5GY3A

The crystal structure of endoglucanase cel10, a family 8 glycosyl hydrolase from klebsiella pneumoniae
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
310
structure length
310
Chain Sequence
DTAWERYKARFMMPDGRIIDTANGNVSHTEGQGFAMLLAVANNDRPAFDKLWQWTDSTLRDKSNGLFYWRYNPVAPDPIADKNNASDGDTLIAWALLRAQKQWQDKRYAIASDAITASLLKYTVVTFAGRQVMLPGVKGFNLNDHLNLNPSYFIFPAWRAFAERTHLTAWRTLQTDGQALLGQMGWGKSHLPSDWVALRADGKMLPAKEWPPRMSFDAIRIPLYLSWADPQSALLAPWKAWMQSYPRLQTPAWINVSTNEVAPWYMAGGLLAVRDLTLGEPQEAPQIDDKDDYYSASLKQLVWLAKQDQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glucanase
publication title The crystal structure of the endoglucanase Cel10, a family 8 glycosyl hydrolase from Klebsiella pneumoniae
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Hydrolase
total genus 108
structure length 310
sequence length 310
ec nomenclature ec 3.2.1.-:
pdb deposition date 2016-09-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.10 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 5gy3A00
1NC5A 2P0VA 3H2WA 5MEHA 1LF9A 3QG0A 1HCUA 1WU5A 1X9DA 2AHGA 2B4FA 5CD2A 2GZ6A 1NXCA 1KFGA 1XW2A 1FBOA 4Q2BA 4WVAA 1LF6A 3QPFA 5GY3A 1WU6A 3WIQA 4WU0A 3GZKA 3VXDA 2DRQA 4L6XA 3ACTA 3VW5A 3E73A 1XWQA 2QNOA 3QFYA 3RENA 4CE7A 1GAIA 4JJJA 4ZH5A 5KKBA 5DGQA 2WYNA 3ANIA 3WIRA 5GW7A 1V5CA 3TF4A 1KWFA 1H13A 3QWTA 1L2AA 3WUXA 2XFGA 1CEMA 1FBWA 1G87A 3RX8A 5M7YA 2FV1A 2JJBA 1XWTA 5DGRA 1WZZA 1FO2A 4Q88A 3QSPA 3S4CA 3QXQA 3WC3A 3W7XA 2EADA 2EABA 2F6DA 4WVBA 3E6UA 1ULVA 4J5TA 3H7LA 2DRRA 2DROA 1WU4A 3WKHA 4L0GA 2EAEA 4AYQA 1V5DA 3QDEA 2NVPA 2A8ZA 3WKFA 1V7VA 1IA6A 4FUSA 3K11A 3GLYA 1GA2A 4AYOA 1L1YA 4TF4A 2RI9A 5CZLA 3EZ8A 2RI8A 3W5MA 3T33A 3QXFA 2VN4A 4Z4JA 5E2JA 1KRFA 4Z4LA 1CLCA 4WVCA 3QT3A 1FAEA 1IA7A 1FMIA 4KTRA 1F9OA 1GLMA 1IS9A 2JG0A 3AFJA 1FCEA 3PMMA 5M7IA 3ON6A 1FP3A 1VD5A 2YIKA 3CIHA 2D5JA 3X17A 4CJ1A 1G6IA 3QT9A 3RRSA 3WKGA 1FO3A 2CQSA 3WIWA 4DOEA 4ZG8A 4CJ0A 1RQ5A 2D8LA 1JS4A 1G9GA 1G9JA 1KKTA 1AGMA 3RX7A 3RSYA 2JF4A 1V7XA 4KTPA 3WKIA 1KSCA 1H54A 2FUZA 3S4DA 4DODA 1DL2A 2ZBLA 1F9DA 4EL8A 3W7WA 3ANJA 2FV0A 5CA3A 2VN7A 3ACSA 3W7TA 2RGKA 3QFZA 2AHFA 3P2CA 4AYPA 2AFAA 3QRYA 2Z07A 1DOGA 1UT9A 3ANKA 1TF4A 1KS8A 4TXTA 1GAHA 2DRSA 2EACA 1K72A 2CQTA 3D3IA 1H14A 3GT5A 3W5NA 4XUVA 3RX5A 4AYRA 1KSDA 1V7WA 2FBAA 3A3VA 3EQAA 3S4AA 3S4BA 2GH4A 1H12A 3W7SA 1UG9A 3W7UA 2OKXA 3H3KA 1KREA 2ZZRA 1AYXA
chains in the Genus database with same CATH superfamily
1NC5A 1I8QA 5CD2A 1X9DA 2GZ6A 3WIQA 3SQCA 4WU0A 3M75A 3PZ4B 1N4PB 1TNZB 3E73A 1N21A 4JJJA 5EASA 3WIRA 1N23A 1H13A 3WUXA 4FNVA 1GXNA 1SA5B 3VSNA 1XWTA 1N94B 3HXBB 2SQCA 1N9AB 3QSPA 1OJNA 3W7XA 1N22A 2F6DA 2V8KA 2DROA 1LTXB 3WKHA 2EAEA 2NVPA 3QDEA 2A73B 3WKFA 1N7OA 1V7VA 3K11A 1JCRB 1GA2A 4LNBB 2RI9A 1LD7B 3EZ8A 3Q75B 3KQ4A 3QXFA 3DPYB 1LOHA 1FAEA 1IS9A 4ZRPA 5C05A 1HV6A 3ON6A 1NL4B 2BEDB 5IK0A 3X17A 1MZCB 1G6IA 3RRSA 1JCQB 1FO3A 2CQSA 1S64B 3M76A 1G9GA 1G9JA 1KKTA 3DSUB 5ILIA 3RJ3A 2FUZA 4DODA 1RWFA 3E34B 1LXMA 4FXGB 2FUTA 2WINB 4D4CA 1H37A 1UT9A 3ANKA 1KS8A 4TXTA 2DRSA 1J0NA 1SA4B 3K7XA 5JPNB 2CQTA 4ONTA 5ILZA 1H14A 3G6JB 5EAUA 2XQWA 1V7WA 4AYRA 3SAEA 4GTQB 1D8DB 1TNOB 1W6KA 2ZZRA 2P0VA 3H2WA 1LF9A 3QG0A 2NOJA 3EU8A 4NEIA 1N4RB 3E33B 1KFGA 4D94A 1FBOA 4Q2BA 4WVAA 4V1SA 1LF6A 3E37B 1N95B 5ILDA 4OK2A 3GZKA 3VXDA 5DHIA 3OEDA 2WCOA 3PYBA 1O6RA 3QFYA 3SDRA 5DGQA 2V3PA 5GW7A 3QWTA 1L2AA 1TNYB 3E32B 1H35A 1CEMA 1FBWA 4V1RA 4C1SA 4D4DA 2F0YB 3M7BA 4OK4A 2FV1A 2JJBA 4F13A 1OJOA 1WZZA 5DGRA 1GHQA 1HN0A 1HMUA 3QXQA 3WC3A 4WVBA 5IM1A 1ULVA 3HXFB 4L0GA 1HZFA 3S9VA 1HM2A 1DCEB 1IA6A 4LNGB 4FUSA 3GLYA 2GOXA 1F9GA 3M77A 3SFYB 5CZLA 1QSJA 2RI8A 4ZRQA 4LNVA 3P5PA 2VN4A 4Z4JA 5E2JA 2PMVA 4F10A 4GTTB 1N7PA 1N1BA 1N20A 1CLCA 4WVCA 1IA7A 1F9OA 2Q1FA 2G0DA 2R2LB 5M7IA 4RNQA 3M72A 1UMPA 1VD5A 1OJPA 2YIKA 3D5SA 1GSZA 4MMIA 4MMHA 3E7JA 4DOEA 3HXEB 1W6JA 1C3DA 3RX7A 1V7XA 1KSCA 1CB8A 4YDOB 5EATA 3W7TA 2RGKA 4YDEB 3PYAA 3VSMA 2Z07A 5IKHA 1C82A 1O5MB 2V3NA 3KSLB 2EACA 1K72A 3D3IA 3M01A 3W5NA 4XUVA 3RX5A 1KSDA 3EQAA 3S4BA 5ILJA 1O6HA 3HXDB 3EUVB 4D4AA 4M76A 3OXUA 1UG9A 2OKXA 4GAXA 3HXCB 1D8EB 1HCUA 2B4FA 3Q79B 4LIXA 1XW2A 3QPFA 5GY3A 4DI5A 3E30B 3NFVA 1WU6A 2ONGA 1W3YA 2DRQA 4L6XA 3ACTA 4GTMB 1XWQA 2QNOA 1N4QB 4OZWA 4E1YA 4CE7A 1GAIA 4BOKA 5KKBA 1H3CA 3CU7A 3TF4A 1KWFA 1O1SB 3EU5B 1GXOA 3LZ9A 3M00A 2XFGA 1O1TB 2WIIB 1G87A 5ILHA 1O79A 4Q88A 1QAZA 5FO7B 4MBGB 2EADA 2EABA 1TNBB 1HXAA 2DRRA 3H7LA 1WU4A 1N7NA 4KKJA 3SDTA 4AYQA 5IL3A 1TN8B 1QBQB 3KSQB 2IEJB 4L9PB 1J0MA 2WDAA 3DSVB 3T33A 3W5MA 1KRFA 1FT1B 3DSSB 1O1RB 4Z4LA 3SFXB 2XWJB 1S63B 3KLSA 3QT3A 2ONHA 1FMIA 4KTRA 4EHMB 1GLMA 2E22A 2ZIRB 3AFJA 3M78A 3M71A 4MU9A 3PMMA 5JMDA 2E24A 3PZ2B 3CIHA 2PN5A 4GTPB 3WKGA 1H36A 3M7LA 5FO8B 1RQ5A 1X1HA 2D8LA 1HM3A 4KTPA 3WKIA 4GTRB 3S4DA 1DL2A 1N7QA 1F9DA 2I07B 2ZBLA 3W7WA 5IK6A 1LD8B 2BRWA 1RW9A 2FV0A 5CA3A 3M7CA 2VN7A 3SDUA 3M7EA 3QFZA 4GL3A 2AFAA 1OJMA 3QRYA 1HXCA 1TF4A 3PZ1B 1GAHA 1EGUA 1H39A 4GTSB 1X81B 2V8JA 5FOBB 2FBAA 3S4AA 3M74A 2X03A 1LXKA 5ILKA 1H3AA 3W7UA 1N24A 1N7RA 1SQCA 3SDQA 1RWCA 2V8IA 5IKAA 1FT2B 3D5RA 2H6GB 5MEHA 1WU5A 2AHGA 2WY7A 1NXCA 4BOJA 1QQFA 3Q7AB 3M73A 5JMFA 2BRPA 3VW5A 4D4BA 1X1JA 4OZVA 3RENA 4ZH5A 5DHKA 4GTVB 3G4DA 2WYNA 3ANIA 1RWHA 1FPPB 5IK9A 1V5CA 1X1IA 3G4FA 5JPMB 2WY8A 1N4SB 4FXKB 3RX8A 5M7YA 2H6IB 1FO2A 1KZPB 3N0GA 3S4CA 1NI1B 3E6UA 4J5TA 4KKIA 1V5DA 3C72B 3E80A 2XWBB 2A8ZA 2J5CA 1N1ZA 1TNUB 4AYOA 1L1YA 4TF4A 1GXMA 1HX9A 1HMWA 2H6FB 1HXGA 3DRAB 4YCRA 1TN7B 4ZH1A 3Q78B 5GZKA 1RWAA 3A0OA 2JG0A 3Q73B 2BB5A 1FCEA 1FP3A 1O6QA 2H6HB 2D5JA 2ZISB 4CJ1A 3P5RA 3QT9A 1F1SA 3AFLA 4OJZA 3WIWA 3PZ3B 3DSWB 3NNBA 4FJQA 4ZG8A 4CJ0A 1JS4A 1R76A 1AGMA 3RSYA 2JF4A 3N0FA 1TN6B 1H54A 4GTOB 3SDVA 5IL8A 2G02A 2BB6A 4EL8A 2B39A 2FUQA 5AGDA 3ANJA 3ACSA 2BRVX 2AHFA 3P2CA 4AYPA 1JCSB 1DOGA 4QT9A 3DSTB 5FO9B 3GT5A 1RWGA 5ILYA 3A3VA 1KZOB 3M02A 2GH4A 1H12A 3W7SA 3H3KA 1KREA 3Q7FB 1H3BA 3DSXB 2BBCA 1AYXA
chains in the Genus database with same CATH topology
1NC5A 5CD2A 1X9DA 2GZ6A 3WIQA 3SQCA 4WU0A 3M75A 3PZ4B 1N4PB 1TNZB 3E73A 4JJJA 3WIRA 1H13A 3WUXA 1GXNA 1SA5B 1XWTA 1N94B 3HXBB 2SQCA 1N9AB 3QSPA 3W7XA 2F6DA 2V8KA 2DROA 1LTXB 3WKHA 2EAEA 2NVPA 3QDEA 2A73B 3WKFA 1V7VA 3K11A 1JCRB 1GA2A 4LNBB 2RI9A 1LD7B 3EZ8A 3Q75B 3KQ4A 3QXFA 3DPYB 1FAEA 1IS9A 4ZRPA 3ON6A 1NL4B 2BEDB 3X17A 1MZCB 1G6IA 3RRSA 1JCQB 1FO3A 2CQSA 1S64B 3M76A 1G9GA 1G9JA 1KKTA 3DSUB 3RJ3A 2FUZA 4DODA 3E34B 4FXGB 2WINB 4D4CA 1H37A 1UT9A 3ANKA 1KS8A 4TXTA 2DRSA 3K7XA 1SA4B 5JPNB 2CQTA 4ONTA 1H14A 3G6JB 2XQWA 1V7WA 4AYRA 3SAEA 4GTQB 1D8DB 1TNOB 1W6KA 2ZZRA 2P0VA 3H2WA 1LF9A 3QG0A 2NOJA 3EU8A 1N4RB 3E33B 1KFGA 4D94A 1FBOA 4Q2BA 4WVAA 4V1SA 1LF6A 3E37B 1N95B 3GZKA 3VXDA 3OEDA 3PYBA 1O6RA 3QFYA 3SDRA 5DGQA 2V3PA 5GW7A 3QWTA 1L2AA 1TNYB 3E32B 1H35A 1CEMA 1FBWA 4V1RA 4C1SA 4D4DA 2F0YB 3M7BA 2FV1A 2JJBA 5DGRA 1WZZA 1GHQA 3QXQA 3WC3A 4WVBA 1ULVA 3HXFB 4L0GA 1HZFA 3S9VA 1DCEB 1IA6A 4LNGB 4FUSA 3GLYA 2GOXA 3M77A 3SFYB 5CZLA 1QSJA 2RI8A 4ZRQA 4LNVA 3P5PA 2VN4A 4Z4JA 5E2JA 2PMVA 4GTTB 1CLCA 4WVCA 1IA7A 1F9OA 2G0DA 2R2LB 5M7IA 3M72A 1UMPA 1VD5A 2YIKA 3D5SA 1GSZA 4DOEA 3HXEB 1W6JA 1C3DA 3RX7A 1V7XA 1KSCA 4YDOB 3W7TA 2RGKA 4YDEB 3PYAA 2Z07A 1O5MB 2V3NA 3KSLB 2EACA 1K72A 3D3IA 3W5NA 4XUVA 3RX5A 1KSDA 3EQAA 3S4BA 1O6HA 3HXDB 3EUVB 4D4AA 4M76A 3OXUA 1UG9A 2OKXA 3HXCB 1D8EB 1HCUA 2B4FA 3Q79B 4LIXA 1XW2A 3QPFA 5GY3A 3E30B 1WU6A 2DRQA 4L6XA 3ACTA 4GTMB 1XWQA 2QNOA 1N4QB 4CE7A 1GAIA 4BOKA 5KKBA 1H3CA 3CU7A 3TF4A 1KWFA 1O1SB 3EU5B 1GXOA 2XFGA 1O1TB 2WIIB 1G87A 1O79A 4Q88A 5FO7B 4MBGB 2EADA 2EABA 1TNBB 3H7LA 2DRRA 1WU4A 4KKJA 3SDTA 4AYQA 1TN8B 1QBQB 3KSQB 2IEJB 4L9PB 3W5MA 3DSVB 3T33A 1KRFA 1FT1B 3DSSB 1O1RB 4Z4LA 3SFXB 2XWJB 1S63B 3KLSA 3QT3A 1FMIA 4KTRA 4EHMB 1GLMA 2ZIRB 3AFJA 3M78A 3M71A 4MU9A 3PMMA 3PZ2B 3CIHA 2PN5A 4GTPB 3WKGA 1H36A 3M7LA 5FO8B 1RQ5A 2D8LA 4KTPA 3WKIA 4GTRB 3S4DA 1DL2A 2ZBLA 1F9DA 2I07B 3W7WA 1LD8B 2FV0A 5CA3A 3M7CA 2VN7A 3SDUA 3M7EA 3QFZA 4GL3A 2AFAA 3QRYA 1TF4A 3PZ1B 1GAHA 1H39A 4GTSB 1X81B 2V8JA 5FOBB 2FBAA 3S4AA 3M74A 1H3AA 3W7UA 1SQCA 3SDQA 2V8IA 1FT2B 3D5RA 2H6GB 5MEHA 1WU5A 2AHGA 2WY7A 1NXCA 4BOJA 1QQFA 3Q7AB 3M73A 3VW5A 4D4BA 3RENA 4ZH5A 4GTVB 2WYNA 3ANIA 1FPPB 1V5CA 5JPMB 2WY8A 1N4SB 4FXKB 3RX8A 5M7YA 2H6IB 1FO2A 1KZPB 3S4CA 1NI1B 3E6UA 4J5TA 4KKIA 1V5DA 3C72B 2XWBB 2A8ZA 1TNUB 4AYOA 1L1YA 4TF4A 1GXMA 2H6FB 3DRAB 4YCRA 1TN7B 4ZH1A 3Q78B 5GZKA 2JG0A 3Q73B 2BB5A 1FCEA 1FP3A 1O6QA 2H6HB 2D5JA 2ZISB 4CJ1A 3P5RA 3QT9A 3WIWA 3PZ3B 3DSWB 4ZG8A 4CJ0A 1JS4A 1R76A 1AGMA 3RSYA 2JF4A 4GTOB 1TN6B 1H54A 3SDVA 4EL8A 2G02A 2BB6A 2B39A 5AGDA 3ANJA 3ACSA 2AHFA 3P2CA 4AYPA 1JCSB 1DOGA 4QT9A 3DSTB 5FO9B 3GT5A 3A3VA 1KZOB 2GH4A 1H12A 3W7SA 3H3KA 1KREA 3Q7FB 1H3BA 3DSXB 2BBCA 1AYXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NC5 A;  2P0V A;  3H2W A;  5MEH A;  1LF9 A;  3QG0 A;  1HCU A;  1WU5 A;  1X9D A;  2AHG A;  2B4F A;  5CD2 A;  2GZ6 A;  1NXC A;  1KFG A;  1XW2 A;  1FBO A;  4Q2B A;  4WVA A;  1LF6 A;  3QPF A;  5GY3 A;  1WU6 A;  3WIQ A;  4WU0 A;  3GZK A;  3VXD A;  2DRQ A;  4L6X A;  3ACT A;  3VW5 A;  3E73 A;  1XWQ A;  2QNO A;  3QFY A;  3REN A;  4CE7 A;  1GAI A;  4JJJ A;  4ZH5 A;  5KKB A;  5DGQ A;  2WYN A;  3ANI A;  3WIR A;  5GW7 A;  1V5C A;  3TF4 A;  1KWF A;  1H13 A;  3QWT A;  1L2A A;  3WUX A;  2XFG A;  1CEM A;  1FBW A;  1G87 A;  3RX8 A;  5M7Y A;  2FV1 A;  2JJB A;  1XWT A;  5DGR A;  1WZZ A;  1FO2 A;  4Q88 A;  3QSP A;  3S4C A;  3QXQ A;  3WC3 A;  3W7X A;  2EAD A;  2EAB A;  2F6D A;  4WVB A;  3E6U A;  1ULV A;  4J5T A;  3H7L A;  2DRR A;  2DRO A;  1WU4 A;  3WKH A;  4L0G A;  2EAE A;  4AYQ A;  1V5D A;  3QDE A;  2NVP A;  2A8Z A;  3WKF A;  1V7V A;  1IA6 A;  4FUS A;  3K11 A;  3GLY A;  1GA2 A;  4AYO A;  1L1Y A;  4TF4 A;  2RI9 A;  5CZL A;  3EZ8 A;  2RI8 A;  3W5M A;  3T33 A;  3QXF A;  2VN4 A;  4Z4J A;  5E2J A;  1KRF A;  4Z4L A;  1CLC A;  4WVC A;  3QT3 A;  1FAE A;  1IA7 A;  1FMI A;  4KTR A;  1F9O A;  1GLM A;  1IS9 A;  2JG0 A;  3AFJ A;  1FCE A;  3PMM A;  5M7I A;  3ON6 A;  1FP3 A;  1VD5 A;  2YIK A;  3CIH A;  2D5J A;  3X17 A;  4CJ1 A;  1G6I A;  3QT9 A;  3RRS A;  3WKG A;  1FO3 A;  2CQS A;  3WIW A;  4DOE A;  4ZG8 A;  4CJ0 A;  1RQ5 A;  2D8L A;  1JS4 A;  1G9G A;  1G9J A;  1KKT A;  1AGM A;  3RX7 A;  3RSY A;  2JF4 A;  1V7X A;  4KTP A;  3WKI A;  1KSC A;  1H54 A;  2FUZ A;  3S4D A;  4DOD A;  1DL2 A;  2ZBL A;  1F9D A;  4EL8 A;  3W7W A;  3ANJ A;  2FV0 A;  5CA3 A;  2VN7 A;  3ACS A;  3W7T A;  2RGK A;  3QFZ A;  2AHF A;  3P2C A;  4AYP A;  2AFA A;  3QRY A;  2Z07 A;  1DOG A;  1UT9 A;  3ANK A;  1TF4 A;  1KS8 A;  4TXT A;  1GAH A;  2DRS A;  2EAC A;  1K72 A;  2CQT A;  3D3I A;  1H14 A;  3GT5 A;  3W5N A;  4XUV A;  3RX5 A;  4AYR A;  1KSD A;  1V7W A;  2FBA A;  3A3V A;  3EQA A;  3S4A A;  3S4B A;  2GH4 A;  1H12 A;  3W7S A;  1UG9 A;  3W7U A;  2OKX A;  3H3K A;  1KRE A;  2ZZR A;  1AYX A; 
#chains in the Genus database with same CATH topology
 1NC5 A;  1I8Q A;  5CD2 A;  1X9D A;  2GZ6 A;  3WIQ A;  3SQC A;  4WU0 A;  3M75 A;  3PZ4 B;  1N4P B;  1TNZ B;  3E73 A;  1N21 A;  4JJJ A;  5EAS A;  3WIR A;  1N23 A;  1H13 A;  3WUX A;  4FNV A;  1GXN A;  1SA5 B;  3VSN A;  1XWT A;  1N94 B;  3HXB B;  2SQC A;  1N9A B;  3QSP A;  1OJN A;  3W7X A;  1N22 A;  2F6D A;  2V8K A;  2DRO A;  1LTX B;  3WKH A;  2EAE A;  2NVP A;  3QDE A;  2A73 B;  3WKF A;  1N7O A;  1V7V A;  3K11 A;  1JCR B;  1GA2 A;  4LNB B;  2RI9 A;  1LD7 B;  3EZ8 A;  3Q75 B;  3KQ4 A;  3QXF A;  3DPY B;  1LOH A;  1FAE A;  1IS9 A;  4ZRP A;  5C05 A;  1HV6 A;  3ON6 A;  1NL4 B;  2BED B;  5IK0 A;  3X17 A;  1MZC B;  1G6I A;  3RRS A;  1JCQ B;  1FO3 A;  2CQS A;  1S64 B;  3M76 A;  1G9G A;  1G9J A;  1KKT A;  3DSU B;  5ILI A;  3RJ3 A;  2FUZ A;  4DOD A;  1RWF A;  3E34 B;  1LXM A;  4FXG B;  2FUT A;  2WIN B;  4D4C A;  1H37 A;  1UT9 A;  3ANK A;  1KS8 A;  4TXT A;  2DRS A;  1J0N A;  1SA4 B;  3K7X A;  5JPN B;  2CQT A;  4ONT A;  5ILZ A;  1H14 A;  3G6J B;  5EAU A;  2XQW A;  1V7W A;  4AYR A;  3SAE A;  4GTQ B;  1D8D B;  1TNO B;  1W6K A;  2ZZR A;  2P0V A;  3H2W A;  1LF9 A;  3QG0 A;  2NOJ A;  3EU8 A;  4NEI A;  1N4R B;  3E33 B;  1KFG A;  4D94 A;  1FBO A;  4Q2B A;  4WVA A;  4V1S A;  1LF6 A;  3E37 B;  1N95 B;  5ILD A;  4OK2 A;  3GZK A;  3VXD A;  5DHI A;  3OED A;  2WCO A;  3PYB A;  1O6R A;  3QFY A;  3SDR A;  5DGQ A;  2V3P A;  5GW7 A;  3QWT A;  1L2A A;  1TNY B;  3E32 B;  1H35 A;  1CEM A;  1FBW A;  4V1R A;  4C1S A;  4D4D A;  2F0Y B;  3M7B A;  4OK4 A;  2FV1 A;  2JJB A;  4F13 A;  1OJO A;  1WZZ A;  5DGR A;  1GHQ A;  1HN0 A;  1HMU A;  3QXQ A;  3WC3 A;  4WVB A;  5IM1 A;  1ULV A;  3HXF B;  4L0G A;  1HZF A;  3S9V A;  1HM2 A;  1DCE B;  1IA6 A;  4LNG B;  4FUS A;  3GLY A;  2GOX A;  1F9G A;  3M77 A;  3SFY B;  5CZL A;  1QSJ A;  2RI8 A;  4ZRQ A;  4LNV A;  3P5P A;  2VN4 A;  4Z4J A;  5E2J A;  2PMV A;  4F10 A;  4GTT B;  1N7P A;  1N1B A;  1N20 A;  1CLC A;  4WVC A;  1IA7 A;  1F9O A;  2Q1F A;  2G0D A;  2R2L B;  5M7I A;  4RNQ A;  3M72 A;  1UMP A;  1VD5 A;  1OJP A;  2YIK A;  3D5S A;  1GSZ A;  4MMI A;  4MMH A;  3E7J A;  4DOE A;  3HXE B;  1W6J A;  1C3D A;  3RX7 A;  1V7X A;  1KSC A;  1CB8 A;  4YDO B;  5EAT A;  3W7T A;  2RGK A;  4YDE B;  3PYA A;  3VSM A;  2Z07 A;  5IKH A;  1C82 A;  1O5M B;  2V3N A;  3KSL B;  2EAC A;  1K72 A;  3D3I A;  3M01 A;  3W5N A;  4XUV A;  3RX5 A;  1KSD A;  3EQA A;  3S4B A;  5ILJ A;  1O6H A;  3HXD B;  3EUV B;  4D4A A;  4M76 A;  3OXU A;  1UG9 A;  2OKX A;  4GAX A;  3HXC B;  1D8E B;  1HCU A;  2B4F A;  3Q79 B;  4LIX A;  1XW2 A;  3QPF A;  5GY3 A;  4DI5 A;  3E30 B;  3NFV A;  1WU6 A;  2ONG A;  1W3Y A;  2DRQ A;  4L6X A;  3ACT A;  4GTM B;  1XWQ A;  2QNO A;  1N4Q B;  4OZW A;  4E1Y A;  4CE7 A;  1GAI A;  4BOK A;  5KKB A;  1H3C A;  3CU7 A;  3TF4 A;  1KWF A;  1O1S B;  3EU5 B;  1GXO A;  3LZ9 A;  3M00 A;  2XFG A;  1O1T B;  2WII B;  1G87 A;  5ILH A;  1O79 A;  4Q88 A;  1QAZ A;  5FO7 B;  4MBG B;  2EAD A;  2EAB A;  1TNB B;  1HXA A;  2DRR A;  3H7L A;  1WU4 A;  1N7N A;  4KKJ A;  3SDT A;  4AYQ A;  5IL3 A;  1TN8 B;  1QBQ B;  3KSQ B;  2IEJ B;  4L9P B;  1J0M A;  2WDA A;  3DSV B;  3T33 A;  3W5M A;  1KRF A;  1FT1 B;  3DSS B;  1O1R B;  4Z4L A;  3SFX B;  2XWJ B;  1S63 B;  3KLS A;  3QT3 A;  2ONH A;  1FMI A;  4KTR A;  4EHM B;  1GLM A;  2E22 A;  2ZIR B;  3AFJ A;  3M78 A;  3M71 A;  4MU9 A;  3PMM A;  5JMD A;  2E24 A;  3PZ2 B;  3CIH A;  2PN5 A;  4GTP B;  3WKG A;  1H36 A;  3M7L A;  5FO8 B;  1RQ5 A;  1X1H A;  2D8L A;  1HM3 A;  4KTP A;  3WKI A;  4GTR B;  3S4D A;  1DL2 A;  1N7Q A;  1F9D A;  2I07 B;  2ZBL A;  3W7W A;  5IK6 A;  1LD8 B;  2BRW A;  1RW9 A;  2FV0 A;  5CA3 A;  3M7C A;  2VN7 A;  3SDU A;  3M7E A;  3QFZ A;  4GL3 A;  2AFA A;  1OJM A;  3QRY A;  1HXC A;  1TF4 A;  3PZ1 B;  1GAH A;  1EGU A;  1H39 A;  4GTS B;  1X81 B;  2V8J A;  5FOB B;  2FBA A;  3S4A A;  3M74 A;  2X03 A;  1LXK A;  5ILK A;  1H3A A;  3W7U A;  1N24 A;  1N7R A;  1SQC A;  3SDQ A;  1RWC A;  2V8I A;  5IKA A;  1FT2 B;  3D5R A;  2H6G B;  5MEH A;  1WU5 A;  2AHG A;  2WY7 A;  1NXC A;  4BOJ A;  1QQF A;  3Q7A B;  3M73 A;  5JMF A;  2BRP A;  3VW5 A;  4D4B A;  1X1J A;  4OZV A;  3REN A;  4ZH5 A;  5DHK A;  4GTV B;  3G4D A;  2WYN A;  3ANI A;  1RWH A;  1FPP B;  5IK9 A;  1V5C A;  1X1I A;  3G4F A;  5JPM B;  2WY8 A;  1N4S B;  4FXK B;  3RX8 A;  5M7Y A;  2H6I B;  1FO2 A;  1KZP B;  3N0G A;  3S4C A;  1NI1 B;  3E6U A;  4J5T A;  4KKI A;  1V5D A;  3C72 B;  3E80 A;  2XWB B;  2A8Z A;  2J5C A;  1N1Z A;  1TNU B;  4AYO A;  1L1Y A;  4TF4 A;  1GXM A;  1HX9 A;  1HMW A;  2H6F B;  1HXG A;  3DRA B;  4YCR A;  1TN7 B;  4ZH1 A;  3Q78 B;  5GZK A;  1RWA A;  3A0O A;  2JG0 A;  3Q73 B;  2BB5 A;  1FCE A;  1FP3 A;  1O6Q A;  2H6H B;  2D5J A;  2ZIS B;  4CJ1 A;  3P5R A;  3QT9 A;  1F1S A;  3AFL A;  4OJZ A;  3WIW A;  3PZ3 B;  3DSW B;  3NNB A;  4FJQ A;  4ZG8 A;  4CJ0 A;  1JS4 A;  1R76 A;  1AGM A;  3RSY A;  2JF4 A;  3N0F A;  1TN6 B;  1H54 A;  4GTO B;  3SDV A;  5IL8 A;  2G02 A;  2BB6 A;  4EL8 A;  2B39 A;  2FUQ A;  5AGD A;  3ANJ A;  3ACS A;  2BRV X;  2AHF A;  3P2C A;  4AYP A;  1JCS B;  1DOG A;  4QT9 A;  3DST B;  5FO9 B;  3GT5 A;  1RWG A;  5ILY A;  3A3V A;  1KZO B;  3M02 A;  2GH4 A;  1H12 A;  3W7S A;  3H3K A;  1KRE A;  3Q7F B;  1H3B A;  3DSX B;  2BBC A;  1AYX A; 
#chains in the Genus database with same CATH homology
 1NC5 A;  5CD2 A;  1X9D A;  2GZ6 A;  3WIQ A;  3SQC A;  4WU0 A;  3M75 A;  3PZ4 B;  1N4P B;  1TNZ B;  3E73 A;  4JJJ A;  3WIR A;  1H13 A;  3WUX A;  1GXN A;  1SA5 B;  1XWT A;  1N94 B;  3HXB B;  2SQC A;  1N9A B;  3QSP A;  3W7X A;  2F6D A;  2V8K A;  2DRO A;  1LTX B;  3WKH A;  2EAE A;  2NVP A;  3QDE A;  2A73 B;  3WKF A;  1V7V A;  3K11 A;  1JCR B;  1GA2 A;  4LNB B;  2RI9 A;  1LD7 B;  3EZ8 A;  3Q75 B;  3KQ4 A;  3QXF A;  3DPY B;  1FAE A;  1IS9 A;  4ZRP A;  3ON6 A;  1NL4 B;  2BED B;  3X17 A;  1MZC B;  1G6I A;  3RRS A;  1JCQ B;  1FO3 A;  2CQS A;  1S64 B;  3M76 A;  1G9G A;  1G9J A;  1KKT A;  3DSU B;  3RJ3 A;  2FUZ A;  4DOD A;  3E34 B;  4FXG B;  2WIN B;  4D4C A;  1H37 A;  1UT9 A;  3ANK A;  1KS8 A;  4TXT A;  2DRS A;  3K7X A;  1SA4 B;  5JPN B;  2CQT A;  4ONT A;  1H14 A;  3G6J B;  2XQW A;  1V7W A;  4AYR A;  3SAE A;  4GTQ B;  1D8D B;  1TNO B;  1W6K A;  2ZZR A;  2P0V A;  3H2W A;  1LF9 A;  3QG0 A;  2NOJ A;  3EU8 A;  1N4R B;  3E33 B;  1KFG A;  4D94 A;  1FBO A;  4Q2B A;  4WVA A;  4V1S A;  1LF6 A;  3E37 B;  1N95 B;  3GZK A;  3VXD A;  3OED A;  3PYB A;  1O6R A;  3QFY A;  3SDR A;  5DGQ A;  2V3P A;  5GW7 A;  3QWT A;  1L2A A;  1TNY B;  3E32 B;  1H35 A;  1CEM A;  1FBW A;  4V1R A;  4C1S A;  4D4D A;  2F0Y B;  3M7B A;  2FV1 A;  2JJB A;  5DGR A;  1WZZ A;  1GHQ A;  3QXQ A;  3WC3 A;  4WVB A;  1ULV A;  3HXF B;  4L0G A;  1HZF A;  3S9V A;  1DCE B;  1IA6 A;  4LNG B;  4FUS A;  3GLY A;  2GOX A;  3M77 A;  3SFY B;  5CZL A;  1QSJ A;  2RI8 A;  4ZRQ A;  4LNV A;  3P5P A;  2VN4 A;  4Z4J A;  5E2J A;  2PMV A;  4GTT B;  1CLC A;  4WVC A;  1IA7 A;  1F9O A;  2G0D A;  2R2L B;  5M7I A;  3M72 A;  1UMP A;  1VD5 A;  2YIK A;  3D5S A;  1GSZ A;  4DOE A;  3HXE B;  1W6J A;  1C3D A;  3RX7 A;  1V7X A;  1KSC A;  4YDO B;  3W7T A;  2RGK A;  4YDE B;  3PYA A;  2Z07 A;  1O5M B;  2V3N A;  3KSL B;  2EAC A;  1K72 A;  3D3I A;  3W5N A;  4XUV A;  3RX5 A;  1KSD A;  3EQA A;  3S4B A;  1O6H A;  3HXD B;  3EUV B;  4D4A A;  4M76 A;  3OXU A;  1UG9 A;  2OKX A;  3HXC B;  1D8E B;  1HCU A;  2B4F A;  3Q79 B;  4LIX A;  1XW2 A;  3QPF A;  5GY3 A;  3E30 B;  1WU6 A;  2DRQ A;  4L6X A;  3ACT A;  4GTM B;  1XWQ A;  2QNO A;  1N4Q B;  4CE7 A;  1GAI A;  4BOK A;  5KKB A;  1H3C A;  3CU7 A;  3TF4 A;  1KWF A;  1O1S B;  3EU5 B;  1GXO A;  2XFG A;  1O1T B;  2WII B;  1G87 A;  1O79 A;  4Q88 A;  5FO7 B;  4MBG B;  2EAD A;  2EAB A;  1TNB B;  3H7L A;  2DRR A;  1WU4 A;  4KKJ A;  3SDT A;  4AYQ A;  1TN8 B;  1QBQ B;  3KSQ B;  2IEJ B;  4L9P B;  3W5M A;  3DSV B;  3T33 A;  1KRF A;  1FT1 B;  3DSS B;  1O1R B;  4Z4L A;  3SFX B;  2XWJ B;  1S63 B;  3KLS A;  3QT3 A;  1FMI A;  4KTR A;  4EHM B;  1GLM A;  2ZIR B;  3AFJ A;  3M78 A;  3M71 A;  4MU9 A;  3PMM A;  3PZ2 B;  3CIH A;  2PN5 A;  4GTP B;  3WKG A;  1H36 A;  3M7L A;  5FO8 B;  1RQ5 A;  2D8L A;  4KTP A;  3WKI A;  4GTR B;  3S4D A;  1DL2 A;  2ZBL A;  1F9D A;  2I07 B;  3W7W A;  1LD8 B;  2FV0 A;  5CA3 A;  3M7C A;  2VN7 A;  3SDU A;  3M7E A;  3QFZ A;  4GL3 A;  2AFA A;  3QRY A;  1TF4 A;  3PZ1 B;  1GAH A;  1H39 A;  4GTS B;  1X81 B;  2V8J A;  5FOB B;  2FBA A;  3S4A A;  3M74 A;  1H3A A;  3W7U A;  1SQC A;  3SDQ A;  2V8I A;  1FT2 B;  3D5R A;  2H6G B;  5MEH A;  1WU5 A;  2AHG A;  2WY7 A;  1NXC A;  4BOJ A;  1QQF A;  3Q7A B;  3M73 A;  3VW5 A;  4D4B A;  3REN A;  4ZH5 A;  4GTV B;  2WYN A;  3ANI A;  1FPP B;  1V5C A;  5JPM B;  2WY8 A;  1N4S B;  4FXK B;  3RX8 A;  5M7Y A;  2H6I B;  1FO2 A;  1KZP B;  3S4C A;  1NI1 B;  3E6U A;  4J5T A;  4KKI A;  1V5D A;  3C72 B;  2XWB B;  2A8Z A;  1TNU B;  4AYO A;  1L1Y A;  4TF4 A;  1GXM A;  2H6F B;  3DRA B;  4YCR A;  1TN7 B;  4ZH1 A;  3Q78 B;  5GZK A;  2JG0 A;  3Q73 B;  2BB5 A;  1FCE A;  1FP3 A;  1O6Q A;  2H6H B;  2D5J A;  2ZIS B;  4CJ1 A;  3P5R A;  3QT9 A;  3WIW A;  3PZ3 B;  3DSW B;  4ZG8 A;  4CJ0 A;  1JS4 A;  1R76 A;  1AGM A;  3RSY A;  2JF4 A;  4GTO B;  1TN6 B;  1H54 A;  3SDV A;  4EL8 A;  2G02 A;  2BB6 A;  2B39 A;  5AGD A;  3ANJ A;  3ACS A;  2AHF A;  3P2C A;  4AYP A;  1JCS B;  1DOG A;  4QT9 A;  3DST B;  5FO9 B;  3GT5 A;  3A3V A;  1KZO B;  2GH4 A;  1H12 A;  3W7S A;  3H3K A;  1KRE A;  3Q7F B;  1H3B A;  3DSX B;  2BBC A;  1AYX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...