5GZNA

Structure of neutralizing antibody bound to zika envelope protein
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
407
structure length
402
Chain Sequence
IRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPTVDIELVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWGNGCGLFGKGSLVTCAKFACSKKMTGKSIQPENLEYRIMLSVHGSQHNDTGHETDENRAKVEITPNSPRAEATLGGFGSLGLDCEPRTGLDFSDLYYLTMNNKHWLVHKEWFHDIPLPWHAGADTGTPHWNNKEALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEAEMDGAKGRLSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYAGTDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVGEKKITHHWHRSGSTI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular determinants of human neutralizing antibodies isolated from a patient infected with Zika virus
pubmed doi rcsb
source organism Zika virus
molecule tags Viral protein/immune system
molecule keywords Genome polyprotein
total genus 65
structure length 402
sequence length 407
chains with identical sequence B, E, G
ec nomenclature
pdb deposition date 2016-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00869 Flavi_glycoprot Flavivirus glycoprotein, central and dimerisation domains
A PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5gznA04
2.60.98.10 Mainly Beta Sandwich Tick-borne Encephalitis virus Glycoprotein; domain 1 Tick-borne Encephalitis virus Glycoprotein, domain 1 5gznA01
3.30.67.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 2 Viral Envelope Glycoprotein, domain 2 5gznA02
3.30.387.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 3 Viral Envelope Glycoprotein, domain 3 5gznA03
1PJWA 3C6EA 3IRCA 5LBSA 1SVBA 1Z3RA 4AM0Q 3I50E 3N43F 5KVDE 2R29A 2I69A 4L5FE 4BZ2A 3P54A 3VTTA 5AAMC 3G7TA 4BZ1A 2P5PA 5GZOA 4FFYA 2JQMA 5JHMA 1ZTXE 2V33A 3N44F 3N42F 4GSXA 2ALAA 4FFZA 3WE1A 1OKEA 5LBVA 3UZEC 4UTBA 3N40F 4UTCA 5IZ7A 5IREA 5KVFE 5GZNA 4X42A 3MUUA 2HG0A 5B1CA 1UZGA 4ALAC 2JV6A 3UAJA 2R69A 3J2PA 5JHLA 2JSFA 1RERA 4AL8C 5KVEE 4UTAA 4FG0A 5LCVA 3UYPB 1TG8A 3UC0A 3UZVA 4UT9A 3C5XA 3J27A 3N41F 1URZA 1Z66A 2GG1A 4GT0A 1S6NA 3UZQB 1OANA 2H0PA 5H37A 1OK8A 4UT6A 5KVGE 5AAWC
chains in the Genus database with same CATH superfamily
2FQEA 4RGNE 5LO7A 1YY8A 3ZL4L 1BVLB 4NZRH 1D5XB 2FD6L 1J1PL 4N2OA 4OIBA 3H54A 3NYKA 4QYAA 3SYOA 3CDCA 5IB1B 2XY1A 4XPAL 1NOLA 4UIKH 1DEEB 1PCSA 1W16A 4AQZA 1CF8L 3SZ6A 4UYQA 1YEIL 3BQUD 1GGYA 5K69A 2CK0L 2X3BA 3ULUE 3GXTA 3AXLA 1KJVB 4K07A 4QHKJ 5D9SA 2IMMA 3ZHFA 4XB8A 3QWOA 5IUSA 3WXVL 1INDH 3Q9QA 3SDAA 5KVFL 3MV01 3U46A 1EXUB 3CZNA 4IBYA 2K3TA 1CXLA 1X5XA 3D4ZA 2V8LA 3UZEA 4CVXA 4OV5B 1DVQA 3EOTL 3VGAB 3M8OL 1LK2B 4GI6A 3AWEA 1R3IH 3HS8A 4PP1C 2CO1A 3T0EE 3ZN6A 2HYMA 2AI0H 4X6DE 5GS0H 4AOFA 4B9CA 5IB2A 4KK5C 3NFNB 3DLQR 2WP3T 4UTAH 3EOYG 1J5OH 4B0MB 3RHWF 1XGUA 1YY9C 4QKTA 3RVVD 1M71B 1E2ZA 3VXOA 4TXVB 1A7QL 1MOEA 3GF8A 3GT6A 2P8PB 1HSBA 3C6EA 4M1GH 5DEFB 2WCPA 1FPTL 1IAKA 4TNGA 3UO8B 4OZFH 2YD6A 3F7YA 3KGRA 4PJ8B 15C8H 5AUMA 1AMYA 3TPUA 3WMPA 4JFXB 4KOBA 1JNLH 3U4AA 1A6PA 2BVOA 3SBQA 1B90A 4FQ2H 3FBKA 3LRHA 3IJ9A 4HETA 3T3MB 2ENPA 1U8OB 3ZTCC 1SJHB 4KKQA 1MLCA 4PB0L 5CEYA 4Q6IB 4KO6A 1EQWA 2WXIA 4Y16D 2ZX9A 5LHDA 5L2JA 2OXHB 1JVOA 4DAGL 1QBAA 1U8MA 5FCSH 5IB5B 3V4UL 3QXVA 1ULVA 3VXOB 4LLUA 1QSFB 4JR9L 1BZDA 3PGFH 1VADB 4ORGA 4N0YL 4GH7B 5DK3A 1UWFA 1RZIB 2WVUA 2XWXA 2WIIB 5JQ6H 4P5KA 2JKLA 3C5ZD 4DGIL 4W4NA 2G2RA 4YDJA 4JFFE 2YGPA 1OD9A 2V9TA 2ZPKL 3DSFL 4OD1H 2YOAA 3FN0L 1UA7A 4KUZH 4CC4A 4JRXE 25C8H 5FYLD 3RA7L 4LIQH 3NG5A 2QDVA 4EI5C 5ILTL 5C08D 4ZX4A 4HXAL 1CF1A 4DP4X 4LLUB 4E5XA 4WFFD 3QDMA 4P23B 5AAWA 4B6ZA 4IRSC 3KNBB 4KRPB 4K9EC 3QXTA 5J5EA 4GRLA 3PUCA 1XCQB 4NO0A 2PKDA 1UWEH 4R26L 2HFFA 1YYLL 4ELMA 1BYOA 1ZTMA 4A6YL 5BQDA 1F3JA 2DQFB 3E8VA 4KHXH 1PNCA 2R0WL 3K6IA 2CHZA 3S34L 1CG9A 2MHAA 3Q1SL 4IRJC 1J8SA 2D2OA 3NH7H 4OM0H 3LN9A 2WOYA 5J6GA 1FFOB 1FHNA 1MCQA 1FLRH 1X4ZA 1YEDB 3T4AB 4OT1H 3MRMA 3QWRA 5EZIL 4M6OL 2AP2A 4HIPA 2XBTA 4S11A 1HCYA 5E8OA 1PPIA 4FNSA 4UV7L 5E9DD 3QE5A 4DKTA 3BAIA 5LGYA 2XYCA 4ONHB 1I1AC 2XOTA 1DJZA 3OXRA 5I8OL 1S7QA 4HKJB 5HY9A 1BWWA 5EC1B 1XCWA 1BOYA 3EF7A 5MHSE 2ZNXA 2J72A 5E0FA 3LQMA 5I73B 1E9OB 1ZIBA 5BS0E 2KPWA 4UAOC 3K72B 4KVNH 3OQRA 5C0BE 5EV7A 5I73C 1G9NC 5HDOA 1UCTA 2EADA 4TSCH 1TR7A 5CLZA 5DJ6A 2BOLA 2N0KA 5IJVB 3CHRA 1HE7A 5T1KD 5LBSA 2J55A 5AAMA 2NY2D 4HW6A 3P9MA 3P0VL 4MJIA 1NBQA 2AXGA 4NP9A 2DV6A 1PYWB 1A5FH 4L8CB 1EAOA 1PVHA 3GMLB 2DWYA 2O61A 1IBGL 2VZOA 3KWVA 3WIHA 2FR4B 3R0NA 3HZVA 3P11L 5GSRA 3SPJA 4CAGA 1AD0B 2HKHL 2JLPA 3QIUB 5J11B 3GMNA 5DVPA 3DHPA 3MRRB 5I1LB 2BJMH 3RYMA 3NZHH 3SE9H 3VXMB 1VPOH 3C6LC 3L9RA 3HZYB 4X6FA 5IUCA 4LL4A 2BP8B 3AGVA 2X2IA 4LESA 5SWQA 3A22A 4YLBA 4LSDA 1IAKB 3ECBB 4LLAA 1UH2A 1Z5YD 4LAQL 2FBOJ 2QADD 2OMYA 3MV7D 3W39A 1ZCRA 3W2DL 4OKVB 3MO1A 2O30A 3QWRD 2R0ZL 2FATH 4R2GD 4NZTH 4F9PC 1OCCB 3NZ8A 3QEGL 1J0KA 3G04B 5C0DA 2QJDA 4AH2A 4S2SA 3DMMC 2XN9A 1IC7L 2VAJA 3NTCH 3Q8EA 1NIBA 5D4JA 4Z7OB 5EIIB 2TRHA 1DLHB 2JJSA 4RSVA 2NNRA 3MV9D 1F2QA 3ZRCC 2KT6A 2I27N 1I31A 3S88L 1YN7A 1EJOL 2W5PA 3QUZB 4WO0A 5DFVC 5C0CB 4PRPD 2E7HA 3EO0A 2ITCA 1XBDA 1QSVA 4J8RB 4KDWA 1S78D 2R29A 1DVUA 1PJ9A 3TBTB 2JF1A 2A6DA 5IVNA 1RPUA 1MHHB 3OAUL 4YHYB 4JFVA 1W8EA 1KCUL 2ALAA 2ZWNA 4JO4L 5I71B 3RWFA 2B7DT 1RAMA 3FS9A 4X4XA 4P4KB 1SHXA 1SBSL 3TFKC 1HHJB 3UTQB 1OPGH 3NCBB 3ZSTA 4ZDHB 4PQXA 5MEQA 5KBPA 3IDUA 1RZGB 1SLWA 1X7QA 4LP5A 1I8MA 1OK0A 3VGAC 3WAKA 2X6UA 3ZHDA 1U6AL 3MRKA 2KZWA 1F4AA 1TF4A 1MDAA 4N2IA 4UILH 1KNOA 3R7QA 1JTTA 4N25A 2YA2A 4GI8A 4P8QA 4Z7WB 2YSSB 1Y7VA 5F1IA 3CU1A 2UX6A 3LD8B 1LP9B 3HC3L 3SKJH 5EOQH 4FNRA 2DWTA 5AWNL 3UC0L 4ELMB 3BWSA 7FABL 3WEXA 2R4SH 2YEQA 5JHLA 3I6SA 3MCLL 2H47C 2RR3A 2CO7A 4PJ8C 4CW1A 1EVTC 3HG1D 4FQJH 1U8CA 3S4SA 1VERA 5B39B 2X9WA 1OANA 2DEYX 3KPRB 5DQDL 5E9DA 2YS4A 4AE1A 5CCHE 5E8DL 4JM2F 3GI8L 3T09A 1WBYA 3QUXC 1QHOA 2GJ6E 4PJAF 1WPCA 3QEQE 4EI5A 2VJ0A 3A6CH 4HAKA 4P23D 1A4KA 1CDBA 2CKNA 1O7VA 2DF3A 4G42B 1LP9A 4M8VA 4ZUTA 4JNXA 1ADQH 1BAFL 3MR9B 1HAWA 3AS3A 1L9NA 1D6EA 1N2RB 3BH4A 2JB6B 3N9GL 4NQCA 1T21A 2TRYA 3WDHA 4DOHB 3MOAL 3OL2A 3O2DL 4OCWL 5DWUL 3V0JA 5DRXA 4POYA 2OR8A 3F8UB 4NQXA 2XYBA 2YWYA 5DZOA 1M71A 1T6WA 1OAYH 3ESVF 2WQRA 3GSXB 3P9LB 1FCCA 1YUHB 4WI0A 3VVWA 3LEVH 1K72A 3RX7A 4IRJA 3FH5A 2J20A 3SGDI 2AEWA 1A1OA 3EFDL 4DVRH 1UEMA 3AREB 5FV1L 2BSBA 4X9HA 1QYGH 3NJLA 4TYUA 1TZIA 1ASQA 1BZ7B 2BXYA 4ZZFA 1IAMA 4L29B 5D72H 3WXWL 1AQHA 4EI0A 2VXQL 1FNSL 2GIMA 4WO4A 3SGKA 4WSJA 3FNKA 4U1HA 5EU7E 1YNTF 2A73A 12E8H 2DQTH 3RB5A 1YUHA 2DKMA 3SGJA 1J8HA 3QJUB 1K4CB 4UNUA 3DSNA 3SO3B 4IRJB 4ESKA 3U0TA 1UASA 3DO4A 4NZJA 4GW5B 4A7TA 2NY6B 2PN5A 4ZOCA 5FYKH 4XP1L 4GSXA 4BUHA 3I6GA 1NWOA 4MZIA 1EJFA 3QWNA 3HAEB 5CHNA 3ZR5A 1JJUA 5LGJB 5JNYB 5EEWA 1HVXA 4K7PL 2VAAB 5KJ4A 1CCZA 4R5VA 1KY7A 4AGOA 2BSRB 1DVXA 4XR8C 2EJ1A 5E1QA 5C07B 3IT8D 2PR4H 2I32A 3O6KL 1T83C 2N7SA 3VE0B 3AMLA 4JZNB 3VM7A 3RGVD 4BZ1A 5AB9A 3DPDA 3ALWA 2GSGB 1VACA 4FRWA 5HYEA 5FOJA 2V8MA 2EXYC 3VFMA 3MRQB 4YH6A 4U1GC 1D9KD 2YXWA 5A2KH 1I7TB 3WN6A 2VAAA 3VDAA 4U1GB 1EEYB 1A2YA 2FECL 3MCKA 2JMRA 1Z9OA 2WKGA 4NN5B 2ICES 1F11B 2QR0B 2HX7A 1ZLWH 2IGFH 1WYJA 5JIMA 3QIWD 4EZLA 1PZSA 2BOBA 4JFHE 5TGBB 4EXKA 3WE1A 1X5MA 4NDMA 1VIWA 3BQUA 3VGBA 1UD2A 2J71A 4WCYH 4W9LC 5CNHA 3VRJB 1TMQA 5LXGH 2AGJL 4MA3A 3B2UC 4BUGA 3JV5A 1PY4A 3KM1A 1DQML 4L3EB 4ODWA 1BQSA 3K2IA 5E95B 2A38A 2ZKXA 2ZXGA 1J05B 5CU9A 4OFQA 2GC4C 1IEBB 1ZLEA 4FG2A 5DJ6B 3LTVA 2XPGB 1FO0L 4PGDA 5KSVB 2XTJC 4NENB 4OLUH 1NIDA 2BCMA 1M05A 2R29H 4WRLA 4RAUA 2P5WE 3FB6A 3H6AA 2FE0A 4GKSB 1PCXA 3OZ9H 4XH2B 4GQPH 4I0KA 4GUPA 5AW3B 5DF0A 2MOGA 3BWAA 5I30L 2X1XR 3KPQA 1E9QB 4JFYA 4ZXBC 1JGDB 3MOBH 4KOCA 1NAMA 2H3NA 1QFPA 3SB3A 1N64H 2FJGB 1JHLL 5IFJB 2VLKE 4P5MB 5IHHA 5KSVA 1ETA1 1PD6A 2JB5H 1UWXK 4EUPA 1BLIA 1K8IA 1BMZA 2BIQA 1IAOA 4YSAA 4HK0B 1JE6A 1IC1A 1PZDA 1OSZA 3G6DH 1Q72H 4JPQA 1GH7A 2X2YA 3D4CA 4RFOL 5FFLA 3M07A 1I8LA 4HK3J 1HJBC 3CLEH 5HHXH 3MHZA 5IFHH 2VC2L 4I3RH 1HFUA 1XL4A 5JDSA 5EIIA 3TO2B 1S5IL 2WBWB 2VDOL 3WLBB 4ETQA 4YSSA 3LVTA 3NZHL 2ZG2A 3H8NA 4JRXD 1KJMB 2VDNL 1NGXB 2IV9A 4HGWB 4YE4L 2QV2A 3EO1A 5D1XC 4WHCA 5K9QI 1KXHA 4U1LB 1ZPLA 4KKPA 4LPUA 2FRGP 4ZQTA 4FLOA 1NCGA 2PTUA 3O3UN 3RVWC 3WN5C 2FL5B 4OIIH 4BFRA 4QUOA 4OLYL 2W38A 4K5NA 4FMKA 4QTFA 2XPZA 3U2JA 4KRMB 3F7QA 3LZPA 3RWHA 5M95B 1MF2H 3DUSA 3OGCB 5AFAA 1AKPA 2L04A 2OMTA 3AT8A 3MFFA 3IGFA 4K71B 1B2WL 5TF0A 3N91A 4L37B 3OKDA 4BBWA 1JCKA 4XN1A 1NMAH 3IGUA 5CM1A 1A6UL 4IBSA 5FDWB 2GAZA 1GS7A 2BW5A 2BOCA 2VWEE 1I1YA 1QWNA 5CBEB 3VG0L 5C0IB 5TF1L 5KVEL 2Q3XA 4MCZA 3LJ3A 1RULH 4G83A 1FVDB 3SGJC 3CSYB 5C92A 1D6VH 5LGHH 3ZKQD 5I5RA 3HE7A 4EDWH 4PJ5D 4FCAA 5ID1A 3W3BA 3AY4A 5F0MB 2ICWI 2D3JA 3DKHA 5DUJA 1JBJA 3F7VB 4EOWH 1A9BA 2JK5A 2G60H 2R83A 2ZOKA 4QWWC 5JXEC 4EN2A 3WFCL 4GO8A 2E6QA 1T83A 1GJWA 3WFZA 3OTTA 1UCBL 1D2OA 4M62H 2CAKA 1CDYA 5I1GH 3GS0A 4PCSA 4Z0XB 1OTSD 1T80A 5JOFB 2DKUA 1JWMB 3BH9A 4HUVB 4J3OD 3ZDZB 1V54B 3OAZH 1KJ2L 5ENWB 2VDLH 3ORJA 3P2BA 2FQDA 3DTUB 3N85L 3VFVA 4AWJC 3NQIA 1SBBA 4YAQA 4K3DH 2JJSC 3T4YA 5IWLA 3FQ4A 3WXVH 1BVKB 1NBVL 2AJYH 4L05A 3WFEL 1RLWA 3A6OA 3FT3A 3IDGA 4LP8A 4XWOC 3KL3A 1Z3RA 1EHNA 4JFDE 1FRGL 4ANWA 3K71A 1SYVB 3MLSL 3QNFA 4WHDA 4XPBH 5CSGA 3BWUC 4HS6A 2V6HA 3S4SG 1L7TH 1DE4A 4LEOA 2ZXEB 5ELIA 5KYYA 2BIOA 4HEPA 4R7XA 3VWJB 1JTOA 1MHEB 1OT1A 4AYSA 5I1AA 2PWHA 2W9EL 1ZS2A 2HVJA 1S7XA 2FD6H 3HG2A 3DI3B 3FSWA 3S5ZA 2JXMB 3EJSA 8CGTA 1A7QH 3CH1B 4JUTA 3TN0D 4HH9B 4HXBH 4Y4FB 3V9CA 2NX5D 4QHUB 4R2GC 5JW4R 1CD0A 5HYQA 1J1OH 3DGDA 3FBQA 3IU3A 1SDAB 3QJTB 5FK9B 3FQNB 5I0ZA 1JNLL 1JDDA 5DCCA 4E9LA 1K3ZA 2PPCA 3F04A 3IFLH 5CWSB 3QQDA 3QUZD 3VO0A 1WFTA 2WJ7A 2YARA 5EEUA 2EDKA 4OLVH 3MLYL 1MWOA 5DFVD 1JZ7A 4Z7OE 5B38G 1WWWX 1UWYA 3WXWH 2AJZB 5SWSD 2L4OA 5D70L 2BSRA 5LCVH 1ED3A 2DDQH 3H42L 3K4AA 4X6FB 1WFOA 3SDXE 4B41A 4KXAA 5H4ZA 4Z8FH 3QUXA 1DQQB 3DNKA 2WIIA 3GBDA 1SUHA 4KZDL 4PRPB 1T7YA 1YNKH 1ZHNA 2DYPD 3AWFA 5GJTL 3NIFB 1KSRA 4JRYB 5EEXA 2FEEL 4KUZL 5IBUG 5LNGA 1GZQA 5IEHB 1G6RL 4LIQL 4H0LC 1H3UA 2W0FA 2EQDA 5EO0B 2DBLH 1U42A 2G9KA 2YPKA 4C56B 4ODTH 4LCIL 1KJ2A 4PYHA 4PWEA 1E27A 4P4KD 4XP6L 4PBWD 2OMTB 5FYKE 3HZMB 1FLTX 3BUTA 3U2IA 2EDMA 3FU6A 3J27A 3WSQL 5GXBB 4PB0H 2P7TB 2VR3A 2Y4SA 1U8NA 2CMRL 3MDJA 8PAZA 2ZWZA 1MXDA 4NO2A 2ZKYA 4OZGE 4LLWA 1FAKT 2PR4L 3CZUB 1KLUA 3HMWH 3O6KH 4MTMA 5IV2B 1NCAL 4JG1L 3ZE2F 5C0IA 4NSKA 4W4OA 3VSQA 4WKXA 3OJVC 1VKXA 4XNDA 2R51A 2XWTB 5D2NE 3RTQD 3HZKA 4K7FB 2AJXH 1IEAA 2ZUQB 3S48A 2OR9H 3NCWA 4AYEC 2NZ9C 3C5ZA 4TTDD 4Y9BA 2ZYHA 4OLZH 3QQNA 1MY5A 5JMRA 5EU5B 2F61A 3T0VA 4N8VG 1TJHH 2HTKC 5F2FA 2KYIA 5JOFA 5FECA 3GKWH 1OAQH 4N2EA 4QYOA 3ARBD 2NQCA 1TTGA 4D0DB 4ZZKA 2XRAH 1PMYA 2EEAA 1T5KA 3QPXL 4LOVA 4PS4H 4LEXH 4C8XA 2YD5A 3BUDA 3KPSE 4J3VA 3L95A 3HZKB 4I18B 4DKEH 2P3YA 3GM0A 4GW4B 1NAMB 1UENA 2H3NB 4TSCL 3AACA 2MPAL 4XMPL 4LF3B 4Z7WE 2IAMC 4B60A 3SJVA 2Y5TB 3O3BB 4HOZA 5AOMA 3BUYA 1A3ZA 1IVLA 3EYSH 3NN8A 4I2XE 4M7KH 4LHJB 4KI5D 3IF1A 4IDLA 1A5FL 2E56A 4FZEL 1PZ5B 4XB7A 4EUPG 4FFZH 5FUCE 3OR7A 3LH2L 4XBEL 4FZ8H 1P69B 3INUL 5J6HA 4HK0A 3VUAA 2L0DA 1S9KC 3V6BR 1YYCA 3L9YA 1T5XA 5KYYB 5CCJA 3DI2B 4MA8H 4D3CL 3VGGA 1DVTA 1SN2A 3TX4A 3VW3L 5I30H 3O9WB 4K8RL 2APSA 2Y06H 4R96B 4G80A 1AXSA 4P9HC 3M1CA 3OZLA 3FOMA 4ZUWA 3EYOB 4QTIH 4TVSa 3T04D 3R18A 5GGTL 5DGRA 2DMGA 1XTLA 2WNWA 2ICEC 1PKQA 5F6HI 1H3WM 5C97A 2CIIA 3HC0B 1ZWIB 4NZTL 4HHAB 1J9CT 3ULSB 1FVEA 4HZ1A 3K46A 4JQVA 5TE6L 2J8UE 4E41E 1H3TA 2C1PA 2Z31A 2BMKB 3CHPA 1E4XH 3FQXB 1Q9KA 4HJTA 4G6KH 4WUKH 3QYCA 3S5LG 1I9JH 4LHUG 2AVFA 5DWPA 4N2MA 3HS0A 1TZAA 4JFUA 2AXFA 1PDKB 4RFNC 5FUCC 1IVTA 3TP4A 1BVNT 1YEEL 3V4PH 3ZQ9A 2JH2A 4ZFZB 4AV4A 1L9MA 1JZHA 2BNQD 4JRYA 2EACA 4Y19B 1EFXD 4Y1TA 5C0RH 5T3XE 3TYFB 5JORA 3N3EA 4ODUB 3P77B 4HJJH 4Z5RB 1DBJL 3NIFE 3QQ9D 4KXBA 4EF3A 2YD2A 3HPLB 1NLBH 1OV8A 1WD9A 1ZLVH 1BMWA 1XZWA 3D0AA 4LL9A 1XGPB 4G7RB 3LD8C 4JN2B 5GS0C 1FDLH 1BF8A 4MZ3A 1B6DA 4Z3IA 4YHNB 1IMHC 1XFPA 4LOUD 2MRYA 2QQLL 4AC4A 4KQ4L 1F5WA 1HH6B 2V2TA 3SODB 5CJQL 2NR6D 5HJ3B 1F4HA 4MAYC 1CE6B 1WT5C 1V55B 4NZFA 1OOAA 3FQRA 4LKXA 4MAYB 3FW6A 5I1DA 2PYED 1RULL 5CGYD 1NFDB 4EQ3A 3VI3A 4HCRA 4B9FA 3POCA 5FO2A 1QO3A 2W95A 4JO1L 1FORH 1N68A 1QBLH 4LLYB 4K7PX 3QRGL 1A3LL 5F9JA 2YMXL 2LU7A 4NUJB 3VAEA 1XV8A 4YO0A 3WIHH 1OY3B 5AB1A 1J12A 3HLAB 4IS6B 4NC1C 3V79C 4MBRA 1J11A 2A1WH 4R4NC 2WVTA 4MVBC 5D7KE 1ADQL 4UZUA 5AG8A 1MW3A 5KANI 4HFWA 1MFNA 2DH3A 2Z34A 2AEQH 3FHQA 1IBDA 1M4KA 2G0KA 3CQQA 3D3VD 5DEZA 3MOAH 3SBWC 2W65B 3IJ7A 1I4FA 3D52A 1HK6A 1OB1B 4BA8A 4G8GD 2ZAHA 3BVTA 3D4YA 4MNQD 1JZ6A 1BWMA 1JWUB 5BXFB 5JIHA 4P2RB 1YEFL 4QCIA 5KBMA 1F3RB 4LT7A 3SDAD 2I9LB 4OCRL 2XTJE 3Q13A 4BA0A 3DIFA 4I3SH 3RX9A 1EAQA 2KZ1B 4MDIA 4Y2LA 1GMEA 2IJ0C 2EE6A 5E4OA 3VFRA 5I0WA 1PZ5A 1QYGL 1LP9F 1Q9OA 4RCAA 3QI9B 2X4RB 3MRGA 4UV4L 3BC9A 1WISA 5D72L 1OZUA 1CI3M 1G7LB 5FYJL 3RVUD 3VDCA 1FNSH 3HE6C 1HYRC 5E4IA 1LM8V 4NI3A 2GTWB 2XQYA 2LW5A 3D39B 5IQ9A 5D1XD 2YQGA 3EO9H 5FW8A 4NN7B 2B4CL 3O8XD 1WAAA 1UOKA 4YLCA 4OZHA 2I85A 4PEEA 1NOAA 4AIOA 5EB9A 5AUMB 1UYWH 1PG7H 1NFDE 15C8L 4RZCB 2L8AA 2V5RA 1OAZH 4KH2A 5IZ7A 1GHFH 2KQMA 4K94H 4FI6A 3REVA 4N1HB 4ALAC 3NCMA 3TPKA 2O5ZL 4IOSD 2A2QT 4HWEL 3KPOB 5JDSB 4JM2A 5CZVL 1JXKA 2A9ML 1K8DA 5AG9A 4CJ1A 3ZZSA 5B39G 1FIGH 1Z5LB 3QORA 2XTSA 4G6JH 4HUWA 5D8JH 5ERWB 4V1DE 3ZYJA 5K59E 3VFGH 1J87A 4BZ1L 3IFPB 2J8UF 4HALA 2FEDD 5B4MC 1A3RH 3CXHJ 5HGHB 4E0RA 5EN2A 2VN3A 3ARFD 2YN5A 3DX4A 2CXGA 4JM0A 4MJIE 2CIKB 2J6EL 2Z64C 4J3BA 1EO7A 2ZX8A 4HD9A 5GSVB 3MAWA 2OP4H 1QTPA 1KTCA 4J4PC 2DM7A 4WEBL 1N5AB 2K7PA 2NQDA 4QPEA 2F9BT 2VZSA 3KWXA 2FUTA 2EDHA 2H6OA 3ET9F 1DUZB 4ZAKB 2I9TB 4L37A 1WGVA 3PNRB 3Q5YA 4YHNA 3RNKA 2EIJB 5DD6A 3ZZLA 3MRDB 1WBZB 4OI7A 1HH6A 4JK0D 4FTVA 4YBQD 3TBTA 4YQXH 2VUYA 5CILL 1UJTA 4ZUTB 4UDTB 2AAVA 1KOAA 5DMKB 1MNNA 2NYYC 1A14H 3KGSA 2F7OA 3U6XA 3VI3B 2FQGA 3H6JA 4KZEL 3U9WA 2Q10A 1KYOJ 3D87B 4Z7QB 1N26A 3K6NA 4H1LB 1S46A 3NJNA 1OSPL 1XXDC 3DVNB 3QXDB 4L3CB 3M46A 2QSQA 4LKCB 4U1IA 4Z7VB 2YKLL 3FRUA 4GS7B 1WZ1H 3K8LA 5C07D 4ZXBB 3S5LB 2B39A 3H4HA 1RK7A 4OZFA 3GK8L 4O2EA 1WG3A 3GXUB 2XZQH 4JJ5A 3QDGA 1QKZH 2P5WB 2VE6A 2Y07L 3CMGA 3I9PA 5FF6B 4CN1A 4DTGL 4F9LC 5I8EA 3M88A 1JHLH 2XWJB 4G7VH 5FOBA 1EMTH 4IJTA 1YEJL 3U36A 1QFWH 4M56A 1DLFL 3D07A 3UBXA 4UQDA 6FABL 2IPTH 2P8PA 1A3QA 5GRUH 4OB5H 3GJFB 4R0LA 2PF6A 5KTEH 3HC0A 3RAJH 4KK6C 1ZGLM 2EO9A 1GSKA 1NGQL 2CALA 1G9EA 1JZDC 1YVLA 4QTHA 4EE2A 3TXAA 2DD8L 4PJCE 2JI3A 4RAHA 2JB6A 5D7HA 5JO5A 3BP5B 2VMEA 2Y25A 1MVUA 2WBJC 4J2QA 4K2UH 4JX0A 2PO6D 4RGMB 4NRZB 4XXDB 3VFOB 3SCMA 3ULVL 2KLSA 4RVBA 4BSWB 3F05A 1SY6L 4IHOA 5JUEL 3JQOB 1YY9D 3RVVC 5J11C 4X6EA 3MOBL 3NSXA 4LCWA 1ETZA 3IXTB 3S8WA 2BY1A 4MDJB 5TE4L 1J48A 1SY6A 1KIPA 3V5HB 5LQBH 4TQPA 2FH6A 3MZTA 2YXMA 3HBGA 1RURH 4S2SB 1HL8A 3FTGA 1UWGL 1YMMA 5E2TH 4CDGC 4WO4B 5TH2A 4A2GA 4IBUA 2WXOA 2FYYA 4MJJA 3KWTA 2QGBA 3ESUF 1WUNT 5JW3L 4Y16C 2JFCA 3T0EA 2MSPA 3TO4D 3CCHA 4X6CA 3F84A 3X1EA 1QSFD 4NJ9L 5I1JH 3B9KA 3CFKA 2ESVB 2E0PA 2VISB 3NMEA 2PCPA 1C5DA 3QZPA 4FQIH 5HDBB 3S3JA 2FNBA 3FSVA 1P7HL 3MC0A 3D6GA 4PGEA 1CE6A 5C09D 4MD4B 3KM2A 1MCPL 5AYUH 4D9RE 2WNGA 1JNNL 4JN1H 1IQDA 4HCIA 3TASA 3NAAL 4N90E 2YD8A 1G6RB 4NNYA 1UACH 3QORC 4MZRA 2PYEA 5KVMC 4P99A 3IDYC 3IRCA 1U6AH 1MHCB 3MLRH 2HKAA 3TWYA 4JM2C 4N22A 4WWPA 3RY6C 1ZTXE 2FHFA 2DWSA 2J25A 4E41A 2W65A 1MCWM 3B2VH 4M3JA 4NN6C 2XWTA 5AWNH 1ZGLA 2FUQA 4XNZC 2CO7B 4JGMA 4G5ZL 4F93B 1PIFA 5HI4C 2QQKH 1YNTB 4U1JA 2VL5A 1FFPB 3EDKA 3TV8A 4AJVA 2CGRL 1XF2B 1GS6X 1AZVA 3QDME 3OSVA 3ULUF 2QPDB 1BFSA 1JF6A 1K8IB 5E8NA 2OS7A 2EECA 3P4MB 3NBNA 4XC1L 4CU6A 4KO9A 5DHXB 1NH6A 4FQQA 4HCGA 4HS6B 4O2EB 4IGBD 4IKNA 3ZU8A 2YPLB 2E9BA 1SHSA 3BT2L 4NYLB 1NMCB 3VWJA 4BRJA 5I1AB 3OSKA 1I9RL 3PNWB 3O81A 5KUMA 3VI4B 1AH1A 4K5PA 2YFOA 3UTSD 1J0IA 4HIIA 2XX0A 3MJ9A 3FUNA 3GSXA 2ORBL 3GHPA 3VFTA 3IFNH 3MRMB 3MLXL 4NWTH 4FTVD 3CXDL 4KRNA 3TJEH 4DUWA 1J9QA 3ZLQC 3IU3B 4AMKH 1THAA 1R0AH 5E8NB 1RZ8B 2O93L 3BFWA 5LAXA 5BV7H 5TDNB 4ELME 2B16A 2QSTA 3T77B 4UV4H 2HG0A 2O5YL 4NQVA 3KWWA 1EEZB 5CN2A 2WTRB 1DLHA 4PWFA 2WXMA 1CPUA 2APVA 2WKOA 3JUZA 3Q8CA 5E99L 3ULAB 2VR6A 1U8PB 4HUWB 3L54A 4NQTA 2NW3B 3Q3GA 3MMEA 2HT3D 3O11B 2KDGA 1P6AB 1MQ8A 4LCUA 1QSEB 1XSKA 4F8TA 3F7PC 2X3AA 3L08A 4MA1B 1NMBH 2AQ1A 5MENB 2QT6A 4PJGF 1K4DB 1G6RH 3Q9PA 2VN5A 2YIHA 3O4LE 3NRFA 2N4IA 3B7SA 4MMXA 2C1PB 3VWKC 3HS9A 5ID0B 3H7BB 3HN5A 1YMMB 2UWEA 1RSYA 1L0YA 3V0HA 4MNQE 5EBGA 3ME0B 3O4OC 1CK0H 3R1GH 1T3FB 2C9VA 3T0BA 1FSKC 4I2XA 1MCLA 3RNKB 3S37X 4WFHE 3D4GA 2Q7YB 5MEPA 1J0HA 1HKFA 1LD9A 3KPMB 3E0GA 2NX5B 3P1VA 3MLUH 1X5HA 4C4UA 1KCVH 2DLFL 3L5XL 2A77L 2F18A 5CU5A 3GSVB 5BQ7B 1ECYA 3RGHA 5JQIB 3T3PE 1SM3L 2R59A 1IM3A 5HYSG 3OWRA 2E9WA 1DVYA 3BCDA 3HPLA 1WZLA 4EN3B 3MCKB 2F15A 2WXQA 1YN7B 4X8XA 3NIGF 5FYKL 1JZ8A 5I0DA 4Q2ZA 5BW7A 1MNUL 1SRDA 5GIRB 2NXZD 1MG2C 4OUUB 2E47A 1LD9B 3K71B 5F6IC 5F71A 1K6QH 2VDNB 3O2VH 3LPWA 4PB9H 4MMYA 2YRZA 1X4XA 3ZTJG 3AW5A 4G6FB 2VDOB 4X4XB 4MB4A 4P3CH 5GGQH 1E7UA 4KVCL 2X4UB 3HMWL 3ZK0A 2H0JA 1KZYA 4FC3E 5IMOB 2Z31D 5GQBA 3D3VA 1M7DA 1V7MH 4H5SA 4DN4L 5I26A 4M9PA 3C75A 4UB0L 5C0BD 5D9SB 4PJ8D 3SE8H 3VSVA 1S9XB 3BEWA 1PSKH 2H8PA 3O45A 4X6CF 5BNXD 3ARRA 1LWHA 1S4IA 3HI5L 3UABA 4HSCX 2EE9A 2WBKA 2FWSA 3MV11 4G9FA 5F97E 3HE6D 3QUXD 5EHFA 3SDCC 1GGBL 1VSCA 1KPVA 3D2TA 4C57C 4K8RH 1NSNL 1U3HB 2EE3A 1JPGA 2QVIA 4I13B 1XGTB 1A8JH 3GO1H 2A74A 3ARGA 5LUMA 1IIIA 1MQKL 1N6VA 5IEKB 1CD1B 2VXTH 1T1WB 2DM4A 4OZFG 3HN3A 4PMFA 3U1QA 3EADA 3RFZA 4P5TD 4G8IA 4KX9A 4AGMA 1DQJB 4W9ZA 3BSZL 1NGPH 2B3RA 3HKFA 3HBPA 3OG6B 4JE4B 4I85A 1EDYA 2E6JA 1I7UB 3MX0A 5I71C 1J7VR 5IWLC 2X1WL 1D7BA 1TZOA 3HZVB 4FNUA 4QDGA 5AAPA 5KS9E 1KPVB 4LSVL 3FU5A 2DMHA 1U58B 2YD3A 5A16A 3NVQA 1A6TB 3ZUNC 1EUUA 3FQUA 2VC2H 1DQTA 4ZG1A 3TO2A 2P28B 3DK0A 5FAAA 1HN1A 5IK3A 2AJSL 1OPOA 4S1SL 3VXSB 1AZNA 3ARFC 5F3FA 3UTPE 4F58L 3SDCA 2Z9TA 5JA8B 3TNMB 4R5XA 3GLZA 3S35H 2ITEA 1SGKA 1I3VA 3BZEA 2HVBA 1Z7JA 4ABWA 3ZRSA 5KVFE 1W80A 3RTQA 5D1XB 3BP4B 2XZZA 3AG4B 3L1OL 3TBWA 3BGAA 3L7FA 3UCQA 3MFFB 4UQ2B 4UNIA 5T33H 2VR5A 1K8DB 1G0DA 1GKOA 1OGAA 1ZXKA 1E6JL 4U4BA 2LFEA 1OP9A 2PCXA 3GSNH 6TAAA 2B5IC 2ZOWA 2P47B 1HC1A 1CLVA 5HI5D 3TWCL 2IQAB 3HR5B 4AKOA 2CIKA 1Q0XH 3D33A 3OX8A 5ICZB 2CBTA 4LIQE 5HHMD 3WJLA 4O4YL 2RQ8A 3L2LA 4X5QA 1FORL 1QLFA 1DBKL 5DS8B 1PS3A 1D9KB 1RK1A 2CKBH 4Y4KD 2WPGA 5CJBA 1D9KC 1SHMA 4Y5VA 1CVSC 3IXAA 4DZBA 3KEHA 2J1ZA 2WYTA 5GIRA 5KZCB 4ZFFA 4C55A 3HZ3A 5CINH 3CDYA 5DZLA 2RGSA 1NGWA 3BRGC 3HB3C 1HSAA 5AZ2H 1MF2L 5E6IA 5HHVL 2AKRB 4ZOBA 1KGCD 4M6NL 3FN9A 5D2LB 3VXMD 43CAA 4W9CC 2Z92A 2CBOA 3APFA 3ZO0A 1UB5B 3RP1A 1V5JA 4DZ8B 4YXHH 4MXWH 1DEDA 5F9OL 5IROA 5DRWB 5TQ2H 3U7YH 3PDGA 1I85C 2C3XA 5E9DB 3DVNA 4JY6B 5EBWB 4WJKB 4X7SH 3F2LA 3GTNA 5KVDE 3HCVB 3PGDA 2YZ8A 3TTSA 4G9FB 1I82A 2NSMA 3O6LL 1SXCA 2D7QA 35C8H 3FQWB 4P59H 3V9EA 5T8IA 1HI6B 3MR9A 3IGAB 3SCMD 2Y1ZA 4QYOB 2BNRB 1OSEA 2LU4A 1I9IL 4NQCB 2GY7B 4TVPE 5C08B 2Q8BH 4OZIB 5B8CC 4GQ9L 5FHBH 4HS3A 5I6XB 2CPCA 5IQ9B 4MHHI 5C0GB 3TEYA 2PABA 3A4AA 5I1GL 1XSOA 1T89C 1KJMA 3WY3A 3MYZA 2CUMA 4HGKC 2E8YA 3ZE1E 2LU5A 1T22B 2NCMA 4XMVA 5KOVC 4X7EC 2WSKA 1IGJB 1ND0A 2Z1PA 4Z3FA 2YD4A 3T9WA 4DP5X 2BSCA 3UDWA 1OHZA 5FYLL 1ONQB 4K94L 5BCAA 3PE9A 2WQUA 4XVSH 2XG4A 1LILA 1NBVH 2AJYL 2C3GA 4Y1AD 1GZPA 3KJ4B 4QOKA 5AYTA 5C08A 4BK8A 2TSAA 4BZ2H 4DK6A 4U1NB 3TEXA 5IIEA 1EV2E 4HMDA 5KJ7E 1GGIL 3N1QC 4NN5C 1KMGA 5GZNC 4GMTL 1GC1H 4PRBA 1U8QB 5I6LA 1F1DA 2BFVL 2OI9C 3TONA 1TOXA 2BNUB 1EGJA 2DWDB 4WEUD 1MCCA 2D03L 2AZUA 1K85A 3OLGA 2HN7A 3T1WA 3V5HA 3L13A 3IEAA 1TJMA 3HG0A 1J88A 2DMBA 3QWQB 2CDFA 3BVNA 4DGVH 3PWVB 5EA0L 4MD5B 3UTQA 2BSED 5IW6A 3TBWB 3WKML 3PV6A 2CQVA 2ZCZA 3QDHA 1CFBA 3HBQA 1EERB 4X7DC 4DGYL 4X5XB 2AMGA 1FG2B 2P5ED 4KJQD 4QMEA 1N19A 3QJOA 2WO3B 1ZVSA 2FJHA 3M7OA 1S5HA 2HWZH 2BXZA 4YUEH 4JHVA 5F7NC 2P4AB 5HYSA 3FTZA 5I23A 5CZVH 5IMMA 1GGCL 2QVKA 4JY5H 5IM7A 2F54B 4WIQA 3GNML 2G2RB 2VTFA 2CRMA 2MH4A 1EAPA 5E94A 3V4UH 4OW6A 5BZWA 2BSTB 2Y1AA 3T2NH 3K2MC 3HNVH 2OTWA 3WL9A 4YIQB 4ATTA 4JPKH 2ZUTA 1KGCE 5F93C 4GXUM 1A6AB 4PLKC 5E6ID 5J1SC 2DQUL 1CDHA 1HXYB 3T4AC 1ZT4A 3WI9A 3O4LD 4Z0BL 2CH8A 1S7UB 2XKNB 5AVUB 2A6KB 4P2QD 3DIFB 3O45B 1KLGB 2K8QA 5JPNC 1AGBB 3BRDA 2DJSA 3L7EA 1YYMH 3O3DB 1ILSA 1NCJA 4F1ZA 4ZFGH 3SD2A 3UROR 2ZOUA 1TO5A 2XZQL 5I17B 3KG5A 1F0LA 4X8CA 3H9HA 5I24A 4JDTL 3H56A 3DBSA 3IGKA 1JFQH 1I8AA 4HIEB 2DTMH 4EZKA 4N3UA 4WHTB 2VZ3A 1E5ZA 2BS9A 3NIDB 2JTYA 4J3OC 4IU3B 3RBSA 4JFZH 1YEJH 4NQXB 5CLXA 4KK8D 1UC6A 5ALCH 4PG9B 5JPMA 3S3BB 4TS6A 2X6MA 2C5DC 3ROLA 3ELAT 5J89A 1ACYH 4NQED 1Q0YL 2QELA 1AO7B 3L7EB 3TF7C 4R7DB 2XLLA 2DQDL 2VOTA 3NCEB 1EO8H 4FGMA 1VAHA 2OFQA 3PJSA 5HVHB 4OGXH 1IFHH 1E2WA 1VEMA 1NUDA 4YDVA 4RISH 3WFDH 4YS4A 1HKLH 1N4XL 1LQSR 3PWUA 1A6TA 3BT0A 1PBYA 3VRLF 3RWIB 2E9GA 2GJ6A 3AG1B 3SPGA 4IU3A 3UGXA 3HG5A 1J0YA 2MQGA 4HK3N 2UWEE 2MPVA 3VA2C 5DVNA 1COBA 3GUTA 4BK5C 3EJZD 2QADB 3IDGB 3BKYL 3MV7B 4GQRA 4OLWL 2CRYA 5KSAB 1Z5HA 4BXSV 3R19A 3BI9X 1KBPA 2IH1B 4YGVB 4RBPK 5GSVA 5JPMC 1JMXA 3M1OA 5KSBB 3UTSB 2X9ZA 3P02A 4AM0A 5CJXC 1UWGH 1FL5A 3HAEA 4TLUA 4X9GA 4H25B 4X80H 2HVJB 1L9PA 3AM8C 3EG9A 1BA9A 2UZYA 4M7KL 1E4XL 4N0RA 2FWOA 3AS0A 3QUZC 4ZW3A 5I75C 4W9KC 5EU3A 2DD8H 3QW9A 3TBVA 3SDYL 3LH2H 2MOQA 4GQZA 2EEXA 1JHKH 5K9QG 1NCUA 1VADA 1WAAE 3OD3A 3K3QA 5AD0A 3BD4A 5HYJE 1CGVA 2OZNA 3VE0A 1CGYA 2VLJE 3ZE0F 4ZOAA 3UYOD 3FQNA 4JPIA 4V2BA 1T7XA 1RHHA 2AERT 5L8LB 4N1CA 5AW2B 4RESB 1G7JA 3BRFA 2FL5A 4AUJA 3OKKB 3NIGB 1PAMA 5C0RL 1DYZA 4Z5RA 4Z7NB 1KACB 1RU9L 1S8DB 4B53A 4AL8C 3FUDA 3FCSB 4R3SB 3QFJE 5IY5B 1RPKA 3ZDYB 2JCCF 3MVSA 1CIUA 1MIMH 1QQDB 1QSFE 3N1FC 4TTGA 1I3GL 3RGVB 3VXQA 5C0AD 5T1LA 2VDML 1UD4A 4YXKH 3UBHA 2J2ZA 3V5DB 2WN3A 4ZMOA 5ESVB 2V2TB 3DO3A 4P2QB 4GAYA 2YAQA 2J88L 4A7GF 5DU7A 4LFHD 5FLVA 2MJWA 3C60C 1XB8A 4O02B 1EIBA 2B1HH 2IWKA 4WU7B 5AW6B 5IG7A 4Q58C 3LRLA 3S3CB 3VWJC 5BOZG 2DQ6A 2VZ1A 2BHYA 1L5GB 3S2AA 2FQFA 1KCUH 2LE9A 4JO4H 3UADA 3MNVA 5B7FA 5D1QB 4JDEA 2NZ1A 2PCYA 3QCVL 5D1QC 4ZX5A 5DJZB 5DJDB 4YDZA 3KYKL 1KENL 2Z6FA 1MY7A 2NZ9D 3KYAA 4FG6D 3F83A 1BZ9A 1KIUA 2YUVA 3MCG1 3IMVA 2K45A 4NAMA 4TOYL 3MV9E 1FV1A 3ZY7A 1PFOA 1DSFH 1OAUH 1C5BH 4LPWA 1SJXA 4HS8H 3WEXB 1ZTXH 2ALWA 4WI9A 3PNWA 4JLRB 5DYOB 1PZ3A 2VKWA 3FSZA 4HS3B 1BJ8A 4LLMB 1E7VA 4WW1A 5SWZE 2YAEA 4M5YL 3SPCA 4E9YA 4ERSL 1M56B 1ZJBA 4JFQB 2H0PA 5BVPH 3QIWA 4XN9A 3LEXB 2W0KA 3BGMA 3MCLH 4AMKL 2F54D 3WNKA 1WBYB 2VJ8A 4ZW5A 5AAMC 4WFED 5G5DB 3SYCA 2F5BL 4HC1A 4GSDL 5LBVA 4F9PA 3AAZB 2EAEA 1NC4D 3G5ZA 3MV8D 1NBZA 4OLXL 3ZKNC 4O2FB 2APFA 3BIKA 4FE9A 2OXHA 1BAFH 4MD0A 2QVMA 3CH1A 4JFQA 3EBHA 3N9GH 1QG3A 3LKPB 2UX7A 2W91A 5BRPA 2AEQL 3QWOB 1AY1H 3K80A 5DO2D 3U46B 4EVNB 1WZKA 1FPTH 4U1LA 4U0QB 4NZ8A 4YGVA 2ENJA 2Y6TE 3MLXH 5CSZA 1IRAY 2CRIA 3DETC 1GYWA 3BW9B 4QHLB 1GHFL 1EHXA 3DMMA 4YHML 2UZYB 3EGSA 1A7RH 3ILPA 1KCSH 2LQRA 3C8DA 3APMA 1NAKL 4PGBB 2WY3B 3ZZQA 4CA4A 4JN2A 1WC7A 1MZYA 3D12B 3X12B 2C9AA 5D55A 2IWGA 3MLUL 3MRLA 3F7YB 4O9HL 1J5CA 2AXJA 4RQQA 2I5YH 4UAOB 3MKGA 1AGFB 2BZCA 3CX2A 1KYOK 1WIPA 3R8QA 5ETUB 3VQLA 4GXFA 3C5JA 2F19L 3F5WB 5F7LB 1CFQA 1KEMH 3Q48A 4OD1L 5AALA 4DFHA 2W0FB 2JKWA 3FTGB 3U25A 4NX0A 3NPSB 3QZWG 2F53D 4PJIB 4QXUH 3PWPB 1B0RB 3TH2T 3RL2A 2KLTA 5HYIA 3OKEB 3VD5A 2UUDH 5AB0A 3CE1A 1TNMA 3ULVE 3P30L 3IE4A 4CJ0A 2OJEB 2BIPA 2YSTA 4R83A 1Y6MR 3R4DA 2HLAA 2EYRB 2RALA 4X50A 2RQEA 2BS8A 5C7XH 2B1OA 4M7JH 3GS4A 4KXZH 2AFNA 5KSAC 2E8ZA 2A0LD 4ZSOB 1JPSH 1KYUA 2EILB 1IEAB 4K9EH 4HIIB 1OM3H 4DGIH 5JPMB 4URKA 4FLRA 3NA9H 1SN0A 4LSUL 4PJFB 4Z0BH 3ULUD 4DP1X 3ZYIA 3QXDA 1BMGA 4HUCA 4F2ME 1P7BA 3HFMH 1MCRA 2R1XA 1ECZA 25C8L 4QXWA 4WK2B 1WZ1L 3U48A 5TDOA 3FF7A 5F7DB 3X17A 4GIAA 5LAXB 4B3EA 3HR6A 1X9UA 3LNDA 2HLFD 4HT1H 1W72L 1FE8L 4IOIA 4KHTL 5D2LA 5TK4A 1P4UA 1IB5A 3V5KB 4AYMC 2EO1A 4UQEA 4JKNA 1HT6A 2J1WA 5JYLA 1ES0B 5DMIH 1QO3B 3FB8B 3L4XA 5AKRA 5D7IB 3SGKC 4MNQB 1W0WA 4U6VH 1R5VA 5FUOL 4FLHA 4JFZL 4UOW0 3QNYA 4F33B 3DGGB 3L16A 4PJ5E 3LNIA 3UPAA 1Z9LA 3KDMA 1FBIL 1QFUH 1A4JA 1VFBB 4WNSA 5EC2B 5FK9A 2ZWYA 3AQZA 4BUQA 4RAUB 2NDGA 1TEGA 3U2HA 4J1UA 4OV5A 2VLRE 2G3XA 3BPLB 1Q4NX 3NJHA 3LHPL 4L1LA 5BJTA 4WWID 4MJ6B 4ZPTB 1TFPA 4BSVB 2YJLA 2VDKL 3OKLB 3WLWD 1MWAL 4WI2A 2KC0A 3BKCH 1O6VA 1HU8A 5DEGB 5GZND 2WVVA 4MFHA 4PREB 4QCIB 3LV3A 4P9MH 5CAYB 1T1ZA 5AD0B 1SLUA 2FK9A 2XKUA 1HHIA 5IBTL 2EUZA 5I5JA 4MMZB 5E1AB 1E67A 1N8OE 4FFYH 4F7CA 4MMZC 3UTTA 1BD2A 3L1OH 1MLCB 5CEYB 2NY1D 4V11A 4WI4A 3KH4A 2NX5E 5DUBB 1EGJH 1RZFH 1G4RA 3QS3A 4OZHF 4CVUA 3A67L 3KPNA 5IW1B 3KS0H 3JUYA 4G7QB 4X4ME 1KGWA 4JVUA 3CPLA 4MMXC 4H26B 5JR1H 3BAXA 2L7QA 4OU3A 3TWCH 1AOHA 4I48A 1WFUA 4M7LH 1QSEA 2OX5B 1H8NA 1E4KA 3G7TA 1OAXH 1ZDSA 1SXBA 4S1SH 4DNLA 3JTTA 3CDFA 4DPAX 3PG2A 4ADIA 3EJPA 3O4LB 1KV3A 2PTTA 4LHUD 4UINL 4KMQA 4EPSA 4I7ZC 2NTFA 2ZXBA 4XMTA 1HJCA 4Y2OA 3KLDA 3WOVA 5T3ZD 4KXZI 1NZRA 2WO4A 2ADGB 4UTBH 1BFVH 3UC0A 3OKMA 3CHXA 4LCCB 5BV7C 5HGGS 4TQ8A 3ARWA 4MJ4A 5DC0A 3WIFB 5J4MA 5IKCB 3V6OC 1YA5A 3ATAA 2F53E 1XAKA 4R90L 1XVSA 1HZLA 2WQAA 1LO5B 2VDPH 3T0EC 1CZ8H 2E27H 3QI9C 4GKNA 4PH8A 4HV8A 1UH3A 2IANE 2XWDA 4MAYA 4PU2A 2OJZL 1THCA 3EHBB 1PZBA 3TBSB 3EYUL 2YUXA 1B0IA 3IETB 4P3DA 1QI5A 2I60L 3HE6B 4LVNB 5C0NC 4Q9RH 2E59A 2L7JA 3HIZA 5CJOH 4F91B 1EDHA 2ZX7A 3D48R 2ATAA 3NIFF 3QO0A 5JZ7C 1FH5L 5DRWA 4Z7UE 3LQZA 1FJ1A 4NC1E 2A3TA 2EYTB 3PABA 4K8RC 2XPGA 2R8SH 3OZKA 1KLGA 5ALBL 1QW8A 1S7SB 1WA0X 1IGIH 5E1HB 2ZOLB 3W9DA 1QRNE 3BPNB 5FM8A 4EAEA 3CUPA 4C4KO 2CCWA 1U93B 3TA3A 4HZLA 3L81A 4MRCA 4XE0A 1EANA 1JNJA 2IG2H 1XZ0A 5FYJE 2YAOA 1P9MC 2B2XL 5F89A 5INDA 3TVMD 3NACL 2OCCB 4WUUA 1H5BB 3VD0A 2R2CA 4LAJH 3LZLA 4I1PA 1GYVA 3ARSA 4UM9A 1F4YL 5DZ9A 1ZEAH 1FF5A 3B3IB 3KJ6H 4P5SA 4XO5A 5C6TH 3T0XA 4U1HB 4WY7H 2AJVL 5LDSA 1E5UI 4A7QA 1C7TA 1BVKA 4HUUB 4ZODA 2GUYA 4PJDE 5EBLB 3EYFA 3OG4B 1E3FA 4YVNA 4AIZA 1SJEB 4O2CA 2NY0C 5C0AB 4W6XB 2CM6A 1IGYB 2V5TA 3QDMD 1ACXA 1K2DB 4DFIA 5AVRB 3KPSD 3L4YA 5KZCD 2X4TB 4G8FB 3CDZB 3ARDA 5AVWB 2XG4B 1T2QH 5EO1B 5I0VA 1YC8A 4XNYH 3V0VB 2X6CA 5I6NA 3QIUA 4M1DL 1HQ4B 3RE0A 4MCNA 5JHDD 1BXAA 2EH7L 3C2AH 3WNOA 1L0QA 2RD0A 4XXWA 4UNVA 4TLKA 4NM8H 3UG3A 4GQ9H 1ZVYA 1TIUA 4G8IB 1P5UB 2VISA 4H8HA 4B9KC 1CLOL 2YAHA 1MIEH 1N6UA 5ETUA 5E5UB 1FQ9C 4KJYB 1M7XA 3CFBB 3L6FA 5KVGH 3BVDB 3WKMH 4Y16A 5BUPA 1K9TA 5H8DA 4NI6A 5BO1H 2WUCL 2OMZA 1QHPA 5HJGA 2VDRL 2NUTA 3U30C 2JJTA 4OGAD 1A7RL 2IAMA 3FUKA 1INDL 5G4NA 2GB2A 3FRPG 1VFUA 1XGRA 1KN4L 3G08B 4YHOH 3SQOH 3TZVD 5GZOD 1RIUL 3H9SB 2WXLA 3NJFA 2HVKB 2I69A 2VR9A 5SV3A 5CUSH 4QRRB 4AGNA 4V2CB 2WGNB 2DDQL 3JWNH 5JHBA 4OJCA 3DX8B 4OFDA 1MI5D 2IQ9L 2VM9A 3CFBA 3L6FB 4D7BA 2JJWA 2WZPA 4UTAL 1J5OL 3B6SB 3IWUA 2IOMA 5LDUA 2DOCA 1ZVNA 1T04B 2FJSA 2MMXA 3IRZA 2XFXA 4FFWD 1DL7H 2W1NA 1ZT4B 3P4LA 5A3ID 3AREC 4Y9CA 2OMXB 2W07B 1IL1A 1IC4L 4KXDA 3O6MH 4EZJA 2BERA 4WHYG 2W88A 4IMLB 1AVAA 2ZAIA 4Y2NA 3D9AL 5EUOA 5C09B 5FM4A 1INQA 2WYHA 5FYKU 2X2HA 1EZUA 4WKZA 1BZOA 3L4VA 4PGEB 4XH2A 4W9GC 1OB0A 2UXFA 2WMPB 3V4VB 1WLGA 4PR5A 3VMOA 3BH8A 1MWAA 3BPCB 4OBRA 3S36H 2P5EA 4Z23A 4DPRA 4MKMA 4RMTA 3T8MA 4LCWE 3J07A 1EA9C 1M7DB 4A6YH 1DJGA 2HPTA 1BBDH 2AEOA 2PYEB 4N5UA 5HVHC 4AKPA 1KCVL 2OQJB 4AVIA 1QFWM 2R2BB 5HHNA 5I76A 4DZBB 2C4FT 2J56A 3UAJC 4B95C 3KAAA 4OCSL 5LBSL 1XX9C 4HSAC 1BBJB 1PYWA 1FLRL 2XNAB 3FF8A 2V9UA 3B8SA 3W5NA 1CVRA 5FGCB 4WUUB 4WO4D 4QRUA 4NWUH 1S9WA 1MREL 3MLZL 3QUHA 2P24B 3WS6C 1MCWW 1EFXA 4GEIA 3N43B 2GI0A 2ZYRA 4OF5A 4OZ4B 3QHTC 3ARDD 3D7PA 2K8MA 4Z7VE 4A7SA 5IEKA 5DO2C 3VGHA 1XF5A 4O51B 2VH5L 3PFQA 4N0CC 4G6FD 4MGXA 4PWJA 5GGVY 2ZTBA 4BQ9A 4LLQB 3QUMB 4AZ8A 4LDOB 4OJFH 2AGJH 2VABA 5L4MA 2XHNA 2FEEI 1AC0A 1KC5L 4KTDH 4PJAE 4DKAA 1I3RA 5BUAA 3VVVA 5CWSA 2RJMA 4N8CL 4HLZH 4PRHD 3EBIA 1D5ZA 1JS4A 4ZO7A 2BIIA 3RWJB 3PGCA 5FO7A 4LCYA 4QHNA 1G9MC 4NUGH 1DN0A 3FJTA 3PXHA 2QKIC 3MTRA 4Z7VF 5IVXA 2VLJD 1P4LB 3D30A 3UTTD 2VN7A 4A67A 5J6SA 3BVXA 2GK0B 3MBEA 4GG6B 1S5HB 2WLLB 4ZMYA 5JW4M 3TNMA 2H32H 5SX5K 1UADC 3SE9L 3OHXA 3MNZA 5DYFA 3N41B 1NSNH 3R4RA 3MRHA 2EDNA 1CDGA 1MJ7H 3QJRB 3QRBA 1LL1A 2QPFA 3MLVH 5CCKH 5KN5B 3HE7C 3O4LA 4JG0H 4Y2DC 3BW9A 2QZQA 3GM8A 4F7PA 3HC4H 2DM3A 4DUXA 2IOOA 1EEQA 4LSPH 5H37H 3ZRFC 4PJ6A 5AW9B 1ODAA 3JWNE 4PJ7A 4HQQL 1HNFA 1UA6H 3WNNA 5I19H 1L9OA 2BVUA 2LGNA 4Q4EA 1WS8A 4PIRF 9CGTA 3AITA 2DJUA 4WGKA 5C9JB 5A6IA 3QUGA 3ECQA 3VSUA 3N43F 4DUVA 4AEFA 4Z95H 3HR5A 4D9QD 1H15B 4YDJB 3S88H 3GZQA 5MENA 3QIBC 1S5IH 2B9AA 1RUQH 1RSFA 4LSRL 4WWKA 4HIXL 4U31A 1JUFB 5FKAA 2EDLA 3MBWA 4R84A 3IETA 4Y4KA 4ZT1A 1VPOL 2EIZB 3VNZA 1X9QA 2VERA 5IF0B 1RK1B 1Q1PA 1DBKH 4M93C 4X7TA 4KTEL 5JHAA 2XWBB 3FHAA 2W07A 1G9MH 4CKVX 1AGDA 1NCCL 4J3OH 3FO9B 4OLYH 2R0ZH 2ZUVA 5EU5A 4G72B 4PUBH 2H41A 1RUMH 2ZXWB 3MA9L 3L1FA 2VDPL 5E56A 3P40A 1B2WH 4HJ1A 1T66C 5EN3A 5JW4Q 1ZSHA 1NFDA 4HF5L 3QDJB 4M00A 3MCYA 2NY1B 5D93B 2NYYD 3U7WL 3OKOA 4YHLL 3MN8A 1E8WA 3NGBB 1HL9A 3OLIA 4TQIA 2HH0L 1WWBX 3P9LA 4U1MB 3NGBC 1C1EL 2OQJA 5I1CL 3RFRA 1KTDB 4LLDB 3GJFA 4L8BB 1MRCH 1F41A 3UXFA 1NGZB 1YEKL 1O9ZA 1OGTA 3BO8B 4ODVH 3CN3A 4LLVA 4JPWH 4BFOA 1D5MB 2DQEL 2G75A 2P5EE 3QEHA 4JM4L 1U8IA 4AM0B 4N8UA 1OGPA 3L4ZA 2G60L 3UJTH 3UEQA 4EOWL 5J0BA 1IV8A 1T1XA 1H3VA 2VMJA 4PPTA 1QLRB 4ONFL 1BG9A 3MRJB 4WZ9A 4UILL 4NZRL 4X2UA 4LRNH 1J1PH 4N8PA 3WTTA 3QIWC 4K23L 4QXTA 3FH8A 4WY7L 3VFNB 5I6OA 3HI6L 1RP8A 3JTSA 3Q6GH 1XH0A 1JGUL 3ULUH 2AXGB 4XAKE 1ZHNB 4OTXH 5CGMA 1XQ4A 3H0TB 1H6UA 3SKJL 3QI9A 3NJIA 3B1TA 1F8TL 1NCOA 3EJJX 4KK9D 1QR4A 2FJFA 2R23A 4MXQC 3WD5H 1RFDL 3QO1A 5ICYA 2YOCA 4QRQB 3WFEH 2WINA 2W80C 1BXUA 4UNTA 1G7HA 3VXMA 3PFUA 2XWZA 4FQHA 3FMGH 3UZQA 3GUTB 1FNLA 4X5RA 4B0MM 4XE5B 1MRFL 2CNYA 2DEWX 3IMSA 1Q9LA 2L7UA 4I18C 1AGEB 12E8L 3U2GA 5AOLA 4FQCH 5IQOA 1OKEA 5C6PB 1I7UA 2XV6B 3GYRA 2OSLA 5DI8A 2GTQA 3DWTA 3VXRD 5J56B 1FL5B 1OOWA 3UL4A 1JWSB 5ID0A 2XETA 1XH1A 2WINB 1L5GA 5EZLB 4U7SA 1E90A 4I5BB 2QSCL 3UZVA 4QLRA 3BQVA 1A21A 3V4VL 3EJTA 3QG7L 1ETJA 5KS9A 4CNIB 1CFTA 3B43A 3EAKA 4N2LA 3TO4C 4E0RB 4M5TA 3RBGA 4ZFFB 1KN4H 3TO4B 4AW4A 2HMIC 4G6JL 2BM3A 1AR1D 2GITA 5HI5C 3O8XA 4H8WL 4PY8J 5JXAH 5HHOB 2ZG1A 2F53A 1JXDA 3H42H 4M8UA 3WEBA 2IQ9H 5D1XA 1ZA3B 4G2AA 1U3NA 1GL4B 2DQTL 3G5XB 3AQYA 1UGKA 4LSUH 4PHXA 1TSRA 4KKAD 2VIRB 5C2BH 3GTTA 3TNNA 2IWFA 1U8NB 3CN2A 4XBMA 4CKQA 2H1LM 5I1KH 3DOHA 3LN4A 1GOHA 3DHMA 5HHOE 2WHVA 3TCXA 2FX7H 3CAFA 3QJFB 4XMWA 3SE6A 3H3BC 4WDIB 1A6WH 2UY7B 4ONHA 4QRRE 4P4RA 4JPVH 3SY6A 2PWFA 2CMRH 3KPQB 3LH9A 1FNHA 2JQZA 2ZSVB 5EU7C 3S36L 3T1FB 4MNQA 4XO4A 1C5CH 4TUOB 4JDEB 2IADB 1FBIH 5LVEA 4C56E 2QLYA 4PYGA 1UM6L 4BQCA 4OM1H 1B0GA 3WNMA 3LNFA 1LDPH 1V27A 4HEME 4X8JA 4I89A 4GQQA 1A4KB 5KBDA 1AE6H 1HSAB 4FFZA 5I15H 4AXWB 4NKMB 3IDJA 5CZXC 2B8OT 5AOIA 1P1ZB 1I8UA 3HFML 5E0QA 5K5YA 4RGOL 1JVLA 1CFSA 4H8QA 4XCNB 4AJ0A 4OLZL 5GISL 1U30A 2VRQA 2BCKB 2DEXX 3WO4C 4ZFGL 3BAEH 4G3YL 5I8OH 3LEXA 5IMKB 2W0LA 4KKBC 2XZCH 4OZHB 1SJEA 3KGTA 3RPKA 1FL3A 4PJHB 3KPRD 1S7WB 2VSMB 1F13A 5J6HB 5ABAA 1NCTA 1JN6B 3ELQA 4OY9A 1KC5H 4KTDL 5FFOA 4KKRA 1DQMH 1WP6A 3ZYOA 2NY7H 1YPZE 1A6ZA 1ACYL 2FLRT 1HQ4A 4CUCA 4OZGB 1B0RA 1HZHH 4YMPA 4RFOH 4PBXA 2WZ0A 5SV4A 1X5GA 5KG9A 3WTUA 4ZUWB 3GXIA 4E5XB 1BM3L 1WAAF 1DBAL 2ZX5A 5F0JB 3QRFM 1J8HB 1KCRH 3CZFB 4NLHA 2R29L 2YC1A 2WLYA 3QXUA 3CFTA 1H6TA 2BNQE 1X5FA 1HKLL 1N4XH 3D18A 4MSWB 5DQJB 4NEHB 3BGFB 3UAEA 3I9IA 3DX6B 2BJML 3CSFA 4G6AD 1A22B 4MCZB 3BGFC 3NP4A 3HG1B 3RY4A 1WA2X 2GJ6D 3P3SA 2NNCA 3UAJA 2H45A 5AW4B 3MJGX 3FYEB 1P4BH 3ZKMD 3FAXA 5JOEA 2PP8A 5H4YA 1M2VB 4EKXA 4ZAKA 2VLLB 5IMLB 5C70A 4KY1H 4PJFA 2JIXD 1EZLA 1FFNA 1ROCA 1PLGL 3LYRA 3CFEB 4LPYA 5HTSA 4KH9A 1I7RB 1U8QA 2CD0A 3BZDA 3IS0X 2VDMH 2FYVA 4NQEA 1I7ZA 4IKIA 2PPFA 4BD4A 1NCWL 3F62A 5JR1L 3D25B 3U0WH 3LIZA 5ICZA 2V0AA 1I9JL 5FO9B 5DMKA 1D5BA 4GB9A 5GJSH 2PPAA 4YL4A 4XCYA 5EDXA 1SHWA 4JFFD 3E7JA 4JDZA 4W93A 5E6UB 1CGXA 1GW0A 5F1NA 3PHSA 3V0WL 3KGUA 4OUOA 4BFIB 1QPKA 2ROXA 2IDTA 1XXFC 3QBTB 4JQIH 4O5LL 2F1AA 4PLKD 1L0XA 2IBZX 4L3CA 4LKCA 2WAQA 4FL4B 5C09A 5DRZA 3KNBA 2APTA 3V0EA 4B9IA 5D4HA 5F7EH 4S0TD 1B4LA 1NCCH 1T7WA 3SHSA 5GRJL 1MCFA 1MFUA 2NY2B 2V2WA 2YD9A 3BJ91 1ZT7B 4GSRA 4UM8B 3IMUA 3L3GB 3SKNA 2PW2B 6PAZA 4P57B 4P4KC 1KGYE 5GS1B 5C8JB 3UIZA 1EJ6A 4ZPTA 3K81A 1AFVL 4RFNB 5IFAH 2XA8H 1RJLB 2JXMA 4DP7X 3STZA 4G43A 3HJ0A 4JFDB 5I1IH 2NDFA 4NUJA 3L9RB 2J88H 4HHWA 4ERSH 2ZCKL 4R7NA 2VL5B 2G3NA 2HH0H 3CNKA 1BPVA 1JZJA 3HG3A 5DHMC 1FC2D 4KNTA 4U6HA 3GRBA 1PGRB 2J5LB 4H7VA 3O6FA 4LVOC 1F56A 2XNAA 2HFGL 3JWDL 3AG2B 3HJEA 3QEUA 3KLAA 4NAJA 1XAUA 2EC9T 3ZX1A 5E00A 4NYLA 3V52L 1ZHLB 4NXSA 1XCTB 3GJEB 2Q7AA 1WFIA 1LO3H 1NWPA 2IBZY 4WTZA 2HRPL 4OD3L 3RKDD 2C9RA 3NACH 2OTPA 1L6PA 2YGQA 5EZJB 2AJUL 4P5MA 3P0YH 4IKJA 3ROLB 2WUBL 3IFPA 4LGSB 1SVBA 2HTKD 4K23H 4PJCA 1PKQB 1ZA6A 5L2KA 2AV7A 3E6FB 5D7EA 1R3KA 3LKNB 5EIQA 1XH3B 3DOSA 1JK9B 4PJAB 4FYTA 4MBOA 4XBPA 2WLIB 1QD0A 3QIUD 1XDTT 4MNHA 1KJ2H 1QOKA 3VWKB 3IVKA 2BVQA 3OMAB 4HIHA 4ODXA 2VLKB 4FQXA 2ILLA 4GRMA 2X41A 4ODSH 2CSPA 5EIIG 3DVFA 3ABGA 3UZVB 1LHZA 4FLSA 3DJSA 4HWZA 1LVEA 1KIQA 4YHOL 3DDFA 3MUHL 1FIGL 4OLVL 5D7JD 4TUKH 4NO2B 2Z35A 2AK1L 3C9NA 3QRLA 4OF8A 3RY5A 3AY4C 5DJ0B 1HHKB 3GRWL 3HVDA 1VGKB 2P80A 3ABZA 3DDGA 5EULV 2AABL 2K9FB 4JFEE 4OIAA 2W9EH 3SQBB 1QMUA 4PTTB 2V2XA 4XO9A 1EFQA 3MODL 2DL2A 2YEZB 1WRFA 5DC2A 1GGTA 2PYEE 2VQ1A 4DK3A 4EN3D 5JOPE 2FAUA 2C9UA 2Q86B 4BKLA 5F1OB 3NABH 3DHJA 3FT1A 4AQAB 3PDOB 3FQ2A 5F9DC 5CEZL 5I1EH 3IAPA 4LSQH 1JTPA 4FYRA 1O5DT 3DV6B 2MQ3A 4XX1E 3BYYA 1NGWB 3BSGA 4XPTL 2O5ZH 2EYRA 5F72S 1FH2A 2H5UA 2IVFC 5DQ9B 1MAML 2BVPB 5TPWH 2GJRA 3FCGA 2VQ1B 4KX7A 4ZDHA 4BZ1H 5I0XA 2HLEB 1FYHB 2IALB 4I9WD 4LPCA 4RLDA 3TH3T 4PJ7F 4HC1L 4MKTA 1R24A 1XH2A 2R2BA 5I76B 1USQA 3JV6B 4C59B 2AJXL 2R9HC 1XF3A 4B7IA 2OR9L 2X89D 4HA1A 5PCYA 4HLJA 4OGQC 5D7JA 2MQCA 5E2WL 3QC6X 1DFBL 3IGAA 3VG9B 5AYQA 4P57A 3KW8A 1TLKA 4XMLH 4DN3L 5EEZA 1OB1A 1CTOA 1KCBA 2KKQA 3KVDD 1O7DC 2QBWA 4QXVA 5KBLA 3VGFA 3I50H 2Q7NA 5L7XH 3KXFB 3MFGB 2Q9OA 4FQ1L 4U1MA 5DD0L 2DYSB 4OR1A 2W81C 3KLHD 1EX0A 3SQRA 3GWJA 3WJJA 4OB5L 4L3EE 3VFRB 4FFTA 2OMWA 1V7ML 3DX7B 1Q1JL 1SEQL 4RAVB 4XNQB 4YBHA 4TVPH 4XVOA 5J12B 2I7OA 3H3KA 4KJYA 2X09A 4K3HA 3WDIA 4IBZA 4AT6A 3IDYB 1JZ4A 4MX7A 5KBNC 4QOKB 1RMFL 1WZMA 1BVOA 4M7ZC 3LQAC 2CO3A 2C7FA 1EWHA 1UVQB 3ILPB 4I77H 3D39A 4PTUA 2QEJA 5ANME 4Q9CA 3W9EB 1J5IA 2WZAA 3GMRB 1JHTB 1KFAL 1KXVA 2QMJA 4JZNA 2ZIDA 2BNUA 2DWDA 1E40A 1XH3A 2H4EA 3DOSB 3GKWL 2A99A 3WYRA 5ISZD 3TZVB 2YRPA 4AYDC 3ZDZF 4L29A 1QPPA 1SXNA 2X0UA 4R0LC 3RZCA 4X99B 1YN6A 4PI0A 2NY7L 4L0YA 4CL7A 4G8GA 5DFTA 5LN4A 4P2OA 3I3DA 4L0ZA 4URTB 4KFZC 1P84K 1JNHA 2O26U 3LY6A 3RL1A 3GSWB 3CK0L 5KJRH 1JV2A 1XWVA 5IM7B 5T5NF 3UPRA 1AXTL 4NO5A 2NQ3A 4XP5H 4FZEH 2ZSWB 2K6WA 4OZHE 4HFUL 1TCMA 3CVCA 2PR9A 3EH1A 3Q8BA 3S97C 4PWIA 4LSSH 4WFEE 5FEBA 1Z3GH 1TQBC 4Q9QH 3FOLB 1LEKA 3KPRE 1MEXH 4J6RH 4UCFA 4JDZB 4EQ2A 4FMFA 1E6OL 2FDBP 2GI7A 3FZUD 3HUJF 5F9JB 2BIHA 4JFED 4LCCA 5GGTH 2AK4B 2Y6SC 1GZHC 3HRZA 5BRQA 2A6KA 5BMFH 1OL0A 2A6JB 1R5WA 2JKTM 1ZSDA 3GSNB 4LHQB 1WBZA 5T33L 2YRBA 4QKXB 3CFNA 4G7SB 5E8EB 3DIDA 4GOSA 5DQ9A 4JHZA 1MHPH 2BINA 2YPLA 4GUPB 1VZIA 1AIFB 4QHPA 3WFBH 3NEOA 2G2PA 2NLJA 4V1DA 1ES0A 1F1AA 5EO9A 2XQYK 4NJ9H 4MA1C 1NIAA 1AOZA 1NFIA 1BPLB 3CFQA 3ECWA 1WBXA 3PHOB 3T4YB 2LW3A 5KSAD 2VIRA 1XF5B 5DA4A 2PLTA 4JQIL 4NCC1 4O5LH 3UTOA 4G71B 4LVNC 5F9WC 1MHCA 2C3HA 3HAEH 2EE2A 5AYUL 1AQ8A 4H44C 1PZAA 4JFOA 3ZKXB 1AS8A 5F9WB 4WKZB 4EDWL 1U9KA 3FT2B 4UT9H 3RZWA 4J4PD 4ACPA 1NUFA 3V4VA 3QC5X 1I3RB 3B7TA 2O61B 2QSVA 4NHCL 4PLJC 3ZXAC 4XWGH 1JZIA 4KO7A 1FSKB 3VRJA 3RWJA 3UBGA 5B8CB 3EBGA 3SYPA 1D7FA 4FFVC 3BDXA 1I1AD 2X40A 3HA0A 4LL1A 2B0SH 5DT1H 1Z9NA 2HLFC 2GJ6B 2JNZA 2NPLX 4M1CD 1AD9A 2EDEA 2GKIA 4XOAA 1ZEAL 4ZMLA 3P4OA 4FTVE 3DHUA 3EYQC 2EDYA 4PI2A 1HIMH 1DQLL 1NBYA 3CFCH 3IDNA 5EFIA 2M1KA 4GG6A 4J7RA 2ATKB 2ZCHL 5F88B 1XF2A 2ITDA 4BIKA 2K4WA 3HPJB 4MLSA 1B88A 1T4WA 5C0AA 1AHWA 1TTCA 5B1BB 4A7VA 2Z1KA 4OCRH 2DICA 2NY2C 1P7KA 2DJMA 3FQWA 4K3DL 4FI7A 2WD0A 3QQDB 1LO2L 1HESA 4OH2A 3LZOA 4XN2A 2N0MA 5B8CA 1T2QL 4XXCA 5A16B 2DQHH 5FGSA 3DJZA 4JM2B 2B1AL 4AQ8A 4M1DH 5F7KC 1R5VB 2BNQB 2VMCA 4XTRC 1NTDA 1I9IH 5GGVH 3V6FA 2O1AA 2GUOB 1J8HE 1OF2B 2PTVA 3BUIA 4X6EB 1DJSA 4H8PA 2X6BA 3PL6D 5I8CA 3K0YA 4PJ8A 3LOWA 5KW9L 2FX8L 3D1MC 1KZQA 1CLOH 3TL5A 2GSIA 2NUPB 1AG0A 5BRZD 3Q0HA 4V33A 2LTQB 2XN9E 5DD1H 3PGCB 5FO7B 2XN1A 2YEZA 4S0SD 4P2OD 1YAZA 3DMMB 3T65A 4EIBA 2D7MA 4EDXA 4UQ2A 2VGLM 4R4FL 1U8PA 2YD0A 1A9BB 2JK5B 3WD5L 4F27A 4H20L 2DBJA 1M9SA 4Q2ZB 2FWUA 3FCTA 3GUFA 5AW0B 3DTXA 5FM5M 3OHXB 1FGNH 3SQOL 2G4GA 1CD8A 4JPSA 4I0PA 2PW1A 3MLYH 5BOJA 1F18A 4NRXA 4PRHE 2B77A 1TJXA 1S78C 4N0YH 1GYCA 4JRWA 2PO6C 4IRSA 3BDYL 4F2MB 4HWBA 5E2JA 3B6SA 3HHMA 1Q9WB 5JQ6L 5EORL 4ZMZA 1XSJA 4CMMA 1UJ3B 1V7NL 5IBLC 3U1SL 1JYXA 3APDA 1FZOA 2IALA 4DEPC 3ULVC 2Z4TA 1NMBL 1MIEL 1WGOA 4M1GL 4YXLH 2PPDA 1AJ7H 1UZ6E 1Z32X 3U6XS 1YUKB 4JFPA 1KCKA 1YC7A 3FT3B 4R6UA 4U1IB 3GLDA 2ICWJ 4ZW6A 3VXME 4EJ1C 1GGUA 5CP7B 2CJSA 3X1FA 3UG5A 1OAZL 2L3BA 1JV5A 3FB7B 2HWZL 1VGEH 3ZIMA 1IILE 1URIA 4X6DF 5AVVB 4PB9L 5FO9A 4IRSB 5CJXA 1U8IB 1CL7I 1YEGH 1T0MB 2XSKA 5T3XL 3RDTB 4HCRL 5DYOA 1SJMA 1OEZW 3VXRB 2V37A 4AQ1B 5DJCB 4M4PA 4BCYA 3H9YA 3QCUL 1OD7A 1MI5B 3AQXA 3VXTA 4R0LB 2FB4L 1UFUA 2EDXA 3CD4A 2N01B 4HP5A 1YMHA 2CLZA 5D1QD 5H94B 3EOBA 4DKFL 1EJ8A 1FC1A 3O4OB 3CDZA 1LK2A 3IDJB 1CR9L 1PD1A 4IIQA 5DA0B 3RA7H 3V0IA 4M5ZL 3B2PA 2CLVA 5D2NC 1KDIA 2YGVA 4NWUL 4QRQA 1R4XA 3MBXL 3QO0B 2VSDA 3II3A 5T3ZL 4HH8A 1D3CA 3FTYA 1XIWC 3G5YA 2EYTA 4QXGL 5F7UA 4JKPH 1KCLA 2GHZA 4MQXC 1KTDA 3DSNB 3U9PL 1PG7W 4P3CL 5GGQL 5E8PA 3BJLA 1YMHB 2CLZB 3GBNL 2OPCA 4YDLC 5F7MC 2X4RA 2HB0A 5F89B 1BYPA 3VXNB 1HWHB 4GKZA 4JFDD 4N9GA 2A4EA 2GCYA 2BO0A 3CG8A 5T3XD 3NH7L 3D0LB 1XD0A 3FB5B 1AKJB 2EKSA 4MB3A 4HU2A 1AE6L 4O58H 5J1TC 3QSKB 4QO1B 5DEGA 2GIYA 3LRKA 1PTZA 3ZKND 3SE4C 4RGOH 4LRIA 3INOA 3MLWH 1OF2A 4HGWA 4FA8A 2QKIB 3QJVB 5K1VA 4IW4C 3WNLA 3U4BL 3MV8E 3C6LB 1L6ZA 3VTTA 5IJCC 3WV0A 4PRAA 5EWIH 5LB1A 5TQ0L 2HN7B 2WTPA 1QP1A 2ARWA 2WLIA 1IM3D 3VXNA 2EEBA 3BN9C 3O0RL 3WTSA 4GG6E 3DURA 2IO5A 1Q94A 3D39D 1XL6A 4PY7A 3ZMEA 5EF0A 1HX0A 1P7QD 1UHVA 3AM8A 3GSUA 4PV1C 1PX3A 3Q7JA 1H8OA 4WV1A 4PVBA 4ELDA 1FNEA 3QUYB 4G6MH 4WTWA 1BF2A 3TC9A 4KY1L 3TTYA 3X3FH 5HPMB 1QFWL 6FABH 2ENSA 3I02A 4FQXD 2CXKA 2R27A 5KYWA 1XGPA 1KCWA 4P46B 1IQWL 4H26A 2XIDA 4KO5A 1I1RA 5CGTA 3SDCB 4CC0A 3D2UD 1DO6A 1CXEA 3NJVA 1NGQH 5DVMA 1KTLB 4NQEB 2HTLC 3WUWG 4NUGL 2R39A 5I6XC 2H6PB 4KWUA 5JHMA 3TZVC 4U3XA 3T3ME 3D51A 4P4RB 4UTCA 4XP4L 4PW4A 2NTFB 4PTTA 1FZJB 5BOPA 4LSRH 2QDWA 3DROA 3ULVH 2MNJB 2OSXA 3EJQA 4YHYC 3TF4A 4I18A 4A6YA 2WYZA 3MZGB 3SOTA 3JWNC 5CBAA 1D5IL 1F4XH 1TCRA 1GS8A 3GXMA 4KMTH 1YEDA 2DIBA 2DLGA 2V5MA 3D85B 3T4AA 2ZWSA 4NM4H 5F3BA 1BIHA 1KWKA 2BX5A 1PJWA 2X89A 4LAQH 4N1EA 3ARED 3LKRA 4DERA 2IAAC 3DVIA 2WQ8A 1DVSA 1YQVL 2BP0A 2DI7A 3NK3A 4HJJL 2JQMA 4L4VD 4WNQA 1MIML 4FEIA 3QDGE 2WO2B 5EUOE 5J3HC 2V2WB 4X6DB 1QLEB 5IG7B 4NBZB 5HHOA 1DJIA 4PV8A 1AFVH 5EC1A 3TV3L 5IFAL 3U7AA 4WTQA 1I85A 1R3HA 2NY4D 5F0LB 4R7LA 4HPYH 3BIAX 5I5MA 4NIYE 4HF5H 4K7FA 4AY0A 2IEPA 1ZLWK 2XA3A 4LEBA 4BFBD 4BQBA 4YDNA 4KITB 2A0LC 1MJ8L 3DGGA 4R7NB 5I1JL 1CGWA 3UC2A 5D1XE 1EHLH 5EPMA 4U7MA 4HIXH 5MP6L 4U3SA 2Z0UA 4MZ2A 3IAQA 1QACA 1E30A 3VTMA 1G7QB 1XCXA 2VLJB 4OZFB 3T8VA 4EXPX 1FNGA 1HL4A 1PIGA 3H9ZA 1LE5B 1GAFH 2PMZA 4HKBA 5JHLL 1F3DJ 3MRRA 4P2AA 3QQ3B 5HHQA 3SO5A 3T1FA 4NQSA 4ETQB 1DSFL 1AZBA 1OAUL 3HLKA 3IJEA 5EOCJ 5IVOA 2X88A 4YHZH 2VO8A 2I26N 2D0HA 2ZX6A 1F86A 4ZXBD 3VDBA 2WLKA 4GUOA 3MROB 3O2DH 4LRNL 5J7CC 5I6PA 4YWGL 3ECBA 1ZA6B 2DMKA 1OTTD 3LAFA 3LXCA 3QVAA 1U8KA 2FJUB 5LWYL 5E7BA 1FZMA 3MRHB 3NSDA 3HC3H 4R97B 2ZCKH 4HZAA 3FTUA 4CVXB 3VI4F 3GXDA 4FXLA 2NUPA 4YXHL 3CXDH 4GAGL 4AT6B 1ZXQA 5F6HJ 1QI4A 3RIKA 2WCGA 4ZAKD 1MVUB 5I6MA 1NC2D 1C7SA 1EFXB 4KMLB 1P7QA 3ZQXA 4OV6F 4FS0A 4TV3A 3QDAA 4WI6A 3WENA 2BWIA 4W9EC 3RTQC 3O6LH 2VL4A 3NIDF 4L4VB 1A7NL 2HG5A 3TEZA 4F5CE 1QA9B 5E5RB 1RJZB 1ETZB 3IXTA 3Q06A 1UXWA 4X4MA 2O72A 4UQ3A 2ZONA 3SDCD 5CSZB 3II2A 4HJGB 4X6CE 4X5WA 5HI3D 5K9OB 1JAEA 4JKKA 1U8OA 4XOBA 2VM4A 1F58L 2X6AA 3RZCB 5FKPA 5JNYA 3A4FA 4TSBH 1O9VA 4I5BA 2CKBB 5DLML 2XPYA 1LDSA 43C9B 4W1TA 5CD3A 2P7TA 3T0DA 4HPOH 3TJEL 1VLXA 2CUIA 4ZRGA 1RUKL 1NFDF 4OUUA 1FFTB 1FG9C 3IDMB 5ESVA 5IVXE 2X05A 4EEEA 4NAQA 5LJYH 5IROD 1CICC 3RURA 1G9NL 1NINA 3FO1B 5J9PA 5CN3A 1CICB 5KN5A 4P0DA 2LTQC 3OJMB 5AL8A 4KJWD 4L4TA 3BXNB 3UJIL 1T04A 2DH2A 4GMTH 3VQ2C 2ETWA 3IMTA 4YAQB 4ABVA 2NMSA 1TTAA 1EEYA 2F19H 1FG2A 1QLEL 2WWNA 2OAAA 4U1SB 1MFBH 4QRTB 2GIXA 2EINB 2PXYD 4LARL 5KANG 4HSQA 5DHVA 3KJ4C 1PZUB 3DGCR 4L8BA 4EUPH 3NABL 4N0FB 4AK2A 2AC0A 1ACZA 4ZFOB 3MBED 2X1QA 3SKUD 3P30H 3D34A 4NDMB 1JZ5A 1U3ZA 3M17B 4AGQA 4HXAH 1ZHKA 2X4QA 2JE8A 4C83A 2GBUA 5FIEA 1QLRA 5FC9A 4WW1B 5L88H 1CK0L 3PHOA 3R1GL 5LXGL 1PX8A 2MQ0A 1YMME 3ERXA 5J12C 1DDTA 4XMKL 3NCCB 1MLBA 2NR6A 3V55A 1KF9B 3EYFB 1TQTA 4ZTPL 2D4FA 3QCUH 1P5VB 4UI2A 4RZKA 2ZKMX 2JI1A 1XMWA 3UACA 2JIXA 5DHYA 5MENE 2R0LH 3GDBA 1SLXA 4QTHB 4YDMA 3PHQA 3R8BB 1J8HD 3M17A 3CZGA 3IVKB 1OO2A 4F7TB 1MG3C 3OMNB 3GMPA 3BWAB 3WBDA 3Q05A 5EZIH 3O9WA 3QQ3A 4F8PA 4PMEA 4LQFH 2FWOB 3FPXA 4ANXA 4PTUB 5T1JA 1JYNA 1MFCH 2VDQH 1MCOH 3QQ9C 1TDQA 4XMLL 4DN3H 1A6WL 2IGTA 4C4BA 3H9SE 4NUMA 1L3WA 4GS7C 3I50E 4NBXB 3F6IA 3BAYA 5F8QC 2J73A 4E42A 1BFTA 5EZPA 1U8JB 3I6GB 4MCMA 1C5CL 4YGAB 2FR4A 4PJBA 5A2IH 1G94A 2JELH 3GSUB 3TT3H 3KBFA 1RH8A 5B1CA 2YRLA 4LCYB 2IF7A 5D7LA 4OCYL 3L7FB 4N6QA 4JCWA 2IFGA 3RG1C 1JZGA 2WZ5A 4P2OB 3LHPH 3LV3B 2AXWA 1SOXA 2MKLC 3G5VA 3ASOB 1NEUA 4DP9X 1TQBB 5J57B 4G9DA 4GG6F 3MA7B 3R0MA 3DX9A 5DFWH 1MFAH 5BZDA 3S3PA 4JKWA 2HFEA 3EZJB 3KLSA 1JL8A 3L5WB 3TYFA