5GZNA

Structure of neutralizing antibody bound to zika envelope protein
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
407
structure length
402
Chain Sequence
IRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPTVDIELVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWGNGCGLFGKGSLVTCAKFACSKKMTGKSIQPENLEYRIMLSVHGSQHNDTGHETDENRAKVEITPNSPRAEATLGGFGSLGLDCEPRTGLDFSDLYYLTMNNKHWLVHKEWFHDIPLPWHAGADTGTPHWNNKEALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEAEMDGAKGRLSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYAGTDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVGEKKITHHWHRSGSTI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular determinants of human neutralizing antibodies isolated from a patient infected with Zika virus
pubmed doi rcsb
source organism Zika virus
molecule tags Viral protein/immune system
molecule keywords Genome polyprotein
total genus 65
structure length 402
sequence length 407
chains with identical sequence B, E, G
ec nomenclature
pdb deposition date 2016-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00869 Flavi_glycoprot Flavivirus glycoprotein, central and dimerisation domains
A PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5gznA04
2.60.98.10 Mainly Beta Sandwich Tick-borne Encephalitis virus Glycoprotein; domain 1 Tick-borne Encephalitis virus Glycoprotein, domain 1 5gznA01
3.30.67.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 2 Viral Envelope Glycoprotein, domain 2 5gznA02
3.30.387.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 3 Viral Envelope Glycoprotein, domain 3 5gznA03
2I69A 5LBSA 3WE1A 1OANA 3N41F 4FFZA 4L5FE 3UZEC 5KVEE 5IREA 3C5XA 5LBVA 4X42A 4GT0A 3N43F 4FG0A 3C6EA 5KVFE 2R69A 5GZOA 1OKEA 5LCVA 1PJWA 2H0PA 3G7TA 5KVDE 4AL8C 1SVBA 3N44F 5AAWC 3N42F 3UYPB 5JHLA 3J27A 1TG8A 4UTAA 4BZ2A 4UTCA 2HG0A 1S6NA 5AAMC 4UT6A 2V33A 3J2PA 3P54A 1Z3RA 3I50E 3MUUA 3N40F 5GZNA 5KVGE 3UAJA 5H37A 3IRCA 2JV6A 4UT9A 4UTBA 2ALAA 2JQMA 2R29A 2JSFA 5B1CA 3UZQB 4ALAC 2GG1A 1URZA 1ZTXE 4GSXA 3UC0A 4BZ1A 1RERA 1OK8A 4FFYA 1UZGA 3UZVA 3VTTA 4AM0Q 5IZ7A 2P5PA 1Z66A 5JHMA
chains in the Genus database with same CATH superfamily
5FYLD 4YDKH 3HS9A 3UTOA 4YN3A 3MSPA 1YMMD 3RPBA 3WI9A 1IIIA 3X11B 4CADB 2YPLA 1R4XA 2X3BA 1F8TL 3K1KC 5C0EA 1B4JL 4IRZH 5HVHB 3GI9H 3HE7B 3OAYH 3MBED 3RWJB 2OW6A 3QR0A 4X7TB 4WF7A 3QJQB 4PRHD 1QFWL 3QXVA 4M7ZB 5AOMA 5IB1A 3X3GL 4G8FB 2XBDA 2P5WB 4NWUL 1I3RA 2PTTB 5PCYA 4WU5B 3BRGC 3LKQB 4LF3B 2DLIA 3ULUH 2P28B 3EJRA 1FO0B 1H9VA 2BNQA 5KBKA 2AABL 1JGEB 3BUIA 4CU8A 5DK0A 4A68A 1EFXD 1LWJA 2HLAB 4NZDA 4P5TC 3MGOB 4QY8B 5DJDA 4Z18A 2PYEE 5JW5A 3VG9B 1KIUA 3VDCA 4QD2E 4OD2A 3NSFA 4N68A 1XF2A 3C6EA 2EE6A 3ABMB 4AL8H 2FIRT 1FNSL 3QGVA 3NH7L 4TLUA 1BF5A 4HKBB 5E2JA 3D2TA 1AJ7H 3IJYA 4PSRA 4FFYL 2OL3A 1NQBA 3F05A 1OAQH 3H0TA 2GVYA 3FQXA 2VXTL 2XA8H 1M7DB 3E9TA 1O5DT 5T1MA 4LSQH 4FFYA 3W11D 3D39A 3EZ8A 5TPWL 4PGBA 4BRVA 2WB1A 4MAYD 1XR9B 3GLDA 3HJEA 1TITA 2OMWA 1K4DA 3MLYL 4ABVA 4KOBA 5MEPA 3P9LB 1T83A 1KEGL 2VQUA 3OKNA 3S34H 4OGAD 4WCYL 3MN8A 4R0LB 3VG0H 4DP9X 8FABA 4W6WB 4S0TD 2VO5A 3VD5A 2WKLA 4JDEB 4XAKE 3V0DA 1I7TA 1U42A 3HVDA 4FF9A 4ERSH 5G5DB 4HD5A 5LLIC 4WY7H 2XQBH 4I0PB 1P9MA 4FQQA 4ZUSB 3VWKD 5BMFL 2MTAA 4S1RL 2X1WL 2QQKH 4JDTL 5B39B 3U0WH 3BAWA 1QI5A 2NUPB 2C3VA 2NY4B 3H7LA 5DK2B 1XF3A 2LLLA 4MCNA 3FUKA 3FH5A 3RNKA 3OGOE 4IRZA 3ZDYB 4X2UA 1QQDB 1BM7A 2JKNA 4NDMA 1MREH 2BS71 4OUOA 3GK8H 2JCCE 2P42B 5DHXB 4NJAL 4BZ2H 3S88L 3VM5A 3ZRCC 2YMXH 1CD0A 4WW1A 4P4KA 3V79C 3AWEA 5AZ2H 3CFBA 4K8RC 4KI5D 4MAUL 5GJSH 4FAAB 1IC7H 2NYYC 2XX0A 1J8HA 1BJMA 1S9WA 1B3JA 2I24N 3IN0A 4MHHI 1D5BB 3V0WL 3GGWA 3QWOB 1KULA 3QJFB 4GQ9L 5FS5A 4BSWB 3REVB 3NZUA 1RXLA 3KPQB 1YYML 5C92A 3QCUH 1DL7L 2VAJA 3HFMH 1B0RA 5T5FH 1CMOA 3UACA 1A6WL 1RZ7L 2XG5A 3LDBB 1OVZA 3PWNA 3EGDA 4J3WA 4PJHE 4YDVA 5C0BD 4PCKA 1TJXA 3VXQB 3IBOA 5SWZB 2QGDA 5KOVC 4N1EA 2CG9X 2C3HA 3J8F7 3O4LA 4XWOD 4WI8A 3U2SA 3VQ1C 2YO3A 5CCJA 5FXCH 5FO7A 1GL4B 4APXA 2I7SA 3SDAC 4V1DE 5HSFA 3MLPA 3QRGL 1YEHL 3CX5J 3Q0HA 1TMQA 5EBWB 2ZKHH 2Z34A 3SGDH 5F3BA 4G82A 5F89A 3L8QA 4JHWH 3LEXA 4Y4KB 2CUAA 2NYKA 3QUMB 4LSUH 4YDLC 3SQBA 5GSVA 3T4AA 4PJ9B 4RWHA 1X5KA 4HQQH 4FQXA 2GTZA 4X4ME 1IBZA 3G5YB 1JMXA 2ADIB 3H2QA 1UXWB 1DBKH 5KTEH 3DYPA 5EUOE 5JA8B 3O2DA 1OZTG 3W3BA 1GPOL 2KHAA 3IDGB 1NGWA 2VERA 4K94L 4NCC2 1GW6A 3BWAA 3NEXA 3B83A 3LXAA 2FT8A 1KGYE 2FIKB 3L9EA 3HG1E 5AW9B 2WQWA 1TEFA 3FDWA 3W0WB 4L0PB 1N0LA 2MQGA 3JWDC 4PRAB 4Y1AB 4PJCA 5BVJB 3OG6B 4XI5C 3L4ZA 3BH4A 5D5MB 1PKQA 2CK2A 1CLOL 4MNGA 1OOWA 4I18B 5C08A 3FYEB 1NWOA 1SMDA 4OY9A 4QYOA 3BO8B 3F12A 2ZX8A 3HKZA 2X0WA 4B3VA 4GKLA 2DWEB 3MV7B 4HUCA 4BZ1A 1QWNA 4TNGA 3HMWL 1JGUH 4HP5A 4F57L 1HSAA 1X6NA 2R59A 2AQSA 2BP0A 3FL7A 3G9VA 3KGTA 2YEZA 5J0BA 2JIXD 4HDIA 5EF1A 3NRPA 5CEYA 5TE7H 3S35X 1UXSB 1HHIA 4QOKE 1LEKA 4PI0A 1TETH 3LH2L 1ADQH 4JFVA 1J8SA 2C1PB 3TC9A 2Q7NA 2ADFL 2HT4D 2YMTA 4J3OG 3C5ZD 5KVEH 2YMOA 3D9AL 2F7OA 4PJXB 3KXFA 1YEGH 1HL8A 1XTLA 3F83A 3V4PA 4JM2C 1SUHA 4S10A 3WSQL 2J56A 2WWMC 2D73A 5EG6C 2EDHA 4JDZA 4PRBB 1TTRA 3WIFB 3SY6A 4O02H 5ALBL 1HOCB 1ZT4B 2X4NB 3LPPA 4J3OF 3RL2B 2FHFA 2O61B 1B0WA 4OU3A 5B3NA 3T6XA 2QPFA 1WS8A 2ZSVA 4PJBB 2FWSA 4DKDC 1FFNB 3GKZA 3HS8A 3LN5B 3PV6A 3QXUA 4J4PD 4UT6L 1OSPL 1IC1A 1CYXA 1D5RA 2Y36L 4U3SB 3EO1B 3OHXC 4F9PA 2XPGB 2J2ZB 5T33H 3HLKA 4G6MH 5CBEA 3QFJA 1KCUH 4NLAA 5F9JA 3WD5H 3VW3H 2KS0A 2DOCA 3LB6D 4NNXA 5EO1B 1HDMB 4MS8D 5I8KH 3NCBB 1L6ZA 3BJLA 1U8JB 3AACA 3GM0A 4I48B 2HT3C 2OCFD 5J6GB 2B4CL 1Q0XH 5E1AB 3TPUB 5IVZA 3SD5A 3LKPB 5E08H 3N1GC 4ZFOL 5CJ8A 2W9EH 4D0DA 1TJIH 1B9KA 2J1XA 3CN4A 3FT4B 1OP9A 3EBGA 3SDXE 3NPSB 2JCWA 4L29A 1U8HB 1RULH 4IRSC 4DTGL 3OJMB 2X1XR 3MRGB 3ASNB 4K7PY 3EFDH 2BXYA 4L29B 1LK3H 2VZVA 3QDMA 4KZ0A 4LLDB 5DEJA 1AXTL 5HJ3A 2X05A 1J0YA 4HSQA 3TJPA 1SMAA 1R5WA 5KZCD 2OMXA 5DD3L 2BY2A 1QVOB 1H5BB 4ESKA 3FTSA 3QO1A 2YC1A 4WHDA 3C8KA 4WI2A 1YMHB 3TIDB 4IEFB 4U3HA 3BQUC 1TLMA 1JGVL 1FH5L 2H6OA 3CNKA 1QRKA 4R8WL 1CICB 2N7SA 1BA9A 2BIHA 5FKAA 3KPSA 3L1GA 2IOIA 4HAGA 3RWHB 2DI9A 3F7QA 5CJOH 4Y4FB 4Z3FA 4IS6B 3APCA 4ZMZA 1BWWA 4U31A 3SDDD 3SKMA 2EIEA 1ZKAA 3GNML 2UXFA 5D4QA 1NEZA 1QHOA 3LIZL 5KBMA 5J9PB 3QPQD 2NX5D 2BVPB 1Z66A 3D25A 4ZPTB 3G5VA 1BAGA 2P8LA 1CB4A 1MH5A 3U36A 4DP7X 4M6NL 2ADJA 3PHQB 5SWSD 4PLKD 4ONHA 2P7TB 3I6GB 2R69A 3ZXAC 3BGFB 3CXHK 4X7EC 1DQTA 2Q87A 4PJIB 3ZVVA 3O4OC 3UP1A 3VH8A 4YHZH 2X9ZA 4G6JL 3RL2A 1NAKH 4JG5A 3RY6A 3MKKA 3RDTD 3KXFB 4RFOL 5D7IB 3RDTC 1R5IB 3PFQA 1V05A 2FJSA 4BFRA 1NCWH 3QP3A 4U6TA 2W5PA 4EF3A 4NZTH 4JVUA 4YXLH 3ZT6A 5GRWA 2C9SA 2P9RA 1EJFA 3N0AA 1F3DH 4IGBD 1J0IA 3H9SB 1HSAB 1HHIB 1LEKB 5DJ0B 3WENA 3BSZA 3F00A 1XCTA 1E30A 5IB2A 5C9KA 2KQMA 1F58L 1VLXA 1BXAA 4N0UA 2PKDA 3GSRA 1RFDH 2MQ3A 3R4DA 1U8LA 3U48A 3ZBMA 5C08B 5ACZA 3ARVA 1JNLL 4DIXA 4Y0GA 1XCQA 3F12B 5IESH 4QYOB 3NFPA 3UTTE 1Q0XL 4TM9A 3LPFA 4F37F 3QZPA 4I5BA 3U0WL 2JKSA 3RWFA 5CLYA 4RETB 3D2UA 4UV4H 1AOZA 2EDBA 1EXGA 1A1NA 3HZYB 5ESVB 3DHPA 2NDGA 5BS0A 1LE9A 2EUXA 3AM8A 5T5NF 2DMGA 1J1OH 2AXJA 5H4YA 4JO2L 5LGJA 4OGYL 4Y4FD 2IFFL 4ZPVA 4PD4J 1TJGL 2VQ4A 2ERJC 4FQXB 5DUJA 3UTTD 2BNRB 3S96B 1KNOB 4JZOA 5AW3B 3VA2C 1DZ0A 2XQYK 2DDQL 2YQ3A 1LO0L 5DHVA 1G9ML 2GTZB 2XRAH 3QUZC 1AGFA 3B37A 2PCPA 3HHSB 3DMMC 2GSGB 5EBLA 5IREA 1I1YB 5A40E 1TTAA 3BPOC 4K3JL 5FOBB 5CJQH 2XXMB 3H56A 3BYYA 5JIMA 4H0HB 3K80A 3FZUC 4HSCX 3PWPD 4U1JB 1S7RA 5BQ7B 1D7CA 3VFWA 2UUDH 3B6SB 3L7EA 3S35L 3FSOA 5JMOC 1I1FA 1ACYL 3TT3L 1JXFA 3P77A 2QKSA 1WWAX 1P4IL 3NQKA 2YWZA 3WEBA 4FQJL 3NQIA 1JD9A 1BVOA 3U0PB 2HP4A 1EZUA 1MY5A 3BUQA 2FR4A 1F58H 4N1HB 2DWTA 3VWJC 4K3GA 4M93B 4RX4D 2EE0A 2VXQL 2EVJA 3CFBB 1FA4A 1VGKB 2R0ZL 1S9WB 2VR9A 3TJHD 5F0MB 4WW2C 3SDDC 2PWGA 2XYCA 4B0MB 3SZ6A 2DJ4A 3X1FA 1JGUL 4GXVH 3BXNB 4PJ8B 3E6HB 3BISA 4MBRA 4PRIB 4BFNA 4JFED 1KJVA 3Q1EA 2CIKA 3ARDA 4GSXA 5IB3A 2OMYA 3BX7C 5IJCC 2HFFA 5TF0A 2D0FA 3LH9A 4LGSB 5CR8A 2DLEA 3WKYA 1Q94A 1UB5B 1K4CB 3L3KB 4G5AA 5K39A 4Z7VB 2WQAA 4PJFB 4HKJA 4EPSA 4QRRB 1JTOA 4HHAB 3U4BH 3MKGA 4EEEA 1BIHA 3ZDZB 2DTMH 3ESPA 3DRTA 3BDBA 4YQXH 4KAQL 3KLDA 4RVBA 1B6UA 2K0RA 1TEGA 2IALA 4LLVA 3P54A 4O4YL 2GK2A 5CFAA 4JQIL 3DX3A 2VDKB 4IBSA 5DSCB 1S7VA 2RACA 2Z35B 4HHWA 4N2MA 4OTXH 1EFQA 2Y1AA 4NO5B 1LMKA 1N2RB 4LQFH 5JHMA 1KTJA 3LMJH 1IKFH 1BBJA 1JI2A 3MRHA 3QCVL 4NRZB 3QSKB 1GHFH 4Z95L 1E4KA 1OLLA 2OZNA 1U6AL 3EYFB 1T21B 4P2AA 1PD0A 2XN1A 4ZUTA 4B5ZA 4BCXA 3HG1B 1SHMA 1B6DA 5C0CB 2DIAA 1UTDA 3NN8B 4NQCB 2PWDA 1RJLB 5CSBA 5JLZA 4KJQD 2HWZL 3BIBX 2BVQB 5CSZA 5GRXG 5J5EA 3S37X 4ONOA 3APDA 4B9YA 3JV6A 2AANA 5B4MD 5J12C 3FCTA 1MCQA 2F5BH 3PPEA 3PRZA 1JF6A 1LTXA 1NM9A 5FYKL 2K3HA 4NT6B 3L9BA 5AVRB 3WMQA 1FAIH 2WLIA 4DEPC 4TSAH 1T7ZA 4J3UA 2F7RA 1M05B 2P24A 4QT5B 1U8OA 5CAYB 1XO8A 3AXHA 2BNQB 3M88A 3K1DA 5D1XA 2LAAA 4PHXA 1WIUA 3FQTA 1TQUA 3PAYA 4Y9EA 1NCIA 1JHTA 4E36A 1BBDH 5KYYB 3G6JE 3ZKND 5SWZE 3ZKMD 3GI8L 1ZIAA 4KY1H 4OV6F 1E50A 3CZSA 1UT2A 1MAKA 3MR9A 5DWUH 5EPMA 1HH6B 1M42A 3NBNA 4S1RH 2YPVH 2WB7A 5I1HH 2AJYL 2BVYA 1L0XA 3QEGH 2O5YL 4YHIA 4GXFA 1OEZW 5EPMB 2CLZB 4Q0XH 1RZ8A 1T66C 1KFAL 3WMSA 3CFNA 4PWKA 1CF1A 1CFTA 1P1ZB 1SLWA 2C1OB 3C08H 3ECBB 4HS3A 3RWCB 3VMPA 1VERA 4YWGH 4MA1B 1TSHA 3RWIB 4M1DL 3H85A 1OCCB 4ZX4A 1CXFA 1PX3A 2IDFA 4OZHB 4OFYA 5JDSB 3ROOA 1U3ZA 3WAJA 1Z5LB 1ZEAH 2IQ9L 2NZ1A 4PJDB 1AKPA 4LLMA 4AUJA 5C09B 4KRMB 3QZBA 3I84A 4XBEL 3N85L 2SEBB 2P48B 2ORBL 4L3EB 4JG0H 4XP1H 4AC2A 3KPLB 4MAZA 4OZFB 4PJ7A 4YR6B 2W9EL 1UT9A 4XTRD 4XZUA 3U46B 1OD7A 1C16B 4UYQA 5CP3A 1GGCH 4Y4KC 4Z7UB 2F2HA 1HILA 5IW1A 1KGIA 4PJGB 3GB7A 4RAHA 3EYFA 4LBEA 5DUMH 3BPLB 3HFML 4GYBA 3FOLA 2BSRB 3MRKA 1KB3A 2PYEA 4QRPD 4GAGH 4L5FE 1P6AB 3OR7B 3Q7JA 3KEDA 4MBOA 4A7SA 2UZIH 5FO2A 2CLVB 3M45A 2CO6B 1LP9E 1WS7A 3FTYA 1XVSA 2NY6C 43C9B 1KTCA 2KPNA 1T4WA 3QJXA 3BZDA 4W9ZA 4XX1E 3B56A 4AVJA 3W57A 2WV3A 1JHTB 1PCXA 1MCLA 1KCSL 3AY4C 3Q48A 1QBAA 4K8RL 5D2LF 1PYWA 2JIXA 4ZX3A 3RJOA 3MQIA 1G1OA 4EUPA 1B3IA 5GHWL 1LWRA 4N0RA 4X80L 4EKJA 1MHEA 2X2HA 2EXTA 2E9BA 4JGNA 4LSUL 4MMXA 1QR1A 3SZKC 2X6UA 4HKJB 2WLIB 2W0KA 2WLHA 1AQDA 3AU1A 3ZE1F 2KI6A 2CBPA 5JYMA 1ET5A 3K4AA 2YUZA 1SY6L 3E6FA 4HGKC 4KUCF 5HGHA 5IBTL 1A4JB 4DKTA 4PRHA 3G7TA 3KZ8A 3AREB 4TVPL 3F7VB 2WJ7A 1WQVT 4JM2D 4QHLB 3WEXA 3ARGD 4YBLC 4KH9A 2BSSB 2VR3A 1OF2A 4KTEH 1I8KB 4HAFA 4WEBH 3W37A 3HI5H 2MOVA 4UM9B 3TO2B 1ZWIA 4PGDA 4AQ1C 1K5WA 1NCBH 3ULSA 1ECYA 2YEVB 4G9FB 4YFDB 3P73B 2GPZA 1BBJB 1YEIH 4L4TD 1KGXA 1XSOA 1A47A 1AVAA 3L3IA 4K71B 2L7QA 5EO9A 4X6BA 3FUHA 5H2BA 1AE6L 1IEBB 3ZE0B 1A1OB 3MUY1 2F74A 4XCFH 4YGVB 4G6KH 4M4RA 4R26L 5DHEA 4ES9A 3F5WA 4G8GA 3CQPA 1E4XH 4OLZH 4RMQA 3LB6C 2XVLA 2Z6FA 3K71B 2OJZL 2XPZA 3MRCA 4JFFB 4NWTL 4OM1H 4LCUB 3VFPB 2YEQA 2CBQA 2EEDA 5HYSB 3B7RL 4TVPE 4HOWA 1OAQL 1MKFA 2DQUH 3A4EA 5CKGA 2GUOB 2EUWA 5LBSL 5FC9A 1QSFA 3EOTH 5DHVB 2QQKL 4JDTH 3DOSB 1ZS2A 2CXGA 3APFA 4K71C 2YAEA 4P23A 3OHXB 5DQ9B 4AYFA 4HIQA 3W5NA 4XBPA 1OGTA 2Y36H 4LHUB 5D7JD 4LLAA 3JUZA 2JXMA 5FFGA 4AQEA 1I4FB 4G2AA 5KVGE 1NGYB 4U6YA 4OLWH 4N28A 4KK9C 3TJEL 1TTGA 3K8KA 4KZCA 1A4CA 3C5ZA 3FMGH 4OF7A 3MGAA 3WE1A 4FXKB 1JHKH 3G6JA 3QDGB 4ADJA 3KHOA 4XN7A 4EKXA 2X41A 3V0VB 4F7EA 1G4RA 5LXVA 5DMJB 3FB5B 1DYZA 1G7JB 2YJLA 4IDJL 1LP9F 4WKZA 4GRMA 3VX1A 3WKPA 5SV3A 2BOCA 1WBZB 2J7LA 4LL4A 4M7ZC 4NRXA 2LLGA 2ZICA 3T2OA 5C2UB 4DO5A 3B6SA 5EZOH 3MO1A 1A4BA 1MAMH 3M6DA 1SY6H 2DQHL 3CQQA 3WG7B 4CVZB 1JS4A 3IKCB 5DVOA 4M48L 4NNYB 3LQAL 3FU7B 2V4LA 4GRWB 2FB4H 3BAIA 3RIFF 3ZTNL 4XXDA 3ECUA 4HIXH 5AKRA 5I1CL 3MLUH 5F9WB 2YRBA 4H8WH 3QDJD 4N8CH 5F2FA 2DM2A 2RCSL 2Y7MA 3NIDE 1QZ1A 3OKEB 3QJOA 1HC1A 4QRRD 4KWUA 1SN2A 2ATKB 4PJIE 4MDJA 3UGXA 5KW9H 1IAIH 2VLJE 1Z2KA 3UPCA 3KPTA 3QEQB 3WFDH 4OD3L 1C5BL 5D1QC 2VZ3A 3O9WD 3OM3B 3BESR 4XNYH 1LE5A 3IPEA 2VJXA 5F7DB 2X4RB 3DHMA 2ZNWA 4NRYA 3IS0X 1FBIL 3EGSA 4ODVL 3S3SA 1AGCA 1INDL 2OZ4A 4NI6A 3O2DL 2ZKMX 1RZPA 5FIEA 5AWNL 3RIFK 3UJTL 3RNQB 3CJJA 5C0FB 3FSAA 1V27A 3KH3A 3P30H 3RP1A 5EEVA 1F8TH 2NCMA 4JY6A 2IPUG 3OR6B 5BO1H 1BQ5A 3VFUA 2XBZA 1AMYA 1GZPA 3ZKQD 3ARGA 2CDEA 4XB8A 5GIRB 1U8LB 4Z77B 1BQKA 2W60B 4LRNL 3MNWB 1U8KA 4JHUA 1WUNT 5FV1L 3HZVB 3CSFA 3KPSD 2G9KA 4PYGA 4GQRA 4LGRB 1HN1A 5IKCA 2FUTA 2K9FB 3H9SD 1KCKA 4QAWA 3Q2LA 4YNYA 5KUKA 1QO3B 1KBGL 5F1IA 4IBTA 2MRYA 2NXZD 2YC1B 1AXSB 5G4MA 2K1MA 5HDLA 1DO6A 5CEZE 1J9RA 5DTFB 3GDBA 2ZP9A 4Z3HA 2GKIA 3K2MC 4LDOB 2X87A 3CX2A 4M61A 3VGAB 3DGGA 3PHAA 2PWFA 2E7MA 3II3A 4XMXA 5F88B 4K3DL 3AITA 4LNVA 2GJ6D 4FA6A 4S1QL 1ORQB 2ESVE 4B5EA 2PXYD 4BXSV 1U8JA 5J89A 5I1GH 1QSEB 2HVKB 2P8LB 2EO9A 4ZUWA 3U36B 3ZHDA 5EHFA 4DT2A 3B2XA 1QHQA 5F7MC 2HXAA 2G4GA 1D5IL 4Y2DA 3UPRA 5ILTL 3L7FB 4FEMA 1DJWA 1MJ7H 4O5LL 3V4UH 4ZMTA 2WUCH 1LEIA 3N44B 4Y4HA 4UQDA 2LABA 3A6BL 5ENWB 2EZ0D 4PV9B 2O5XH 3D12B 3PV6B 2R2EA 2EECA 4GI9A 1DANU 5EZIH 5B1AB 2N3JA 1MCPH 1C12B 4N2NA 5CEZL 1WT5A 1KBBA 1YPZA 4EN3B 2OKMA 1BAFH 1QNZL 2V2XB 3L6FB 2K70A 5BO1L 4G5ZL 4MQ7A 5SWZD 1H3XA 4JO5A 4F1ZA 1IBDA 4HMCA 5F7EL 4ZFZB 4DZ8A 4PJ9C 2LTQC 3SE3C 1D6EA 4X42A 2F1EA 4GT0A 4QI3A 2B1AL 3BUYA 2PW2B 3SJVA 5I2IB 4PHZA 5CINL 3QDGD 4ANUA 4F7KA 3WDHA 4EI6A 3BJ91 2ICEC 2PP9A 1WA1X 2AZUA 3FTWA 3OKLB 4D0CA 3Q05A 1T04B 5EEWA 3UC0L 2BOLA 2ED7A 5A2CA 1QX1A 1MHPH 5E5UB 3V4LA 2GIXA 1U8KB 5CZXC 5C0AB 3Q9PA 2FL5B 3MOAL 1Q72H 4K7FA 4H8PA 4AT6B 2OYMA 3VYNA 3VRJB 1BZ8A 3QISA 4J23A 5DS8A 4YSQA 3QFJB 3WSQH 3GIZL 4JZNA 4R90H 2R0ZH 2Z3FA 4YHPB 2CAKA 1A9BA 4J3OD 5D7KE 2VDPB 3H55A 3JQOB 5MP6H 5DD5H 1RK1B 4KXZH 1GZPB 2Q7YA 4F2MA 5L7XH 2ALWA 2YGQA 3DVGA 3EG9A 4K7PX 3SGKA 2JE8A 4DAGH 5IM7B 3RVWC 4PVBA 5E6ID 3IKCA 2AGJH 3APNA 3OTTA 4P2QD 3ZT7A 1TZHB 5C0FA 1HWHB 1ZMYA 3JWNG 4J28A 3KPPA 3CXFA 3SD2A 3ETSA 1G94A 5KBLA 1DCEA 2EDOA 2NY5H 4B9CA 5DT1L 3B5HA 2EYTB 1OCZB 4HMEA 4F5CA 3V55A 4PM1A 4HWZA 4LOUC 4B0MM 5EULV 2K78A 3PL6D 3D06A 5E8EA 4F7EB 5IWLA 2OK0L 4JE4B 2Y07H 2PYFA 4CGUB 4P3CH 4FQXD 2CR6A 2OFQA 3WY2A 4V1DB 3U6XA 3QUMA 4UTAA 5D1ZD 5L8KB 1QD0A 4HIJB 2WLZA 4Y1TA 4WWKD 3FBQA 3BIKB 3DV4A 1SN5A 3UAJA 4KK8D 1KWKA 1P5UC 2Q10A 3HRPA 2GBAA 5I8EA 5D96B 1F18A 5EBGA 2G9HA 4XO8A 2QMJA 2MPAL 2CPCA 3GNMH 1A65A 4ENEC 4ZFOA 5CMAB 3QUXA 2OS7A 2CJ3A 3S36X 1QLEH 4PCTA 4EIZC 4HXBH 3GSWA 3NACH 5AB0A 3N0PB 2H3NB 3C9NB 4XH2A 1XWVA 4ZUUA 3O6KL 2YRZA 2G2RA 4KV5E 5HDBF 3CVCA 3WXWL 3VRIA 3QEHA 1AD0B 4HJUA 4KRNA 4X7SH 3DOSA 5EZIL 2EVFA 1ZVHA 3MNVA 4PLKC 1UWFA 3LZRA 4MB5A 1J86A 4JFXA 1T1YA 1VENA 3NP4A 1WHOA 3F8UB 2B59B 3IDJA 3GS4A 4PJCB 4OCNC 5GGUB 1MCWW 5DHYB 1V10A 4JN1L 4P2QE 3K71A 4IOIB 4RMRA 5GS1C 1MFVA 5CWSB 3WDIA 1G9HA 3FB7A 2VDML 2YSSB 2CLRA 2ZYHA 5EO0B 2NY0D 4WAFA 5BOPA 4HX1B 5E70A 1PIGA 1WC7A 5GGSB 3D5OF 3SDXA 1IO4C 1YNKL 3DURA 4PJ9A 4JO2H 1NLBH 3VI3B 2DD8L 1C8PA 3BZFA 3FT9A 2OSLB 1WO2A 1BJ8A 4A04A 2CRYA 2DMKA 4M6ML 5DWUL 3D4GA 4N2BA 2O30A 1OB1B 3EDJA 3IE9A 1NANI 4KRLB 4E42A 2VH5L 2AZAA 2R27A 2DQ6A 3T0XA 3K2KA 4ELKA 3BRFA 5ACLA 4XP6L 3D2UD 1ERNA 1PY4A 4RFOH 1MCKA 1X7SA 3MCKB 3UERA 1IGJB 5KVMC 3CFMA 3KGSA 2YHGA 1PLGL 1R3JA 2OULB 1X5YA 1SRDA 2E74C 2V17L 3JV4B 2D3LA 4IKKA 4X5XB 4ZXBC 1QSZA 4KVCH 5HHMD 2ZUXA 5C86A 4LOEA 4P5SA 3PGCB 2WOBA 5IF0A 1MCOL 2NY2D 5TE4L 1DLFL 1AQDB 3W2DH 3OAWA 1ES0B 4C83B 3L3OC 3G6AB 3NJNA 4FQPA 2NY5L 1IGML 3CDYA 4QHKI 4XVTH 5LVEA 3AXIA 2C9RA 4IBWA 4JFEE 5E1IA 1AR1B 1KYOJ 1RIVL 2YAPA 4BKSC 5EDSA 3W56A 1NMAL 3KXFE 4OZGA 4H8WC 4LVNC 4ECNA 2DZEA 1RZKL 1HKLH 5CZKA 3ARBC 1OF2B 3K8LA 4NPJA 5DD5L 5C0CD 2H6PB 3IJ9A 1QKZL 1PU0A 3RX8A 3MRQB 4Z23A 2EC9U 4UOQA 4KRPD 4LVNB 4MQSB 3N1FC 1AQ8A 5I30L 1DQDL 3RVVD 2BSRA 6TAAA 4XAWH 2AKRB 4U7SA 5CJBA 4RDQG 1N67A 3H9ZA 3MNDA 2PPAA 3NCFB 4HLZH 2ZWKA 3U7AA 3LS4L 3F58L 4GW5A 4AENB 1RHFA 3TVMA 3ARGC 1KJ2B 1A7OH 2WIMA 4MMXB 4X9IA 5AUMB 5IMOA 4FNLH 1KEMH 4HAKA 2BCKB 2PN5A 2PCFB 5J13B 1A21A 5C0RL 5BUAA 3FAWA 4I9XA 3U9PL 1RUMH 1GGIH 4OD3H 5IB1B 2VDLL 1A8ZA 4FJ6A 4PY7B 2P52A 1UD3A 2X89A 3IPBA 1JXKA 3S2CA 3ZQ9A 3VDAA 1E28A 1XSKA 2M8XA 1UEMA 3FTGB 5DRZB 2ERJB 3FOLB 3FT2A 1QABA 3PWVA 3GS0A 1OZUA 5A2LH 1LK3L 3FFCE 4HZLB 4E9LA 5MENB 1J48A 1YO4A 1M71B 4A2MA 4BQ9A 4LEEA 4LOFA 4BK4A 1H8SA 4LSRH 5K9JH 5GGTH 4PY7A 2VXUL 3H0TB 1LLAA 1E9PA 3D51A 3ABLB 4RSYA 1CD1A 1JK9B 2DRUA 3PXJA 2GT9B 3C60A 1V7NH 3ATBA 4I1NB 3WFEL 4OLUH 5DFAA 4G71B 4PGCA 1IEAA 1KZYA 4UDUB 5BUGA 5DRNB 5AVZB 4FI7A 1A6AB 4QKTA 4ZS7H 4WV1B 2P1YA 1KDIA 4FTVE 5IIEB 5D93C 4JFZH 3RX5A 4HG4K 3X17A 4GG6E 4ELME 4KROB 4FQCH 2AVGA 4HFWA 1I7UB 3RILA 1ZGLA 4HS3B 4UI2A 1ZE3H 4BV1A 1J5OL 1KPUB 1DLHB 5EOQL 5BO0D 3JYCA 4UQ2B 1RZ8B 4K94C 2LGNA 3SSGA 4ALAH 1OV8A 3WGVB 3QE5A 3RWCA 1CC3A 3KPMB 1T1XA 2YQ2A 4OQ1A 2ATPB 1H3TA 3O6MH 4FLSA 5DO8A 4K3EL 2HT4C 1P1VA 2DIJA 4F91B 2P8PB 4HWUA 4S2SA 3I6KB 1T1XB 5DMIL 5J8OA 3FB6B 5I73B 5KSBA 4FXGA 2H1LM 3MR9B 5K9QI 1JV5A 4EUPG 2WUBH 2DQFB 1BM3L 4B7LA 3HNVH 1NOLA 1QFOA 2PO6B 1DQJB 1G4MA 3FFDA 1IAMA 3AABA 4JJOA 1PJ9A 3U9PH 3VDBA 2AXHA 4H2AA 4F7MA 1FAIL 1UGKA 3IE4A 4OTXL 3PWUA 3V6FA 4HEME 4C83A 5FF6B 3EJSA 3VGDA 3FCBA 3UBHA 2VB5A 2DWDB 4RMBA 1D5ZB 1XHHA 3VFGH 1AZRA 1P7QA 3TWCH 5F3HB 1Q72L 2LU4A 4UAOB 2Z93A 3R7RA 3VQ2C 3ULUC 4GAJH 1OPGH 4XPAL 1ROWA 3EJJX 1HFUA 4L1DA 4OZHF 5AZEH 3UZVB 1B9ZA 5DYFA 3RDTA 5IUCA 4KDVA 3EYUH 3X3FL 5C0CA 4LCWA 2MCPL 2XQYG 4LFHG 4JANB 1S7WA 1NFKA 4QPEA 1DBJH 4UQEA 1KGWA 5FYLH 1XGUB 5EH1A 1WA0X 3R8BB 1JCKA 2HFFB 2QSCH 3LNIA 2A9ML 2F19L 3SQRA 5TQ2H 2V3DA 4B3EA 5ALCL 4P4RA 3PYCA 4U1HB 4NUMA 4I4WB 3LTVA 3VFMA 2NXZB 3QJVB 5KBDA 2R1WA 5EOQH 3ECWA 4KKBC 4XXCC 3SKJL 2TSAA 3HRZB 5DVMA 1MDAA 5F7KC 4N0CD 1ZGLP 2PCFA 2WXQA 2XCMC 1PBYA 3WY3A 5D9SB 1VGKA 3FAXA 3CC5B 2IALB 3BPCB 1NL0L 3QDJB 2Z1KA 3BH9A 3GUTA 1GOFA 3UZEA 3QNYA 4KHTH 5IOPB 4TSBH 4ADGA 4JFOA 4X83A 1FNEA 4EIUA 5JW3L 2YD3A 1Z9SA 3BQVA 3ARDB 3QA3B 3S35H 1CGWA 4TXVB 5GGRA 1QFWI 1W8OA 1O6SB 3MU3A 2Y24A 2GBVA 1U91A 5JHDD 2VOTA 3Q06A 2E7LA 3NEOA 4MJID 5CMAA 3ARDC 4PRIA 2Q86A 5C7XH 4O51A 1NAMH 1QRNE 4X7SL 4D9LH 3HC3L 1MOEA 4RQQB 3MRLA 3QJZA 1QFWH 3IFLL 1AZCA 1FCCA 1SOXA 2ZOUA 4K4KA 1B2WL 3K74B 3P4NA 1A6TA 2PXYC 4IIZA 2JF1A 4GKZB 5J11C 4GSDL 5GRJH 4UF7C 2EKJA 2ZKXA 2QSTA 3NYKA 1DVFD 3EOBA 4G42A 3WAKA 1OP3K 1GGCL 4AY0A 5K59E 3B8YA 5ITBL 2F53B 5MERA 1EXHA 2W0PA 1G1YA 4X98A 2FQGA 4XMKH 1HQRB 5J7CC 1N3NB 4XPFL 3L7EB 2NQDA 4URKA 1MI5B 2XQYA 3GK8L 4QOKD 1KEGH 4L8SA 1N6QH 3O81A 2H41A 4RISH 1UVQB 4W93A 5EN2B 1A1NB 1N59B 5I1LA 1CL7H 3W9DA 5I8EB 3L1FA 3O6ML 1MJJB 1T2QH 5KYWA 3BVWA 1D9KA 4TULL 1CVSC 4O2FB 2WWMD 3HBPA 4ENZA 1LD9A 1PQZB 2J57A 4NC1C 4QRTA 1JD7A 2DI8A 5FFLA 1IARB 2PCPB 3HHSA 1H15A 5I6PA 1ACXA 1AGFB 2BNRA 3S96A 3TX4A 2W07B 4H8QA 5FA3A 4XNDA 5IJBC 4X8XA 3RU8L 1KJMA 3OXRB 4ZXBA 4UCFA 1F3DJ 1ZLUH 4HPOH 1AS8A 1NTDA 4M3JA 1XB8A 1CLCA 5DR5L 5BV7C 1UB6B 1Y18B 5ESVA 1NMCB 2V37A 4DKEH 1JWUB 1T04A 2QVKA 4TL4A 1L9NA 2H2SC 4OKVA 2CH8A 4ODXA 1FLRL 5EOCL 4X6EA 4UZSA 4YHZL 4JG1L 3BC9A 4B53A 5CXPA 2UV3A 4MJIB 3S4SB 5F72S 2IANB 1GYWA 4GAJL 1AD0A 4XPAH 3VU1A 4AEFA 4L37B 1FO0H 5KSBE 3MROB 4QEGA 4A7GF 2IPTH 4ABWA 3EJZD 2YAMA 4LQ1A 4EQ3A 1TJHL 3M46A 5HYJD 4FQ1H 3TTYA 2P7TA 2XQ0A 3I6GA 3KJ4C 3T0VA 5IQMA 3T0EA 3HPJA 1PG7L 3AG3B 1YC8A 1DVFB 4IMKC 2JB6A 1XAKA 1EERB 3C09B 3RJQB 1JNJA 3VFOA 3KWXA 1MXDA 4N0CC 5TH2B 3TBWB 4BFIB 2MKLC 1GJUA 2KH2B 1U95B 2R83A 3B2VL 3QW9A 3W9EA 3WNJA 4QNPE 3WL9B 1IQDA 4J3OH 1MLCB 5C07B 1PZSA 4WWKC 2YQGA 1G7HA 1M9WA 4NIYE 1NWPA 4FG6C 4G8IA 3B2DC 4JM2B 4JN2A 7CGTA 1MCNA 1GYCA 3MCYA 1DQDH 3LPWA 3L3HB 3WKMH 1F41A 3T0BA 4QRPA 4R4BB 3O6FA 4UQIM 4Z3EA 1VADA 1MH5B 4AV5A 1U8PA 2HRLA 5L9DL 2OTUB 2Z1PA 1FYHB 2BHZA 1D5XA 3IFNH 4IBYA 4YDKL 2MOQA 2QV2A 3LXBA 4HC1A 1FLRH 3RE0A 3Q8CA 1ASPA 4KQ4L 1LO3H 1XL6A 4EDWL 3F01A 3BW9A 1IM9B 3AQZA 1QFHA 4Y9BA 2ADGA 2UWEA 3BUDA 1RUAL 3HS0C 5F7AA 1JRHH 1CZ8L 2DV6A 3TA3C 1WFIA 4JHAH 5AAWC 2YUVA 5D55A 5DMIH 5C0JB 5E2WH 3HNSL 2W60A 4MVBC 4QCIA 2I25N 3BI9X 3OWEA 2EIKB 5FHAL 2IPKB 3NG5A 1FIGL 4FABL 2IXQB 4GBXC 1YN6B 5J6HA 1JSYA 2Y25A 1NGZA 2B3IA 2IH8A 1NCAH 1CTNA 3EO1A 2DI7A 4Z0XB 4F20A 5FUOL 4BRJA 2FSEA 1A8JH 4OJDH 4DQAA 4G70B 2C9VA 4P9HH 1V3KA 2A3TA 1KENL 1QATA 3NACL 1A7QH 4HBCH 1LWHA 1J7VR 5IW3A 4NAMA 4AYBA 4W9EC 2O26U 2M2DA 1J1PH 2JJSC 3IJEA 1ZVSA 2CO4A 1SF5A 2ITCA 2VXTH 2XA8L 3O0LA 2ZF9A 4NAJA 5GS3A 1QBLH 2ATKA 1GTNA 4H4NA 4I48A 1XF5A 1IGFH 1GZQA 2ITFA 1HDMA 2XPGA 3G04A 4IHOB 2XTJD 2YKLL 3NRFA 3O0RL 3NSYA 4Q4EA 4XP4H 1MXGA 1CICC 5GZOD 4PH8A 1RCYA 1TZAA 3MBWB 4PB9H 4X8CA 1FFNA 3ESNA 4S1SL 5HHXH 4GRLD 1I82A 5FYLL 4PJAF 2YBRA 4PJ5B 3MLVH 3QQ9D 3JUYA 1FHNA 1UCTA 1DUZA 4IOFC 1JZ4A 2CKBA 4J27A 1MVYA 5AQ0A 3MGTA 4ABQA 1ZVYA 3QAQA 3IAQA 3ZKNC 3E2HC 5CLWA 5D72H 3NFSL 3EFFA 1CK0H 3EJYC 5EU6B 1ILUA 3FT3B 4BCZA 1IQDB 2R23A 4LRIC 4RRPM 4XX5A 4KHTL 3RZCB 4AH2B 4XNUH 2AXGA 4QF1A 5BVJA 1XH0A 3V9EA 4EAEA 4OKVB 1U3HD 1HT6A 3I9AA 1ZRUA 3L3OB 2BP0B 2C1PA 2X0VA 2VM9A 4LHUD 4A7QA 5BPPA 2P5ED 3S3JA 3IDMA 3VB9A 4Q14A 4XHJC 1BQRA 3TF4A 1WAAE 3BGFC 2OMVA 4OCRL 5IBUB 3TFBA 2O5XL 2AW2A 4OLWL 5KAQG 1ZTXE 3ARBB 5IHUH 1WZ1L 5DEZA 2W07A 1QSFB 1HYRC 5GSVB 2GUYA 4Y9FA 1DN0A 1KC5L 1RZKH 4MJ2A 4MSWB 3K6SB 5CHNB 2C34A 1N7MH 3EUDA 3SJVD 3EYUL 3X3FH 1CI3M 5GGSY 3W0WA 3DYMA 3M8OL 2QGBA 2GIYA 4NC2B 4R3SB 3JTSA 3MRCB 4JFFA 3UIYA 5FHAH 3WBDA 2NY3C 5E23A 4X8JB 4W9FC 1UZ6F 1DL7H 4NRYB 2QTVA 1QRNA 4LPWA 5I5RA 3PV7A 2YAFA 5FYKH 3C6SA 4I9WD 3N40F 1YYMH 1B90A 3N43B 2YAHA 2EE2A 5FA3B 1DBAH 3T4AB 3VTTA 4AVHA 2PF6A 1UFGA 5MERB 3QUYA 1UXWA 1HHKB 3GI8H 3KGUA 2Z8VC 4P2CG 1NMBH 3FQRB 4FQIL 1W0YT 3OF6A 3X1EA 4HMDA 3N9GL 4R2GB 5I26A 5L4MA 5MEQA 3FB8B 2WZ0A 4RAVB 1LP9B 2HA1A 4NQEA 1UKQA 4GP4B 5T1KD 2OL3L 2YPLE 1WZMA 3STBA 1K8IA 1YECL 1AOHA 4PBDA 4CVZA 5CEXB 4UIKL 3VFPA 4N3TA 2VMFA 2A9NH 3ATAA 2I60L 4RA0C 2V8LA 3O4LB 3OAYK 2OXGA 5TJWK 3AQDA 3D3VE 2XTSA 1NKRA 2NZIA 1B0RB 3OX8A 2VISA 3MNZA 5C0IA 1XBDA 5GGRB 2EAEA 4PJGE 4X6BB 3WHXB 4L9LB 5K5YA 3L13A 3J7HA 1VFAA 2OZ4H 3L9YA 5DJZA 4B50A 1CBJA 15C8L 2OM5A 4F2ME 2AEIT 4KJQC 4L3CB 4R7LA 3RVTD 4D3CH 4XO5A 4RQQA 3TN0C 1AHMA 3ULUF 4XP5L 5ICUA 4F92B 1OM3L 2CGYA 3OLDA 1KGCD 4LCYB 3UPAA 4M93C 4X4YB 5D8JH 2A74B 2E59A 2XWJB 32C2A 4ZS6D 1BG1A 2O6FA 1R3KA 1W72L 4N2AA 4JKWA 3RNKB 5CU5A 3E6FB 4UOW1 4FTDA 3T3MF 2ZD0A 4M5YH 3K91A 3TH2T 1XF3B 4Z7OB 4X6DA 1R3IL 5IOPA 1JP5A 4Y7OC 4F7CB 4QRUB 4PS4H 5KW9L 1ZHBB 4BH7A 3B2UC 1JK8B 1VFOA 3QWQB 2OP4L 4PWHA 3R0MA 1HZHL 1WUZA 5DD0H 4WIQA 1E6JL 3B9EA 2CLVA 1E5BA 1WEJH 1SXCA 2WINB 5H8DA 4YFLI 2AJUL 1K4DB 5FHBL 3T65B 4J12A 1FYTE 1Z5LA 2EH8L 2H26A 3OKNB 5BNXD 2XU9A 2FO1A 1R3HB 3CVBA 4PP1C 4HUXB 4MXQD 5CGTA 3ARFB 5JPNC 1TTUA 1ROCA 4JY5H 3A23A 3KBHE 1I8KA 4G6AC 1JGEA 2VITA 4I85A 3IPFA 1P53A 1NZRA 5HHOD 3A5VA 3BGAA 4FTVA 4JDVA 5JOPD 1SOKA 5T3XE 4S0SD 3ARFC 4NHUB 1IGCH 4UB0H 4LPTA 2APVA 2X4TA 3GSUB 4FP8L 4XTRC 5JHLH 5EIIB 5C6PB 4TNFA 4LPCA 2HX7A 4HIEB 5E9AA 5HHVH 4DH2A 5EIQA 3WIIL 3N04A 2O5NA 1G7PA 2VSKB 1CDCA 1IUZA 4JMXA 4OQTH 4QXTA 3VXMA 4HF5L 4AQ1A 2WBKA 1M05A 1CE6B 1W72H 2WK2A 4G6KL 3ZKSD 4ZTPH 3ZZ1A 3NPSC 3JSSA 5HY9B 4FXGB 3HB3D 3QUXC 1HVXA 3SYQA 2FECI 1L9OA 1RL1A 1XZ0A 3B4NA 1G7PB 5TF1H 2R1YB 4NPYB 4PS4L 5A16A 1I7RA 1ICTA 3EHBB 5CN1A 1NLDL 2O6EA 1BVNP 4OI8A 1IGFL 1RJLA 3EOAA 3M1BA 5T3XL 4YDJA 3UBXG 5IK3B 5LDSA 4RH4A 1KCBA 2ZF8A 3BD4A 3VU2A 1B0GA 3KG5A 2QADC 4P23C 5A43C 5JXAH 4RCAA 1RJYA 2QMKA 4KXBA 3A0OA 2XN9E 43CAA 2Z4QA 2O6DA 3BKML 4HJ0D 3FTGA 4NFCA 1DQVA 1TJMA 4NX0A 3W2DL 1A9EA 4N6RB 1XFPA 2C9XA 2EDNA 5J11B 5E6SB 2H26B 1TYEB 3LZLA 2AJXL 5TK2A 4B9IA 5FUCE 2WKOF 2W92A 3BQUB 4WUUE 1UADC 3CSGA 2ZUQC 3NGBB 1ZSHA 4QRUA 3EDFA 4OCYL 1CD1B 5JLZB 3CSBA 3C6LC 1SLXA 1LM8V 4FTVB 2F9BT 5PAZA 5C6TL 1F6AB 4N9GA 2X4UB 2D03L 1ANUA 3POCA 1T2JA 1EO5A 1XIWC 4EDXB 4OIIL 3VWKB 1DJYA 2ICEA 1CFTB 1P1ZA 3SQOH 4XO9A 3WJMB 5BV7B 1CR9H 4LCVA 4JLRB 1HQ4A 3MA9L 1VGEL 1U6AH 3X2QB 4Y1AE 2C5DC 5HDQH 2BP3A 3GSNH 4JEGB 1YEEL 3QQ4A 2DW5A 1DCLA 4JFSA 1EVTC 4UTBL 2V9UA 4QXVA 3QDGE 3U1PA 1NGPL 2OQJB 3MLRL 1KB9J 3NABL 1Y6MR 1N7ML 4MMXC 1K8DA 5DK3A 4OZGB 3WFEH 1NSNH 4XWGL 5CD3B 2HTLC 3MLXH 1W72A 4NZUL 4OUUB 3HNVL 5E8NB 2I7OA 4N2EA 3H54A 4TQEH 5DGRA 5SX5K 1DE4A 4ODVH 4HCRA 4WTZA 4ANVA 2I07B 2BSEA 4BD4A 5EZOL 4WO4B 1OOAA 4L48A 1IM3D 3CQFA 1ZLVH 3VO0A 4GKOA 4KRPB 2D3VA 1ZEAL 1VJSA 4RFNC 3VFWB 1YNTF 1X5XA 1W0WA 3IRCA 4OGAC 3ULVE 1DQQB 2B3RA 3ELAT 1GVIA 4G7RB 4QJ3B 2FEDC 3FQ1A 2FATL 4LVOC 5EZLB 1FPTL 5FM8A 4QRBA 5LDUA 3HUJF 5F8QC 2K3TA 4YGAB 3WFHB 3INUH 1IRAY 4LPUA 1DFBH 1LQSR 2E5EA 3SGJA 4ZMLA 1YC7A 1TJIL 3HAEH 1J11A 4G8GE 5JW4R 4PWEA 4XP9H 5E0QA 5JIQA 4ZPVB 2XC8A 2IQ9H 4JKMA 3WEAA 3QIUA 4X5XA 4ORGA 4YVNA 4XMTA 1WBYB 5DQDL 5B1CA 4PAZA 4DW2H 4YBLB 3X13B 2Y06L 2YLHA 4JAMB 4NQXA 1MEXH 1ZHNA 4G6ML 5D7IE 4Q2ZA 1X5JA 3MRFA 2ILLA 3ULVL 1RZFL 1SDAB 1Q94B 3D85D 4JJ5B 1MIML 3WV0A 2O6PA 3HE6D 3CZFA 1SFHA 4C54A 3UMNA 3X1GA 1X5GA 2WVVA 1P7HL 4WNJA 3VQMA 2XN9D 4ETYA 1E65A 5IJDC 3SOBL 3TVMD 2BO0A 5TQ0H 5JUEL 3RVWD 2VLKA 5ID1B 1KXVA 4ZFOB 3QIWA 3C6SB 3IFOA 4HZAA 3LRHA 3PHOA 3ZY7A 4I89A 4OIFA 2YSSA 3SPVA 5BS0B 1SYVB 1PW3A 3IDMB 4XT1C 4R3SA 1ZJBA 2DH3A 2ARJQ 2KT6A 3VXOA 4KPHL 5IWLC 2AJSL 2J1WA 3WTWA 3GBLA 4H1LG 1XBRA 1R5IA 3T6QC 3MNVB 2M1KA 4OT1H 4OLEA 5D7IA 2VDQL 4KZEH 1WICA 2B1AH 2X89D 4IW4C 3RVUC 2Q3AA 4JFXB 4FLOA 1RV6X 4U1IA 5HHMB 1EDYA 3J2PA 1N26A 4CN6A 5IOKA 2FGZA 3P77B 2ZP0T 5CGMA 5MHSD 3WUZA 1WLGA 1Z0MA 3L95B 3JV5A 4P49A 1PY0A 12E8H 4M43H 1AZUA 1XIWA 4OSUH 2VKXA 1GOGA 4KVCL 1ZLWH 1E8ZA 1V5JA 1QPXA 1KLGB 2B1HL 3L3OA 4WI5A 2HKHH 4RAUA 2IBGA 1F4AA 1IGMH 2PYFB 3BIKA 4XVTL 1O7DC 1XF5B 1AIZA 2XTJB 2HKAA 3OAZK 5JOPE 1T03L 2J8HA 2HTLD 1AO7A 4KKRA 4S1QH 4PJAA 3ASWA 4P9MH 2QHLA 3K2UH 4FFZL 1OE1A 2YARA 3HR5A 5IEHA 4P3DA 1MIMH 2AHIA 3MLWL 5CJOL 3HC2A 3M17A 1VRSA 1G1KA 3K5RA 1H5BA 4QHMB 4R84A 3EH1A 5D1QA 1OKEA 1Z9OA 3Q2CA 1XX9C 3IKKA 3NZSA 4WKXA 4EUPH 5KSAC 3MRGA 4PBWD 2XJLA 3NJIA 4Y1SA 1A6VL 4Z0XA 1RK1A 4FX5A 1EK3A 3UEQA 2IXQA 3FS9A 4KPHH 2X6CA 3TBYB 1PD6A 2WXMA 1T22A 3GJEB 1MSPA 4OIBA 4JRYD 5E8OA 3NCYS 1C08A 4JY4A 4YVUA 1CGSH 4TVPD 3CXDL 2C3GA 3CTTA 3C8KB 1GJIA 2QL1A 4R2GD 5D7IF 3CFEA 4BQBA 3W38A 5FCUH 4NYLB 5H35B 4E5XA 3BZ4A 3QCTH 4A6YH 1J87A 1WITA 3UDWA 1CDUA 2WXNA 3F65A 2AAAA 5FDWB 1AGEA 4NKDB 4UQ3A 3HFFA 4ZZFA 1SJEA 5JIHA 4D0CB 5AWNH 3UJTH 4LKCB 2DYPD 5IV2B 1DBMH 4M48H 5IVOA 2FWOB 2IWFA 1MCIA 2ADFH 1VADB 4K8RD 4KI5C 4PFEA 3WXWH 3B5GA 1UZ8B 4HIIA 5ANME 4CSTA 1MW1A 4FP8H 4NSKB 5L2JB 2B39A 3BEWA 3TPUA 3ES6B 5FO8A 4NQCE 3GHEL 2ZAHA 1HH9B 4J3XA 3WS6C 4PJ5D 1LDSA 3KLHD 1G7HB 4ZSOB 1HHJB 1I1AA 1HEZA 1OQOA 5DMYA 2OPCA 1S7UB 5LXGL 3HMXH 2UZYA 3TIEA 3KCPA 2K6ZA 3OKOA 3SKMB 1AFVL 1WT5C 1TVBA 1AXSA 4FJYA 3HPJB 3D3VB 1QLFB 1HESA 4GP5B 3IAPA 1NC2D 3IVKA 2ZG2A 1TU2A 1CCZA 3ORJA 1F0LA 2BZCA 4M7JH 1MJUH 1DUYB 4NZ8A 4B9JA 1XIWB 4U6XB 4ERSL 3HG3A 3DI3B 4IEFA 4QGYA 1Z1WA 3MNWA 2QDVA 5C7ZA 4E9SA 1FUNA 4P46D 2CJUL 2CJSA 3DX9A 2LAGB 5E1HB 5ITFB 4H2CA 3DGGB 1FL3A 4PPTA 5FCUL 3PNRB 5BRZB 4FFVC 1BVKB 4B95C 4YDIL 4MLSA 3ZE2F 3WN6A 4FOMA 3P69A 1UGNA 3VXOB 3EGSB 1M9SA 2AJZB 3PY9A 4KKNA 3VVWA 3SPVB 2A4CA 3WTYA 3CLEH 4Z3TA 4PUBL 3ZZSA 3B34A 3CFEB 5JHBA 3AY2A 2P3YA 2B9AA 1KXQA 3OXRA 1DVYA 1RJZA 4JGUA 4TTDC 5I74B 2YUWA 3SKJH 1HNGA 5GIRA 5E8OB 4Z77A 3GRBA 2NY1D 1DQKA 1RUAH 2F8OA 3H7BA 1RSFA 2C7FA 4TNVK 4LEXH 3QT2A 4MCMA 4JFQA 4K3DH 1FDLH 1NBYB 4ONFL 2VJ8A 1PKQB 2DM7A 5KS9E 2P8MA 2ENJA 3DARA 2AQPA 4Y2LA 3EYSL 4PS7A 4P5MB 5GISL 1N0LB 4I18C 3K2IA 4MWFB 3TBVB 1QSED 1X9LA 2F58H 4EXPX 1AGCB 1IX2A 3U6RB 2J5LC 2WUCL 4G43A 2FD6L 1T0NA 3NSDA 3US0A 3NIFF 5EBMA 3CSYB 5AW7B 4OCLC 2N0MA 2AEPL 4ZRGA 3C5ZC 3EOBB 4G42B 4Z0BH 3V4PB 1S9YA 4HC1L 4LSVL 5E4OA 1PAMA 2KLRA 1NL0H 3HN3A 4FYRA 2X6BA 2CDFB 3C5ZB 5DF0A 3ASOB 3DVFA 1YEJL 4J3TA 2KKQA 5DEFB 1T1WA 2B8OT 2ZAIA 3TEWA 5EN2A 4N9OB 3OHMB 5IR1B 3LKNA 1YYLH 2WLYA 1P4BL 4IRJD 5EU7C 4YHLL 1JBJA 2XZQL 3AFLA 3BVUA 3HB3C 3HNTL 1QQDA 3BEVA 1NPJA 4H1LH 5TE4H 5F6IB 4NCC1 3WN5C 2EIJB 3IXAB 2MKWA 5FM5O 4PJBF 1H5BC 2ZCHL 1BX2B 1EBAA 2HSIA 4P4KD 2BVEA 5E8NA 1KGUA 4U1NB 2Z4TA 4XNXL 2ZNXA 2TSBA 4JM2F 5C0AD 4NZRL 4X6FA 2FYYA 1VPOL 5E2VH 1AACA 4G9DA 1EANA 4RGMB 2VR6A 1OAUL 3LKSA 4IRSB 1UCBL 4M1CD 2JXMB 3MRLB 3PJLA 3L5JA 3IMTA 3SYOA 4FQ1L 2QADB 4P23B 4XPFH 2IG2L 3P9WB 3CBKB 4DAGL 2AI0H 1BWMA 3KPNB 3MV9E 5H2BB 4E41E 3N41B 2B7DT 3BFWA 4QJ5B 3NAAH 3ZHLA 2ROXA 1TETL 3LH2H 5DRXA 4B6ZA 4F15B 3EHBC 4XHJD 2Q76A 5TE7L 5C9JA 5LN8A 3GUFA 3HBZA 2GW5A 3BIAX 3LRSA 4UM9A 4XCEB 4AW4A 4Z0BL 1X5LA 1QPKA 3NJKA 4Y16C 3UCQA 4M4RB 1VEOA 5D9SA 5I66B 3QORA 1U3YA 4AIZB 1TQCC 2FQDA 3BCDA 4F8NA 1ZANL 1MVFA 1ZV9A 1C5BH 3EGDB 2VMDA 4UIMB 4ADIA 2VLLA 1IZJA 2NX5B 4XR8C 1IAIL 2GJJA 3UYPA 4I3SL 1ID5I 2F74B 3RKDC 1HWGB 2AV7B 3DROB 3QPQC 2ESVB 1YQVL 4OGYH 3OMNB 2X4OB 3EJUA 3KYOA 1KN4H 5EO9B 4JFFE 3TO2A 1WFOA 1DJZA 1TR7A 4J6IA 4BFBD 3KLQA 2DL9A 5KVEE 1KIQB 5EZPA 2BS8A 9CGTA 3BSZL 2BSSA 4MB4A 3RDTB 2NNAB 2HJLA 4MTMA 2HB0A 4Q7DA 1FZOB 5FM5M 3OZLA 1NBVL 4GQPH 3T6VA 5ABDE 2VW7A 3FUFA 4HPYH 4LCCA 1NC4A 5IK3A 4JRXB 3SOTA 5SV4A 4X5WA 1E0OB 2R0KL 3L2MA 2OL3B 1QYGH 2V5MA 3MRPB 5GXBB 3ZYJA 3O8XA 4B7IA 3WFBL 1C5CL 4O2EA 1I7RB 2OSWA 4G7VL 2WXIA 4HS8H 1I7ZA 2AVFA 3FU6A 1L9MA 2HKFH 4FYTA 2LE9A 1BOGB 1DE4B 2CSPA 1M53A 2BZDA 4GMSH 1RZJH 3S97C 4LCWE 2CCVA 3NH7H 1HILB 1MIEL 4L2YA 4WEEA 3S5LG 3BWZA 4EDWH 5JZ7C 2P5EB 5HYJA 1K3IA 5J4MA 1MW2A 5DVNA 5ISZB 3B1UA 1CLVA 1K8DB 5F7YC 2Q20A 5LGHL 3VXUB 1FE8L 3ZMRA 1V7ML 1ZT1B 3QXAA 1NFIB 2B5IC 3PQYE 1JK9A 3O3AA 1A5FH 4X7TA 4HEPA 2NX5E 1A9EB 4JFHE 4MNQA 4HIPA 5HDBE 4GW1A 4EO5A 1NPUA 4JO8A 2VLJB 3GHPA 3WELA 3TV3H 2L04A 2Y22A 3TCXA 2F1AA 3W0WD 5G4NA 5HGDA 4A63A 2Q3ZA 4FXLA 5F3FA 1BEXA 1I8MB 4QHNB 3NJFA 4J3SA 4LLQA 4N9GB 1M7DA 2Y7SA 5B38A 2WLKA 3NIGE 4P2YA 3OMZA 3EOAB 3M1BB 4R7VA 3IWUA 4KKZA 15C8H 4Y5XC 1FFTB 1IC5H 3ETTA 3CGTA 3SE4A 1U3HA 1JPFA 1FH5H 1XZ0B 4AXWB 5I8KL 1JRHL 2SEBA 2BDNL 4O4YH 4F1SA 3B3BA 2P5EA 5HYJB 3LKRA 2QDWA 3RGVB 1DR9A 3QFJD 4NXKA 1J8HD 4JUSA 4P48A 4Z7UE 1S5IH 4LDLB 3RWEB 1G7QA 2Y6SC 4A6YL 3CHSA 3D08A 2G75A 1DSFL 4M4PA 4POZD 4KV5F 4QOKA 5B22A 4ELMA 5E99L 1RJYB 1GKOA 5DRZA 4Z95H 4NJAH 1E28B 4BZ2L 4ZAKD 4O2EB 2CM5A 2XICA 4FJZA 4PB0L 4A7UA 5DC4B 4YSCA 2CQVA 1RZJL 4OH2A 1IVLA 1W0VB 1JF1B 4MXQC 3UTQB 3MBEC 5JMRA 1TVHB 2EADA 4TLKA 3MRMB 5T1DH 2JI2A 3DETC 3K0YA 4FCHA 3O8XB 5EF0A 3V0FA 1FZOA 1HOEA 2R1YA 4NPYA 3MBEB 7FABH 1L6PA 2FUQA 3IDNB 5AALA 3UABA 3DX8A 4ZUTB 3LJ3A 3KDMB 3QI9D 4LLYA 3PU7A 3SEPA 3VXRD 3TGXA 3C12A 2QQQA 4QXGL 3MV8A 2WXHA 1YEWA 3ZR5A 1WBXA 3DROA 5DUML 1I7ZB 4NKIH 4OVVA 5DR5H 2XN9B 1EUTA 2ZPKL 3FCTB 3LRLA 3UGUA 1E5ZA 4ZBJA 5IBUG 1BJ1J 2Y7NA 3MV8E 2V9TA 3CCHA 4AIZA 1FG2A 1ACCA 4C4KT 3BT2L 5EIIA 1RPKA 3HS0A 4YL9A 2YPVL 3DBXB 5GS2H 3QORB 5CEXA 5FO9B 3L54A 1SLUA 2LHAA 1NCGA 2Y07L 4U1LB 3W11C 4PIRF 2YA0A 1XGTA 2IGTA 1XH3A 1FFOA 2IFGA 2OSLA 4MVBD 3FB8A 3U9WA 4AW7A 1T21A 1TZIA 3H53A 4G9FE 4AE0A 4LSPH 2QTEA 4EI0A 4NRZA 3S2AA 2XWBA 1OHZA 3ARQA 3DC0A 5KSAD 2NXYC 4S1DC 2FO4A 2GK0B 5L0QC 5EO0A 3O2DH 2FDBP 2FJGB 1R24A 5DZNA 2FBJH 5CWSA 3SDXB 1I53A 3U9UB 3M07A 3NIFB 4IRSA 3S3BB 4F7PA 1DN2A 3IMUA 5C0ND 2JJSA 3MCKA 3RTLA 4EVNB 5E03A 5D7JB 3EF4A 3UBXI 4N2HA 3RY4A 1AGBB 4L5FH 2VXVL 4NOFA 4WI6A 1UB5A 1CG9B 3L3KA 3SKNA 4HW6A 2VL4A 3ILPA 1UCBH 2Z7WA 1URZA 4JM0A 3WCYA 5HPMB 2G4EA 2CDGA 4HUMB 4L18A 4LPYA 1LDPL 1RUKL 2A9NL 1K4CA 2DLTA 3BKCH 3LZQA 5DUPL 5K39B 2NSXA 2YD6A 7PCYA 1L9RA 4GSQA 5EU5A 1X5IA 2NY4C 4KDTA 2I9TA 2NY4D 5TDPA 3LKNB 2A74A 32C2B 1I9EA 2XWJA 4HX1A 4LSTH 4HEPG 4LO9A 4HKZB 2WXPA 2X09A 3T8XA 4U1JA 1K8IB 5BS0E 1EGJA 1WWBX 3ZKMC 3OKDB 1IFRA 2B4CC 1BQSA 3TBSA 2UYLB 4AKPA 5B1JC 3P4MB 3RZCD 3QS2A 2FR4B 4H88H 4I7ZC 4D8PB 2W80C 1BX2A 3KLHC 4Q6KA 1VCAA 4YQXL 4WFEE 2X2UA 2YSTA 1YSOA 3IXAA 3V7AE 3FT3A 1JPTL 3TEYA 2V5TA 1HI6B 4N4YB 4G1MB 4NAQA 4BE6A 1I1FB 1J5DA 1UJTA 2AEQL 1IM3A 4PREB 3SDYL 1FIGH 3QS3A 4FABH 3N42F 1TOXA 3X1BA 4UOJA 5LGJB 4MAYC 2P46B 2QSCL 3SYAA 3SCMA 5F1OB 1WLHA 3CDZA 2E76C 4YDMA 4KUZL 4JHBA 4PI2A 2NR6C 2VXVH 2EDMA 4I0PD 2V7HA 1T6WA 4ZMQA 3LX9A 3I6LD 4KK9D 5INCA 2CDFA 4YHPA 3BVTA 4I13B 3A22A 1LNUA 3FO1A 3FQRA 1WZLA 2W9DH 4MRCA 4BK5A 3D4CA 1SJMA 1HHKA 4KITB 2C26A 2ZJSH 5EU4A 3DTXB 5M94B 3KWTA 5I24A 3BKYH 1ZVSB 2G30A 5JORA 3KPPB 4YIQA 2F54D 4B97A 1K5NA 3NJMA 2VNCA 2WW8A 1EXUB 4PY8J 3PQYD 4L05A 3ILQD 1KCRH 1NBQA 5ES4B 3RHWF 1EHLH 4Z78A 4WTXA 3BKJH 3HZMB 2BNQE 1KG0B 4DHLA 1L7TH 1V7MH 3RRQA 1RURH 3EO9H 1N8ZA 3VH8B 1DVFC 1LYQA 5IMLB 3MGTB 5C3IA 4Y5VB 3QYNA 1RJZB 3VE0B 5HJDA 3QNZB 2ZYRA 3L3DB 4KBPA 4PG2A 2YA2A 1TVBB 1VACB 4LEOB 2Y2TA 3C08L 3ABZA 1XT5A 3WE6B 4CN1A 1V8HA 5FLVA 3UZEC 3N41F 5C0BE 4K2UL 5C0CE 3SE9H 2XBTA 1WZ1H 4L8SC 3WEMA 3UO8B 3U4AA 3ZX1A 3K72B 1KYOK 1I8LA 2L4OA 4Q9RH 2PW2A 1H3PL 2HJFB 3F04A 3KXFD 1BVLA 3VYPA 1BGXH 1MVUA 4EI5B 1CICA 4LRNH 3E80A 4ZTEA 1HE8A 4FFYH 3QUML 3TN0D 4PGJA 3ELQA 1CFBA 4RBPH 1H0DA 3B2PA 2VDOH 3P0YL 2PYED 4HIIB 2CO1A 3UP6A 1XD0A 3V8CA 3SBWA 1FVCA 1NC2B 5HHME 1BQHA 3T1FA 2JNZA 3MUGB 1J5OH 1AZBA 2CALA 5C8JB 4GUCA 3BZ4B 3F7LA 3POHA 4NQVB 2D3JA 1MFMA 4WUUB 3NZHL 2CBOA 4ZDHA 4CW1A 4DEWA 4Q9CA 4AYGA 3V10A 5SX4I 1ZCRA 2PMZA 1VACA 3QNXB 4Z7VE 2XZAL 5HDOA 3OKMB 4WU7A 2UX7A 2X42A 3QRBA 1AI1L 3RWHA 1OP5K 3QEUA 3KYNA 4KJYB 4XB3A 4U2ZA 1U41A 3EJYD 5H37A 2YPVA 5GRUH 4OJFL 3PXLA 1JV2B 4WU7B 2YOAA 4NNXB 4J6RH 3KPRD 2MIZA 2ICWJ 2MNJB 1F1DA 4JR9H 5D1XC 1MQKL 5T1LA 2IGLA 3TBYA 3FUEA 1OCWH 3CZEA 1OGAB 3PWLA 4QTHB 5EEYA 4H8HA 2NY5C 3CH1B 4U6HA 2C7UA 1OM9A 4XCCL 5DA4A 3AUVA 5AW4B 3LN5A 4UNVA 4W9GC 5DURD 4R96B 5E6UB 1GKEA 2VDKL 3ESVF 3U30C 1E5CA 4F2FA 3MLZH 4A2HA 1CDBA 1P4BH 1H0DB 2VR5A 4U1SA 5F1IB 1CVRA 3CPUA 3QEQA 4N22A 5KVFL 4JQVC 5HDQL 1P7BA 2BM3A 5EO1A 5LNEA 3VJ6A 2HT2C 2A2QT 4FFWD 4DGVH 2HT2D 4FFWC 3SDDA 2BSBA 3ISRA 2W9DL 1AO7B 2YZ8A 1WH0A 1B88A 3WIHA 1G9NC 3OR6A 2IWEA 2IDTA 3WE6A 4N3UA 4FA7B 3EH5B 4U3SA 2JB6B 3ZDYF 4IU2A 3LV3A 1X3DA 4KI1A 2XKSA 5D1QB 1AE6H 3NFNB 1KXQE 1KBGH 3OZKA 5FKPA 3O6FB 3SCMB 4CJ0A 3DX4A 4JFFD 3IMSA 2NTSP 2BOCB 3NDZE 3UZQB 2D9QB 2IOMA 3IMWA 1DJGA 1YEEH 3CIAA 4Z1PA 3IETA 3QQ3B 3PHSA 4D9QE 3VD2A 2KDYA 2ZE0A 3BO8A 1LO4L 4JL1A 5F1SA 1TQCB 3TBTB 4P5TB 2R4SL 2IANA 3U2HA 2DQUL 2J8UE 4U1IB 1I8IA 2F6AA 3C2AL 3OGCA 4MMZA 4QRSB 5FK9A 1QZNA 4M1GL 3CU7A 5IROC 3DMMA 4WTZG 5JIDA 4ORZC 5IVXA 1GCYA 3MXWH 4AJYV 3HOGA 4OZ4A 4YSUA 2TRHA 1JI1A 3KL5A 1MG3C 1DVTA 3MUJA 5MEOB 2QSVA 1YMME 4I3SH 3LN4B 3WY4A 2GJPA 2WQ8A 2AK4A 2Z8WC 2VR4A 2QFRA 1NCNA 4N2DA 2Y3AA 2IQAB 1FFPA 1N12A 5D2NA 4XC1L 5DQJA 1KXVC 2WQSA 4Z7OE 3WTXA 2V5YA 3MJ7A 3H1ZA 4FXTA 3FO1B 4DGVL 4YHOL 5IHZB 2MWCA 4FMKA 1MJJA 4LEXL 4ACPA 2WOYA 5HYSA 1UM4L 2AF2A 3KYAA 4HJEA 4L4VD 5F7BA 1RUML 2OMTB 2YKLH 3IWVA 4HKXA 3N1PC 2WQVA 4JRXD 1FGVH 1AS6A 4UBDD 2WGXA 1I4FA 3KW8A 2DLFL 3HRZA 1X5ZA 2Z7YA 5A2AA 3L3IB 4CL7A 3OHXA 3DWTA 4Y7MA 5IQ7L 5F93C 1KIPA 3VI4F 3O2VH 1XGUA 3AS2A 3IJSB 3GGWB 1GYUA 3QWOA 4HH9A 2R4RH 2QELA 3OWRA 4JW3A 5EC1B 3V6OA 2WYHA 4APXB 4H8WL 3QUHA 4TN9A 2AFNA 4JG0L 1DQQA 5AG9A 1MG2C 2A0LD 2FWLB 2RGSA 1E5UI 4TVUA 2IGFH 1WHPA 2PW1A 4NZJA 1GZHA 4JAMA 1E4WH 1KGCE 4TQIA 3ZTEA 5B8CA 5FO7B 1NBZA 4B9ZA 2EEXA 5L7XL 3BMWA 4KQ0A 3FO2A 2XG5B 5E5MA 1UQSB 1E6JH 1NCUA 3LKOA 1TUPA 4C56A 4IJ3C 4PWIA 2MPVA 2N0KA 3D1MC 4POYA 4CVWA 3CCHB 1IEBA 4XMPH 5T3ZE 2QZQA 2DWDA 2XFXA 3H6JA 1G6RH 4I3RH 3IEAA 4B60A 3F7YA 1WGVA 5T3ZD 5K9QG 4YUEL 4N8CL 3NZ8B 1CXEA 4QLRA 3UCRA 3P0VH 1A6TB 3PWJB 4QRAA 3IGAA 4G8AC 3RWDA 4PJAE 1KB5B 1H3VA 1E67A 4WSGA 1BVNT 2WWKT 1M1XA 1I7TB 2GHWB 2VDNH 5F6HJ 1TQBB 4ZNEA 3ZDXF 5D1ZA 3AUWB 4NWUH 2FGWL 3A6CH 5FW7A 2CNYA 1KTLB 1QI3A 4OQTA 4MD0B 1HQ4B 2C4FT 4R0LA 2NNCA 8FABB 1J12A 2CO6A 4LAQL 1SBSH 2CHXA 5AOJA 2WZ6A 2P5WD 1U36A 3FRPA 2RJMA 4I1PA 4WSKA 1MWOA 4N8UA 4AOFA 5E8DL 1S7QB 5I74C 1INDH 3W39A 4ZTOH 3HIZA 1CD8A 4Y19D 4PGBB 5K9KB 4UQ9A 1O0VA 4GXUN 4OR1A 3UZVA 1OWWA 4AYDC 5CD3A 3TWCL 4HFWB 3WTSA 1UWGH 3QDJA 1ONQA 2DTSA 5IIEA 3TYFA 1ZOXA 3BGMA 1OXYA 4O2CB 1JPGA 3LKRB 3IU3B 3RGVA 2V7NB 3PNWB 5ADOL 2VO8A 4KX7A 5A6MA 3KPLA 3AJ7A 5D2NC 1TQTA 2X7LA 1JZJA 4FQ2H 1AQKH 1WBXB 5I1GL 3MV8B 1UATA 2XVKA 3FOMB 5CP3H 3DPDA 1T20B 2BSTB 1YNTB 4KUCD 1A2YB 2A6JB 3GYRA 2A6IA 1KV7A 4OV5A 2ED6A 3ECQA 3S48A 1ZS8B 1TZGH 1VGEH 3EH2A 1DQJA 2C1OA 2R0WH 3ECBA 3FFDB 1F6AA 5EORL 3UC2A 4UTAL 5I28A 1SZNA 5LGYA 4PBVC 1ZHLB 1JV5B 4DSYA 3RWIA 2HLEB 3EHBD 1C16A 3GRGA 5IQOA 3WJLA 4LXFA 3QULA 1KCUL 1S46A 1P5UB 2P5WA 5BMFH 3MMEA 3QDJE 5AL8A 3WFZA 3DSFL 3ARSA 4PS3A 4R4FH 1DHKA 1YUHB 4RMWA 1INQA 2DQDL 1ZT1A 4Y16D 5KYYA 2F5AL 3I02B 1K72A 3UJIL 4ZS6C 1NCAL 1OALA 4BFGA 4I2XE 2EH7H 3TJHC 5DJDB 2WANA 2E9IA 1BXXA 3CFDA 4LCIH 4ENED 3QQDA 3HMXL 3K6FA 3H3PH 4DUVA 2NMSA 3QIUD 3V4UL 3PWUB 4GKNB 3MGOA 4Z7OF 2VXSH 3WTVA 2VDNB 4WV1A 2P24B 1INQB 4QT5A 2DQCL 2QKIA 2PTTA 5JNYA 4QXTB 4V11A 1MI5D 4YDJB 3VMNA 5GGTL 1PZ5A 5CS7A 2IADA 3ZUNC 2ZKWA 2W0LA 3P0VL 3P1VA 4HIEA 2ZUTA 3U30B 5KZCB 1UWGL 1RZFH 4JFPA 1AQHA 4G8FA 4QKXB 4Q52A 2DWXA 2O4EA 1IB5A 4JRYE 1A9VA 4AX3A 1FCGA 1KTDA 1EHKB 1JGDB 5CIPB 2F61A 2J3SA 1JVOA 2WO3B 2P44B 1TCRA 7TAAA 3C60C 4UT9H 3NCEB 1F2XK 1D7FA 2Q8AL 5HYEA 3KBFA 4MJ4A 1BDYA 4RWYL 4FKHA 3WJLC 3QZLA 4Y9CA 3TWYA 1R3HA 2DQEH 1N6QL 1S7VB 1QEWA 2ESVA 1FRGH 2BSDA 3VB8A 1N2RA 1PMYA 4EOWH 1YY8A 3X12A 3JV4A 2FEDD 1GXEA 2Q2LA 1L9QA 2WNXA 2Z31B 5DRWB 4J6RL 1JK8A 1OPOA 3LEYL 4M7KH 4L8DB 1P84K 1JPGB 5AYUH 5K9KA 1HZHH 1JNNH 2VMEA 3I2CH 3WO3B 4AV0A 5ID0B 5JHLL 5I0DA 5D1XE 3IDXH 3CG8A 1VZGA 1E3FA 2HYMA 1A3RH 3ARWA 1V3MA 1NANH 3ZO0A 1FVEB 3JTTA 3GIVA 4XE5B 2BWIA 2PR9A 5DRXB 1J1OL 4DK5A 5DFVC 3ZT5A 3FRPG 2VL5B 1GZHC 2A7BA 3U1SL 4XC1H 3L1EA 1OT2A 4WHYG 3W81A 4YSAA 1M1XB 3TJEH 2KZ1B 4DGYL 1NC4B 1ILSA 2VDQB 4DW2L 4XBEH 3FO0H 2NNFA 3E6HA 3V6OC 4N87A 5I23A 3PWJA 5EU6D 1JPSL 4OLXH 3GO1H 5MHSE 3FB7B 2HJLB 1AP2B 3THML 5FW8A 2CMRL 3H6AA 3OKKA 1XH1A 3NEEA 3WS6A 4DP1X 4EZMA 5SWQA 4OBSA 4PJ6A 4QRRA 4Q9QL 1JDAA 3L81A 4KRPC 5IP4A 3SYCA 1T1YB 4Y4HD 3T2PA 2X4OA 4N25A 1WSST 3F7YB 2AQNA 3TNNA 4A2GA 4ZODA 3OJVC 1ZLSH 2XFXB 2DM3A 4Z6AT 3V6BR 1OCRB 2F1BA 5CJ5A 4XGZA 5TDNB 2GFBB 2H3NA 3C9NA 3GSWB 3QDAA 1UH2A 1C7SA 4BSVB 3AXLB 2NDFA 4FG0A 2ZSWB 2ZXDA 3CHPA 4WWPA 3EIFA 2GSGA 3UOAB 2WNGA 3S7GA 2WNKA 1NBCA 3OG4B 4P2RE 1U8IB 5CU9A 1T89A 5FOBA 1NEPA 3QWNA 2CRMA 1YAZA 4P9ML 4DZBA 3M86A 4PGZA 2WSPA 3VYOA 3DURB 3US9A 5CBAB 5DC9B 1BZDA 4Y4KD 3MOBL 4HWZB 4MCZA 1KNOA 3SQOL 1DBML 2EYTA 2WSKA 2OXGB 4N8VG 1P0SE 4BQ8A 3L1OH 4IOIA 5L6YL 1IEHA 1S7RB 1SM3H 1KV3A 4L4JA 4AGQA 2YD2A 3TBVA 1PJWA 3FH8A 2FX9L 3QUZB 3VXPB 1LE9B 4KMTH 4EZLA 2MTPA 5DJ8A 3DI2B 1BFSA 3JTSB 4YC2B 2WQXA 1N0XL 3VUAA 4JGJA 4KTDH 3ARBA 2F18A 1N5YL 1PEZA 1GR7A 4PEEA 3AMLA 3PE9A 5HYQB 4Y5XB 4LSPL 2PXYA 3D50A 3KHQA 1M7IA 4F8TA 2JTYA 5GGSA 1NCDH 1XV8A 3FU3A 1XB6A 5C0AA 5IJKA 4IGBA 1IL1A 1WFTA 4AJWA 3JXAA 2K45A 5IVXB 2WC7A 5DEGB 5KN5B 1R5VA 2MHAA 4HJ1A 5HJGA 2VKWA 2XZZA 5JPMA 3X1NA 5F1KC 3LH8A 2DD8H 4A66A 3EJQA 1CXKA 1QBBA 2E46A 4OJFH 4HLEA 4LSDA 4CSZA 3NFPB 3O45B 3TBTA 4CC4A 1AI1H 3GBDA 4UM9D 1DN0B 3JZYA 4GG8B 4JFTA 3V6ZB 1U8NB 2H7WA 1JAEA 4FERA 4O58L 1BQLH 4WEMB 4ZFZA 4W4OA 1QNIA 3GFUA 1INEL 3RFZA 2ADJB 3HG4A 3U6RA 2C3WA 3QFGA 4X6DE 2G3XA 4KO5A 4HS8L 4TUOB 3UTPD 3B43A 1JUFB 3KYKH 1CU4H 5I8OL 4AV4A 3B2MA 3QCVH 3SPJA 2A4ZA 2CHWA 2G60L 2HFEA 2TRYA 4ZOAA 2H32B 1PZ2A 2RFXA 2V3EA 3RZCA 1NEZB 1EZVX 2EEAA 1AO7D 2ZX7A 4LSSL 1OE3A 5EU6A 1RK0B 1JPSH 1UZGA 2DJMA 4NKMB 4OLXL 1PD1A 2DYPA 2A9CA 4P4KC 2E6QA 3MRJB 1UD8A 4JZJA 4K7PH 3K8MA 4NSKA 2NNXA 3LQAC 2OR7A 1K3ZA 3BVVA 4XX1G 4Q0XL 5F88A 2E9JA 3QC5X 5IQNA 4BWWA 3GMLA 4NM8H 1OT4A 2RAMA 1M56B 1RIUH 1U8QA 3BP4A 4UNUA 5F9WC 3QJHA 5J9PA 4W81A 2VLKE 2BX5A 4AQOA 5JA9A 3P3YA 5D7JC 4X5PA 3GBNL 1BF2A 4MCYA 4TRPH 1FFRA 1HEJC 4N24A 5KVGH 3V0GA 3SODB 5I6OA 2YKKA 4XC3H 3UYRH 5EMYA 1IM9D 5FUZH 4U6XA 4XP1L 1GIGH 1CLOH 2A1WH 4LVHB 1C12A 3UO1H 4J5VA 3BE1H 3GMRB 2H6UA 1A3QA 4P07A 4YSRA 4GQQA 4JO4H 1HL9A 4ZDHB 2VC2H 3T77A 3TV3L 4CW1B 1U0QA 2ADGB 2WO4A 1F4WH 4MCYB 1BQLL 3X14B 2EIBA 2OMXB 5GS0H 4K9JA 1N64H 4BUHA 4WJKB 3RFZC 1G0DA 3TONA 2C8NA 4QRPB 1T0MB 1NGZB 1YJDL 2IV9A 4BUGA 4JCLA 1NCOA 4FXGC 4EI6B 2WXJA 3TO4A 2RR3A 2ARJB 1ZPUA 3DUUA 5GS1B 1JWMB 4PJ7E 1HHHA 2ETWA 2G60H 1I85C 3ARYA 3CUPB 4ZMNA 2FNBA 4BQ6A 2A0LC 3SKOA 3AC0A 4NC0B 3TFKC 3IU4L 4PLNC 3L6FA 3CFJB 1X5HA 1SEQL 5C6TH 1H6EA 5DFWH 5DMGC 4K8RH 3S5ZA 5DZAA 3T6WA 4OCYH 1M3JA 2AQQA 4PRPA 4NKDA 3KWWA 3CFQA 2FRGP 4QIRA 3UJJH 2WBXA 1KF9B 1KFGA 2XY1A 5ADPH 2D2OA 5L4JA 2HFEB 4H25A 1YYLL 4MDIB 4ZO9A 1IC4H 4AIXA 2QBWA 2WWNA 4W68A 4XVUD 4NYLA 2YD8A 4K5MA 4Y2DB 1IKFL 2V9RA 4IYKA 4MQXC 5HVFB 3UPRB 4G7YH 4MXWH 5D5ME 4GG6F 3Q8EA 1EZVY 4U2YA 2WQUA 3VXSB 4YPGB 3WMPA 2VAAA 1DJSA 5I0VA 3Q3GA 5K9OB 1DJIA 4APQC 3MROA 1H9DA 3AWGA 3DDGA 5AOIA 3VE0A 3LZPA 2G3MA 4DFIA 2HUHA 3GSOA 3LIZA 5E4EC 2QVIA 5E1GA 1FG9C 1RUQL 2KBGA 2PCXA 5L88H 1EBPA 5J57B 1NFDA 2X4QB 4PJXA 1TXKA 5F21B 3RI5F 3TBWA 4GOSA 4BFIA 5I1JH 3G6JB 3QDGA 3WXVL 1IBGL 1T5KA 1X4XA 2H1PH 4AUUA 4RGOH 2XY2A 4M6OL 5AVQB 3SIKA 4Y1AA 1R34A 1GC1L 4OI7A 3A67L 5DU7A 2VLRB 1AHWB 5JIPA 4YIQB 3UGEA 1IAII 5E7BA 1RLBA 2ADIA 1JCVA 5DD6B 3ZMNA 4IOFD 4XBPB 2JVUA 5AB9A 4MDIA 4OFDA 5I71C 4MDJB 5HI5D 1LNUB 5F0LB 2DPKA 4B96A 5FGRA 5IJKC 1IGYA 4DP8X 5F71A 1URLA 3MRBB 4H8VA 4I18A 3NFSH 3V0EA 3QQXA 3WIHH 2FGWH 3QUZD 4HCIA 3N3EA 3GC3A 4XXDB 5EBWA 4GINA 4GAYA 4NN5B 5KYWB 3CX5K 2V17H 2WTPA 1MFCL 3UAEA 5B1BB 4AL8C 3PAUA 3NIDF 1I8AA 3JWOL 3DUUB 5GS1A 2W1NA 4POZC 3MACL 1LE5B 3IDGA 4GRMB 2K7QA 4GKSB 1T0MA 1BF8A 4JFEB 4LOUD 3FO0L 1FL5B 3KJ4B 5A7EA 4BIKA 1QHPA 5EF3A 5TDOB 5KVDE 4F7TA 2OR9H 1KMGA 5HVWA 3C8DA 3N1QC 1BEYL 3QJFA 1UOLA 5LGHH 2CKBH 4OFKA 3FSVA 1ZAGA 3SDCD 3L45A 3L4YA 3R06B 1RVFL 4UINL 4ZS7L 5ICZA 2FECL 4AMKL 5CUSL 2R56L 3SDAA 3D87B 1B4LA 4FNQA 3KM1A 2WXGA 5AFAA 2CO2A 4ZMXA 1J5CA 3QA3A 3V0IA 3VD1A 3S9DB 1CDHA 3HKFA 2BMKB 4KJWC 3AS0A 1R47A 6CGTA 2IAND 2FB4L 1F3JB 2KZKA 3QNYB 3ZTNH 1U8CA 2Y7QB 3HUJE 4CRPA 4DESA 2Q8BL 1U4EA 3EH3B 3BPCA 1Z9SB 1QACA 4E9VA 4EVNA 3QHTC 1SVBA 1JFQL 2BLFA 3BH9B 3T08A 3GUTB 2L3BA 4QAMB 1UM4H 4DK6A 3TBCA 4CC0A 4GIPD 2XNAA 4X4ZA