The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
65
|
sequence length |
407
|
structure length |
402
|
Chain Sequence |
IRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPTVDIELVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWGNGCGLFGKGSLVTCAKFACSKKMTGKSIQPENLEYRIMLSVHGSQHNDTGHETDENRAKVEITPNSPRAEATLGGFGSLGLDCEPRTGLDFSDLYYLTMNNKHWLVHKEWFHDIPLPWHAGADTGTPHWNNKEALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEAEMDGAKGRLSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYAGTDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVGEKKITHHWHRSGSTI
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Molecular determinants of human neutralizing antibodies isolated from a patient infected with Zika virus
pubmed doi rcsb |
molecule keywords |
Genome polyprotein
|
molecule tags |
Viral protein/immune system
|
source organism |
Zika virus
|
total genus |
65
|
structure length |
402
|
sequence length |
407
|
chains with identical sequence |
B, E, G
|
ec nomenclature | |
pdb deposition date | 2016-09-29 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00869 | Flavi_glycoprot | Flavivirus glycoprotein, central and dimerisation domains |
A | PF02832 | Flavi_glycop_C | Flavivirus glycoprotein, immunoglobulin-like domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Sandwich | Immunoglobulin-like | Immunoglobulin-like | ||
Mainly Beta | Sandwich | Tick-borne Encephalitis virus Glycoprotein; domain 1 | Tick-borne Encephalitis virus Glycoprotein, domain 1 | ||
Alpha Beta | 2-Layer Sandwich | Viral Envelope Glycoprotein; domain 2 | Viral Envelope Glycoprotein, domain 2 | ||
Alpha Beta | 2-Layer Sandwich | Viral Envelope Glycoprotein; domain 3 | Viral Envelope Glycoprotein, domain 3 |