5GZNA

Structure of neutralizing antibody bound to zika envelope protein
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
407
structure length
402
Chain Sequence
b'IRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPTVDIELVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWGNGCGLFGKGSLVTCAKFACSKKMTGKSIQPENLEYRIMLSVHGSQHNDTGHETDENRAKVEITPNSPRAEATLGGFGSLGLDCEPRTGLDFSDLYYLTMNNKHWLVHKEWFHDIPLPWHAGADTGTPHWNNKEALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEAEMDGAKGRLSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYAGTDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVGEKKITHHWHRSGSTI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Genome polyprotein
molecule tags Viral protein/immune system
source organism Zika virus
publication title Molecular determinants of human neutralizing antibodies isolated from a patient infected with Zika virus
pubmed doi rcsb
total genus 65
structure length 402
sequence length 407
chains with identical sequence B, E, G
ec nomenclature
pdb deposition date 2016-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00869 Flavi_glycoprot Flavivirus glycoprotein, central and dimerisation domains
A PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5gznA04
2.60.98.10 Mainly Beta Sandwich Tick-borne Encephalitis virus Glycoprotein; domain 1 Tick-borne Encephalitis virus Glycoprotein, domain 1 5gznA01
3.30.67.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 2 Viral Envelope Glycoprotein, domain 2 5gznA02
3.30.387.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 3 Viral Envelope Glycoprotein, domain 3 5gznA03
2GG1A 3UZVA 2ALAA 1OANA 2H0PA 5KVFE 2V33A 3N43F 5H37A 5LCVA 4AM0Q 3C6EA 3UAJA 4UT9A 5B1CA 2R69A 3C5XA 1PJWA 4ALAC 2JQMA 5GZNA 3N41F 2P5PA 2JV6A 5AAMC 3P54A 5GZOA 4AL8C 1ZTXE 4BZ1A 1Z66A 3UZEC 5IZ7A 5JHLA 3VTTA 5KVGE 1SVBA 5IREA 3UC0A 1S6NA 4UT6A 3WE1A 3IRCA 3N42F 3UZQB 4UTBA 3I50E 5KVEE 1Z3RA 4L5FE 5LBVA 3MUUA 4FFYA 5AAWC 1URZA 5KVDE 1TG8A 4FFZA 1UZGA 3J27A 5JHMA 4X42A 5LBSA 2HG0A 1OKEA 2JSFA 3UYPB 3G7TA 3N44F 4GT0A 4UTCA 1RERA 1OK8A 2I69A 2R29A 3J2PA 4FG0A 4GSXA 4UTAA 3N40F 4BZ2A
chains in the Genus database with same CATH superfamily
2EE9A 2VDQL 4YBHA 3SYQA 4WEBL 1ROWA 3AXLB 5GGRA 2WP3O 1M53A 3UTZA 4M93B 2H41A 7FABH 2HKFH 3HLAA 2BFGA 3K46A 1U8LA 4FJYA 4JFEB 4NI3A 2J1WA 3Q44A 1C08A 2YXWA 1SYVA 2P46B 2OQJB 1C12B 4NZTL 5HYJB 2Y7MA 4LSSH 3ASWA 3UADA 1BBJA 4DUVA 1NCDL 5L0QB 1RUAL 5CD3A 1TQBB 3WFHA 3SDYH 2BSCA 5FKAB 3ZXAC 3DIDA 4ODUA 1A4JA 2C34A 5DZAA 1C7SA 4JBSA 4U3SA 3GXPA 1NFDF 1JNHB 4YUEL 3E6FB 3VAEA 4EBQL 3ULAB 3TO4D 2K6ZA 3RL2A 3ZTCC 3QDJB 1HCZA 3GMPB 4U3XA 1J5OL 1OT4A 1T7VA 4KI5C 2AJUH 1F6AB 3L1GA 4R96B 2DWDA 4K9EC 2X9WA 3IN2A 1AP2B 2GUOA 1IBZA 2P49B 4CN6A 1Q94B 1NL0H 1SLVA 2MHAB 5FKAA 1KXTA 5GS3A 4L05A 3TBBA 4Z7OF 4RA3A 5B21A 2AQQA 3VGEA 1V7NL 3E6FA 5HHVH 2OYPA 1XGPB 1PZ5A 5EOTB 4ZX3A 3FTYA 4U2YA 1RY7B 4BGDA 2RAMA 4G6ML 4KTGA 2F7RA 3EO0B 4PRAB 4OAWB 4Q2ZA 5H2BB 1ZS8A 4FDWA 4TTGA 1NC4B 2VSKB 1YLBB 1HQ4B 2X0WA 5T5NG 2QHLA 4FXKA 1S7RB 4DGYH 2E7LC 3SQOH 4Z7VF 1I7ZB 2DEWX 5KVFE 5CIPH 5LG1A 5DJCB 3BZ5A 3N0AA 3EJCA 1DHKA 1KJVB 2A1WH 4GY4A 1KN4H 3D08A 2CBPA 2FE0A 4P2OD 1P5UA 5FO2A 5T5NF 1NTDA 1U2HA 2XN9E 1FAIL 2YPLD 1ZA3A 3K4AA 5JMRA 5JW5B 4KUZL 4OFPA 3QCTH 2ADFL 3UC0L 4UNIA 1TTCA 3T0ED 4FLOA 3FB7A 5D1ZI 3H2WA 4ZPTB 3J2PA 2C3GA 4FNTA 4S0HA 3K80A 4J1UA 4RZKA 1ZHBA 2YD6A 4Y7OC 1JZ7A 4M6NL 3C5ZA 4YQXH 3FOLA 3BAYA 4NN5C 4P2RA 2QADD 3O6ML 5ANHA 1HTYA 5IJBC 1IGCH 5G2NA 3W81A 3SE6A 5D1XD 5FYKD 3MREA 3IAGC 4HJSA 3Q5OA 4R4BA 4ZFOB 3T2QA 3NZ8A 4BGLA 4UV7L 3KXFD 2A73A 3K7UA 5BZWB 3UCQA 4XH2A 4YL9A 3MRMA 5IOPB 1JPTH 4K5LA 4H0IA 4HSAC 1PFCA 1NGYB 2CM5A 3N1QC 5DMIL 3GS7A 3T4AA 3VI3A 3VGHA 1LO0H 2YSSA 5A43C 5E4OA 1BWWA 1I1AB 4OI8A 4PY8I 3B5TA 4JDZB 4JHAL 2H0JA 4RBPK 5ABAA 1F4WL 2DWEA 2NW2A 3CX5K 5I6XB 3N42F 2HT2D 4K0OA 3B2XA 3OXRA 4ZS7H 5FYJH 1PSKH 5GRUL 1OP4A 3EYVA 4I2XA 4E0RB 1Q9WB 1UWEL 4FMVA 5EEWA 2I60H 2YAEA 3L9EA 5D5MB 1ZHNA 4X7CC 5HVFB 4HHAA 3FCTA 4IGBC 5E95B 3TFKD 5DWPA 2QLVB 7TAAA 3M7FB 3GMQB 4PW3A 5JTWA 3MRCB 4GW4A 1FNSL 5IHZA 4XNQB 5SWSD 5LXGL 3MLRH 4XTRD 2GW5A 4HFUH 1RZKL 1DQVA 2R4SH 3KBHE 5EU6D 2I7SA 1DE4B 3KG5A 4ZMTA 5FIEA 5K9QI 2IQAB 4QKXB 5DTFB 4BQ9A 4X4ZA 2WAHA 3PAVA 2WHVA 1A4CA 1E65A 1YYMH 3SQBA 1FZMB 2KYIA 4EVNA 5H35A 4QWWC 4GQ9H 4OKVA 2A9DA 2F19H 1U3YA 4H7VA 3INOA 4B9JA 4EIBA 1F45A 4K7FA 4XP9L 2CJUH 5DR5H 2VDMB 3BVNA 3P3RA 3Q9QA 4J6RH 4POZC 4YNYA 4XNAA 2WZPA 2B3IA 3VJ6A 5BS0D 5D7SH 3KBPA 3PWVA 4OBSA 4Y1SA 1ECYA 3U36A 4M43L 1DBJL 3ILEA 3P3YA 4LEXL 4DCQB 5BV7H 2E86A 2G5UA 3WTTA 5GGRY 3RFZB 2WC7A 1W6WA 4KKLD 3GJFB 3JUYA 3BAIA 1IC4L 1H3VA 2JI2A 4HUVB 4GKSA 3LV3A 5A2FA 1OM9A 3L95A 1Q9OA 4H8PA 4ZOEA 4MD4A 4IRJB 4ACPA 3QEUB 2CKBA 1WGVA 1G7MA 3CFMA 3OKOB 2R0ZL 2LW5A 1UQSA 4U31A 3HIZA 1Q0YL 4NUQA 5KJ4A 3SB3A 3GM0A 1AHKA 4F7EB 3VB9A 1ZVNA 1L4IA 3GB7A 3N43B 4IKIA 3DO7B 1R24A 4B27A 3DX3A 5FW8A 4PREA 1TCMA 1PNCA 4YDKL 5DMKB 3MRFB 1GY2A 4Q74A 2NX5E 5D7IE 3MQIA 3GI9L 1P6AB 1MEXL 2NQCA 4QKTA 2YEQA 4YXHL 1YECL 4G6AD 1U3NA 1T83C 2D9CA 2HLEB 4C4BA 1KXVA 1JJUA 4OVUA 3E1F1 1KB5H 2CDGB 4HJ0C 2CDGA 4KRMB 1AXSA 1A7QL 1TVBA 1HZKA 1QBLH 4K4KA 1BIIA 1XH3A 1NUDA 4JVPA 4R8WL 3SBWA 2NY0B 1TCRB 4DUWA 1CTNA 1QSEA 3I3DA 5DRNB 2IDCA 2VXUH 5I15H 4P2RD 1CF1A 3OGOE 3AU0A 4JUTA 4ALAH 5EU7E 4WRLA 1KBBA 2IG2H 1PTZA 4CSSA 3DNKA 3Q1EA 2CO7B 1BOGB 2XY1A 3LRGA 1VPOL 1IBYA 5ECJE 2DTML 3MUZ1 2EEFA 4G9DB 3ZY7A 3WDHA 3FQRB 1OE3A 5KOVC 1WIOA 1A3RH 4JFVA 3D18A 2BNQE 1QPPA 3WKPA 1E5BA 4FRWA 3PLYA 5L2KA 4G8FB 4H25B 1Q90A 1LDSA 1UUNA 3F84A 4YHKL 3IWVA 2EINB 3UBXA 4Z3FA 4J3OF 2Z64C 2AHIA 1KEMH 4K3DL 2GJJA 1QFHA 4JPVL 4APXA 2YGVA 4HT1L 1A6TB 2RCSH 4LIQE 1XBDA 1FNLA 2K4AA 1BM3L 3BZ4B 3HI5L 3QYCA 5EU3A 4A6YA 2HTKD 5L9DL 1LWHA 1RH8A 5GZNC 3QXUA 2YS4A 4JRXE 1MJUH 1IBDA 2XG5A 4JDEA 4M62L 3JV4B 4U3HA 5DHMC 1NGPL 5BRPA 4KI1A 2NY4C 2WXOA 1G5GA 3VXSA 3US1A 1IM3B 2FZ3A 4PHXA 3CPUA 1YC7A 3QHFH 2Z9TA 3PXLA 3AS2A 3HZYB 4F7CA 2OULB 3ARXA 4GH7B 4JM0A 2NY7L 4X7DC 1I8LA 2XKNA 5D2LA 3UZQB 4XO9A 1P4BH 4JEGB 3BH9B 5HHPA 5JPMC 3DGGB 2HVKB 3VB8A 2Q9OA 4Y8AA 3TONA 2AQ2A 1RZKC 1NFKA 3V0JA 3VG9B 4IEFB 2K4WA 3ZKSD 1OO2A 2X6AA 3BW9B 1G1KA 5FWQA 2A9NH 3UPRB 1OGTB 3TA3C 4G8IB 3MGOA 2QTVA 3A67H 3OXSA 4NLHA 1TZ8A 2IH1B 4U4BA 1KGCE 3WENA 4RAUB 2BVPB 4HOXA 1YDPA 4JW3A 3S3BB 1BEYH 1UEYA 1YEGL 2AMGA 3L5JA 4M93C 5I2IA 43C9B 2F53E 3H9SA 4WW1A 3WTUA 3RUGE 1FYTE 4FNSA 2VR9A 2EEAA 1U8JB 3EKCA 1FIGH 3RPIA 4M7LL 4N8VG 2VR7A 4CJ0A 2UZIH 4JZNB 5IW1A 4FQIH 4F7KA 3RPKA 4YZFE 1FFNB 1TYRA 1YN6B 3OKMB 1V7MH 3BVXA 3BQUD 1B0WA 1GGBL 1IAMA 1JF1B 5E1QA 5E7FA 3S5LB 3LH8A 3QYMA 2W60A 3HMWH 2J3SA 5I16B 4JK0D 5KYXB 3UC0A 5LAXB 4WV1B 4X8JB 4G1MA 1BFTA 4PJFE 3N44B 4N6RA 3VW3L 2CALA 3FUFA 2WWNA 3OG4B 1U3JA 4Q9BA 3REVA 3ROOA 1WAAE 4OIAA 1KENL 1KXHA 1QEXA 6CGTA 1ZVYA 4X5XA 4ZYKB 3V55A 3UTSD 2VC2H 2GUYA 3L4UA 2KPWA 1ZK5A 1C12A 2CHNA 5FS5A 3I02A 4CMMA 2X2UA 4HBCH 3QPXH 4FD0A 2QKIB 3LHPL 5AL0A 1NCJA 4ES9A 1HZLA 4GAJL 4AUJA 1K4CA 1OCZB 4DTGL 5I6NA 1YSOA 4XN9A 3MGTB 2YRZA 4HUCA 1N2RA 1GGCH 3B1UA 2P47B 4Q58C 1MJ7L 3MRKB 4G6KH 3CDCA 2EDBA 4KRLB 1G7QB 3CXDH 3WGVB 3FQXB 3NJFA 4JO1L 4J3VA 4F27A 1NH6A 1U8CB 4QXGL 4XMVA 4ONFH 2YPVA 2Y6SD 4XMKL 1ORSA 4L8SA 2F53D 3MROA 1H0DB 3FUMA 2XXFA 3NSXA 3HBZA 1KBWA 4N0RA 3ARWA 3L54A 4UQ3A 1GZQA 2Q1EA 1CS6A 1H3GA 4XN2A 3TEYA 5HI5C 4WHTB 4OI9A 4WI3A 3IFPB 3CZKA 5E8EB 1JYVA 1TO5A 3VD2A 1JXJA 5CZKA 3SGEH 5AFAA 5D1XC 2IWFA 2Q7NA 5GRZA 2ZKMX 5AZ2H 3RHWF 3PFUA 3ZZQA 2JMRA 5BRZD 2ZCLL 3S96B 3CN4A 2FJSA 5AAWC 2G2RB 3QUZA 3BISA 1UM6H 5GGUB 1ZXKA 2QHRH 5DC9B 1OGPA 3K1DA 4HP5A 1MFAH 5T3ZL 1MFCL 3QFJD 4WLCA 3NA9H 2QQLL 3QIUC 4R9HA 3U7WH 1KWGA 4FFYL 3IF1A 3RTQA 4PTTA 4C47A 4PJ8C 1BA9A 2GIMA 4X99B 1NC4A 4RGNC 3T0AA 1AQKH 4LHUB 1X6NA 1R5IB 4Y2NA 4RAHA 1FG2B 5HI5D 2AK4E 1UZ8A 3Q05A 4QRQA 3ZKND 1ED3B 1T4WA 3RWFA 3OPUA 4P59H 4Z76A 2FGWH 1QFWM 1OVZA 3BP4A 4IEFA 3MA7B 4B5EA 2BM3A 2QDWA 2GFBA 3MRGA 4TOYH 5I1IL 3R8QA 1KY7A 4PJCF 2JE8A 1N67A 1NWPA 4NRYB 3BP6A 3AM8C 4Q6YA 3L17A 2NY1D 5LXGH 5D70L 2VDOB 1NCOA 2YAMA 5J9PB 2EIMB 4NQVA 4S10A 1SYSA 3BEVA 4MMZA 1U8IA 4PJ7B 2JV6A 4AYBA 2V4LA 5IFHL 1NCDH 2OMTA 5BS0E 5KBKA 3ASNB 4TUJA 1XCTA 4Y5YC 2JKSA 4NHUA 1FH2A 1T5WB 4O5LH 3OSVA 1Z3RA 1IM3A 4G80B 2NCEA 2CKBL 1KB3A 3ECWA 2L7EA 4RWYH 2DLTA 1EVTC 4MAYA 3CFIC 4OH2A 3L13A 4IJTA 4UDUA 3KM1A 4JFEA 4H8WC 2OV0A 4NJ9L 3T1FA 3EFDH 3QFJE 3C6LD 5I8OL 4F57L 4KKAC 4GAAA 3UPAA 2QBWA 3QNXA 5TTRA 4NNYB 2K6WA 3OHXC 4ILDA 1IC4H 2YPKA 4WO4B 5CLXA 5KBDA 4LAJH 2WLIB 5GGTA 3V0AC 4FAAB 2WTRB 2NLJB 3RX7A 4J7RA 2B9BA 4QHMA 5D6CB 3EYUH 3UGXA 4L8CA 1S9WB 3NFPB 1AC6A 4OFVA 1N70A 3DECA 5CILL 5I0ZA 1OSPL 4KKLC 2C1PB 5A16B 2G9HA 1GTNA 1U3HB 5B3SB 3D6GA 4JB9L 1U4EA 1XGUA 4UQIM 4NZRH 2M1KA 5HGDA 4RGNB 3BPCA 5MERB 2OTPA 3GO1H 2X1WL 5F3HB 3MODH 3SE8H 4BRVA 2IVFC 4N3TA 4XP6L 3TJPA 4AZ8B 1EXHA 5D7JC 2VLLA 4JY6B 4WSJA 3TT1H 1J05B 3NN8A 4RH4A 4WCYL 3LD8B 5ICXB 3T8XB 3V4PA 2VWEE 2AXJA 2CLVB 3VD3A 4S0TD 4IMKC 3T04D 3B9KD 4HKZA 5JA8B 5TE4H 1NLBH 2VISB 4Y4FA 2PW1A 3M1OA 2NY0D 3CHOA 1IQWL 2NR6A 3IU4H 5GS2D 4C56B 4YXHH 1BVOA 2F8XC 4PWHA 1JXGA 1JXFA 1UA6H 4HUKB 4LQFL 1IEBA 1EEZB 5FCUL 2YN5A 1PD6A 4IKLA 3SOBL 1DVZA 4OLZL 4LSTL 3VXRE 1YQVL 3O81A 5DD6B 1VF5C 2EO9A 5FYKE 3FT2A 4I89A 3RRQA 2VKXA 3ZKQD 2EDTA 4JFED 3ABMB 5AWNH 2BLFA 3RTLA 1I9JL 1FH5H 1OXYA 2Y1VA 4FG6C 4P5TB 3PWVB 4AJVA 3TN0B 2OMYA 1ZT1B 1YC8A 5JNYA 2X2JA 2WQSA 3BDBA 4KK8C 2XV6B 4PBXA 3RL1A 5HD8C 3B9KB 3U9WA 5ETUB 1NLDH 2CCWA 2OMVB 1HSAB 5GGTL 2BY0A 2D4FA 3JXAA 2H3NA 5PCYA 3JWNG 3HNSL 3L2MA 5MEND 3E9UA 1FORL 5FUZL 5EIVA 4I77L 2DQHH 3GZKA 3HG3A 3KYKL 2IALB 3O4LE 3CDZB 3LNHA 1BQHA 2A9MH 5HDLA 2EDNA 4LDCA 1FYTD 3VX0A 1BZ8A 1Q9LA 2Q20A 5TQ2H 1MRFH 2IAND 4JO5A 4D3CL 1C16B 3OLEA 2PWEA 4NQDA 1E40A 3TNMA 4N2OA 2CDFA 1LEIA 4PS7A 4X4XB 3FSVA 2OTWA 3CZSA 1U8HB 1CBVH 2A9AA 4G1EA 4KK8D 4PV1C 1LK3L 3A0OA 2X4NB 3GBLA 4OV6F 5KEZA 4NPYA 4GQZA 2XPYA 5I71B 2MKLC 4TQEH 4APQC 4KJWD 1DVUA 1TPXC 4P99A 4ADGA 1RUPL 2VM4A 1KGJA 5E9NA 4F7MA 3FHQA 5B1CA 3SIKA 4YHYC 2FWSA 1JZ4A 3U7YH 1IM9A 4DNLA 3FUEA 2AEQH 1E5UI 1NEZB 1BLNB 3MYZA 1LEIB 5IMOB 3KJ4C 2BPBA 4O58H 3WTSA 3A5VA 2VUOA 3GSRA 1TTRA 4WKZA 4LVEA 4UF7C 2DJUA 2QMKA 1S7SB 2QVKA 3ILQD 5I30L 4IBWA 2GTWA 1QQDB 4G3YH 4ZTEA 2QPUA 3CVHL 4RGOL 1JV2B 4OD2A 4CN4A 3T5WA 1LQSR 2BCKA 2VLRB 1UWGL 3NEXA 5FB8B 3NZHH 1QKZL 1W16A 4XCEA 3DUSA 4JQVC 3WJLC 4QRRD 1XEUA 3UABA 4BKTC 5T1MA 2ETWA 1HXYA 1NGYA 3AGVA 2ZSWA 3WO4B 3UZVB 2VQTA 5IMLB 3S48A 1BV8A 1FIGL 4XMZA 1D5IL 1QUNB 3HR6A 3NIGE 2F8OA 4JGUA 1IZJA 3S2CA 3DRTA 5K9OA 2UYLB 3PDGA 5F3FA 5HHXL 4OD2B 3QXWA 3W11C 4BZ2A 1CDYA 4UQDA 1O6SA 4PIBA 1BWMA 4CVZA 5I9QC 3PCYA 1WRFA 4N0YL 5IFJB 1RZGB 2WAQA 3WNIA 2PPDA 4H5SB 5ABZA 1JL8A 2H4EA 3EF7A 4Y19B 4M8QB 3TGXA 2X2HA 4J4PC 4KTEH 4HS3B 1SXCA 3D2UA 1UKSA 3C75A 2PPCA 1T89A 3H85A 3MLZL 4KKRA 3CSFA 4LNRB 3JTTA 1E7UA 1XEDA 5DMJB 5JW4R 5C7XL 1CVRA 2HG5A 3ZSTA 1BQHG 2IFFL 4D0DB 5EOCJ 2WXRA 3WU1A 3TO4C 3WD5L 3KXFE 3FU9A 2W88A 3S35X 4HH8A 1VLXA 2Z7WA 4LLVB 5MEQB 3BIKA 4M1CC 3DJTA 3H7BB 3ZDWA 3O45A 4NO0B 3VD7A 2ATKB 3L3GB 4HWEL 1FRGH 1BXXA 3KLKA 2ORBL 4HDIA 4KNSA 3PPSA 4OLVL 5HGHB 1NKGA 1IGFH 3GMLB 2YAPA 3DX1A 4V2BA 3K6IA 1ANUA 4HXAL 3P4OB 4RGNE 3P4OA 1RZIB 5AG8A 5E2VL 4HEME 1SOKA 5KYYA 4FHKA 2G0KA 3IAPA 4AEHH 1O9ZA 5FO8A 5FYKU 2BIPA 4UTAH 1K4DA 3H1ZA 1K3IA 1D9KD 1JAEA 3H7BA 5D6DC 3V0WL 4K3JH 4NXKA 5SWZD 2K3HA 3BH4A 3G9AB 2HKHL 5SWSB 5DLMH 3BJLA 4ZSOB 4O02B 4OFDA 4YAQA 3D4ZA 3RL2B 3PHQB 4DF9A 1AZZC 1N12A 4N8VA 1QASA 3AXIA 4OZGF 3OWRA 2ZCKL 2IXQA 4G5AA 2VXSL 2JFCA 4GW5A 1ERNA 4MNQD 3PWPD 4JKNA 4E5XB 1JNHA 1WJ3A 1S5IL 1A9EB 3QDJA 1JDDA 4FYSA 4QRRE 2BOBB 1YAZA 1VFOA 4PRHA 4E42A 5IGXH 4LVHC 2AJYH 1KUMA 1OAKH 1F6AA 3CQFA 1HU8A 4QHNA 4HUUB 5IB5B 4O02A 3OAWA 3OAYH 4YAQB 3GXFA 5CMAA 3SHSA 4E41B 5EEZA 2EC8A 2BIIA 4M48L 3LZRA 1WHOA 2YMTA 4QF1B 5C7ZA 4FQ2L 4I1NB 5CP3A 2HUHA 5JOEA 1C5DA 3HE7A 3QNYA 1P5VB 3FO9B 4JQVA 3EJUA 4IIZA 4EJ1C 1TQVA 2DJ4A 3L4ZA 5CKAA 4CU6A 4R4NC 4G5ZL 3RYMA 3MAWA 4L3EA 1K5NB 3MFFA 3NFSH 1QSFB 3IF1B 2O5XH 3F64A 5L8KB 2NY1C 5I76B 1O6TA 1FCCA 3CK0H 5AUMA 1EHKB 4KK9D 4YEFA 3GRWL 4FZEH 4LLMA 2A6JB 1J0HA 1WIUA 5E8DL 5HYEA 3RA7L 4BKLB 1SVBA 4LCWE 1MQ8A 2BCKB 2X4OB 3CH8A 4E9SA 4E41D 5KVEE 5J3HC 3DX6B 4BFIB 2VSDA 2CH8A 1A7RL 5JIHA 2OR8A 4P2OA 5HHOE 4Q0XL 1R3JB 3CFJB 4I2XE 2PCFA 3HI6L 1IV8A 1AZNA 1OHQA 3CUPA 3DJ9A 3GMNB 4NS0A 4WF7A 4ENZA 5IMOA 3V10A 2PWHA 3BPNB 4FYQA 5DGQA 3DHUA 5JUEH 4JGNA 5J13C 4OUUB 5BZDB 3KPOA 3IS1X 3HAEH 1ZK9A 2QZQA 3FRPB 3TFKC 5I18L 3SDDC 3ARDC 2FAUA 5D4JA 3G5XB 4S1QL 5LGKA 2Z0UA 3LPFA 1TZOA 4Z18A 1BOYA 4RETB 4RZCB 1OSZB 5FYLD 2P5WD 1X5ZA 4YHLH 3MRHB 2IOIA 4FXLA 1OTUC 4B95C 3SPVB 4EUPA 2GG1A 3A22A 5C86A 2QGBA 1AI1H 3UAJA 1J5HA 1K72A 3RIKA 2BZDA 3C08L 2YO3A 4PJ7A 4KV5E 4FG4A 1MVFA 3HZYA 1G9MC 3SZKC 2JXMA 4W9LC 1RVFH 3HC2A 3F6LA 4L48A 5CJXA 5FECB 3DV4A 1MCCA 1RUKL 3BRGC 1S8DB 2RJMA 3KLLA 4L37A 1IEHA 3JQOB 3GUFA 2BSTA 3DX8B 3SKMB 1JK8B 1KPRA 1L3WA 2C9QA 2ZXDA 3S5LA 3DJSA 1GHFL 2P8MB 4LOUD 5HHOD 1T20A 4XBPA 1HIML 1DQJA 2CM6A 2R1XB 1UVQA 3VWJA 5F88A 4ODVH 1OT1A 2XICA 3D4GA 4F8TA 3GTNA 2Y72A 3HHSA 3PQYB 3TFBA 4ZTOH 1UYWL 4I0KA 4NAMA 2J1KA 5IM7A 1ML0A 3MO1A 1T66D 3MNWB 1MCWW 5GJTH 4HGKC 2HJLA 3ZE2B 2ADGA 4XCNA 3B5GA 3U2IA 1SEBA 4QGTA 2ITFA 4ZZFA 5DJ8B 5K59E 3IMSA 5DJ8A 1HS6A 1DBKH 2WIMA 4FE9A 1K6QL 1A7QH 2HT4D 1DVTA 2FJUB 4XX5A 4FFWC 3VFTB 1AQ8A 3BWZA 3T8XA 1AYOA 4WENB 2BDNH 2VMFA 3GI8L 1EH9A 5B39G 5E08H 1EWHA 5H4ZA 4LB8A 1NOFA 2VZ3A 5ALBH 5KAQF 1NUFA 1P7QB 3IDMA 1LM8V 2AK4B 4CADA 3IMWA 3I9AA 5DD0H 1KJ2L 4WW2A 4ZOBA 4BFGA 1DUYA 4D2NA 1PKQA 3ATDA 1OARL 4FKHA 2ZNXA 3NFNA 2Y0SA 3ZDYF 3CHPA 4LL9A 4OT1H 3KLHD 4RDBA 3MBEC 4C54A 4UU9A 3ARGA 2YAFA 4PJEF 1ZSDB 4JFTA 3KYMA 2EH8L 1QG3A 2DMKA 4A68A 4IOSA 4Y5XB 5IROC 2AV7B 2DLFL 3LIUA 4XNZC 1Q0XL 2BNQA 2V5RA 5DD3L 1S78D 1YEHL 3FQ1A 2F15A 2H9GB 3LNGA 4LARH 5D1QA 2BVOB 3K1KC 3RL1B 5F93C 2CLZA 4XP5L 2YGPA 1WZ1H 3LKSA 1M05B 3A23A 4LFHG 5B1JC 5JQIB 1BQRA 3BSZH 4JE0A 4JHVA 1UM4H 1E5CA 5FK9A 3FB6A 1OKEA 3NIDE 3FB6B 4UT7L 4OZFH 1VACA 1KTKE 2B1OA 2KQNA 4OZFB 3VXUA 3ULVD 4BQ6A 4JHAH 5FHAL 5KSAB 4JJHA 5IFHH 2ARJA 1W91A 5EN2B 4JRXA 1F4WH 3ILPA 2R9HC 4C59B 2DYPA 2Y7QA 3TZVC 1GMIA 3U2SB 3UYOD 2H1PL 2IQ9H 4Y19D 5GZND 4PJFA 1E2VA 4OCWH 2YBRA 5L4JA 2H32B 5FUCE 1A8ZA 4N2MA 4XBGA 1COBA 1E6OH 2DPKA 2DI7A 1ZDQA 4FFZA 3HKZA 3C5ZD 4N0YH 3A67L 4RISH 1S7SA 1KYAA 4Z7WB 3HJ0A 5I23A 2I07A 2N7SA 4GRWE 4N28A 4QRQB 4HJUA 1SOQA 1YZZA 4JFDB 4P3DB 4HJEA 5E51A 3HG1A 3AWEA 2IANE 5TF0A 4WK4B 3LSOB 5C71A 1HJBC 4GAGL 1R0AH 3HCVA 4U6XB 3B2UC 1WP6A 1XGTA 4Q6IA 5TE7L 3AG4B 5I1LA 3OHXA 2MEJB 3PGCA 4FQHB 4HEPA 4K7PL 5CZVH 4ZO7A 3P73B 4NUJB 1G9ML 1CICB 5B39A 4XWOC 3QNXB 2WBJD 1E4XH 2DKMA 4AVKA 4BFKA 3LZFH 2AEPL 1UVQB 4NZTH 4NHUB 2Q8BH 2DRUA 4JO2L 2DBJA 4D8PB 4IOIB 1D7FA 2BW4A 1SQ2N 3EHBD 1OM3H 4NEHB 1FHGA 4R5TA 2ED6A 4PLKD 4A7VA 4CRPA 5ESVA 5F7DB 1MWOA 1BX2B 1SHSA 2XFGB 4LNRA 1Q9KB 4HW6A 5I9QB 4ZD3L 2YFOA 5F88B 1JFQH 1TQWA 5CF3A 1HVXA 5DWUH 1DQDH 4DGUA 3I75B 3UJIL 3Q8CA 2XQYA 5AWNL 2PYED 4IBZA 2IBZX 3DURB 2J8HA 4GAJH 2NYZA 1VCAA 4WI4A 5C0AB 4X5RA 1DLHB 3KLQA 1LO2H 4U7SA 2N4IA 3T6XA 3T6WA 1SZNA 2HP4A 4NQEA 1HJCA 4DZBA 5C0FB 4D9RD 4XMKH 1X5FA 1YECH 3FT2B 5EH1A 3MUHL 3BDXA 5EPMB 2DQHL 3GSVA 3QQDB 3E8VA 4PY7A 5HHNA 1KB5L 4FFVD 1L6ZA 4UQ2A 2B59B 3HLAB 2BZCA 1ZHKB 4XMWA 4TTDC 5GPRA 3UTPD 4WHDA 4D3CH 3UBXG 2DQTH 4DQAA 4J5VA 2XTJB 2YKLH 4HC1H 2DQEH 3DHPA 4Z9KB 3EBIA 4OQ1A 3KAAA 4U1NA 5GRJH 5BO0D 3QR1A 2ITCB 3MYJB 2PABA 2X4PB 3AREA 5BZXA 3ATFA 3ZIYA 4JFHE 4WTQA 3I6LE 4P2QA 5ILTH 3Q8EA 4UILH 4I48B 2UUDK 4MZ2A 1INQB 1TIUA 4PJEE 4TUKH 3THMH 5SV4A 3O9WB 3ZKMD 4KO9A 3FKUS 4LT7A 1UD2A 4NM8H 4ZYKA 1AKPA 1C5BH 3MDJA 1U41A 4E9XA 2FT7A 5DEFA 2WXGA 1GYWA 4Q52A 1OAZL 1MAMH 3U79A 4NNXA 4XB8A 3I50H 2R83A 3SE4C 4TTDD 4EN3B 4P23B 1AO7B 3WJMA 1QFOA 2Y1AA 2C5DC 4PJDA 4MQSB 4PJDB 4X9IA 3DDGA 4OV5B 1DUZA 4DCQA 1N2RB 3GS4A 5IVZA 4EN2A 1LE9A 2IH9A 2GI0A 2BJML 3KYMB 1IGCL 2J72A 4KKZA 2R2EB 1URLA 1Q9LB 5J12C 3GMRB 2YLHA 3F04A 3QARA 4PB9H 3FO0H 5JXAL 3KD4A 1GSKA 4ANVA 3NFNB 4I0PD 4DP1X 1ZLWK 2DAVA 3BYTA 2J20A 4OGQC 1OT2A 2X4RA 1DO5A 4MS8D 2YAOA 3EJSA 4K3GA 5F7FA 4Z3EA 3LQZB 3V9CA 3QVAA 1RULL 2R69A 2BHZA 3SDCD 1CDUA 2PP9A 4NBZB 3K4ZA 4GRMB 1T6BX 3ARBD 1CZ8L 3IGAB 2L04A 3KPTA 5HHXH 5DEZA 5JW5A 3GLZA 5E1GA 5ANMB 2ED7A 4RMVA 3PWNA 1WV7T 3EDFA 2Z0BA 2Z65C 3ARPA 5FYLH 2X0VA 3H2PA 1E8WA 5DC2A 1PSKL 4CILA 4I87A 3P9LA 2OSLA 5I75B 5AW9B 3SGDI 2AJ3A 4L18A 3K2MC 4PJ9D 5E5RB 1CICA 5B39B 3AY2A 3VD5A 2OSYA 3IFNH 2WXNA 4YXLH 3LKOB 1HINL 1QI3A 3EG9A 4EIZC 3N91A 5AALA 2NW2B 4P46C 5HDWA 4D7BA 1GHFH 4YDMA 4JLRB 4OCRH 4OR1A 3SE3C 3OJ2C 4XP6H 4G43A 4AX3A 1SJXA 3QWRD 1YYCA 7CGTA 5HYSB 2ZUYA 2I5YL 4ONHA 2JIXD 3DV6B 3ILDA 3UDWC 1UEMA 3BCFA 3ARBA 3RVVC 5BOZG 1G7HA 4YJZL 5J06A 3T4AB 1N6VA 3DI2B 4NENB 2I07B 1J8HA 2EJ1A 1DQML 2J5LB 1K8IA 1BAWA 4JFHD 3VXRD 4UIKH 3FH5A 1NGZB 3IDNB 5A1AA 1D2PA 4W6XB 3RJQB 3HFFA 2X4TA 3QJTB 2CHZA 2PP8A 2SEBA 1A9BB 2ED8A 5EBGA 4CN1A 3VXTB 3TVMB 1RU9H 1L7IL 2FHBA 1R19A 2OMWB 5DCCA 4DFIA 4LLVA 4PJ9B 3UTSB 5MEQA 5IEKA 1KLUA 1NAMH 4UZGA 4X6BB 4BQCA 4RVBA 1XF4A 2WNKA 3BZ4A 2Y5TA 3OGCA 4E41E 5EC1A 5EC1B 1JDCA 2A0LC 2ZSVA 4FYRA 3JV4A 4Y9BA 4OLEA 4XVTL 3AUWB 1WHPA 1GKOA 4J23A 4HUNB 1AGDA 1F6FB 3HS8A 5DVOA 2KMWA 1XB8A 4DO4A 4H8VA 3EH1A 3G04A 3HN3A 2ZUQC 2YEVB 3Q01A 2SEBB 4Y19A 4XN7A 1YAIA 2BC4A 5EUOE 5CAYB 5KW9L 1MHPL 5IREA 1CF8H 4LEOB 3QIBA 2PO6D 3US9A 3X17A 4HIPA 1EFXB 1I8KB 3C60D 2Q2EB 3C8DA 3GBMH 25C8L 4M5YH 3ZJAA 5CJ5A 1OAKL 3L95B 1KZQA 3S6CA 4KVNH 5KVGH 4S1RH 2B77A 2R27A 1YEHH 4NYLB 4PGDA 3V4VB 3U6RB 4PLJC 5D9SB 2OL3A 1ZIAA 3TBVB 2FWLB 4FYTA 2V17L 2EADA 4YVNA 3W9EA 3CFTA 3W9EB 4UDTA 3ZTJG 1SOXA 3BHBB 2BMKA 3IDMB 3GSOA 3QDMB 1EDQA 1QNZL 3A6BH 1G0DA 1DEDA 2DDQH 4G5ZH 5DDHA 1KB9K 3SE4A 2QQLH 1NPNA 3U7WL 1A7NL 1OGAB 2ADJA 4FFYH 4CJ1A 1CFNB 1FFPB 1UZGA 2OK0L 3DSFH 3H9SB 3K6DA 4WW1B 3MOBH 4PJ6A 4XZUA 3SBWC 1J7VR 3X12A 4FTVB 5ENWA 4HJJH 1BJ8A 3D05A 5E8DH 4N2LA 2CPCA 2DQJL 4H88H 4JHUA 1CE1L 4XC3H 5IR1B 2VO8A 3P0YH 2ENPA 2WXFA 2HFGL 2NOYA 5F7NC 1S46A 2VR5A 4RRPA 4Z3IA 3TXAA 1NFAA 2Q3ZA 1G43A 4I4WB 4QRTB 5JHMA 3LKNB 2A74C 1D9KB 3LPWA 1QWHA 3JYCA 3ZYJA 1J1OL 4HUWA 2LLGA 3WJJA 3PWLB 4AYGA 4XPFL 4EDWL 5J7CC 2E6PA 3FN0L 2VDKH 2DM3A 2FO8A 1CXKA 2R0KL 5D72L 1KCRH 2XQBL 4YGVA 3VNZA 2MTAA 1D5IH 3D07A 4X7SL 5IOPA 1AQDB 1AQDA 4LP5A 4RWYL 4P48A 2PWFA 4F9LC 2VTFA 4JO2H 4LKCB 5IQ7H 1ZCRA 4BHUI 5EU3B 2OJZL 2NX5B 3O2DH 4MAZA 1B0RB 5TJWK 1WTLA 4EQ3A 4U05A 2OYKA 2A73B 2C4XA 1KPVA 2H1XA 3G3LA 1JFQL 2Z92B 1U6AH 3EYVB 1E2ZA 4H8WL 4I2XB 4PQXA 4DKEL 4K2UL 3D3VB 1TTFA 2RBLA 3CUPB 3K8KA 5HYFA 4A7QA 4GYBA 2LW3A 2IGFL 1ZA3B 1YY9D 3FQRA 4GW1B 4XCFH 4CVXB 1NM4A 1L7TL 3PGFL 5B1BB 3QORC 4OGYL 5AVZB 3SGEI 5C9JB 3RWDA 4K7PX 2TRHA 3K81A 3WXVH 4P8QA 1AHWC 1LJMA 4PG9A 4PS3A 4HCFA 3NCCB 5LWYL 2ALAA 2D7MA 3DYMA 4P4RB 4AJWA 2DMHA 5CLTA 1YYML 5D5MA 5EO9B 2DYRB 5F1OB 1N68A 3MV9B 1BZ9B 1IBGL 4Y5YB 5KSBF 3P2DA 3T9WA 4R6UA 1JF5A 2YXMA 3PL6B 2WTPA 4Y4KC 2EE0A 5JR1L 3AADB 5EO0A 4EEEA 2WBXA 4KC3B 5IHUH 1OSZA 3DIFB 4KXCA 3G6JF 5DVMA 4P2AA 2AF2A 4E9QA 3VI3B 1QO3A 1NM9A 3NTCL 1N3NA 4Z0XB 3FF7A 1EFXA 1PDKA 1OWRM 5HVWA 2UWEF 5GGSY 1M6UA 2YUXA 4LPYA 5I66B 5ESVB 5F7DA 4P23D 5DUBA 1T03L 1ACCA 1CL7I 1A9VA 2W8CA 3N40P 3BX7C 2EQDA 2OPCA 4G9FE 4QNPF 4X5WB 3SDAC 1AGDB 1ZGLP 1CI5A 4MTMA 2KPNA 1CYWA 2G3NA 4W9IC 1J8RA 1L9NA 2FT8A 5I1AA 1KBKA 3I50L 4HMCA 3WIHH 3DURA 2VDML 2X4SA 1F2QA 3RPIB 3NACH 1B6DA 1W2KT 4MJ2A 1EJOH 2CAKA 4YDKH 3GJFA 2QGCA 1NFIB 5J6GA 2D7NA 3TBSA 4OGZA 3JWOC 4M3HA 1Z9PA 2LU7A 5EZPA 4OQTL 2R1YB 4HKXA 4N8VB 4UOQA 5JHDA 3ZUNC 3PXHA 4ZW3A 3ZDYE 3RFZC 3P30H 3AITA 2AVFA 5D1XE 4MQ7A 3KLDA 4TULH 2E9BA 5I1HH 3SBPA 3H42L 4PRNA 2UUDH 5KYYB 1FCGA 2K1MA 5HHOB 4Z3HA 2E7CA 4ZUSA 1MHEA 4IK6A 2F74A 1MHEB 5T3XL 3N44F 3X13A 1NIFA 1C5CH 2XWTA 2XWTB 5DDHB 2J12B 5CN1A 2D31B 1JZ5A 4Z3TA 4HBQA 2VL5B 3PHOA 1RZIA 4DVRH 3EGDA 4WW2C 4A2EA 5JQ6H 3AAZA 3AAZB 1QZNA 1QYGH 3MUJA 1KCSH 3NIDF 4R4ND 3WLBA 5I6OA 5L0QC 4PJXE 5CO1A 2CO3A 3KBFA 4FQJL 3CMGA 4LKXB 4OFYA 1P7KA 3QJXA 5IBUB 4A2DA 2AANA 1AG6A 4JM4H 1R5VA 3ILPB 4F58L 1IFHH 3F85A 4JFFB 2Y07H 4GS7C 3MRIA 3UGEA 4P05A 2X87A 1A9EA 3UTPE 4A2GA 2GEEA 3LEXA 4LLWB 5ESAB 5EZJB 3AWGA 3WIIH 4Y2DC 1IO4C 1LP9E 3KNBB 4OCRL 2AK4D 3FQXA 4KDTC 1E5ZA 1KGYE 4OM1L 4KHXH 1RSFA 4YC2B 3EH5B 3A24A 2C8NA 4W4OA 2CMRH 3HAEB 1U8OA 2VQ1A 4ETQA 3QIBD 2AEPH 3D18B 3IEAA 1SY6A 3LKSB 1SM3H 5L2KB 1VGKB 1T7WA 4MRBA 4NC2B 4XX1G 5CXPA 1QR1A 4M7JL 1AI1L 1VGEH 1A6WL 4IIQC 4GG6E 3EOAB 4C8XA 1O9WA 3II1A 4KTEL 1A3ZA 3WY2A 5IW3A 1HL9A 3QULA 1MJ8L 3K2UL 2I60L 4ODXA 2X12A 5CJXC 3CV5A 3MV9A 1FI8C 2NNRA 4TNEA 1A02N 1F00I 1S7QA 3MI6A 4XNXL 5CGTA 5I1CH 4PG9B 3WE1A 3O2DA 3O6FC 1WEJH 4Y4HC 3MGAA 5BOPA 3US0A 4AYFA 2VC2B 5D2NA 3IJ7A 2XWDA 4Z0BL 5IVNA 5EO9A 3UTZB 3EADA 1XXDC 3GYRA 2A38A 3PAYA 2EIBA 3L45A 4QXUL 3QFJB 4JFXB 2OMUB 3HE6A 2Q87A 5FUCC 4Z7OB 5EOCL 2N01B 3MBEB 5AW5B 4L1LA 4NDMB 3UPCA 2VAJA 4GO8A 4UT9A 3FRUA 3OSKA 4GRLA 4MRCA 4QAWA 4YE0A 4DGIH 2WLIA 5AB9A 3QO0A 3JWDH 4AITA 4P3CL 2I7OA 1BLNA 2C9XA 5LBSL 1I4FA 1UD5A 5ITFA 4R4FL 3VFOB 4IBUA 4N0UB 1GGBH 5IJKC 1T5XA 2PO6C 3G5VB 3WHXA 5C1MB 2CGYA 5ES4B 1CL7H 1B0GB 2EYTA 2CBTA 2F08A 3LN5B 4UDUB 2NY5C 3T6VA 3QNZB 1LO4H 3SDAA 4PUBH 1XH0A 3SJVD 1ILUA 3EGXB 2YWZA 1T5WA 2EZ0C 3BPLB 5F96L 3I2CH 4QRPB 3L1EA 1YPZB 1QFUL 5DMGC 3THML 2EDXA 5EU5A 4RDQF 1JGVL 1OARH 2WINB 3QHTC 4WFEE 5AOMA 3DVGA 3ESVF 3QPXL 3S8FB 5LN8A 2AJYL 1TQTA 3L3DA 3L3DB 3QE5A 3F7VB 5JW3L 3RGVC 1AKJB 1YUHA 2HZHA 5IP4A 4XBPB 2CO4A 3WE6A 2FIKB 3E1ZA 3Q7JA 3TCLB 3HB3C 4G6KL 5LAPA 1WE5A 7PAZA 2ZOTA 2GBAA 1ULVA 5F7UA 2EDKA 5HPMA 1ZT4B 1R3HA 4WFFE 4KVCH 4X6DA 4AUUA 1HCFX 5IW6B 1CD1B 4G72B 1ZEAL 2O6EA 1NICA 2NY3B 4HXBL 5I0DA 2OMYB 1D6VH 4QT5A 1RP9A 2E7HA 8FABB 4FQXC 2Q8AL 2MQ0A 3GMQA 3WJJC 3BAEH 2Q76A 1C8QA 5KBMA 2NQ3A 3VXMD 1IBFA 3IFLH 4A6YH 5C0AD 3H7LA 1N6QL 3S5ZA 2PW1B 5BMFH 1RIHH 1IRAY 1CQKA 3ETSA 4YDZA 1KIQB 3K74B 2WMPA 1AC0A 1IE4A 1M3JA 2NNXA 4FQCH 4L5FL 4LCCC 4FTDA 1I85C 3LTVA 4AQEA 3HB3D 1P9MA 4POUB 3D12B 2GJ6B 5F1NB 4LLDB 2AQSA 4CU8A 1WO2A 2GIYA 1OP5H 4OD3H 4FXGC 4NQXA 2WXQA 3HZKB 4F33A 4Y1AE 2R0LH 2B1HH 2CJTA 4NSKA 1I8IB 4XXWA 1B3IA 4BCXA 3TA3D 2A3TA 4XZUB 3TBTB 3ZW3A 2XTJD 4UDTB 5EO1B 4MCYA 1MCIA 3VFWA 3TC9A 6TAAA 4KX9A 4FMFA 4XO5A 4YXLL 3BKJH 3IBOA 2VLJE 4L29B 2LOEA 2A6IB 4XE0A 1N9PA 3FO9A 2OMVA 1JZ2A 2Q5BA 4IIQA 2CK0L 1SMDA 1YVLA 4F8NA 1RFDH 3HMXL 2X9ZA 1G9MH 2EXYC 4X8CA 2DMBA 3WN5C 5E4EC 1DSFL 2VDKB 4ZMWA 2HTLD 4A38A 3FOLB 1GZPB 2Q8BL 4M7LT 4PJAE 2ZG1A 3NCYP 3R1GL 5EFIB 2HG0A 1L9QA 4KXDA 1UD3A 5T8IA 3T3ME 4ZFOL 3C08H 2YGNA 5KSUB 1AMYA 1P5UC 3GDBA 5FHBH 3LEXB 4LLWA 4ETQB 5FM5O 4NBXB 5MEPB 1AGBA 2SODB 1B9KA 2ZONA 2JIXA 4PJ8B 5EZLA 3OM3B 2DW5A 4FQ1H 5DVPA 2BHFA 2WQAA 3JV6A 4HIHA 5KS9F 2EUWA 4GXUM 2AXFB 3IXAA 4FEMA 2H0EA 3FNKA 4R5VA 4NJ9H 2CHXA 3MRGB 4H13C 5D1ZB 4KKQA 1A6VH 4AQ8C 2BVYA 1FO0B 2E0PA 1U8OB 1SJMA 2Q0ZX 4NENA 2J88H 4DESA 2A7BA 1KYOJ 3R8BB 3TA3A 3B4NA 1NEZG 4Y4KD 5KBLA 2W07A 2FJHB 4KH2A 3PQYD 5DUMH 4PJHB 3D0VA 3OR6A 2B2XL 4XXDA 5C0IA 2PXYA 4Z3JA 1OCCB 3BH8B 4LSDA 4PAZA 4JLRA 2NDFA 3RFRA 4AH2B 4C57C 3V6FA 2OMWA 1NIEA 4FHBD 4MNGA 4W9ZA 1JVKA 3DV6A 4XI5C 1HL8A 1HSBA 5EU5B 4AVIA 3ARBB 2BY1A 4KJQD 2XKUA 4UI2A 2W65B 2W65A 2AERT 4KFZC 1M6OB 4A04A 2XACC 3SO3C 2VDMH 4O4YL 4EIUA 3P02A 5F7BA 1LGVA 2Y06L 1EBAA 1ZKAA 4GB9A 3BOVA 2Q2LA 1NBVH 2D3VA 4AOFA 3BXNB 5LG6A 3ZKXC 1M7DA 4ZDHA 5GGSB 2K3TA 4Y4KB 5CR8A 1HDMB 2GHZA 4ODTL 3B7RL 2Z4TA 1MSPA 4FJ6A 3DVNB 1ASOA 1J12A 3ALWA 4PW4A 1FBIH 4IMLA 3IJ8A 3ESMA 3P11L 3AT0A 1KENH 3D2UB 2OMTB 2BNRE 1F3RB 5FV1L 3BSGA 1EK3A 1Q9KA 5T3ZE 2G30A 3STZB 4GKZA 1WAEA 4NM8L 3O3EA 1VCBC 3PQYA 4KO5A 1V27A 1TEFA 3Q2NA 5IEHA 1NAKL 2DM7A 4X6DB 4N3UA 1KACB 2P8LB 1M71A 1E50A 2GBTA 3DOHA 4P2RE 1OGAE 4ZO6A 3AVEA 4F2MB 5GGTH 2IDUA 4OZ4A 2GT9A 3VUAA 5EBLB 1WBYB 2ICEA 3MV7A 1JTOA 3OLIA 4X4YA 1ZMYA 1HILB 3BD5A 3RY6C 3LEYL 4RFNC 2M8XA 1MCDA 5EO0B 5D5MF 1XWVA 3W39A 4B9PA 4F58H 5I66A 4YBLB 5DD1H 4F3FB 1L9PA 4NWTL 5HJDA 3DIFA 3KYKH 1BXAA 3D52A 2WD0A 4DZ8B 4G83A 2NY6B 3BQUB 2OI9B 4NP9A 5DC0A 2QR0B 3VU1A 4QRSB 5FWRA 3S4SG 1C1EL 4HJ1A 5ICZA 5I1EH 5JHLH 4BH7B 1L9OA 1NMBL 3GBNL 3WXWL 5I15L 2YSTA 4I0PA 4YIQB 4YHOH 5E2WL 2ISDA 3Q0HA 5T33H 5D93C 1A66A 3EJJX 5AVVB 4Y2DD 5TD4A 5GISH 2F5AL 1REIA 3CZJA 1C7TA 1OTUD 2W59A 4N1HB 4CA4A 1PKOA 5DYOA 1JVOA 2IDTA 4JJ5B 4XOBA 1PX8A 5L7XH 2V8MA 2GHWB 4KY2A 1KZYA 1TR7A 1YN6A 2JLLA 4R2GC 1XQ4A 5FYLE 3HAEG 4AENA 3QJZA 3N1PC 3TASA 2CKNA 4DEPB 2MCG1 1U8QB 3D87B 4EDXB 4K2UH 5E9AA 3CVDA 4P57A 3SDDA 4B9YA 1OGAD 4P59L 3MRKA 4MLIA 4LMQI 2RALA 4LKCA 1G9HA 4JFOB 1XGRB 3C6LA 1AACA 3GXIA 4KI5D 2FHFA 1CK0L 1RD6A 1QPXA 2VZ1A 4G7YL 3DX7B 5CCKL 1VERA 3FTVA 3NZHL 2BVOA 3U25A 5ISZD 3LZFL 2H8PA 3U83A 1WAAA 2OMNA 3I02B 3CHXA 4X7FC 5AOZA 3BFOA 5EZIH 4HLEA 5HHQB 4YGVB 1OD9A 4ZK8A 3V0GA 5C2BL 1G7JB 1NEPA 2Z92A 4UIKL 4IKKA 4YC2C 2WXHA 3F3HA 2BWQA 3H9YA 4UANA 4AC2A 4AH2A 2YUZA 3TBWA 1OLLA 4W9EC 5H37A 2GC7C 2YEZA 3GEWB 3PGDB 5TDNB 3QJFA 1M56B 4JG9A 4P0DA 1J18A 3VQ2C 4WU5A 2Z4QB 3IXTA 3QUMA 2AXGA 4TMPA 1UA7A 4NQDB 2XG5B 1DL7L 2EH7H 2BY2A 4NKMA 4PV8B 3QJQB 1PJ9A 2HPTA 5JIPA 1P53A 4GJTB 4GMSL 3PE9A 4TUOB 3OAUL 4ZS6D 1ZSHA 4OLWL 1M7DB 4JQXC 2HRPH 4ZDHB 1MF2H 4ZQKB 4FG6D 4LEEA 4Q6IB 4LIQL 4JN2B 5IB4B 3F7LA 4WJKB 2EVGA 1E4JA 3BQVA 4YDIH 2DI8A 1D5ZB 1RMFH 5DO2D 3MLXL 2O30A 1TJIL 4HWUA 5JIMA 4ODVL 3KR3H 1RKRA 3TNNB 4BFJA 1IQDB 4IOIA 3GMNA 2OA9A 3OXSB 4PJ5D 1XGTB 5IV2B 2ORBH 5ISZE 2F7QA 5SWZB 1GJIA 2DQEL 3NJKA 2ZXEB 2GC4C 1JNLL 1HCVA 2J8UF 3BKCH 3M1BB 3U4BH 1DP0A 3K6NA 4HDIB 2AABH 4YHPA 1KY6A 2VLMD 1M6OA 1HZHH 3QDGE 2NNAB 4HXBH 4YHZL 1PQZB 4AM0Q 1KBPA 2ZUVA 3NJGA 1TVDA 4IRSD 3JZ7A 4KKCC 4CC4C 2FIRT 2VE6B 1XL6A 4JQIA 2JJWA 1QP1A 3SE9L 3HZ3A 3RY6A 4AKQA 5H8DA 4HJJL 3BAKA 1C5BL 2ICES 4WNQB 4JFUA 1S9VB 2V7NB 3B2MA 4I8DA 1KJMB 1MAML 1UB5A 4PPTA 3FL7A 3WI9A 5AL8A 2IOMA 3P0YL 5IG7B 1L6PA 3CWGA 3KWVA 4HJGB 3AB0B 4J4PA 1VKXA 3QUYA 3QUXB 1F41A 4PRID 5DMYA 5GIRA 3P69A 4KRPD 3VFPA 4JO1H 4PJIB 2YGOA 5I6LA 1BFVL 5F72S 3RUGA 1TLMA 1TSHA 4K3EH 3N41F 2DQFA 3DX9B 4JM2C 4L3CB 4LSUH 4I77H 4L3CA 1WC7A 3FT3B 4NRXB 1A64A 2ZXBA 4BXVA 5BOJA 5IGXL 4OJAA 5IUSA 1R24B 1SRDA 2J1XA 3FMGH 1BF5A 2BOBA 5DFVC 1MCWM 3LS5H 1ZIBA 3D30A 3QIWA 1WFIA 5TQ2L 1LO5B 1M57B 3O4OB 3QXDA 5BQ7A 1WA2X 3F7YA 4HJGA 1S9KC 3EZ8A 3QRBA 3UJTH 3LKQA 4F7PB 5HBBA 4WO4C 1EBPA 1G87A 2Y7OA 3LDBC 1ZSDA 5JPMA 3LRSA 5J57B 1IEAA 4OKDA 4MJ5B 4Z7WF 3CZNA 2XCMC 3QDJD 4XTRC 5ACLA 4KMTL 2BNQB 3PG2A 1N8OE 4YL4A 4R0LB 5E4IA 1WICA 3LPPA 1FWXA 2H6UA 5D1ZD 3BUDA 4OIIH 1BEXA 4J2XA 3IJEA 4GUPA 3PHOB 2MCMA 4IOFD 1DN0B 3CVCA 3MNDA 2XWRA 3I3EA 1J0JA 1YEIL 3TZVB 3MNZB 1U6AL 4H8WH 4Q89A 4UBDC 4LSQH 5E8PB 5AVUB 1JWUB 4Z7VE 2R7EA 4L4TB 1MRDH 4RMRA 2QEJA 4ODHH 3BUYA 1JZJA 2V2TA 1Y6NR 3RWFB 4RIRA 5IESH 4JFQA 4KZEH 4WWKA 4LLYA 1P7QD 3S8GB 1L7TH 1PZ5B 5TFSH 4BSVA 2HLAB 1MIEL 2H2PD 2EXWD 4MJ4A 2J71A 3ARTA 3QUXC 2ICEC 2ITDB 5GS1B 4QJ3B 1I1YB 5E6ZA 2C3VA 3VXRB 4L1DA 4PJBE 5I18H 4CUCA 3WN5B 5C97A 3TJHD 1GAFL 4QDGA 1U8QA 5TE7H 4X0KB 5DHVB 5JOPE 1ZJBA 3O0LA 1AZUA 3C6EA 4FNRA 1OAYH 1E4XL 3V0IA 3QRGH 3VFRA 3GBEA 5B38A 1NAML 4DWHA 4FLRA 4K71C 2IAMC 1MI5E 2E3VA 2GITB 2XX0A 4KJQC 2PYFA 3ZHDA 1LE9B 1PEZA 1QA9A 2WZ6A 4KFMA 3R06A 4PGCA 4K7PY 3GIVB 4P4KA 4WJ5B 5HVGB 4Y2LA 3S8WA 2WXLA 2R2EA 2WVVB 4RMBA 4ENEC 1T80A 3GMRA 2DJMA 3ZDXE 4I5BB 2X0UA 4B9CA 1F4AA 3NH7L 4DPBX 4G8EA 4IS6A 3T3PB 2ESVD 1CT8B 5INCB 4NQDE 5ITFB 5L2KD 1EFXD 3D0LA 2FJGB 4UQ9A 2D7TH 3GBML 3MCYA 4YR6B 1IJNA 5I73B 1BZ9A 3C9NB 3QWOA 4PJAA 2F1EA 5DJXA 4MNQE 3DO3A 1L5GB 1EGJL 4XNDA 1ES0A 1E6JL 1XR9B 3AXHA 4ZRGA 3Q48A 1RJZA 1R3JA 4RGMB 4B97A 1E9OA 1MNUL 2R29A 5JDJA 1FYHB 1S7WA 1EO5A 3M88A 4MHHG 2FQGA 3CSGA 1KCUL 1SVCP 1T5XB 4FA8A 5L88L 1QFWI 2V9QA 3U0WL 4DP9X 2J8OA 3T0DA 3MMEA 5HGDB 3PDOA 5MERA 2CPUA 3ECVA 3O0RH 2PCXA 1CWVA 5DJXB 4PJIE 5DK3A 3V0WH 4HC1L 3RWHA 2QLYA 5F1KC 2HLFC 4F91B 1O7VA 2CLVA 4LE8A 2FHCA 2NT1A 1UCBL 3GRBA 4GG6A 4AV0A 1ZV5A 3D3VE 1E9OB 1T1YA 2VR3A 2VL4A 4N8UA 5GGSA 3BZFB 2C1OB 4ZPVA 5EDXA 3P4NA 4G8GA 1TENA 4HZLA 2XSKA 4JCMA 3ET9F 4LVNC 2FH8A 4NZFA 4S1DC 1ESOA 1IAIM 1WWAX 1E3FA 2P7TB 3BP7B 1IFHL 2WTRA 1S9YB 2H3XC 2HSIA 3L4VA 3H56A 3UTTA 2QQNL 2IH1A 7PCYA 4BUQA 2R9HD 3Q6FB 3FN0H 3ZHKA 1VIWA 4TM9A 1M71B 2FH6A 3F58L 2FSEA 2PYEB 3UEZA 3VSUA 1KIUB 4AJ0A 3UMTA 1KG0A 4TNVF 1E3XA 4QAMB 3OQRA 1I7UB 3O8XD 4JZOB 4K5MA 3STZA 1QVOA 3D85A 2IBBA 3LH2L 5ID0B 2ZXCA 4NZ8A 2UY6A 2J43A 1E9PA 4YHYB 1SBSL 1E9PB 3S3DB 5C2BH 4PLOB 1ZANH 1EZVX 1NBZA 4DVBB 3GC3A 3BEWA 1GPOH 1JPGB 5IOKA 1GC1H 4HIIB 3R7RA 4JMXA 1LEKA 1CO1A 4UINH 1IBHA 4RIRB 1MJ8H 2ZCHH 3K2UH 4ONOA 5CEZH 4NP4L 1A4BA 1PZSA 2X40A 3KM2A 3RVUD 3MV7E 3VCLA 5DHXB 3BQUC 4JG1L 5F44A 4MNQB 5ESQB 3FC8A 2BNRB 1R3KB 2IV8A 2WOBA 5GHWH 3B7SA 2LAAA 4OAWA 3V0VA 2WVTA 4A2LA 4E9WA 1TLKA 4BE6A 2AJZB 4BDVA 2BMKB 4MB1A 4LMQE 2DY2A 4L9LA 4LHUA 3O4LA 1DBAL 4N2IA 3LEVL 2VLJA 3V79C 1OEZW 1J1XL 4WFFD 4DGWC 2CSPA 2VXQA 2F8IA 3IFNL 4P2YA 1HNGA 4WJG3 4X6DF 1KGIA 3GDCA 2XBDA 4UZSA 4X98A 5FGCB 1A1NB 2ZP8A 5D2NE 4BUGA 3CSYB 1M9WA 4PLKC 4GRLD 5EO1A 5H94A 3VFWB 4MMXC 4DN3L 4S1QH 4GSDL 2BERA 2WQ8A 3IK2A 1VEMA 1IGTA 1Z6JT 4J28A 2GY5A 4ODSH 5FM5M 4ZX6A 2MNWA 3CVHB 1EO8H 2AP2A 3T6QC 3EFFA 3ZE0F 1ROCA 5DO2C 4IKJA 1NBVL 5FLUA 5MEPA 1KGXA 3QEGL 1QFWH 4E9YA 2B4CH 4KXAA 4NIYE 1ZOXA 2XIDA 3FTGA 3GSNB 5TQ0H 5FK9B 3UYPA 3VXOA 1KN4L 3FH7A 1S7WB 4N2EA 1IKNC 1L7IH 1T5KA 4ZXBB 3I9PA 3V4UL 4GXUN 3NCWA 4KBPA 1PEWA 2VITB 4M8UA 3U1SH 1RUKH 4OZHE 5DFAA 1BFOB 1SYVB 4KK6D 3RDJA 1LK2B 1T7YA 4YSDA 1XHHA 5SX5H 3BAJA 1I8MA 1YNTB 4Q7DA 4XPTL 1ZV9A 4Y1AA 1Y6MR 1W0VA 1QSFE 1MFVA 4YFLF 1CT8A 4MXWL 3ZZSA 2VJ8A 3VXME 2EILB 3WNNA 1IAKB 1MCNA 3DPDA 2Z91B 4TVPD 4RDQG 4DERA 5DJDA 4XB3A 2D3JA 3QZWG 4EVNB 1ZE3H 1G1OA 4R7VA 1UZ8B 1S78C 1Q4NX 2APTA 2E9WA 5EEYA 4G43B 5E56A 5JQHC 4ZUTA 1NJ9A 2UX7A 3ARFD 5L6YH 4GXFA 2HX9A 3QISA 2WINA 2ROXA 4JM2D 2ZX5A 5CEXA 4PGZA 3RLSA 5E2WH 2OP4H 2ZF9A 3LNDA 4I1PA 3OKNB 5C0JA 3GXDA 4QOKE 1WFJA 5IF0B 2ZWKA 3NCYS 5DD0L 4H2AA 5J56B 4FQJH 3T09A 3IDYC 1MKFA 2WUCH 5F0JB 3ZQXA 4B3VA 3DSNB 4N0UA 5D93B 4PVBA 1TVHB 4JM4L 2BSDA 4TLTA 1CD1A 1ET5A 1UZ6E 3UX9B 2XN0A 3V6OA 1KTBA 5CJOH 4ABUA 1Z9NA 1PZ2A 1HKFA 1H0DA 2EO7A 2UXTA 5CIPB 3WIIL 1EEQA 1E9QA 3ZN6A 3WIFA 3F7VA 5IROA 3L3HB 3SN6N 1YEJL 1USQA 1O7DE 3QFDB 2JXMB 4PCSA 4MQXC 1V54B 1XB3A 5E5UB 1UTDA 3KYAA 4X5PA 4XHJC 2IALA 3MLRL 2E8ZA 5KVMC 2MCPL 4FL4B 2P44B 2CWRA 1OP3K 2FECL 5E99H 5EUKA 4B9IA 1BZ7A 5IHBA 1N0XH 1XDTT 4QTHB 5BRZA 3R1GH 4PVLA 5C0ND 5IKCB 1R3IH 1MHHA 1A7OH 5I1KL 4X50A 1RL1A 4N6QA 1EUUA 3DRQB 4LESA 3B2PA 4AT6B 3EYSH 1NIDA 3WIFB 3WNJA 2G4EA 1TXKA 3AU1B 2EIZA 2DLGA 3BUPA 4DHLA 1OAYL 4N2NA 2ZUWA 4F7PA 3KDMB 5IVZB 4FKEA 4HK0A 1T0MB 4I18A 5DRZA 3B9KC 3CDYA 1FL6B 4QHKJ 3H9HA 4NC1E 5LHDA 1RJYB 4H0GA 4D8OA 1GXEA 2AK1H 2AEWA 2J88L 4E9VA 1RUQH 1J1PL 4F15C 5BNXD 3FB7B 4MMXA 4B7IA 1NQBA 1AD9A 2GPZA 3QEQD 2E59A 4XN1A 3KPSA 3SDDB 1BZOA 2ZOLA 5JORA 5C6WH 5C9KA 3KNBA 1XZ0B 2R29L 3G6JA 4N90D 3QUKB 1X9RA 4KWUA 3GSUB 3IN0A 2OZ4A 4BKLA 4WTZA 3K6FA 5CFAA 2A99A 2V9TA 3JWDL 3QQ4B 12E8H 1LLAA 3KPPA 1KDIA 4OGYH 3FTWA 5CS7A 4PMFA 3RVXD 3RWJB 1SMOA 4PJ7E 4GXVL 4ONHB 3B1TA 1NIAA 5F1IA 1AVAA 4J2QA 5CKGA 4IOSD 1G7PA 1A4KB 4ANWA 2YSSB 5IJVA 1RZQA 1UXWB 5KYUB 4JPQA 4OF6A 4N0FB 2XIIA 3Q2WA 1JFHA 2Y1ZA 4FL4C 5J89A 3LZOA 3DGGA 5AZEH 5EBMB 3G6DH 2FR4B 1SXSA 4PD4K 4Y1AB 1TJXA 4Y9FA 3C5SB 2Y7NA 4ORGA 1T21A 3ABKB 3D69A 5I5JA 5D1QE 4L8CB 1WSST 3QAZB 1B2WL 3UTSA 5IV2A 1DVFB 1CFSA 3C60C 3CHQA 4GQRA 5E2TL 2W0FB 3MBXH 1S3RA 2VDQB 2P26A 2IG2L 5TPWH 2ADFH 1H9DA 4ZXBA 2W95A 1A14L 3UBHA 3VD1A 3IGAA 2P45B 3BCDA 4ICXA 4NT6A 3W5NA 1MFEH 4NT6B 1RAMA 1EUTA 3N06B 2C7UB 1ITCA 5DJ6B 3VXTA 1U30A 4K23H 2J6EL 1A0QL 4ODUB 2W0FA 1NUGA 2Y5EA 2WLLA 4OF7A 3CQQA 1TZIA 3FN9A 4GIPD 4HIJB 3CFCL 3JT0A 1HHJB 4NZUH 1FZMA 4IM8A 4BSWA 5JHDD 5BV7B 2MPVA 1LEGA 1UWXH 3WL9A 1QEWB 2E7MA 4QI3A 1PKQE 1TVHA 3RUGF 4RZCA 4IKNA 4ZAKC 1OTTD 4TULL 2ENJA 1IGML 4S2SB 5L7XL 3WDJA 2CJSA 1XV8A 5DFWH 2NY7H 1EDYA 1Q38A 4XXWC 5IJKA 5E8OB 3PDOB 3UJJH 2R0LL 4M56A 4UINL 2YRPA 3HC3H 3H3PH 4N2FA 1XCQA 3WUWG 1XF5B 4LLQB 3LNFA 3QSKB 2AW2A 4LSQL 1YJDC 4PRNB 4RFEA 4UT6H 5LBVA 1G9NC 1PAMA 5JYLA 1HAUA 15C8H 2K45A 3LX9A 4H8UA 4I88A 3RDTB 4KKNA 1MCRA 3IKCA 4K9JA 3CPLA 1TPXB 4HFUL 3ISYA 4OCMC 1Q1JH 1CI3M 3IFPA 1BD2B 4A63A 4X9FA 2VM3A 3O6LH 1T0MA 1GIGL 1Z5HA 1MCOL 1OB1A 2IFGA 2VABB 3L3KB 5F89A 2QR0A 2B0SL 4AGLA 3SDYL 3FHEA 4I7ZC 5DS8B 1J0IA 4NKIH 1YPZF 2QKIA 4FABL 3CC5B 1JYWA 1U3HC 5ADOH 1DANU 3QQNA 4RSYA 3CZUB 1J0KA 4P4KC 2Z8RA 5DVNA 1X5LA 4ZMXA 4W9KC 2J2ZB 2P4AB 3QCUH 1YEDB 1EAPA 4PJBF 5T5FH 1WFMA 3ROOB 2COVD 3MCKB 4MA7L 2VABA 1FFRA 2A6IA 3RI5K 4YDVA 1TSRA 1MWAH 1ZA6A 5E6IB 1F58H 2VLKD 3KHOA 4WUUE 1R33A 4JX0A 4BZ2H 1HINH 2CUHA 4XMXA 3VFRB 3UH8A 2BW5A 4AW4A 5ESAA 5EZJA 2XVKA 1E43A 2WB7A 4H20L 3R06B 4PGCB 4MDIA 4PY8J 2IJ0C 3HVNA 5FPIA 2YOAA 1E90A 4HPYL 3POCA 2CR6A 4N2HA 4BJLA 1TJGL 2YD9A 3PAZA 3P73A 4NUJA 2Y06H 4P4KD 4DQOL 5I8CB 3DYOA 4NQCE 3IE4A 4OLYH 4MMXB 1DQMH 3B9AA 1QI4A 1MNUH 3W1ZA 1D2OA 4ONGL 3SDCB 4E9RA 1XCWA 1I8UA 1NZRA 2ATPA 2F7OA 2OTWB 5KSBA 2FJGA 4POYA 4JVWA 3D3VA 4WY7H 3JVGC 4AM0A 3GGWA 4P23C 1OE2A 2P9RA 3KPQA 4G8GE 1KIPB 1WISA 1FVDB 2JKIS 3AROA 3C2SA 1GGIL 2VDNB 4OF3A 2G75A 5C6TL 2A77L 1OD7A 2BP8B 3CIAA 4XXDB 3EOTH 5C0IB 5KN5B 2VXTH 4Y16B 2BHUA 2E9JA 4ZFGH 2PETA 3MRDA 1SXNA 4ZMYA 1JHTA 5K69A 3A3YB 4P07A 2WY3B 3NA9L 4MNGB 4LSVL 3KPRA 3N3EA 1HWWA 1PZCA 5FGRA 3UXFA 3PP3H 3X1FA 1SJEA 2P1YA 1BX2A 3KVDD 3CJJA 4OKVB 2ZX6A 3NZ8B 1HESA 4IRZH 3MNVA 1LDPH 2JIXB 1WPCA 4KOBA 1S7VA 1WITA 4LPXA 2AXHA 3JVGA 2C7UA 1IC7L 4XNMA 5FA4B 1ACXA 3EO1B 3NIFB 5D1ZA 3GQFA 3PL6C 1AR1D 2V9RA 4F37K 1OY3B 1HOCB 3L5XL 2CU9A 3HZMB 5BQDA 4GUCA 2D0GA 4GG8B 3VX1A 5GS1C 3SDXF 4KJYA 4OQTH 4U6VL 1QWUA 2EYTB 1IC0A 1HC1A 5SWSA 3RZCD 5HYJE 1MLBB 1YJDL 2ESVB 2F58L 2MFNA 3QHFL 4PB0H 1S7UA 2Q8AH 5C0BD 2HVBA 1KB5A 2HJKB 1AIFB 5M7QA 1KLUB 4X6BA 1FLTX 3QO1B 1JIBA 1GC1L 3MOBL 3KCPA 4KK5D 2C1PA 2A6KA 1JXDA 1VZIA 1OP9A 2DQFB 5FEBA 5BMFL 3I9GH 4YSQA 3QIUB 3ZK0A 1IKFL 2NXYD 3BPCB 5AYTA 5C0NC 4HH9A 4M8RA 4URTB 4CVWA 2X38A 3SYOA 3VFSB 3VFSA 2CUAA 1EXUB 4PP1C 2NSQA 1MUJB 5GGVL 3KGUA 5IMMB 1CQYA 3F65A 3IDXH 4MVBD 5FYKL 5AW1B 1F90L 5IG7A 1T0PB 3QGVA 1BM7A 1S7UB 3FUDA 3IPBA 3ULVH 3S2AA 2V8LA 2QSVA 4D7PA 2QVMA 1S9WA 3NFPA 5JPNB 5HP5A 4DOHE 3QORA 1FN4B 3TVMC 2E46A 3ROLA 1U3HA 3ZR6A 5ERWB 4Y4FD 3QWQB 2VH5H 4NHCL 3LVEA 1Z5LB 5K9QG 1USZA 3WIHA 3ULUL 2BSEA 4NN6B 2CKBB 3SE8L 4L8DA 2UVEA 4EZJA 4ZMLA 4X7SH 3RUGB 1GGYA 3EBHA 1KFGA 5H37G 5E00B 4F7EA 1YN7A 1E4KA 3VXUB 2X6VA 1H5BA 2GTZA 5DQDH 1E27A 5D7KD 4GIAA 4OJDH 1HFUA 3UZEA 5EUOB 3MRLB 2FWOB 4WQOA 3QR0A 5CLYA 2CXGA 2YKKA 1UOWA 4KITB 4MJIE 1UA6L 1ZWIB 5KTEH 3LXAA 4MD4B 2IPKA 4GO6B 1F8TH 2B7DT 3TH4T 3NCEB 1DJHA 3POHA 2OLDA 4JO8A 2G3MA 2RHEA 4X8GA 5DEGA 4DN4H 5DJZB 1DJIA 2AEOA 2YPLA 3L7FB 2VZVA 1A6AA 4X99A 3O3AB 2WP3T 5EUKB 2O5ZL 3VVVA 4OCXH 5GS0H 3MV8E 2H8PB 2WYHA 5ETUA 5I5RA 1A14H 3BI9X 1NPUA 4BINA 4ERSH 2RIKA 5DUML 4AEIH 1E4KC 2IANA 3VYOA 2QKIC 3HNSH 1Z7JA 2CNYA 4W9GC 3UZEC 2WJ7A 1XIWC 1QBAA 3TO4A 4X6FB 3KBEA 2PCPA 2BNRD 32C2A 5BJTA 1ICTA 5T3ZD 4GNKB 5IR1A 1T83A 1ASPA 1KCUH 1IGIH 5E2UH 3FYIB 2BIMA 4OM0H 1QLEL 1VFMA 1EZLA 4ZI8A 1MCEA 3SY6A 1UACL 4P57B 2XTJE 1FVEA 1KB9J 5AZ2L 3LRHA 3VFOA 3DDFA 5E8NA 3A21A 4JFXA 5D8JH 1EZSA 1Z2KA 4HHAB 4BK4A 3UC0H 1FO0A 2P8MA 3FRUB 2ICCA 5EC2A 2A5UA 3DOIA 1DBMH 4JRYA 1A3RL 1AAJA 3O6MH 2DKUA 2XNAA 4J3OH 3L9RB 2CRZA 4WDIA 5JZ7C 1AQKL 4FC3E 2WSKA 2NMSA 4O2CA 2AEQL 3NVQA 1ZVSA 1UD8A 2C4FU 4XNUL 5E6SB 3TWYA 3GINA 2QDVA 4O58L 1BFOA 3OAZK 4JPVH 1X5MA 4WFGE 4TL5A 3GSXA 1EQWA 3ZO9A 3MRBA 2G9KA 1JPTL 2I25N 2UYLA 3C5ZC 3U9UB 2FD6H 4ZOCA 5AVYB 3TOPA 1NGPH 1UWGH 5D4IA 4M3KB 2GSIB 1G7LB 3AMLA 4UB0L 2VDLH 2YBGA 3MRHA 1PF3A 4LSRH 5I1HL 4PJGA 4V1DA 3QZPA 1L9RA 3MLTA 3LD8C 2XG4A 3Q9PA 3X11A 1GCFA 1P6WA 2A9CA 3DSFL 2HJFA 3BO8A 3G6AB 4WEMB 3P3TA 5DU7A 1D3CA 3KPNA 3K5RA 4JDTL 2ITCA 5AAWA 1PBYA 4Y5XC 5T1LB 2VRKA 3T6ZA 4ATWA 1A9BA 5I71C 5TF1L 4KXZI 1EAQA 4GKZB 2WWKO 4RSVA 1F02I 4OGAC 2VE6A 2QQQA 4XVSH 3L1OL 2E75C 3ARFB 4Y19E 5D7IA 5GHWL 4LAQH 3WG7B 2HYMA 3UACA 1YNLL 5BV7C 2W92A 2F8VA 1BIHA 2NCMA 4AYEC 4KDTA 2LABA 1JD7A 3RNKA 1OF2A 3B7YA 4N9OB 2W9LA 5F7EL 2WYZA 1BEYL 3GHEH 3AZUA 5E8OA 2EVFA 43C9A 2QZ5A 3VWKC 1V10A 3OVUB 1AGCB 2FQDA 4DEPC 3VXMA 5T1DL 4FFZH 4IU2A 5C0AA 4MBRA 4Z95H 3VGDA 3M8OL 1O7DC 4Q2ZB 3O2WL 2F19L 2R8SL 3OPZL 4EI5C 4OCYH 2KLTA 4TNWK 1IM3D 4WSKA 2Y2YA 3DXAE 2EDWA 2OJEA 3A4DA 3CCHB 4ODSL 3VI4A 3A6CH 1OHZA 5T1JA 3RNKB 4HWEH 3VCLB 4HMEA 4K3HA 4XRCA 3MXVH 4NJAL 1JCVA 1I1AC 1IGFL 3MUY1 4M43H 1A6UH 5CUSL 4CSPA 1H9VA 2Q3XA 2BSSA 4M1CD 4ONGH 4XBGB 1ZD6A 3TN0D 3PJLA 1F97A 3K8MA 4TSBH 2ENQA 5F8RC 2X70A 3GMMB 5BVPH 2WGXA 3SOBH 3S37H 2YZ1A 4UZUA 5J6GB 3EYQC 4QY8A 2KH2B 4QY8B 3TBSB 1MCBA 3BUIA 1CXHA 5IB2A 1GGIH 4TVPE 1F3JB 4N5ED 1W80A 1BBDH 1WZLA 2C9RA 2GAZB 1YEFL 5F0MB 1RK1B 2NXZC 5DMGD 4KHTL 5ID1A 3TBWB 4GMSH 4YSPA 2Y69B 4LBAA 5EU7C 4ZOAA 5JHDE 4GW5B 3AT9A 1UXWA 5KYUA 1BQUA 4PIRF 5TDPA 2YXFA 1L9SA 2F9BT 4LSVH 4G2AA 2X70B 2MQCA 4CNIA 3CXDL 5B8CA 3CAFA 4Z7UF 5D1QB 4D0BB 3WFCL 1MZYA 3MRPB 3X1BA 1MEXH 2O4EA 4ZFFB 1MN4A 5IMKB 5DRXA 5AOKA 1MQKL 2X9XA 1LDPL 3PYCA 4TYUA 2AJXL 4FLSA 4JFOA 2NNCA 2C3HA 2Q10A 1JCKA 2Y4SA 2GJRA 1G7PB 2H0FA 4QOKD 5SWQA 3IYLW 4NGHL 3R4RA 2PPAA 4XPHL 4BWUA 1K85A 4QRFA 5F6HI 1DCLA 4LFHD 2F54A 2R2HA 4N0FA 5IHUL 4LK4A 3HE7C 2OXGA 3EOBB 3LY6A 4MAYC 3B2DC 3ME0B 4OLUL 3GUTA 3PPEA 2X89D 2KZBA 4XNZB 3U6XS 2FRGP 4WGVB 1UXSB 1H3PL 2EKJA 2FEJA 5ISZB 1CBVL 4EMZA 2CBOA 5I75C 4LCCA 4XXCA 4YHNA 3FAWA 8PAZA 4U1MA 4GUQA 2BIOA 2WXIA 1Q72L 4QRPE 2F7IA 2O5XL 2J8UE 3TJEH 4GINA 1JPEA 1LP9A 5DO8A 3VGBA 3BFQG 3U7YL 2Q6WB 2NYKA 4KUZH 4N90E 4RAVB 2X28A 4FQXA 4HHWA 2HG5B 4AQAB 1WT5A 1JPSL 3L8QA 4P06A 4RMWA 1VDGA 2ZTBA 4BA8A 4XAKD 4Z7NF 4HS8L 3D09A 1CLCA 1TNNA 4PYGA 3VXSE 1M7IB 3G6JE 3QZLA 1EA9C 3EJZD 1AS8A 4O2CB 4Z8FH 4MAYD 4YK4B 5J9PA 3FSZA 2R56H 2WVVA 2XWZA 3AREC 3J27A 3L6FA 5E0FA 3U2JA 3K3QA 4NM4H 4FULA 4JRYB 3H9SD 5E99L 1UT2A 4TUJB 3AS3A 4FTVD 4G8EB 4IS6B 3VXUD 1URIA 5DZPA 1R3IL 1ZANL 3FCGA 1MELA 1GIGH 1TFHA 4DZ8A 1CGTA 3RNQB 3BVNB 3BVUA 5I1EL 4JKPH 5JHLL 5FECA 1Y18A 4HLZH 2UZYA 3FT0A 4M6OH 4M02A 1RIHL 4Z77B 2A74A 3PWPA 3FFCD 5ALCL 2YMOA 4POZD 5DJYA 5JNYB 5KYXA 1KTCA 2DM4A 4QRPD 3P9WB 3X1EA 4U1GB 4QNPE 2F5AH 4HF5H 3FQUA 4PRPD 1GRWA 4L4JA 3V4LA 4WHYH 3EGDB 5EF3A 4U1LA 2BS8A 4LCYA 5DSCA 2VN4A 1J1PH 5E94B 1IIKA 5IBLD 2DS4A 2F2HA 1D5MA 2BK8A 2F7PA 3KWUA 3H2QA 4WI0B 4DO6A 4FQLH 2LGNA 2XJKA 2ZUSA 2ZD0A 4IRSB 4DKFL 4Y2OB 2QTEA 5HGAA 3IKKA 2IFFH 1DLFH 4FGMA 5C08B 3WEBA 1G9NL 5DJYB 4K8RD 2QSCL 4YXKH 2IBGA 4DT2A 3EGXA 3V0DA 5BS0B 1NMCC 4YMPA 4QPEA 3RVTC 3QJUB 1ZT4A 2DF3A 5DSCB 2JK5B 4A7UA 4ERSL 1WTGT 2FO4A 4AGQA 4ZTOL 2X4NA 1LD9A 2EDRA 5F71A 2R7EB 2JJVA 1NLBL 3QIWD 4YDVB 3HMWL 4GRMA 5C70A 1SDYA 4AXWA 5LCVA 1WVZA 2GBVA 3B7TA 1BJ1J 3DGCR 3ML8A 1UG9A 2VWEC 1BSIA 1R75A 3MV9E 4OZFG 2XOTA 4LQFH 3MRNB 1HH6A 4HV8A 3ZYIA 2J1YA 4G70B 3TCLA 5JHLA 1CVSC 3LKQB 2RQEA 2BIQA 3VGFA 4PJXB 1U95A 5FKPA 4YE4L 2LVCA 1BQHB 4YX2L 4K73A 3LS4H 1X5XA 4K8RC 3U2GA 2HLFD 2ENSA 5E2TH 2EDFA 3MRQB 3IRPX 4LCIL 3T0EA 3QZOA 1CDBA 1PZAA 5L4FA 5FYJE 1WEJL 4Y4HA 1IL1A 4JDEB 3IGLA 1T1WA 2H3NB 2I9TA 4WUKH 4PJ5B 2EAEA 3ZDXB 4GG6F 4UM8B 1N59B 3OAZH 5EOCH 4G9FD 4LIQH 2O6DA 3B34A 2QV4A 4HAKA 2CHDA 5FOJA 5GZOD 4ETYA 3QULB 4R4BB 1XSKA 4FP8L 4KO7A 5A2LH 4DUXA 4MWFB 2WNGA 5I0VA 5D96B 1A0QH 1T1XA 2ESVE 1SYSB 2OXGB 3H6AA 4ELDA 4OJFL 4B96A 4P3CH 2VERN 3BP5B 3CLEL 3KPOB 3KR3L 4KU1A 2EDLA 4J3XA 4OVVA 4XVUC 4EDXA 5IB2B 1IC7H 3E6HA 4PFEA 1DZ0A 4FQ2H 5J13B 2VLKB 1JNLH 4DAGH 2VR8A 1IGTB 3TBTA 1SGKA 3KPMB 4AYDC 1MCHA 2AABL 2UZXB 3B3IB 4M29A 1UM5H 5IWLA 3TO4B 2Y6TE 1SLUA 4ODTH 1R5IA 3OMIB 4L4VE 3QI9A 1IGMH 1K2DA 3QNFA 4TQEL 3WOVA 4QRAA 4KRPB 5I2IB 4MA3A 4BCZA 3CFDA 3OQ3B 5E9DE 5KS9B 2GIXA 2WXMA 4UMSA 4QO1B 2Q3AA 3OJMB 4AM0B 1HOCA 3MNMA 3EJPA 3CLWA 5HJBA 1IVLA 3VM5A 2IC2A 4F9PA 3M1BA 3CIQA 1U8PB 1B90A 4UOW0 4TLSA 3TV3H 5DUPL 1OTTC 3TH2T 2WZPD 3NAAL 1BMZA 3GEFA 3NEEA 1EXGA 3VG0L 4FI7A 3ZZ1A 4G3YL 1KB5B 4FOMA 4AUYA 3HHSB 3CVIH 4G80A 1I1CA 4JM2A 4LLUA 4MD0B 1R3HB 1PG7W 1F5WA 3FFCA 3MJ9A 3WDIA 4J3OD 4EOWH 3ZHNA 3BAEL 1BPVA 4JGMA 1WGOA 1JV5B 2ZPKH 3FTXA 4L8BA 2AI0L 3CSPA 4PS8A 2J57A 5HYJA 3AGWA 4JANA 4YHOL 3PHQA 3C09B 3KWWB 4LLQA 4MGXA 3MGTA 3DIVA 3ES6A 3AWFA 1X7SA 3FT1A 4H5SA 4L4TD 1XVSA 1WF5A 1DFBH 5CEZD 1DDHB 3GNMH 1J9CT 1DSWA 1RUQL 3FQNA 4MNGE 2Y3AA 4CW1A 5IIEB 2DQIL 4M9OA 3MJ8B 5FO7A 3HUJF 3MLZH 1E9QB 4K94C 4PJDF 4ISVA 5M94B 5EEUA 1MFNA 4PS4H 4P5TC 2HX7A 3EBGA 2H32H 3FAXA 2NSMA 2NY5H 1ZLUH 3BIKB 3CN3A 1XF2B 1JWMA 1QACA 1MPAL 4Z7UB 1DTUA 1FNSH 4I3SH 4WTZG 5JW4Q 1HOEA 5DZJA 5C0CE 4WUUA 5GGVY 1ZTXL 2D0FA 1F4XH 1U3ZA 2QFRA 1OAUL 5DRNA 3OZ9L 4N5EC 3BUTA 4NO5A 3SPGA 1FNFA 3QJHA 2ZKHH 1MY5A 2LLNA 3IMUA 5TH2B 1G6RH 3I74A 1EAPB 4LU5L 1WBXA 5FHBL 2YIHA 2AJXH 3EH2A 3TYFB 5IVXA 3FK3A 2VNCA 2A6JA 2JTYA 5D7JA 1G84A 1JI2A 3PIQA 4HD5A 4Y2DB 1IKNA 1MFDH 2EABA 2OR7A 4JFEE 1UACH 2XV3A 1I7ZA 4LSTH 6PAZA 3ULSB 1T1WB 4F7MB 1T1XB 2HT2C 2JTDA 3BMWA 3FS9A 3RG1C 4YUEH 2I9TB 4JRWA 4PJ5A 5D7IF 1AD9B 2EIZB 1XR8A 3G7TA 3V4VH 4FFVC 1Z3GH 5F9OL 3WEXA 3EYOA 1NAMB 1INDH 3ALXA 3NMEA 3L3KA 3EO0A 2AZAA 32C2B 3O2VL 5BJTB 4XAKE 2ADYA 1ZHLA 4WJ5A 5E5LA 1WYJA 3NG5A 5IQ9A 2DLEA 3L3OB 4KKBC 4C4KO 3MVSA 2AC0A 2PF6A 4CNIB 1H3XA 1IAII 1I7RB 1AHWA 3UTQB 4PV9A 2IBZY 3FN3A 3T0EC 2FVNA 2R0ZH 5HI3D 3NYKA 5J3HD 1CDGA 2WIIA 2JKTM 1PPIA 5HHVL 3EJQA 3FULA 2RTTA 3HA0A 3LRKA 1F3JA 2B14A 5KSAD 2APSA 5I0YA 2PLTA 1BYPA 1UOVA 2LTQB 2RGSA 3KPQB 4Y5YA 3U4EB 2XI9A 3ESOA 2VLRA 1SDDA 1T3FA 3SKNB 1KYDA 3MRIB 4DGYL