11A 3WC3A 2OKXA 1ULVA 3HXDB 2BRVX 3D5SA 3E30B 4GTTB 3W5MA 4WVBA 1GAIA 1TN8B 1HZFA 3Q75B 1W6JA 3QWTA 2B4FA 4OK2A 3RJ3A 2DRRA 3A0OA 4LNGB 5M7IA 2BB6A 2H6GB 3PMMA 3PZ1B 1WU6A 4GTOB 3E34B 5IKAA 1K72A 5DGQA 5IL3A 2D8LA 3QRYA 5FOBB 1KFGA 1N4QB 4YDOB 1JCSB 1RWHA 4TF4A 5JMDA 1N95B 2E24A 1N9AB 3ANKA 4FXKB 4XUVA 4JJJA 2SQCA 1FO2A 1O6QA 3DRAB 4L6XA 1LF6A 2ONHA 4BOKA 1FBWA 5AGDA 1GXOA 3G4FA 4GL3A 3SFXB 1VD5A 1HXCA 4CJ1A 2P0VA 2AFAA 3PZ2B 3N0FA 3QT3A 1X1IA 1N4PB 1LF9A 1HCUA 3SDTA 1N1BA 1KREA 1H3AA 1UMPA 1LD8B 5IK0A 1HMWA 1O5MB 4ZH5A 4DI5A 4GTQB 2BB5A 3WKIA 1GHQA 3WUXA 1L1YA 5ILHA 3D5RA 3E37B 4NEIA 3M71A 4GTVB 2IEJB 5CZLA 1N21A 1J0MA 3VW5A 2JF4A 2G0DA 5MEHA 2BEDB 4RNQA 1H39A 1H37A 1MZCB 3WIQA 3OXUA 3EU8A 4KTPA 2EAEA 5DHKA 2ZISB 3E33B 3CIHA 1HV6A 5GY3A 3KQ4A 1OJOA 1V7VA 2AHFA 3S4AA 3HXFB 1S64B 3QDEA 5FO7B 5EATA 5ILZA 1FCEA 3SAEA 1KS8A 3M7EA 1H36A 2WCOA 3E80A 1FO3A 2NOJA 5C05A 3P5PA 4KKJA 4AYOA 1QQFA 2EABA 4YDEB 3VSMA 3M00A 1NI1B 2V8KA 1WU4A 3OEDA 4QT9A 1FT2B 2V3NA 1V5DA 5EASA 3M72A 2R2LB 3WKGA 1RW9A 1X81B 5GZKA 1EGUA 1H35A 1KSDA 4D4CA 3E73A 5JMFA 1OJNA 1G9GA 3M76A 3DSWB 1D8DB 1LOHA 3AFLA 4AYPA 1FPPB 3RSYA 1S63B 4Q88A 1NL4B 2WY8A 2X03A 2EACA 1FMIA 4D94A 4AYQA 4J5TA 3M74A 1R76A 1AYXA 1I8QA 1N7NA 4GTSB 1TNZB 3QPFA 3VSNA 3DSXB 2PMVA 4AYRA 1HXAA 3M7BA 1G87A 4MU9A 3QFYA 2FUTA 2BBCA 4ZH1A 1N94B 1HXGA 1KZPB 1O6HA 3P2CA 1LXMA 1O1SB 3PZ3B 1XW2A 2FBAA 3RX7A 1O1TB 3W7SA 4F13A 1J0NA 3HXBB 5FO8B 1X1JA 1QSJA 3N0GA 4E1YA 2FUZA 1N24A 3KSLB 3QT9A 2V8JA 3SQCA 2Q1FA 1D8EB 3M7CA 1N7QA 5KKBA 4Z4LA 1H12A 1KSCA 2RGKA 4ZRPA 3VXDA 1LD7B 1QBQB 2ZIRB 1KKTA 2JG0A 3ANJA 1WU5A 2CQTA 1RWAA 1X1HA 3M7LA 1HM2A 3M78A 1H13A 4FXGB 2F0YB 2H6HB 3ACSA 3GT5A
chains in the Genus database with same CATH topology
2A8ZA 3X17A 4KTRA 3E32B 3SDRA 2B39A 4KKIA 3RX8A 2A73B 3RX5A 3DPYB 1TNOB 1G9JA 5M7YA 4ONTA 1H3CA 3W7WA 1KWFA 2WYNA 3QXFA 3S4CA 1V7WA 1H54A 2H6FB 4CE7A 1XWTA 4WU0A 1CEMA 2WIIB 4GTPB 1V7XA 2DRQA 4MBGB 1JCQB 1TNUB 2XQWA 1GSZA 1O79A 1JCRB 2H6IB 3C72B 5DGRA 2XFGA 4Q2BA 3KLSA 2XWJB 2YIKA 3DSSB 1N4RB 1N4SB 1DOGA 1V5CA 4FUSA 4V1SA 3P5RA 3M77A 1F9OA 1GXNA 1SA5B 1L2AA 2GH4A 5JPMB 2WINB 1RQ5A 4DOEA 1FBOA 3ACTA 2DROA 3PZ4B 5FO9B 1WZZA 4L9PB 3QXQA 4BOJA 2QNOA 4LNVA 2ZZRA 1FAEA 3W7UA 3Q7FB 3Q7AB 4YCRA 2EADA 2NVPA 1TF4A 1XWQA 2VN4A 1CLCA 3Q79B 2CQSA 4M76A 3ANIA 1GA2A 3ON6A 3QSPA 3HXCB 1GAHA 3KSQB 1JS4A 1FP3A 4EHMB 3HXEB 1LTXB 4WVAA 1UG9A 2V3PA 2I07B 3EQAA 3DSVB 4V1RA 3QG0A 3EU5B 2RI8A 1TN7B 2RI9A 1KZOB 3M73A 4ZG8A 3A3VA 1IS9A 3RENA 4LIXA 2G02A 3W7XA 3AFJA 5GW7A 1TN6B 4CJ0A 2FV1A 1O6RA 2GOXA 2XWBB 4TXTA 3WIWA 1UT9A 5E2JA 3D3IA 3QFZA 2WY7A 2D5JA 3SDQA 4D4BA 3WKFA 3H2WA 3WIRA 3H7LA 3W5NA 4DODA 2ZBLA 2PN5A 3GLYA 4EL8A 4ZRQA 2DRSA 4L0GA 1GLMA 2GZ6A 2JJBA 5JPNB 3PYAA 1G6IA 1GXMA 3EZ8A 2Z07A 3TF4A 5CD2A 1NC5A 2VN7A 1IA6A 1FT1B 3RRSA 1SQCA 1DL2A 3DSTB 3CU7A 4D4AA 3Q78B 3M75A 3SDUA 3E6UA 4GTMB 4GTRB 2FV0A 1W6KA 1NXCA 1AGMA 1TNBB 1O1RB 3PYBA 3Q73B 1KRFA 2F6DA 3SDVA 1H3BA 4Z4JA 2V8IA 4C1SA 3H3KA 1F9DA 1SA4B 3K7XA 3SFYB 3W7TA 3WKHA 3G6JB 1IA7A 1C3DA 4D4DA 3GZKA 3S4BA 1X9DA 2AHGA 4LNBB 1TNYB 3EUVB 4WVCA 3S9VA 3T33A 1DCEB 3DSUB 5CA3A 3S4DA 1H14A 3K11A 3WC3A 2OKXA 1ULVA 3HXDB 3D5SA 3E30B 4GTTB 3W5MA 4WVBA 1GAIA 1TN8B 1HZFA 3Q75B 1W6JA 3QWTA 2B4FA 3RJ3A 2DRRA 4LNGB 5M7IA 2BB6A 2H6GB 3PMMA 3PZ1B 1WU6A 4GTOB 3E34B 1K72A 5DGQA 2D8LA 3QRYA 5FOBB 1KFGA 1N4QB 4YDOB 1JCSB 4TF4A 1N95B 3ANKA 1N9AB 4FXKB 4XUVA 4JJJA 2SQCA 1FO2A 1O6QA 3DRAB 4L6XA 1LF6A 4BOKA 1FBWA 5AGDA 1GXOA 4GL3A 3SFXB 1VD5A 4CJ1A 2P0VA 2AFAA 3PZ2B 3QT3A 1N4PB 1LF9A 1HCUA 3SDTA 1UMPA 1KREA 1H3AA 1LD8B 1O5MB 4ZH5A 4GTQB 2BB5A 3WKIA 1GHQA 3WUXA 1L1YA 3D5RA 3E37B 3M71A 4GTVB 2IEJB 5CZLA 3VW5A 2JF4A 2G0DA 5MEHA 2BEDB 1H39A 1H37A 1MZCB 3WIQA 3OXUA 3EU8A 4KTPA 2EAEA 2ZISB 3E33B 3CIHA 5GY3A 3KQ4A 1V7VA 2AHFA 3S4AA 3HXFB 1S64B 3QDEA 5FO7B 1FCEA 3SAEA 1KS8A 3M7EA 1H36A 1FO3A 2NOJA 3P5PA 4KKJA 4AYOA 1QQFA 2EABA 4YDEB 1NI1B 2V8KA 1WU4A 3OEDA 4QT9A 1FT2B 2V3NA 1V5DA 3M72A 2R2LB 3WKGA 1X81B 5GZKA 4D4CA 1H35A 1KSDA 3E73A 1G9GA 3M76A 3DSWB 1D8DB 4AYPA 1FPPB 3RSYA 1S63B 4Q88A 1NL4B 2WY8A 2EACA 1FMIA 4D94A 4AYQA 4J5TA 3M74A 1R76A 1AYXA 4GTSB 1TNZB 3QPFA 3DSXB 2PMVA 4AYRA 3M7BA 1G87A 4MU9A 3QFYA 2BBCA 4ZH1A 1N94B 1KZPB 1O6HA 3P2CA 1O1SB 3PZ3B 1XW2A 2FBAA 3RX7A 1O1TB 3W7SA 3HXBB 5FO8B 1QSJA 2FUZA 3KSLB 3QT9A 2V8JA 3SQCA 3M7CA 1D8EB 5KKBA 4Z4LA 1H12A 1KSCA 2RGKA 4ZRPA 3VXDA 1LD7B 1QBQB 2ZIRB 1KKTA 2JG0A 3ANJA 1WU5A 2CQTA 3M7LA 3M78A 1H13A 4FXGB 2F0YB 2H6HB 3ACSA 3GT5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RI9 A;  5CA3 A;  3S4D A;  4AYO A;  4ZG8 A;  1H14 A;  2A8Z A;  3A3V A;  3K11 A;  2EAB A;  3WC3 A;  1IS9 A;  2OKX A;  1ULV A;  3REN A;  3X17 A;  4KTR A;  3RX8 A;  1WU4 A;  3AFJ A;  3W7X A;  4WVB A;  3RX5 A;  3W5M A;  1GAI A;  1V5D A;  5GW7 A;  4CJ0 A;  3WKG A;  2FV1 A;  1KSD A;  1G9J A;  3E73 A;  5M7Y A;  3QWT A;  2B4F A;  3W7W A;  1KWF A;  1G9G A;  2WYN A;  3QXF A;  3S4C A;  2DRR A;  5M7I A;  4AYP A;  1V7W A;  4TXT A;  3RSY A;  3WIW A;  1UT9 A;  3PMM A;  1WU6 A;  5E2J A;  3D3I A;  4Q88 A;  3QFZ A;  2D5J A;  1K72 A;  1H54 A;  5DGQ A;  2D8L A;  4CE7 A;  3QRY A;  1KFG A;  3WKF A;  1XWT A;  2EAC A;  3H2W A;  3WIR A;  1FMI A;  3H7L A;  3W5N A;  4AYQ A;  4J5T A;  4WU0 A;  4TF4 A;  4DOD A;  2ZBL A;  4XUV A;  3ANK A;  3GLY A;  1CEM A;  4JJJ A;  1FO2 A;  4L6X A;  1LF6 A;  4EL8 A;  1V7X A;  2DRQ A;  1AYX A;  1FBW A;  2DRS A;  4L0G A;  1GLM A;  3QPF A;  1VD5 A;  2GZ6 A;  5DGR A;  4CJ1 A;  2JJB A;  2P0V A;  2XFG A;  2AFA A;  1G6I A;  3EZ8 A;  2Z07 A;  4AYR A;  3TF4 A;  4Q2B A;  5CD2 A;  1G87 A;  1NC5 A;  2VN7 A;  3QFY A;  3QT3 A;  2YIK A;  1IA6 A;  1HCU A;  1LF9 A;  3RRS A;  4FUS A;  1DOG A;  1V5C A;  1KRE A;  1DL2 A;  3P2C A;  1F9O A;  1L2A A;  2GH4 A;  3E6U A;  1RQ5 A;  1XW2 A;  4DOE A;  4ZH5 A;  1FBO A;  2FV0 A;  1NXC A;  2FBA A;  3RX7 A;  1AGM A;  3ACT A;  2DRO A;  3W7S A;  3WKI A;  1WZZ A;  3WUX A;  1KRF A;  2F6D A;  1L1Y A;  3QXQ A;  2FUZ A;  4Z4J A;  3QT9 A;  2QNO A;  5CZL A;  2ZZR A;  1FAE A;  3VW5 A;  3W7U A;  2JF4 A;  3H3K A;  2EAD A;  1F9D A;  1TF4 A;  2NVP A;  5KKB A;  5MEH A;  1XWQ A;  4Z4L A;  2VN4 A;  1CLC A;  1H12 A;  2CQS A;  1KSC A;  3ANI A;  1GA2 A;  2RGK A;  3WIQ A;  3ON6 A;  3W7T A;  3QSP A;  3VXD A;  4KTP A;  2EAE A;  3WKH A;  1IA7 A;  1GAH A;  3CIH A;  5GY3 A;  1JS4 A;  1KKT A;  2JG0 A;  3GZK A;  3S4B A;  1V7V A;  1FP3 A;  2AHF A;  3ANJ A;  3S4A A;  1X9D A;  2AHG A;  1WU5 A;  2CQT A;  4WVA A;  3QDE A;  1UG9 A;  1FCE A;  3EQA A;  4WVC A;  1KS8 A;  3T33 A;  1H13 A;  3QG0 A;  3ACS A;  1FO3 A;  2RI8 A;  3GT5 A; 
#chains in the Genus database with same CATH topology
 2A8Z A;  1HM3 A;  3X17 A;  4KTR A;  1LXK A;  3E32 B;  3SDR A;  2B39 A;  4KKI A;  3RX8 A;  2FUQ A;  1RWF A;  2A73 B;  3RX5 A;  3DPY B;  1TNO B;  1G9J A;  5M7Y A;  4ONT A;  5IKH A;  1H3C A;  3W7W A;  1KWF A;  5ILK A;  2WYN A;  3QXF A;  3S4C A;  1RWG A;  1V7W A;  4F10 A;  1N23 A;  1H54 A;  2H6F B;  3NNB A;  4CE7 A;  1XWT A;  4FNV A;  4OK4 A;  1N7R A;  4WU0 A;  1CEM A;  2WII B;  4GTP B;  1V7X A;  2DRQ A;  4MBG B;  1JCQ B;  1TNU B;  2XQW A;  1GSZ A;  1O79 A;  1JCR B;  2H6I B;  3C72 B;  5DGR A;  2XFG A;  1N20 A;  4Q2B A;  3KLS A;  2XWJ B;  1OJP A;  2YIK A;  3DSS B;  1N4R B;  1N4S B;  1DOG A;  1V5C A;  4FUS A;  5ILY A;  4V1S A;  3P5R A;  3M77 A;  1F9O A;  1GXN A;  1SA5 B;  1L2A A;  2GH4 A;  5JPM B;  4GAX A;  2WIN B;  1F1S A;  1RQ5 A;  4DOE A;  4OZW A;  1FBO A;  2BRP A;  3ACT A;  2DRO A;  3G4D A;  3PZ4 B;  5FO9 B;  1WZZ A;  4L9P B;  3QXQ A;  4BOJ A;  2QNO A;  2ONG A;  4LNV A;  2E22 A;  2ZZR A;  1FAE A;  3W7U A;  3Q7F B;  3Q7A B;  4MMH A;  2EAD A;  1RWC A;  1TF4 A;  4YCR A;  2NVP A;  2WDA A;  1XWQ A;  2VN4 A;  1CLC A;  1N22 A;  3Q79 B;  2CQS A;  4M76 A;  3ANI A;  1GA2 A;  1HX9 A;  3ON6 A;  3QSP A;  3HXC B;  1GAH A;  4FJQ A;  3KSQ B;  1JS4 A;  1FP3 A;  4EHM B;  3HXE B;  1LTX B;  4WVA A;  1UG9 A;  2V3P A;  2I07 B;  3EQA A;  3DSV B;  4V1R A;  3QG0 A;  3EU5 B;  2RI8 A;  4OZV A;  1TN7 B;  1N7O A;  1KZO B;  2RI9 A;  3M73 A;  4ZG8 A;  5IK9 A;  3A3V A;  1IS9 A;  3REN A;  4LIX A;  2G02 A;  3W7X A;  3AFJ A;  5ILI A;  1N1Z A;  1W3Y A;  5GW7 A;  1TN6 B;  4CJ0 A;  2FV1 A;  1O6R A;  2GOX A;  2XWB B;  4OJZ A;  1OJM A;  4TXT A;  3WIW A;  1UT9 A;  1QAZ A;  5E2J A;  3D3I A;  3NFV A;  3QFZ A;  2WY7 A;  2D5J A;  5IK6 A;  3SDQ A;  4D4B A;  3WKF A;  3H2W A;  3WIR A;  3H7L A;  3W5N A;  4DOD A;  2ZBL A;  2PN5 A;  3GLY A;  1CB8 A;  4EL8 A;  1N7P A;  3LZ9 A;  4ZRQ A;  2DRS A;  4L0G A;  1GLM A;  2GZ6 A;  2JJB A;  5JPN B;  3PYA A;  1G6I A;  1GXM A;  3EZ8 A;  2Z07 A;  3TF4 A;  5CD2 A;  1NC5 A;  2VN7 A;  1IA6 A;  1FT1 B;  3RRS A;  5IM1 A;  5ILD A;  1SQC A;  1DL2 A;  2J5C A;  3DST B;  3CU7 A;  4D4A A;  3Q78 B;  3M75 A;  1HMU A;  3SDU A;  3E6U A;  4GTM B;  2BRW A;  4GTR B;  2FV0 A;  1W6K A;  1NXC A;  5IL8 A;  1AGM A;  4MMI A;  1TNB B;  1O1R B;  3PYB A;  3M02 A;  3Q73 B;  1KRF A;  2F6D A;  3SDV A;  3E7J A;  5EAU A;  1H3B A;  1F9G A;  4Z4J A;  2V8I A;  4C1S A;  5ILJ A;  3H3K A;  1F9D A;  1SA4 B;  3K7X A;  1HN0 A;  3M01 A;  3SFY B;  3W7T A;  3WKH A;  3G6J B;  1IA7 A;  1C3D A;  4D4D A;  3GZK A;  3S4B A;  1X9D A;  2AHG A;  4LNB B;  1TNY B;  5DHI A;  3EUV B;  4WVC A;  3S9V A;  3T33 A;  1DCE B;  3DSU B;  1C82 A;  5CA3 A;  3S4D A;  1H14 A;  3K11 A;  3WC3 A;  2OKX A;  1ULV A;  3HXD B;  2BRV X;  3D5S A;  3E30 B;  4GTT B;  3W5M A;  4WVB A;  1GAI A;  1TN8 B;  1HZF A;  3Q75 B;  1W6J A;  3QWT A;  2B4F A;  4OK2 A;  3RJ3 A;  2DRR A;  3A0O A;  4LNG B;  5M7I A;  2BB6 A;  2H6G B;  3PMM A;  3PZ1 B;  1WU6 A;  4GTO B;  3E34 B;  5IKA A;  1K72 A;  5DGQ A;  5IL3 A;  2D8L A;  3QRY A;  5FOB B;  1KFG A;  1N4Q B;  4YDO B;  1JCS B;  1RWH A;  4TF4 A;  5JMD A;  1N95 B;  2E24 A;  1N9A B;  3ANK A;  4FXK B;  4XUV A;  4JJJ A;  2SQC A;  1FO2 A;  1O6Q A;  3DRA B;  4L6X A;  1LF6 A;  2ONH A;  4BOK A;  1FBW A;  5AGD A;  1GXO A;  3G4F A;  4GL3 A;  3SFX B;  1VD5 A;  1HXC A;  4CJ1 A;  2P0V A;  2AFA A;  3PZ2 B;  3N0F A;  3QT3 A;  1X1I A;  1N4P B;  1LF9 A;  1HCU A;  3SDT A;  1N1B A;  1KRE A;  1H3A A;  1UMP A;  1LD8 B;  5IK0 A;  1HMW A;  1O5M B;  4ZH5 A;  4DI5 A;  4GTQ B;  2BB5 A;  3WKI A;  1GHQ A;  3WUX A;  1L1Y A;  5ILH A;  3D5R A;  3E37 B;  4NEI A;  3M71 A;  4GTV B;  2IEJ B;  5CZL A;  1N21 A;  1J0M A;  3VW5 A;  2JF4 A;  2G0D A;  5MEH A;  2BED B;  4RNQ A;  1H39 A;  1H37 A;  1MZC B;  3WIQ A;  3OXU A;  3EU8 A;  4KTP A;  2EAE A;  5DHK A;  2ZIS B;  3E33 B;  3CIH A;  1HV6 A;  5GY3 A;  3KQ4 A;  1OJO A;  1V7V A;  2AHF A;  3S4A A;  3HXF B;  1S64 B;  3QDE A;  5FO7 B;  5EAT A;  5ILZ A;  1FCE A;  3SAE A;  1KS8 A;  3M7E A;  1H36 A;  2WCO A;  3E80 A;  1FO3 A;  2NOJ A;  5C05 A;  3P5P A;  4KKJ A;  4AYO A;  1QQF A;  2EAB A;  4YDE B;  3VSM A;  3M00 A;  1NI1 B;  2V8K A;  1WU4 A;  3OED A;  4QT9 A;  1FT2 B;  2V3N A;  1V5D A;  5EAS A;  3M72 A;  2R2L B;  3WKG A;  1RW9 A;  1X81 B;  5GZK A;  1EGU A;  1H35 A;  1KSD A;  4D4C A;  3E73 A;  5JMF A;  1OJN A;  1G9G A;  3M76 A;  3DSW B;  1D8D B;  1LOH A;  3AFL A;  4AYP A;  1FPP B;  3RSY A;  1S63 B;  4Q88 A;  1NL4 B;  2WY8 A;  2X03 A;  2EAC A;  1FMI A;  4D94 A;  4AYQ A;  4J5T A;  3M74 A;  1R76 A;  1AYX A;  1I8Q A;  1N7N A;  4GTS B;  1TNZ B;  3QPF A;  3VSN A;  3DSX B;  2PMV A;  4AYR A;  1HXA A;  3M7B A;  1G87 A;  4MU9 A;  3QFY A;  2FUT A;  2BBC A;  4ZH1 A;  1N94 B;  1HXG A;  1KZP B;  1O6H A;  3P2C A;  1LXM A;  1O1S B;  3PZ3 B;  1XW2 A;  2FBA A;  3RX7 A;  1O1T B;  3W7S A;  4F13 A;  1J0N A;  3HXB B;  5FO8 B;  1X1J A;  1QSJ A;  3N0G A;  4E1Y A;  2FUZ A;  1N24 A;  3KSL B;  3QT9 A;  2V8J A;  3SQC A;  2Q1F A;  1D8E B;  3M7C A;  1N7Q A;  5KKB A;  4Z4L A;  1H12 A;  1KSC A;  2RGK A;  4ZRP A;  3VXD A;  1LD7 B;  1QBQ B;  2ZIR B;  1KKT A;  2JG0 A;  3ANJ A;  1WU5 A;  2CQT A;  1RWA A;  1X1H A;  3M7L A;  1HM2 A;  3M78 A;  1H13 A;  4FXG B;  2F0Y B;  2H6H B;  3ACS A;  3GT5 A; 
#chains in the Genus database with same CATH homology
 2A8Z A;  3X17 A;  4KTR A;  3E32 B;  3SDR A;  2B39 A;  4KKI A;  3RX8 A;  2A73 B;  3RX5 A;  3DPY B;  1TNO B;  1G9J A;  5M7Y A;  4ONT A;  1H3C A;  3W7W A;  1KWF A;  2WYN A;  3QXF A;  3S4C A;  1V7W A;  1H54 A;  2H6F B;  4CE7 A;  1XWT A;  4WU0 A;  1CEM A;  2WII B;  4GTP B;  1V7X A;  2DRQ A;  4MBG B;  1JCQ B;  1TNU B;  2XQW A;  1GSZ A;  1O79 A;  1JCR B;  2H6I B;  3C72 B;  5DGR A;  2XFG A;  4Q2B A;  3KLS A;  2XWJ B;  2YIK A;  3DSS B;  1N4R B;  1N4S B;  1DOG A;  1V5C A;  4FUS A;  4V1S A;  3P5R A;  3M77 A;  1F9O A;  1GXN A;  1SA5 B;  1L2A A;  2GH4 A;  5JPM B;  2WIN B;  1RQ5 A;  4DOE A;  1FBO A;  3ACT A;  2DRO A;  3PZ4 B;  5FO9 B;  1WZZ A;  4L9P B;  3QXQ A;  4BOJ A;  2QNO A;  4LNV A;  2ZZR A;  1FAE A;  3W7U A;  3Q7F B;  3Q7A B;  4YCR A;  2EAD A;  2NVP A;  1TF4 A;  1XWQ A;  2VN4 A;  1CLC A;  3Q79 B;  2CQS A;  4M76 A;  3ANI A;  1GA2 A;  3ON6 A;  3QSP A;  3HXC B;  1GAH A;  3KSQ B;  1JS4 A;  1FP3 A;  4EHM B;  3HXE B;  1LTX B;  4WVA A;  1UG9 A;  2V3P A;  2I07 B;  3EQA A;  3DSV B;  4V1R A;  3QG0 A;  3EU5 B;  2RI8 A;  1TN7 B;  2RI9 A;  1KZO B;  3M73 A;  4ZG8 A;  3A3V A;  1IS9 A;  3REN A;  4LIX A;  2G02 A;  3W7X A;  3AFJ A;  5GW7 A;  1TN6 B;  4CJ0 A;  2FV1 A;  1O6R A;  2GOX A;  2XWB B;  4TXT A;  3WIW A;  1UT9 A;  5E2J A;  3D3I A;  3QFZ A;  2WY7 A;  2D5J A;  3SDQ A;  4D4B A;  3WKF A;  3H2W A;  3WIR A;  3H7L A;  3W5N A;  4DOD A;  2ZBL A;  2PN5 A;  3GLY A;  4EL8 A;  4ZRQ A;  2DRS A;  4L0G A;  1GLM A;  2GZ6 A;  2JJB A;  5JPN B;  3PYA A;  1G6I A;  1GXM A;  3EZ8 A;  2Z07 A;  3TF4 A;  5CD2 A;  1NC5 A;  2VN7 A;  1IA6 A;  1FT1 B;  3RRS A;  1SQC A;  1DL2 A;  3DST B;  3CU7 A;  4D4A A;  3Q78 B;  3M75 A;  3SDU A;  3E6U A;  4GTM B;  4GTR B;  2FV0 A;  1W6K A;  1NXC A;  1AGM A;  1TNB B;  1O1R B;  3PYB A;  3Q73 B;  1KRF A;  2F6D A;  3SDV A;  1H3B A;  4Z4J A;  2V8I A;  4C1S A;  3H3K A;  1F9D A;  1SA4 B;  3K7X A;  3SFY B;  3W7T A;  3WKH A;  3G6J B;  1IA7 A;  1C3D A;  4D4D A;  3GZK A;  3S4B A;  1X9D A;  2AHG A;  4LNB B;  1TNY B;  3EUV B;  4WVC A;  3S9V A;  3T33 A;  1DCE B;  3DSU B;  5CA3 A;  3S4D A;  1H14 A;  3K11 A;  3WC3 A;  2OKX A;  1ULV A;  3HXD B;  3D5S A;  3E30 B;  4GTT B;  3W5M A;  4WVB A;  1GAI A;  1TN8 B;  1HZF A;  3Q75 B;  1W6J A;  3QWT A;  2B4F A;  3RJ3 A;  2DRR A;  4LNG B;  5M7I A;  2BB6 A;  2H6G B;  3PMM A;  3PZ1 B;  1WU6 A;  4GTO B;  3E34 B;  1K72 A;  5DGQ A;  2D8L A;  3QRY A;  5FOB B;  1KFG A;  1N4Q B;  4YDO B;  1JCS B;  4TF4 A;  1N95 B;  3ANK A;  1N9A B;  4FXK B;  4XUV A;  4JJJ A;  2SQC A;  1FO2 A;  1O6Q A;  3DRA B;  4L6X A;  1LF6 A;  4BOK A;  1FBW A;  5AGD A;  1GXO A;  4GL3 A;  3SFX B;  1VD5 A;  4CJ1 A;  2P0V A;  2AFA A;  3PZ2 B;  3QT3 A;  1N4P B;  1LF9 A;  1HCU A;  3SDT A;  1UMP A;  1KRE A;  1H3A A;  1LD8 B;  1O5M B;  4ZH5 A;  4GTQ B;  2BB5 A;  3WKI A;  1GHQ A;  3WUX A;  1L1Y A;  3D5R A;  3E37 B;  3M71 A;  4GTV B;  2IEJ B;  5CZL A;  3VW5 A;  2JF4 A;  2G0D A;  5MEH A;  2BED B;  1H39 A;  1H37 A;  1MZC B;  3WIQ A;  3OXU A;  3EU8 A;  4KTP A;  2EAE A;  2ZIS B;  3E33 B;  3CIH A;  5GY3 A;  3KQ4 A;  1V7V A;  2AHF A;  3S4A A;  3HXF B;  1S64 B;  3QDE A;  5FO7 B;  1FCE A;  3SAE A;  1KS8 A;  3M7E A;  1H36 A;  1FO3 A;  2NOJ A;  3P5P A;  4KKJ A;  4AYO A;  1QQF A;  2EAB A;  4YDE B;  1NI1 B;  2V8K A;  1WU4 A;  3OED A;  4QT9 A;  1FT2 B;  2V3N A;  1V5D A;  3M72 A;  2R2L B;  3WKG A;  1X81 B;  5GZK A;  4D4C A;  1H35 A;  1KSD A;  3E73 A;  1G9G A;  3M76 A;  3DSW B;  1D8D B;  4AYP A;  1FPP B;  3RSY A;  1S63 B;  4Q88 A;  1NL4 B;  2WY8 A;  2EAC A;  1FMI A;  4D94 A;  4AYQ A;  4J5T A;  3M74 A;  1R76 A;  1AYX A;  4GTS B;  1TNZ B;  3QPF A;  3DSX B;  2PMV A;  4AYR A;  3M7B A;  1G87 A;  4MU9 A;  3QFY A;  2BBC A;  4ZH1 A;  1N94 B;  1KZP B;  1O6H A;  3P2C A;  1O1S B;  3PZ3 B;  1XW2 A;  2FBA A;  3RX7 A;  1O1T B;  3W7S A;  3HXB B;  5FO8 B;  1QSJ A;  2FUZ A;  3KSL B;  3QT9 A;  2V8J A;  3SQC A;  3M7C A;  1D8E B;  5KKB A;  4Z4L A;  1H12 A;  1KSC A;  2RGK A;  4ZRP A;  3VXD A;  1LD7 B;  1QBQ B;  2ZIR B;  1KKT A;  2JG0 A;  3ANJ A;  1WU5 A;  2CQT A;  3M7L A;  3M78 A;  1H13 A;  4FXG B;  2F0Y B;  2H6H B;  3ACS A;  3GT5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...