5GZNC

Structure of neutralizing antibody bound to zika envelope protein
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
227
structure length
223
Chain Sequence
b'EVQLVESGGGVVQPGRSLRLSCAASGFTFSSYAMHWVRQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDNSKSTLYLQMNNLRAEDTAVYYCARDHLGWSSIWSAPESFLDYWGQGTLVTVSSASTKGPSVFPLAPSSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Genome polyprotein
publication title Molecular determinants of human neutralizing antibodies isolated from a patient infected with Zika virus
pubmed doi rcsb
source organism Zika virus
molecule tags Viral protein/immune system
total genus 42
structure length 223
sequence length 227
chains with identical sequence H
ec nomenclature
pdb deposition date 2016-09-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5gznC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5gznC01
1DUYB 4UTAL 4I2XA 4KXZI 4MD0B 1W0VB 1DE4A 3VXSD 4LSSH 4JZOA 3RNKB 3MRPB 1TZIA 3MRQA 4N0UE 4HS6A 4HC1H 1CQYA 4X99A 2JJWA 1S7TB 4O9HH 2AERT 2CK0H 1UACL 1QBLL 3MSPA 4LLDA 3HAEG 4EIGB 1MI5E 4QHNA 3MRDA 3G6AB 3JTSB 4Z7VA 3RVVD 1E4KC 4PGCB 1FRGL 1F3RB 1EEYA 4RFNC 1HOCA 1P9MA 2AJUL 5BV7L 3QDGE 1BFSA 3HC3L 5ALCH 4TPRL 5DC0A 3RNQA 4MX7A 5I73C 5HYQA 3H9SE 4RISL 4FTVA 1JWSA 3S7GA 4GAJH 3O3AB 4XWOD 3U1SL 4DZ8A 5L2KB 3CDYA 1Q72H 5EA0H 4X9IA 2UYLA 4UBDC 6FABL 4UIKL 3KXFE 4XVJL 4HIEB 4O2FB 5DD3H 3MLRL 2CDGB 1YEEL 3NA9L 1QEWB 1BQLL 1OT2A 2IGFL 4BQBA 3CLEL 4PRHE 1MPAL 3FHQA 4IDJH 2X9XA 5FCSH 2EC8A 3MCLH 3RAJH 3QDJD 4O2EA 1SJEB 4MQSB 3ET9F 4KHXH 4WWKD 1WCQA 2NY1B 1SJHA 1V3LA 2C1PB 3C60A 1IE5A 5J1AA 4KWUA 1LEGB 3VWKC 4EQ2A 1MCFA 5B39B 5C8JB 4M9OA 2H2PC 2VTFA 3MV8E 4W4OA 2CLVA 5I9QC 5BQ7B 2IANE 4JJ5B 4EI5C 3QIBA 3MRFA 5DHVA 5IVZA 3U7YL 4PBVC 2L7UA 5C0AB 4Q2ZB 3GUTA 5DFVD 1JWUB 1F4HA 4NDMA 4EKXA 4JPWL 3MYZA 1BBDH 3LKOA 4ONOA 1XF2B 3SBWC 2EDKA 2GT9A 3EGSA 4LHUD 5ETUA 3TVMA 1NAMH 5FUZH 2R1WB 3MMEB 3RVXC 5C1MB 3FB6B 2VH5H 1CLZL 1MJ7L 3LPWA 3PV6B 4JFFE 2F58H 4PJIE 5DHXB 4MB5A 5SWZA 3U30C 3QNZA 1KPVB 3BPNB 2PXYC 2GUOA 3ZL4L 4KY1L 5DYOB 1MJ8H 5GGUA 1JK8B 3DVGA 4P46B 1ZLUH 4RAUB 1CI5A 3VFWB 3JVGC 1IGMH 4D3CL 3B2UC 2I9TA 3MCKA 1BQSA 5KSBA 4XNMB 3ZYZA 1A6VH 3SO3B 3KJ6L 3U6RB 3G5YA 4ZUWA 3LEXB 3Q3GB 5E4EB 2NW3B 3WL9B 4MWFB 3T0XA 3PWJA 1G9ML 4ODHL 4PREA 5B3NA 3ZT7A 5DUBB 2KZ1B 3ARYA 5FHAH 3P9LB 1T2QH 5EIIB 3QG7H 4WTXA 4IS6B 4M1DL 2X1QA 2J8UA 5T3XD 3OJDB 1GOFA 3P77B 4HKZB 3BDBA 4J3UA 1NQBA 3QT2A 1J0ZA 4L3CA 4PJ9B 5EO1A 5D1QD 3L1OL 5E5MA 2X4OB 3FB5A 4OZIE 3WHXB 3QJFA 4Y4FC 5FDYA 4BQCA 5J89A 1A47A 3HCVA 4QCIB 5IEHA 1E4XL 2OTUB 1XMWA 5BMFH 3IJSB 3MOAH 4PG9B 3P9MA 2WBJA 1ACYL 1MREH 1CICA 4U05A 1JZ4A 2HLFC 3T0DA 4Y2DC 2ZJSH 4X5WB 5JOEA 1FL3B 4I0PC 3UEZA 1YY9C 3GMRA 1H5BC 3VGFA 4TTDC 5LAXB 1GZPB 5C70A 3QIWC 3T09A 4D0DA 1TNMA 2Q20A 1TZHB 3E8UH 1I4FB 4HKXB 2ILLA 3EZJB 1C12A 2GCYB 1FFOB 3HS0B 1KBGH 4U6XA 4PY8J 1NBVH 2LV4A 5FGBA 4HIHA 1I7TB 3TT1H 5A2JH 1U8JA 2EO9A 2M2DA 2FBOJ 2FGWL 4F8QA 4IM8A 2R69L 4MD5A 3NACL 2DQGL 5SX5H 4ONHA 1ZVYA 1BFVH 1E6JL 1QKZL 5IM7B 3NABH 2DQCL 1IL1B 5I1IL 2D7NA 3ULSB 3KPRB 3CIQA 5C08D 4NQVA 3IDXH 2NMSA 3LRSA 3FOMA 4YUEH 1QSFB 3ULUL 4DUWA 4M1CC 2PO6B 4L4TA 3T08A 1G0XA 5TE6H 4RGMB 4A6YA 5I8CB 3S35H 4QXTB 4M7LL 4JO4H 2V17L 3DYOA 4L29B 4NHUA 5DO2D 3UTQB 4U1SB 2HP4A 4JPKL 2A9ML 2J4WL 5C9JB 5JORA 5JXED 3CC5B 3S4SB 5L0QB 3HKFA 2XI9A 2OZ4A 5ERWB 4XXCC 3X17A 4WUUA 5CZXD 2YPKA 4KKBD 2L4OA 3L7FA 3MV11 5I8EB 2C3XA 2RCSL 5I8KH 3UO1H 5DK3A 5E2WL 5F7WC 3ARDC 5TF1H 4PBWD 5IB2B 5IROC 4S2SA 4L4JA 3QJHB 3QI9B 2NXYD 2A6IB 3MRLB 1B88A 1L6ZA 1LK2B 1CD0A 3MNZB 3NGBB 4M61B 4YDVA 3REVB 3AU1A 5J7CC 3PXJA 5DK0A 2DD8L 2R1XA 3SDCC 4PJCB 3B6SB 1T04A 4MSWB 4GRLC 5F96L 2VNCA 3D69B 3QBTB 1KLUB 1TFHA 4OGAC 4P23B 5EUOB 2ORBH 1KC5H 5ESVB 2NYYC 1KGCE 4FTVE 3LQAH 3VXRB 3MODH 2AK4A 3WKMH 3EBAA 3LKRB 3VXOB 4LIQE 4X6FA 3VG0H 2C3VA 1BLNA 5TE7L 1F90H 2VDKH 1UM5H 4DW2H 1NGPH 4GKSA 4O2CA 4PJAE 1BD2D 1B90A 1CFNB 5B39G 2EIBA 3SKMB 4CMHB 3EW3B 3JWOC 1NAKH 3FONB 3PWNB 5HHPA 4JFPA 3LPGA 5BRZD 3VI4F 5KVEH 2NNAB 4M1GH 3FT3A 3BPLC 2FCBA 5BXFA 3P4OB 4QRTA 1CK0H 1T6VN 2ZOLA 1QR1B 3BW9B 1I7RB 43CAA 2LTQB 4KTDL 4HUUB 4ODWB 1N26A 2UUDK 4HKBA 2NXZC 4NYLB 5FM5M 1I1FA 2FWOA 1A14H 1XR9A 1ZXQA 1K3ZA 1SVCP 2EDHA 3ZKXC 1QPPA 3VXME 3GMOB 2W9LA 5T1MB 1BBJA 1QLRA 4KUCD 4M6MH 4UDUB 4G6JL 1OAQH 1BECA 3W81A 3BKCH 5T1LB 1UWGH 3S5LB 4UQ2B 1QTYT 4PLOB 4UAOC 4K9EC 2Q87A 1JNNH 3U2SA 1AGEB 4LAJH 2P5EA 4C4KT 1NAMB 4XP9H 5B21A 5IBTH 3C5ZD 1H3UA 4QT5A 4TRPL 3QUZB 3RWJA 5FO7A 4GQ9L 4DFHA 3IFPA 5AWNL 3BHBA 4KGJA 1S3KL 1NJ9B 2GJ6A 2XN9B 3WLBB 1WFTA 3FT4A 1QOKA 5DRZB 1D9KC 2HMID 2X4UB 4U1IA 5D7LA 2H32H 3UPCA 4F15B 1J1XL 1FO0B 2HRPH 2IBZX 3GSQB 4UNTA 1T80A 3FT2B 5EO0B 5SWQB 2EC9T 3F6LA 3L6FA 5BVJB 1N6QL 3EJYD 1UB5A 5DD6B 3O3UN 2ITCB 1VKXB 1BOYA 1CN4A 4G42A 1YZZA 4P2QE 2OR8A 1AQDB 1QLFB 4B7LA 3GRWH 1KYOJ 3DIFB 1V8HA 3THML 2DLGA 1EERB 3TYFA 4GUPA 1MCWW 2XTJD 1D5IL 3N1FC 25C8H 3O6MH 5TH2B 4NQTA 3V79C 3QXWA 1YUHB 5F89A 3BI9X 3BFOA 3UTTB 3K1DA 2YXMA 4PUBL 3MCG1 2BVPA 5K9KA 4KJYA 2IBZY 5JW3H 1ZEAH 4HUWB 3SDDC 3L3JB 3TNMA 4BQ9A 4XVSL 4ERSL 5E99L 1XF1A 2R0WL 1NLDH 2JELH 5L88L 4NFDA 1ITBB 4LK4A 3QEQB 2UVEA 1NGZB 2D4DA 3VFGH 1EMTL 2D31A 2MCPH 3HE7D 1OAXL 4JFEB 3OL2A 4EUPA 1VACA 2A83A 2RGSA 2QQKH 2XNAB 5GGSB 1CDBA 2HH0L 4UZGA 4PV8A 3O8XB 1J1PL 3MLUH 3WXWH 4HT1L 2HG5B 5IWLA 4N0UB 4UDTB 2NPLX 3H2WA 2LABA 4WWID 3I6LD 3IXTB 2R0ZH 5EC2B 4ZTOL 3HPJB 1DL7L 3IDIB 4XNXH 4WEBL 4UT9H 5SWSB 2HFTA 1A6UH 1ND0B 1U3JA 2P45B 2C4FU 1NBYB 3P9WB 3SDXA 4NQEA 1RJLA 4KRNA 1Q1JL 4WWKA 2QSQA 2V5TA 4PJ7A 3VXUD 3TIDB 5IGXL 1II4E 3DSNA 4ZXBD 1HHKB 3VD3A 5DJYA 2VZTA 3VXQB 32C2A 3C8HA 4MCYB 1EK3A 5GJSH 4XZUB 3KLAB 3GI9L 4FFZL 1S9XA 1CVSC 3FN0H 2QLVB 3FQXB 2E8YA 4XP1H 1CG9B 1ZA6A 3RBGA 3MJ8B 1OD7A 1ONQB 3Q2CA 3V7AG 1WK0A 3NFPB 3O9WC 1QNZH 1ZKAA 3RUGE 1QP1A 3JUYA 1G7IB 4OCSH 1UCBH 2NY0D 4YQXL 2V5SA 43C9A 1KN4H 4U1KA 2EYTA 4YBQD 3DX9B 2NY3D 2YKLL 3HPLB 5BOPA 1INDH 3GSOA 5CBAB 4KROB 1P53A 3TN0A 4GG6A 2OYPA 5E6ID 1TDQA 2UV3A 4U3CA 2PTVA 4I48A 2V7HA 2GTWA 1F3DJ 4XCNB 1S7QB 4GAGL 4OSUL 1Y6NR 2WP3O 5AZ2H 4MDJB 5JQ6H 2F54E 2AK4E 2VDRL 4NZRH 4ODXB 1UJ3A 1ZWIB 4CBPA 4P3DA 4U0QB 4P2OB 1KV3A 3OAYK 4OV5A 3LDBB 1WEJL 1DBMH 4NFBA 1I9EA 3O2VL 5ACMA 4KPHH 4DVRH 3SE4A 1KJ3L 2J5LB 5DJAB 5DLML 1A9BB 4UILL 4A2LA 1MFAL 3GB7A 4XX1G 3VRJB 5IMKA 1KG0A 1PLGH 4PLJD 4UT6L 3TH4T 4LSUH 3V6OA 2DB8A 4UT7H 5DJCB 1CT8A 1IQWH 2UWEB 5I18H 2ZKHH 5DT1L 1UZ6F 3C5JA 4Y5YB 2DQHL 4L4VD 3ULVD 3SE9L 1MIML 4TVPL 4NJAL 3B9KD 2DBLL 5IF0A 1KEGH 2FBJL 5IQ9A 1B0RB 1YEHH 4HS8H 3O4LE 1DBKH 1LE5A 3FRPG 2WUCH 3MR9B 5C09B 1MCPL 3B8YA 1MFCL 1XEDA 4KMQA 5I19H 2P5EE 5GSRA 1KJ2B 5HGAB 1YN7A 3NN8B 2CIKB 4MJID 4YWGL 5DJDA 2BSSB 3BT2H 3GMMB 2X9YA 1I9RL 3VWKA 3WEXA 1F5WA 2HAZA 2IBGA 1GGCH 2NY7L 3TNNB 4DKFL 3FL7A 2YC1B 2GJ6E 3PABA 2OTWA 1R0AL 3MLWH 4F2MB 4NRYA 5C08A 2ZUSA 2CRZA 3AROA 2PTTB 3HE6D 1IARB 4HFUH 4HUVB 4L3AA 3LZFL 2H32B 2IQ9H 4RSVA 5CWSA 5TDPA 2IADB 1HH6A 4PP1D 1OARH 1W8OA 3QDHA 3VA6A 4Y2OA 1RZIB 1NBZB 3ARUA 5EOQH 2VDOH 2EDJA 2P7TB 3UC0H 1G6RL 5HPMA 5D7KD 1AC0A 4Y5XB 4NOFA 1IKFL 3MA7A 1JHLH 2FJGA 4IOIB 5MI0B 1JPTL 5FYJE 5LGJB 1AQKH 3BDYH 2PXYA 3RY5A 1I1AD 4X4YB 3WUWB 1P7KB 2NY2C 2VC2L 4PJHA 2FSEB 1JFQL 3CXHJ 4XXDA 4AEEA 4CU7A 3HN3A 1T22A 5B38B 2Z91B 3QUYB 4TSBL 1KJMA 3UX9B 1C8PA 4KJQC 4A6YH 5D6CA 2X4TB 1WIUA 3L3GA 2J88H 3V0WL 4H1LA 3NPSB 2YPLD 3ES6A 3HR6A 2MTPA 2XPGB 2VITA 1L7IH 4OF6A 5LCVH 2P8LA 5I16A 2Q86A 1RK0A 4OUOA 3S37H 3MXWL 1H3WM 4I2XB 4ESKA 4UUJA 2V9TA 3G6JF 1DE4B 3OB8A 3SGEH 4JRYA 2NY4B 3V4UL 1CF8L 1RIHL 4U1HA 1VPOH 4JZOB 5F9DC 1YEIL 1CTNA 3MRQB 1PJ9A 4HS6B 5CUSL 1CGUA 4Y2DA 4FFYL 3BXNA 1W72A 4X99B 3EYUH 5T5FL 2WIMA 1BD2A 1IMHC 4LLDB 4PBXA 4I0PA 4E42A 1P7HL 1U3HD 1KXQE 5CEXA 2VXUH 3O11A 1H5BA 4QHNB 3T3ME 3MRDB 4N0CD 3ZYIA 4QRQA 4Z7VB 5CCKH 5BRZA 1TJGL 1HOCB 2VWEE 4NQEE 4ACPA 4L1HA 4K2UH 1ADQH 3RNQB 4MX7B 1H3PH 5HYQB 1BP3B 4H8WH 1WBZA 5D5MA 4XGZA 5T33L 4OFKA 1JWSB 3UZVB 3HG1E 5J12C 4OIIL 2PETA 4DZ8B 1KCUH 1V05A 4N5ED 4HQQL 5F9WB 1X5XA 4R4NC 2CXGA 2UYLB 3LD8B 2AJZA 1LEIB 1PDKA 4JN1L 1T4KA 4PJGE 4TUJA 2BOBA 4UB0L 4PJDE 4JKPL 1RSFA 3AY4A 1A7QH 3ZYOA 4O2EB 5E9DD 2OL3A 5B3JE 5MHSD 3C5ZA 5FGRA 3M07A 2EKJA 4RFEA 1SJHB 2WLZA 3M8OL 1TETL 3C60B 4FZ8H 2L0DA 4MA3A 4WO4C 5DMGC 3TYGH 5K33A 5J1AB 1LNUA 2BC4A 3O41A 3D2UA 3QDAA 1QFWH 4ZAKC 2CLVB 2QTEA 4HWEH 1BZ9A 2QEJA 5ITBH 3BP5A 5KVDH 1NCDH 5DHVB 3MRFB 5IVZB 3GUTB 3ARFD 1AO7E 3O3DA 4NDMB 3LKOB 1YMMD 2BNRD 1OPGL 1GAFL 1YQVL 2GT9B 5INDA 3ARDA 3EGSB 2F5AH 4FMKA 5ETUB 3TVMB 4KDTA 2AJYL 5I71B 4U7MA 4N68A 5CINL 3T3PF 2JLLA 2EDRA 3ZSTA 5FAAA 3P30L 1EO5A 1RURL 5SWZB 5I1CH 1T66C 3QNZB 3FQWA 3SDCA 2GUOB 3FFCD 3V2AR 5GGUB 4GRLA 3DVGB 4FQ2L 2NY5L 5IJVA 2WBWB 1Q9KA 4FQIH 2I9TB 3MCKB 5KSBB 3HI1A 2C26A 3G5YB 4JM4H 4ZUWB 3I6GA 1KELH 3NIDE 5KBNC 2E3VA 2OP4L 3IDYB 3PWJB 4PREB 5I30L 1CGTA 1EH9A 3RVWC 1DQDL 2AJ3A 2DQTL 4IRSD 2J8UB 5FYJH 4ODTH 4ETYA 1OVZA 1CFSA 5GS0C 3S9DB 5I75B 3KYNA 4L3CB 5EO1B 2EE3A 3KG5A 2QADB 4F58L 5E5MB 2SEBA 3FB5B 5TDNA 3QJFB 3HCVB 4NSKB 1P7QA 5IEHB 4R26L 1IT9H 4XTRC 2VJXA 3P9MB 1D5ZA 2WBJB 3RQ3A 5C7XH 1Y6MR 1CICB 2XYCA 3RY6C 5CGYD 3ZDZF 4YX2H 4AG4L 2QV2A 3NIFE 4ODVL 1UXSA 3IKCA 2EE6A 5GGQH 4G6MH 3PQYD 3GMRB 1RFDH 5DD5L 5GZOC 1SBSL 2HFEA 2ADIA 4D0DB 1P84K 3ULUD 3L3OA 4X6CA 3SN6N 5HYSB 4ZXBA 1C12B 4PJFE 4EUPH 4U6XB 1UWEL 4N0YL 2AEIT 4HIHB 5B38G 5JXAH 1U8JB 1N64H 3EO1A 3JWDH 2CUIA 4JQVA 1T1YA 4MD5B 5SV3A 2KPNA 2PKDA 4ONHB 5LQBL 5J0BA 2Z9TA 1D9KA 4OLVH 3MRRA 4EQ3A 4J8RA 4NQVB 1EDQA 4S1SH 5E5UB 4HCRA 1MWAL 5IHLB 3FOMB 4F9PC 3MBXL 3WYRA 4G7YL 5I1GH 2AS5M 5GGVL 4L4TB 3X12A 4A6YB 4PRID 4XCFL 4WW2B 5DEZA 4UOW0 4NHUB 1FN4A 4IOSD 2BY1A 3RWDA 4Q9RL 5DVKA 3WNPA 5DZLA 5JORB 3QYCA 1JWMA 5E6IA 4YAQB 4FNLH 4MNQD 1F4XL 5E1HB 4P9HH 1X5FA 2J12B 1BVZA 4OF0A 1IVLA 1WQVT 4EZMA 4HMDA 4PRNB 5L2JA 4WUUB 2Z31C 2YPKB 5DRXA 4JRYE 3L7FB 5F7EH 3EYSH 5EZIL 3HZMA 4LCWD 2R4SL 3B9VA 4FS0A 4OCYH 3NCFB 4LLUA 4Z18A 3IAPA 5HHNA 3GGWA 1CZ8H 3SDDA 4S2SB 4JHAL 4PJ5A 2W9DL 4GS7C 5D7IF 3TA3D 3NTCH 4KI5D 1OW0A 1PEWA 4YDVB 5J56B 4M62H 4OZHA 4WFED 1OSPH 3AU1B 2XRAH 5DK0B 5HHOE 4OKVA 4FQHB 4OTXL 1YEGL 1T04B 4DCQA 3GM0A 1P6AB 1KXTB 5E0QA 3QXTA 3V4PL 4NT6A 3P11L 4LPXA 4KZEL 5DUPH 1QD0A 2UZXB 1PKQB 3P0YH 2C3WA 2EKSA 1JI1A 4X6FB 4XC1L 1JYWA 2C3VB 3JV6A 1BLNB 2OMBA 1TQCC 3B9KA 3D3VD 4M7JH 3LHPL 4FFVD 4ZPVA 1P4IL 4TVSa 5D2NA 3INUL 1TLKA 5IFHL 3WFZA 3SJVD 5HHPB 2YXFA 4JFPB 1X4ZA 4JFHD 5BXFB 4YDIL 2B2XH 4QRTB 5J3HC 43CAB 5GHWL 4ENED 5IVOA 2FNBA 5IHZA 5CJXA 1TVHA 4HPYL 3PWUA 1I1FB 4NQCD 2FWOB 1EHLH 1XR9B 3TBTA 1FL5A 2VOTA 1FDLL 1N5AA 2E27L 1I3GH 3HE6A 4OFIA 3S3PA 1BBJB 1QLRB 2FEDD 5LWYH 1FNLA 4P4KC 2FRGP 2ICWA 4K8RL 3UYPA 4JRXD 4H20H 2NY6D 4LSPH 4RGOH 3U2SB 3B5GA 2R56H 1NCBH 3WLWC 1UZ8A 5ICXA 4N1HB 2G9HA 5EORL 4QT5B 4QOKE 1HYSD 4WV1C 4ZTPL 3RWJB 3R1GH 1EEZA 5FO7B 2X1XR 4OM1H 2W07A 3BHBB 4GSDL 3AB0B 1WBXA 3JV4A 1PBYA 1MHPL 3CU1A 1I1AA 1HDMA 2VXVL 2HWZH 2I5YL 5I8OL 4BFIA 5C0CD 3BKJH 1IGFL 3FT4B 3GO1L 3BE1L 5CILH 1MEXH 4U1IB 2XZQH 1ZMYA 3ARED 5CP3A 5D7LB 2Y23A 5D1QC 1YQ2A 1JMXA 5IVXE 5GISL 4LVHB 1AJ7L 4RBPK 3L6FB 1YNLH 1FPTH 1N7ML 1UB5B 4KAQH 4PJIF 2MPAL 4G42B 4XP5H 2FATL 2W1NA 2D7OA 3S96A 1FNSH 3AFLA 3CD4A 2VABA 3SDAD 3TYFB 3RWHA 4GUPB 3W0WD 1J87A 3IS1X 3ZT6A 1GC1C 2YRLA 3MRJA 5DQ9A 3TJEL 3VXSB 4M3JA 1F8TL 3U7WH 3MGTA 3GHBH 3E6HA 4YZFE 3BMWA 3T0VA 1KIUA 2WQ8A 3BH9A 5HYSG 4PRAA 4YPGA 1J1OH 4PGEA 3O4OC 2IMNA 2BVPB 5A1AA 1Q9OA 5K9KB 4K94L 4KJYB 1BPVA 3CSPA 3NCJH 5IMOB 1ZT4A 4YXKH 3PGFL 3TFKD 3TNMB 2C3GA 4H1LH 4KH2A 2XA3A 4PV9A 4Z7UA 5HDQH 4DGYH 1CTOA 1HKFA 4L8SC 1PD6A 4OM0H 2CKBL 2D31B 4P57A 4OZIF 3N1PC 4Q58C 4DGIH 4EUPB 1VACB 4KKLC 1LVEA 3VDBA 2PNDA 2HTKC 3OWEA 4LBEA 1ACZA 4AIOA 2CR6A 4PV8B 5DK2A 5BZWA 4P9ML 2RJMA 4HC1L 5JXEC 3K2UH 4PYGA 4O9HL 5C0BE 4Y4KC 1QFWI 3DGGA 2CJUH 4V1DA 1CLOH 3S36H 3SDXB 4M4RA 5CZXC 1RJLB 5E9DA 3C09C 4WWKB 1GVIA 4U6HA 2GK0A 4PJ7B 5I74B 4HWNA 4G9FA 3NCCB 4IJ3C 5DJYB 32C2B 1NKRA 4APQA 1IM9A 3R0MA 4GAJL 1CIDA 2JIXD 2P5WE 3QXAA 1X5ZA 3HC0B 4NZUL 2PF6A 5A3IC 5A2IH 1Q72L 4JDVA 5EA0L 1GGIH 3DXAA 4Z5RA 4EI6A 1NCTA 1JPSH 2DIBA 3RU8L 4HIXH 4I13B 5JMRA 1JMZA 2AXJA 4YDKL 3ARFA 1ZA6B 5DD3L 5JQHC 1Q8MA 3NA4A 3MO1A 2J8HA 1ZHBA 1J8HA 2BNRA 3RL1A 3KWWA 4IDJL 2GKIA 5F44A 5FHBH 4DVBA 4B41A 4NQDD 3MCLL 1DQJB 2OL3H 4XBGA 4P5TA 1ZT1A 2A9NH 43C9B 4U1KB 1QACA 4Y5VC 4Z78B 2EYTB 3U4AA 1C08A 4UIMA 1Y0LA 4BQ8A 4PJ5E 3ZE1E 3UJJH 5HPOA 2F53D 1M6OA 3GSOB 3TN0B 4GG6B 5F93C 1CD8A 3KYKL 1U58B 2DAVA 1IC1A 4I48B 2C3HA 2V7HB 1CDUA 1KB9K 4X6DE 1EO7A 2GTWB 2CRMA 5J8OA 5EZLA 2KH2B 7FABH 2W92A 1UJ3B 1BBDL 4P3DB 2VQ1A 4XMKH 4OV5B 3LEYH 4G6AD 3BUTA 5FUZL 1WBYA 4TVPD 4MNHA 2VH5L 3GHEH 1T3FA 1NGQL 4G6FD 2VLKA 4RFNB 3FQUB 4E5XA 1VEMA 1TMCB 2X42A 4U4BA 3GB7B 1UH2A 3GBMH 3U9UA 5IMKB 1KG0B 3LVEA 3NVQA 4ZFOL 4JM2C 3PWPA 1QSZA 2W9EH 5F1SA 2EDYA 3C5JB 4NN7C 2A74B 4XNUH 5M95B 3O45A 2JJSC 3SQOL 4EVNA 4PJAF 4CU6A 4NRXB 4HPOH 3WJLA 1ZE3C 5IF0B 5KANI 5IQ9B 5FHAL 2GSIA 1T2QL 4YJZL 3QG7L 3JWOH 1LE5B 4UV4H 4H5SA 2DM2A 5F21B 3LSOA 3OJ2C 1C5DA 4HEPG 1RZFH 1GZQA 1U8IA 5BVPH 1INEL 1AP2A 5GSRB 2J6EA 4RCAA 3LN4A 1YN7B 3K74B 5BO1H 2WZPD 3EJYC 1FG2B 5DJDB 1TJHH 4JZJC 4JQXC 5BMFL 4HJGA 3DX8A 4DUXA 2D03H 3MOAL 1DBJH 3VWKB 3IF1A 4ONGL 1I8KB 5B8CB 2ZJSL 3BX7C 3PABB 2OTWB 4NRYB 3GBLA 5C08B 1BAFL 1J0KA 3S34L 3SOBL 1YECH 3IETB 1HH9B 3ZKSD 5CWSB 2HVJA 1P5VA 3ZHKA 5TDPB 5MEQA 1JL8A 1HH6B 3K1KC 5IBUB 3E8UL 4BSVB 1JGLL 1NGWA 1LGVA 4PTTA 4K9EH 4HMCA 1DQQA 4HIIA 4Y1AD 1NBVL 3TT1L 4PG2A 1YEKH 2Z8RA 3OR6A 2ZUWA 5EZOH 1BJ1H 3MA7B 5D1ZD 2FJGB 2CLRA 4MNQA 5FOBA 1A0QH 2CGRH 4FZEH 1BFVL 2PXYB 5AYQA 3NABL 3L5XH 2D2OA 5FKAA 2IFFH 3TZVC 4OF7A 4R2GC 2KL6A 4PJHB 4XXDB 1QHOA 4BA8A 3N9GH 3IDXL 4MXVE 1T22B 4YUEL 2LE9A 4OLEA 3SPVB 1ZHKA 2DF3A 1ZHNA 5CGTA 4WFFE 3D9AH 1OT1A 5TE6L 5D6CB 3S35L 2NXYB 4JO4L 3UDWC 3BQUD 3TA3A 5TGBB 3L3GB 4QRPA 4H1LB 4NRZA 1CFVH 2ARWA 1T20A 3G6DH 3ES6B 3ALWA 4RMWA 3VMNA 4HJJH 1KCSH 3S35X 2KBGA 2P8LB 5LJYH 5I16B 2Q86B 1RK0B 2QSCL 1T7YA 3CJJA 5F1NA 2YMXH 2GY7B 3FZUD 3JWNC 4UUJB 4MLSA 4XNYH 3TV3H 4JRYB 4XB7A 4U1HB 3V5HB 3U0TA 1DFBH 2HYMA 2WW8A 2BY0A 2JJTA 4Y2DB 3VFSA 3RZCC 1A21A 1W72B 3BXNB 5TF1L 3TCLA 3SHSA 1BD2B 4I0PB 4OCXH 2CO7B 3O11B 2BJMH 1H5BB 4X8XA 2W0PA 3D0VA 3SJVA 4QRQB 3CZJA 5BRZB 3RGVD 2X4RA 3DWTA 1N4XH 4NO0A 4WFGD 2NZ9D 3IS0X 4JEGB 1TJIH 4CL7A 2ORBL 1M7IA 3DYMA 2R2CA 1KC5L 1WBZB 4G9FE 4R9HA 4XGZB 4NQSA 5D5MB 5EOTA 4CW1A 1EEQA 3WV0A 5J9PA 3MODL 1X5KA 4LHUG 2F19H 1K4CA 3WKML 3WFCH 3ULVH 1JE6A 3BGFC 1JHKL 1IRAY 3NCEB 4P99A 4WVRA 3ISWA 3VG0L 2VDKL 1F6AA 4DW2L 5KSAA 4GXVH 2AJZB 3HB3C 2VZ1A 4OIBA 4FP8H 2AGJH 4TUJB 1U36A 4JRXA 2BOBB 5C07A 1J8HE 3F7RA 1NAKL 3VGHA 1ZLUK 3QRFM 4TNWF 4WFHE 1S9VA 4X9BA 5KVEL 2OL3B 1TITA 3C5ZB 5I17B 2EEBA 3TWCH 5HD8C 4RFEB 2VAAA 3V8OA 4X7FC 5TF0A 1R3IH 1I85C 2V6HA 1RZJC 1X5AA 4MA3B 1FSKB 4FA8A 1QSVA 1LNUB 2BC4B 3O41B 3D2UB 3QCUH 1A14L 5BZDB 2YZ8A 4FQXA 4O5LH 3EFFA 3E3QC 1NPUA 1WVZA 1BZ9B 3VXPA 3BP5B 1XGPA 3AREA 2Z31A 3RUGF 4M6ML 1WLHA 3O3DB 4FQLL 1OAQL 5CJQH 4IRJD 1UWGL 2ZSVA 4X4MA 5INDB 1JNNL 3ARDB 3WDHA 4TULL 4XP9L 3P2TA 3CFEA 1NCCH 3KDMA 1CGYA 5F1OB 3SDAA 5DF0A 2VLKE 2XTJB 5D7JD 4EBQL 3FQWB 1J86A 3SDCB 1EAJA 4JGJA 3PDOA 3EOAB 5EUKA 2Y6SD 5FDWA 2FJFA 3MLSH 4DJMA 4EJ1C 3ZZ1A 4E0RA 1RUAL 3MLTA 1NC4A 1D6VL 4X7SL 3N1MC 3BD3A 5DA0B 5IJVB 1Q9KB 3PWPE 4N8CL 3S88H 3MV7D 1ERNA 3HI1B 1TIUA 4MLIA 4J3VA 3QUKA 2ESVA 3DVNA 3C2AL 4BUGA 1X3DA 1QBLH 1TCRA 2CMRH 2VN4A 1QSEE 1R3LA 4R7NA 3DNKA 3S97C 4KKAC 4WGWB 4LEXH 3L5WA 3DI2B 1WZMA 2AJ3B 4WENB 3HC3H 1CFSB 4TPRH 4I3RL 1AHWA 4NN5C 1NCNA 4B5EA 3UJTH 3KYNB 5ABDE 4RISH 3E2HB 5FYLE 5TDNB 3O6ML 1QFHA 4KZDH 1K8IA 3PV7A 1DVFA 2ENSA 4GW5A 1HEZA 2EDWA 2DTSA 1OTTC 2NXZB 1D5ZB 4POZD 3NAAL 5DZOA 1QRNA 5I0ZA 4UIKH 3ZKXB 1ZEAL 3FO0H 1LP9A 4OI9A 1UXSB 4JB9L 3IKCB 1YEEH 1BQLH 2IGFH 1S9YA 1R5WA 4U3HA 5EC1A 1NLDL 1MFEL 2ADIB 4F9LA 2BSRA 4HLJA 3VD9A 2IAMD 3L3OB 1MH5A 1DLHA 3VGBA 3CUPB 3QNXA 4X6CB 3VFGL 4UAOB 2X1WL 3QR2A 2MCPL 4ZXBB 2ZUVA 5LG1A 4JZNB 1AGCA 5IB4A 4Q7DA 1QFUL 2QQKL 5ISZE 1T1XA 2N7BA 3EO1B 3TJHD 5JZ7C 3MLUL 1OOAA 1T1YB 2NR6D 3WO4C 5EBWA 1U6AH 3SCMC 4LF3B 5ACLA 2B1HH 5J6GA 5GPRA 1U8PB 3B2VL 2R0ZL 4PRPD 1OGAE 1D9KB 2NX5A 4XNXL 3MRRB 2PTUA 3C6LD 4J8RB 4UT9L 5MEPA 1A6UL 2YK1H 4NQDA 4MJ5A 2NY0B 2IH1A 4G8GE 3X12B 3RTQA 2V2XA 4AY0A 5IP4A 2BNQD 1FN4B 1MJ7H 3RWDB 1G7QB 4QRPE 1U9KA 1MAKA 3VFMA 2BERA 4KDWA 5ID1A 1JWMB 5GJSL 4HG4K 4LIQL 1U3HC 2E9JA 5E6IB 4YEFA 2ZPKL 3DTXA 1AIFB 2O5ZH 2Z35A 2XZAH 5L2JB 4D3CH 4N90D 4XP1L 3TO2A 4BZ1H 5HVWA 3EOBA 1A6WH 3MREA 5KTEH 1F3JA 3HZMB 3BAEH 1GRWA 2EC9U 4OCSL 4LLUB 4JGUA 3WHE1 5HHNB 3GGWB 3RP1A 4P2RE 5DSCA 3FB8A 1G9MH 1KN4L 4ZNEE 3SDDB 4JG1L 1EAPA 5MENE 4PJ5B 3LB6C 1EVUA 3KS0H 2AEQH 4OZHB 1INDL 3PNWA 4OKVB 1NH6A 5D2LA 4DCQB 3LQMA 4KI1A 4EN3D 3H0TA 4J2XA 1N59A 4P46D 4NT6B 4KUZH 1ACYH 5AZ2L 1AKJA 2FX9H 4NZRL 4ZOAA 2ADGA 4YFLI 5EU6A 15C8H 5KS9A 5DVLA 3B9KB 4X6EA 3RIAF 4EDXA 2EDDA 3T3MF 1NUDA 4DVRL 4Y4KA 3WIIH 3Q6FA 1ODAA 4ZPVB 5INCA 3N06B 3FTGA 1N2RA 5D2NB 2CD0A 3DMMD 5C07E 4NZJA 3QEGL 3TIEA 4PRDA 3H42H 5C0GA 4PJBE 3F8UB 4C56A 3GMPA 4PJ9D 3WS6A 3QPXH 4NO2A 1PLGL 1EBPA 4LSUL 4OB5L 5C3TA 1KXVC 2FGWH 5IHZB 4UT7L 2WBKA 1SEQH 1TVHB 5I18L 2ZKHL 2BOCA 1DSFH 1MCIA 1F97A 3PWUB 1E6JH 1QKZH 2DQCH 1G7HA 1MRDH 5I1IH 3SDYH 3TBTB 2XWJA 1FL5B 1N5AB 2A6JA 3B8SA 3HE6B 4PJGF 1LWRA 1KEGL 4PJDF 1YEHL 2VXTL 4HS8L 2ICWB 1DBKL 2IJ0C 5B3JF 1NSNH 1I75A 4AENA 2VDLL 1T21B 2X9WA 4Y1AA 2V17H 1UZ8B 1RZKC 5F9OH 5ICXB 5I19L 4J3OC 4Y5VA 5DJ6A 2G9HB 5FYLH 2J6EH 5C86A 1AXIB 2A9MH 2XKSA 1EEZB 3OPZH 1IQDB 1X4XA 3EFDH 4U2ZA 1C16A 3BT2L 5JTWA 2DLFH 3F7VA 1GGCL 1WBXB 3JV4B 4LLWA 5E5RB 1NMCC 1I1AB 2I07A 1HDMB 3EDDA 4X7DC 3MV01 4CDGC 4IRSC 3U36A 1MCLA 4JFYA 4BFIB 3CZFB 3MLWL 3ZT5A 4LQFL 1PYWA 4JFDD 4HFUL 4I18C 2RCSH 3SGKC 3DX7A 3ZHDA 1JTPA 2IQ9L 3QDME 3BRDA 1I8LA 1OARL 3P40A 4JCLA 4F8TA 5EOQL 5CGMA 2VDOL 3MUHL 4J6RL 1MCSA 2GHWB 4Z0BL 3UC0L 4V2BA 4XMPH 3S3JA 3S96B 4M7ZC 3EYQC 4KKCC 1HN1A 2VABB 5ICZA 2Y9RT 1JHLL 1NUNB 4BZYA 5BV7B 3RWHB 1AQKL 1G9NC 3BDYL 5F96H 3VXTA 5JPMA 1PY4A 5DQ9B 3MRJB 4ZSOB 3SKOA 2BVOA 4J4PC 4NBYB 3LCYA 4JM2A 5IHUH 4P3CL 4WIQA 2Q8AH 3E6HB 3MJ9A 4G3YL 3O2DL 3T0ED 3BH9B 3NIDF 4PRAB 1A6AA 4YPGB 4PGEB 1H3GA 4GT7A 4AIZA 4XWGL 1QRNE 1Q9OB 5IW6A 1MQ8A 4OUUA 4A6YL 3TBSA 5I1AA 1ZT4B 1LP9E 2XXMB 3KHOA 2GAZA 1DTUA 4PV9B 4K7FA 4Z7UB 3HNVH 1HSBA 4KK6C 3OHXA 3RWEB 4MVBC 1L7IL 5LCVL 5D6DC 3S37L 4KK8C 4MDIA 3OBAA 4P57B 3A67H 3AM8A 4L9LA 1IEAA 4KTDH 4P23D 1DCLA 4LBEB 1MCCA 4DKDC 5DK2B 2HKFL 3VXRD 2B5IC 3QG6A 4JQXA 3NPZB 3S37X 5BZWB 2LQRA 4YBLB 3QHTC 1KJVA 3CX5K 3KPQA 3NIFF 1PZ5A 3GBNH 1GGUA 4GMSL 5BS0A 4IRZH 1JTTA 1EGJH 3HLAA 3QO1A 5T3XE 1LILA 3DGGB 4ZUUA 4V1DB 2VXUL 1GYAA 3T2OA 2JJVA 5E9DB 4PJFF 5C6WH 4U6HB 2ICWI 4RRPG 2GK0B 1QVOA 4K2UL 1ADQL 1F4WL 1H3PL 2WIIA 4H8WL 2FB4L 3OAYH 4APQB 1IM9B 1FG9C 4KRLB 3U9PH 3EIFA 3QQNA 4QEGA 5IMMA 3QXAB 3H9ZA 2I60L 1NMBH 1G7PA 3QEUA 4Q9BA 3OAUL 4JDVB 3DXAB 4NKIH 2Q1EA 4Z7WA 3OKYA 4PLKD 3DX6A 3TZVA 5T5NG 2NY2B 3ARFB 4F3FA 1ZHBB 1J8HB 4S1QH 5D96B 1YMMB 2BNRB 3RL1B 3KWWB 5DGQA 1KEMH 5JW4M 4DVBB 5T1LD 5K59E 1KB5A 1A7QL 2EECA 4XBGB 4P5TB 1ZT1B 2N1KA 4XVUD 4FXKA 5HHXL 1C08B 3BD5A 1Y0LB 4UIMB 3Q0HA 4RGND 3QUZD 3H6JA 5D7JA 4FZ8L 1FCGA 4FFVC 4FG6D 4C57C 1J88A 1D7FA 1M6OB 3VDCA 2COQA 1XIWC 1WICA 1WAAE 4HWEL 5D2LE 5ITBL 5KVDL 1NCDL 5IG7A 5JDJA 1PAMA 4UU9A 5EZLB 4KJWD 4ENEC 4JFZH 3VJ6B 2VQ1B 5F6HI 4NM4H 3KLHD 2F5AL 5EU6E 5KS9E 4M3KB 3BESR 1WBYB 1K8DB 2XG4A 1LO3L 1MSPA 4MNHB 5E99H 3TEUA 2RQ8A 2R0WH 1CQKA 1T3FB 3BKYH 3V5KA 1NGXA 5I1CL 2WWMD 1Q9WA 1BX2A 4H0IA 4E5XB 1OAXH 2VMFA 1LK3L 1P84J 3U0PA 5DMKB 4MMZC 4MQXC 2X1PA 4HT1H 1U3ZA 4FQIL 1SYVA 4S1DC 4WJ5A 3GMQA 4MHHI 4JE4B 4GXUM 1T03L 2ED9A 1KELL 4HX1B 3O45B 3R8BB 1DL7H 4EVNB 2P47B 4QRRE 4ORGA 5EU5A 5FUCC 5HGHA 4KC3B 4YO0A 2GSIB 1UADC 2IAMA 4U0RC 4J7RA 4KRPD 5CKGA 2YD3A 4H5SB 2QQNH 3QEQD 5FYJL 4ODTL 3LSOB 2IC2A 1C5DB 2BVTA 4E41A 1GZQB 1U8IB 1AP2B 3TO4C 4HK0A 3PWLA 3K4DA 4I9WE 4LPVA 4TNWK 1I85A 1DN0A 2A73B 1IT9L 4HJGB 3DX8B 1IKNC 2QSTA 3IF1B 3OKEA 5C7XL 4FFZH 3ZDXE 3ESUF 4YX2L 4L3EA 3WNMA 2RBLA 1CE1H 1LDPH 3C6LA 5GGQL 5F7NC 4G6ML 1MI5D 1I3VA 4RQQB 4WI4A 1RFDL 4DOHE 4LDOB 3RWGA 5MEQB 1B6UA 5DS8B 4YQXH 3QDGD 4PRIB 1NGWB 4PTTB 2F9BT 3O6FC 2BNQA 1DQQB 4PJ8C 3RKDD 3V9FA 4K23H 5AYUH 2FLRT 1VB9A 5JXAL 3JWDL 3OR6B 3D39E 3CFBB 3CMGA 3QUMH 2VDPL 1NC2A 2CLRB 4MNQB 5FOBB 3HI5H 1D6EA 5EU4A 3KXFD 5FKAB 4QHKI 4XPHH 1INQB 4I3GA 4GAGH 2RFXA 2Z4QA 3PL6D 5IVXF 4LLYA 3NFNA 4HXBH 4LCWB 2VAJA 2ERJB 2VDRH 3V95A 4F7CA 1ZHKB 3BH8A 1ZHNB 4MAYA 5I1GL 1FFNB 3DRTA 3CDCA 3WN5A 4IHOB 3V0VA 1MRCL 1JZ5A 2D4FA 4QF1A 4MHHG 5KAQG 5J1SC 3TA3B 3VWJD 1GPOL 4NRZB 1FH5H 3BISA 2X4NB 5EBGA 1T20B 1WUNT 4D0BA 4HUKB 3MV8D 1IAIM 4KROD 1H3TA 4P9HL 5F1NB 2IAND 3WNOA 1ITCA 3IFNL 4YZFF 3AMLA 5IVNA 4YFLF 1UYWH 4BELD 5F7EL 2A0LD 3U0TB 3V8CA 3KR3H 3NZ8A 4HD9A 2DWEA 2DQEH 2DQHH 2E8ZA 2OLDA 2YR3A 4OCYL 1S9KC 4QO1A 2EDQA 2I9LA 3VFSB 3MACH 3DV4A 4TVPH 3TCLB 1JZ7A 5BS0E 2DBLH 4K3EL 3H3KA 4JFFD 5IFJB 3LMJL 4HBQA 2D0GA 3DMMA 3D0VB 3SJVB 4KDVA 1SJXA 5E1AA 4Y19E 2X4RB 2XRAL 3O2WH 4F33B 5DDHA 2ZCHL 4NO0B 2BRRL 5AZEL 3UTPE 4UINH 4JREB 1BIHA 2CRIA 1F58H 4CN6A 1M7IB 4YWGH 3G6JA 4YHMH 4NQSB 5EOTB 4CW1B 3ARGC 1I9RH 1A6PA 4ZO8A 1JF5A 5J9PB 4NQCB 1K4CB 5KJRH 4CVZA 3UYOD 3DUSB 1OAKH 1EZVX 3KPOA 3UPRA 1OM3L 3B3IA 1F6AB 4M7JL 4Z7WE 1VADA 5KSAB 3TM6A 3LZFH 2YD2A 3AS2A 3W9EA 5ACZB 4QHUA 4JRXB 5C07B 1A02N 3LV3A 1S9VB 3M17A 1A9EA 1TPXC 5FGCB 3AAZB 2B2XL 3GNML 4JKLA 2OQJA 2VAAB 3DYPA 1Q9LA 1FYTA 1IKFH 2ZSWA 1BWMA 4FQXB 3EFFB 3KPSA 1VFUA 4RDQF 4RA3A 3VXPB 1EZVY 3HZYA 4JFDA 1JFQH 1I3GL 1XGPB 3BP7B 3AREB 4QLRA 4U1GB 5ESQA 3U48A 2ZUQC 4J3TA 3C08L 2XIDA 1QYGH 5B4MC 3RDTD 4LNRA 2ZSVB 4LSPL 5LXGH 2P4AB 4RGOL 1FNFA 1GGYA 1NCBL 2GQHA 3C8DA 3OKLA 2EXWC 4IMKC 3ZE1F 2NZIA 3KDMB 4G8EA 4KVCL 4KQ4H 3GK8H 1JZ2A 3SDAB 4OM1L 1DUZA 3T4AA 2CKBA 4WU5A 5ELIA 5EUKB 1U8LA 4X6DF 5GIRA 2HWZL 1UH4A 5FDWB 2FJFB 3ARQA 1HHGA 3BKJL 1RIUH 4E0RB 3MLTB 1NC4B 3V4UH 5CILL 2XZQL 3T0EA 4D0CA 4K7PH 3ZHLA 1Q0YL 2VXQL 1MIEL 1D5XB 3QUKB 4FFYH 4HC1A 2ESVB 2PYEA 3DVNB 2OJEA 4L8DA 3BZEB 3OGCB 3RWFA 1FPTL 1TCRB 4KAQL 4YE4L 4WHDA 1R3LB 3V6BR 4R7NB 3MRCA 4JPIA 2YWYA 4XP5L 4QKXB 5D1XC 3L5JA 5F7DA 5C9KA 2Y06H 3L5WB 3VE0A 1FNSL 1YC8A 4LSDA 1CVRA 5JW4N 3RIAK 3RX7A 5KW9L 1AHWB 2DRUA 1FZJA 4E41E 1ED3A 4Y4HD 5F7YC 3CX2A 1MCBA 3IDNA 4R0LC 5T33H 5E2VH 3OAZH 1K8IB 1DVFB 4GW5B 1HEZB 2NY4D 4ZUTB 3U7WL 2AW2A 3GHBL 3MJ9H 1ZAGA 4HQQH 3V5DA 3NFSH 1J1OL 5IQ7L 4U1JB 1VFAA 5D1ZC 1BQHA 2NTFA 3NCJL 1MNUH 2BNUA 5JW4Q 4JN1H 6CGTA 1S9YB 1R5WB 4B53A 5EC1B 1OTUC 4UB0H 3QA3A 2BSRB 5HGBA 4DGYL 1DLHB 1OAZH 4LHJB 3R8QA 4OM0L 2W59A 4QNPE 3QIUC 1AGCB 4DGIL 5IB4B 2ZOKA 3BEVA 2AEWA 1VDGA 1T1XB 3CFCH 4L4VE 1KGCD 1FV1A 4FTVD 3BQUC 3TP4A 5EBWB 3HUJE 5CD5D 1AY1H 1LMKA 4KMLB 1AFVH 1Z0NA 3K2UL 4O58H 4GFTB 1VENA 2NX5B 4R97B 3SE8H 2CJUL 5MEPB 1CLOL 3H7LA 3S36L 4NQDB 1OPGH 4MJ5B 1C5CH 3RVTC 2IH1B 3CGTA 1S9WA 1JI2A 1C7SA 4GXUN 4XHQA 3VCLA 4MJIE 4CKVX 5IT2H 3KNBA 2CDFA 3RTQB 4OLWH 2V2XB 3S36X 3DJ9A 3VFUA 2EIDA 3QWRD 3VFMB 4GBXA 3ZDYE 5ID1B 3LKQA 4J3WA 5FEBA 4KJPC 1K4DA 1ULVA 2N4IA 3DTXB 1GGIL 1WITA 4FQ2H 3RGVC 1JPSL 4ZFOA 4HIXL 2IPUK 2Z35B 4MXVF 3H3BC 3UMTA 3RX5A 3QIBD 4LAQH 3TO2B 3EOBB 3MREB 3FN3A 5GGRY 2DL9A 1F3JB 5DTFB 1KB5H 4MD4A 3WDIA 1GIGL 3O4OB 4LARL 1X9QA 5DSCB 2A9NL 3FB8B 3ROLA 3TVMD 5I66A 3D18A 5F7HA 1JGUL 2PUQT 2AQ1A 2MQ3A 4G6FB 2OSLA 3MA9L 2M8XA 3BUYA 4WDIA 1KN2L 3UJJL 3MRIB 3HMWL 3QULA 2DMCA 3PNWB 4MA1B 2KUTA 3LN9A 2Y4SA 4F58H 4FQQA 3H0TB 1N59B 3F5WA 1NGYA 5IK3B 3MXVH 2JCCE 4RMVA 2E7LC 3I6KA 2VYRE 4WRLA 1A1NA 5H2BA 2WM0A 1L0XA 1AKJB 7FABL 4LQ1A 3MBEC 1S7UB 2ADGB 5IBLC 1CCZA 2JB5H 2YPLE 4XMKL 5EU6B 2GIYA 3LEYL 4X6EB 2APFA 4UQ3A 3IT8D 4P2QD 4DEPC 5DD5H 5FO8A 4Y4KB 2B20A 3Q6FB 5INCB 1UB6A 1V5JA 5D7IA 3QPQC 3QUXD 1EUUA 2W0FA 1YYMH 3QWOA 4E9LA 1AGDA 3TIEB 4PRDB 4LRIC 2HJLA 5C0GB 5C0JB 4C56B 1UWEH 4N0YH 1Q0XH 3GBML 1ZGLA 1IGJA 1G6RB 4NO2B 2QADD 4L5FH 4RBPH 5EOCL 4JR9H 4IJ3B 1TVBA 1GHFL 2H2SC 1FJ1A 4F7TA 2W9EL 1GOHA 1VGEH 2BOCB 3L95B 5HI5D 1BOGA 4Z95H 2WBJD 4AJ0A 2YEZA 1G7HB 5LQBH 2EDOA 4YPJA 2XWJB 4OF8A 2NCMA 1ZLVH 2A6JB 1MI5A 4DKEL 5JHDE 4HPOL 1YPZE 4GH7B 5I76B 1RK1A 2PW2A 1K2DA 4ZG1A 3JWOL 3QDGA 3SY0B 5CFHA 4AENB 4LDLB 2YD4A 4Y1AB 3H9SA 4ZFZA 4Y5VB 4Y16D 3VH8A 4R4FL 5BO1L 5HVHC 1TJHL 2R0LL 3ZTNH 1DBJL 2QSVA 3F7VB 3CSBA 4HF5H 2FX7H 3KXFA 4LLWB 1XIWA 5DD1L 2VO5A 3U36B 4JFYB 1SBBA 3PL6A 2VUYA 2GJJA 2ZZUT 1PYWB 1C1EL 4PRHA 3DX7B 2PCPA 3D85A 2QQQA 1X7QA 4L4TD 2WWKO 3J8F7 3QAZB 4K9EL 1JNHA 3VWJA 4XVTL 1UFUA 4B50A 5MERA 1MCNA 3STBA 1YEKL 1SEBA 1UVQA 2A1WL 3N1GC 3MV8A 4M9PA 3PDGA 2R23A 1YEGH 2CGRL 5I1KH 1R3JA 2AJVH 3VXTB 5IEKB 3QFDA 4EXPX 2OCFD 2IFFL 3SKOB 2BVOB 2LFGA 2D0FA 3OZ9H 3BRFA 4WUUD 1DEEA 4C59B 3N9GL 4JY4A 5KOVC 2FHBA 4FQCL 1A6AB 3EKCA 3D9AL 4AIZB 1RHFA 2C5DC 5IW6B 3GMNA 4OUUB 3TBSB 4AL8L 5I1AB 4JFFA 4PJIA 1HI6A 1QA9A 2X05A 2GAZB 3F7YA 1CFVL 4K7FB 1CGWA 3FFCE 4OZFG 3G6DL 1HSBB 3RWCA 3OHXB 4HJJL 2V9QA 1KCSL 4JKKA 1U8MA 4YDIH 4XBPA 3PIQA 4MDIB 5GHWH 3SGJC 4L9LB 1IEAB 4OI7A 2Z93A 5GRJL 4XNYL 1IC5L 3TV3L 4W68A 3WJJA 3ZKMD 5DA4A 3WO3B 2CSPA 5CLWA 1Q94A 4HPYH 3QG6B 4GRWE 1DFBL 2NY1C 2F54D 2AK4D 4RA0C 1KJVB 5HDOA 3KPQB 1PZ5B 4KK5D 4NZTH 1FDLH 4W6XB 2E27H 1E28A 2Y5TA 4ELME 2MFNA 5E8DL 3HLAB 3QO1B 3T0AA 3VXNA 4OCXL 4ZUUB 1ZV5A 2BJML 4K8RH 1QO3A 2GSGA 4MS8D 3BOVA 1N4XL 5HGDA 3O6FA 1QVOB 4OZIA 1TJIL 2KKQA 3DURA 2VL5A 3VFRA 3QQ9D 1L9MA 5IMMB 3D87B 2F19L 4LCUA 3WFCL 1XGRA 1MHPH 1G7PB 3QEUB 4MCZA 3PQYE 4K71B 3TT3H 4FABL 4FHBD 1IGFH 3G5VA 4OKDA 2HT3C 3DX6B 3TZVB 2FGZA 5C6PB 3KAAA 3ULUE 2OMNA 3BPNC 4F3FB 1T0PB 2Q6WA 3VGAB 2AGJL 4IIQA 5L6YL 3TBVA 3BVNA 4IRJB 3V6ZA 1JGVL 4F7PA 1IGIH 4HFWA 1N7MH 4RNRA 1M7DA 2MPAH 5ESAA 2P5ED 3TWCL 5FYKE 1BMGA 4NKMB 2FATH 3SO3C 4W81A 5E4EC 5FUOH 4BH8B 5D7JB 2Q7YB 3AGVA 3B4NA 4EXKA 1CGVA 3QCUL 3OGOE 4O5LL 5JOFA 2GJ6D 3JXAA 5IG7B 1T83A 4PJ9C 2ZWLT 4UU9B 5ANMA 5CJQL 1IAKB 5SX4I 2K9UA 2VZ3A 3I02A 2E9WA 1A3QA 3O3EA 3PWVA 1PX3A 5D72H 2APTA 1DP0A 5B22A 2W60A 1NCCL 1S7WA 3V5KB 1NGXB 1V7MH 2HT2C 3P4MA 4M8QA 5CMAA 4U7KA 5FF6A 1Q9WB 1BX2B 5DD0L 2CKBH 3LY6A 5FYJD 1F02I 4Y4HA 3ILQD 4PB9H 1I8MA 1AGBB 4YHKH 3U83A 5FV1L 2IQAB 3U0PB 3MLSL 5DJZA 2XFXA 2YHGA 4LMQE 5A2KH 3SE3A 4R7DA 3S88L 4WJ5B 2MMXA 3GMQB 1CXEA 4P9MH 2E9BA 4Z8FL 2J7LA 5E7FA 3GSVA 4KI5E 4OZGE 2CMRL 4J1UA 3OMZA 4ORGB 5HXMA 2DM3A 5HGHB 1MWAB 3ZKQD 4YO0B 2IAMB 5LVEA 4OCNC 4ODBD 1XF4A 3EYOA 2EYSA 4LEXL 4PJBF 3QP3A 2OK0H 5L8KB 3GSUA 1TZGL 3WE6A 5HI4D 4XPBH 1KSRA 5IOPA 3UJTL 4XHJC 4KV5E 2HTLD 1TQBB 5EBMB 4QY8A 1SQ2N 4HK0B 2PO6C 3PWLB 4KZDL 1DN0B 2X41A 4RGMC 1M71A 4DK6A 3D3VE 4MQ7A 4NZUH 3OKEB 5C0ND 3RU8H 4PRPB 3MNWA 1F45A 4L3EB 3FO0L 4LVNB 4HG4J 5FB8A 4PJAA 4YDKH 3C6LB 5L0QC 5IMLB 1QBML 4HWUA 1WWWX 1IGCH 3WIHL 5IB5A 4NQED 2BNQB 1RZKH 2BZDA 1N6UA 1KPUA 4XPGL 3QWRA 3HG1D 4GRWH 3BN9C 1MCHA 1M4KA 3QI9C 1NC2B 4OGYH 3ARVA 1U6AL 5J11B 2B1HL 3NGBC 2X09A 3VXMA 3KYKH 1TVDA 2XWTA 2DLEA 4OT1L 4K3GA 2YUVA 1PZUB 2Z4QB 4DGVL 4LLYB 3ARBC 3NFNB 5CHNA 1FC2D 1E6OL 4P23C 4KK9D 4F7CB 2YK1L 3BH8B 4MAYB 1MQKL 2R9HD 3T1WA 4QWWC 3DRTB 3WN5B 3BKMH 5HHQA 3V0VB 5JHLL 3OKDA 5MP6H 3ILPA 5CJOH 4QF1B 4EEEA 2FZ3A 1NGQH 5FUCE 4R90L 4YDLB 4ISVA 2K3TA 3BO8A 4D0BB 3LH2H 1CYGA 4CADA 1AR1C 3DBXA 4MXQC 4X80L 4EN3B 1G9NH 3TN0D 4NN5B 4RAVA 4CMHC 4ZNCD 1UKQA 2O5ZL 3W82A 4C58B 2XZAL 5D71L 4GOSA 1NCAL 1DANU 4BZ1L 4NWTH 5CSZA 1A6WL 1AO7D 2VLRE 4U31A 3NZ8B 5KTEL 2DWEB 3BAEL 1IILE 4ZO9A 2LTQC 1T6WA 2EZ0D 1LP9F 2I9LB 4XC3L 3SQOH 4P2QA 3QEHA 5FYKH 1BIIA 5BJTA 5IUSA 3QUXA 1NUFA 3W0WE 2P43B 3DMMB 1MHEA 4F7MB 4CNIA 4PLKC 2AEQL 2FEEL 1T2JA 2BHUA 4FRWA 5E1AB 2AQ3A 1CR9H 1CGSL 1L6XA 5DDHB 4PGBA 4OCMC 4LEOA 1INEH 4I3SH 1CFBA 3QIUA 3G6JB 4JO1H 1C5BH 3ALXA 3FO2A 1ZLSL 2WV3A 4KUZL 4ONGH 2FX9L 4CVZB 4RMUA 4MNGE 3KPOB 12E8H 3WXVH 1FGNH 3UPRB 15C8L 3B3IB 1BAFH 2MHAA 2VZVA 4UBDD 3S34H 3SOBH 4BM7A 3WIIL 1SHMA 3W9EB 3QHFH 4QHUB 1OF2A 5T3ZE 1N3NB 5GXBB 1JGLH 3M17B 1A9EB 4XPAL 1BFOB 3H42L 3O0RL 4Y16A 5AG8A 3GKZA 4QTHA 2OQJB 4TSCL 3QPXL 1DLFH 4OQTH 1Q9LB 1X6NA 1FYTB 5FM8A 3FAWA 1LEKB 2HVKA 1SEQL 2ZSWB 3VWKD 2XA8H 1DSFL 3UZEA 5L8JB 1JYVA 1JIBA 1AI1H 5E94A 4Q6IA 2QR0A 1MAML 1MRDL 1WFUA 3KPSB 3SDYL 2H2PD 1KOAA 2A6KB 3HZYB 4JFDB 1ORSA 2HKHH 3MRBA 4EI5D 4GMTH 5ESQB 5ITFA 3O2DA 3T1FB 5K59F 3L3IA 5ANME 1NSNL 3IAQA 4LNRB 2R2BB 5HHME 1AXSB 5F9OL 1EBAA 4XH2A 3GSWA 3OKLB 4LCCA 5FYLL 2J6EL 4TNVK 1NKOA 5JA9A 3RVXD 1J0IA 3O3BA 2Z8VC 4G8EB 3OPZL 3EFDL 8FABA 3NCYP 3T4AB 2QSCH 1WAAF 2DLFL 2CKBB 3ESVF 3OF6A 3FAXA 4LVOB 5D2LF 3T4YA 4WU5B 4JHWL 4XBEH 1NFDE 2PXYD 1U8LB 3QFJE 5GIRB 2N56A 3EDFA 1HHGB 2DQDL 4XPTL 5JPNA 1DQLH 3DV6A 4JN2A 4EOWH 1KACB 2DJUA 1E4JA 2E7LA 4N0FA 4WNQA 3T0EB 3RUGA 3B2UD 1G0YR 3W39A 4D0CB 1MVUA 1FQ9C 1HXMA 5AG9A 3MBEA 5KS9F 2PYEB 4L8DB 2OJEB 3O8XC 3RWFB 3DGCR 2DKMA 1CS6A 3CX5J 5E56A 2F53E 4G9DA 3MRCB 4JPIB 3VGGA 2DMKA 1ZLWK 4XMPL 5F7DB 3VE0B 4XMLH 3HRPA 5JDSA 1TXKA 3F65A 1SY6L 4LRIA 1ADQA 1FZJB 3I2CH 1WT5C 2G75A 3O6KH 1ED3B 2ZUTA 3IDNB 1P4LA 1W0WA 4JRYD 5IHUL 2F54A 1WZKA 2Q8AL 1JHKH 3EDKA 3I3DA 4CN1A 1BGXL 1MHCA 1T0MA 3WD5H 3V5DB 5DZNA 1RQ5A 2HLFD 4LVEA 4Y2DD 5CZVH 1VFAB 1BQHB 1BVLA 2NTFB 3MV9E 2BNUB 3GMLA 4I0PD 4LFHD 1WWBX 5ADPH 3HNVL 3QA3B 4TTDD 5J57B 5HGBB 3BZDA 3QHZH 3QIWD 3MZGB 4BZ2H 5GS0L 3A67L 1IGYA 1A2YA 2R2HA 4Y89A 5JO5A 2B0SH 2ZOKB 3BEVB 4NWUH 1Z6JT 1RJZA 4HLZG 1FV1B 1GSMA 3ZDXF 1GOGA 3C8KA 5EIQA 3PE9A 3GBNL 1MF2H 4YLQT 4IRZL 3V52H 1EGJL 4PJEE 4NO3A 1J7VR 2GW5A 3EHBC 5IB3B 4YDJA 3O4LA 4FQLH 4RMRA 4QXUH 4X7EC 5F6IB 2YBRA 4MD0A 1S9WB 3VCLB 4M1CD 2A0LC 3LQAC 4TULH 3KNBB 2CDFB 3MNVA 5LBSH 3ZTJH 2V7NA 4RGNB 1E27A 4P2OC 1NLBH 3IRZA 3VFUB 5DRNA 1YNTA 1A6TB 3LDBC 1RV6X 3U9PL 5DJ0A 1S7TA 1CFTB 4GBXB 4EBQH 5EU7C 1KYOK 1K4DB 3D2UD 1NMBL 4NKIL 2J5LC 5FKPA 1A7RH 1RUAH 2EYRA 4PGCA 4ZFOB 1D6VH 4X7SH 2HJFA 4JM2F 4DZBA 4N8CH 5T3ZH 4S1QL 4LSQH 5I6XB 5DR5L 4XAWH 1G9EA 1KEML 3C2AH 1NCUA 4LCYA 5JW5A 2GTZA 3ARDD 1V3MA 5I66B 4I5BB 3D18B 4Y5YC 4QOKD 2M26A 1JBJA 2E9IA 3L3DA 3MUZ1 2OSLB 2G5BA 3BUYB 4WDIB 5DWUH 4OD2A 5GZNC 4I8DA 4I3RH 3QULB 2V2WA 3SDCD 5D4QA 4FQQB 3F5WB 1KTDA 4GRLD 4OGAD 3DVFA 1IAMA 3I6KB 5JIKA 2D0HA 5HSFA 2F15A 2NYYD 1A1NB 5H2BB 4UNVA 3NAAH 2CH8A 4YH6A 2D7QA 4JFZL 4AZ8A 1ZT7A 4YGAB 4NM4L 2G2RA 4JB9H 1WCBA 4RZCA 4UQ3B 5DFTA 2GK2A 2DQIH 4QXWA 5FO8B 3EJZD 1MFEH 1UB6B 4KRPB 5D7IB 5F1IA 3BKYL 5D8JH 2AJSL 2AXFA 2AK1L 2W0FB 1NL0L 5J13B 1AGDB 2HJLB 2UVFA 4Q2ZA 1MCWM 3PF2A 1CLYH 3I85A 3DVIA 2VLLA 4AMKL 1ZGLB 1QFUH 1IGJB 4LP4A 4PP2A 1TVBB 3X11A 4X9GA 4LSRH 1U2CA 5HYJE 1FJ1B 1P7QD 2EEAA 4F7TB 3FQTA 5HYEA 2NXZD 3A6CL 1BOGB 2YEZB 4Z7WF 5EPMA 1F2XK 3B2VH 4Y5XC 1K6QL 2EXYD 1RULH 4IEFB 1MI5B 5MI0C 3S4SG 2XQYK 4ZMAT 1RK1B 2PW2B 4OGXL 4WFGE 4C4KO 1K2DB 3QWQB 3QDGB 1X44A 2QQNL 3ZSSA 3EO0A 2R39A 2VSDA 3H9SB 4ZFZB 4GAYA 3R0NA 2MKLC 3QUYC 3VH8B 3HG1A 4D9QE 4MB4A 3AVEA 3RIFF 1HSAA 3UTSE 1U8HA 2HFGH 3NCMA 1OWWA 4LIQH 4CRPA 2ZPKH 3NPSC 1KLFA 3KXFB 2V5MA 5H94A 5E6YA 5TE4H 3Q48A 1CE1L 5C0BD 1XCQA 1LDPL 2Y36H 3PL6B 4KGLA 1D9KD 4PJGA 3P77A 4PRHB 2V2TA 1R6VA 4PJDA 4OLYH 1FGVH 2PCPB 2YPVH 4U6VL 3T2PA 1RJCA 1HYRC 3F62A 4M8VA 1X7QB 5CP7A 2NY4C 4HEME 3RA7H 1CL7L 4JG1H 2ATPA 1JNHB 3GIZH 3VWJB 4PG9A 1J8KA 2QHRL 4K23L 1GH7A 5J06A 4KTEL 5AYUL 5MERB 4PTUA 1PQZA 2VLJE 3FMGL 1SEBB 1UVQB 2HFFA 1T1WA 1YJDC 5TQ2L 2YRPA 3QUML 3MV8B 5DURD 1FL3A 1A1MB 3CFKA 3DHJA 5JOPE 1BQHG 2R23B 4W6YB 3HI5L 3E0GA 2IANB 1R3JB 4MJ2A 1LO5B 1GZPA 3QFDB 2R2EA 4ZUVA 5T3XL 1N0LA 2QL1A 1P9MC 4XPHL 2VZOA 5C71A 1DEEB 1AO7A 1OWRM 2ADJA 5F7LB 4HXBL 4U7SA 5I0DA 3HFMH 1JPGA 5KZCD 3BZ4A 4O4YL 3KYMA 4PJXE 4LKXA 1JRHH 3GMNB 3PXHA 2H6PA 4JFFB 4PJIB 1HI6B 3SDDD 1QA9B 3MJGX 4RFOH 1RU9H 5F9WC 3F7YB 1FH5L 4PJ5D 1IAOA 1B2WH 2AEPH 1E4KA 1REIA 4JRWA 3G5XA 2PR4H 1LO0H 2EDLA 3QEGH 3RWCB 3LD8C 1T7ZA 1U8MB 3VFPB 4XBPB 1S5IL 1H8OA 3PIQB 1WGOA 1X5HA 2Q8BL 1GC1L 3I75A 4OB5H 3MV7E 2C4XA 4L1DA 3S5LG 2ICEA 5EFIB 3V4VH 1UYWL 3K46A 1Q94B 4HK3J 2IMMA 1UT9A 3KR3L 1G7LA 1Z3GL 3CFJA 1RAMA 2DQEL 3EDJA 1EXUA 3C60C 3MACL 4HDIB 4NN6B 1E28B 2BXZA 3HAEH 5C9JA 2Y5TB 3MLVL 1PKOA 5CAYB 4BYHA 3VXNB 2CXKA 4TQEH 5E70A 5ID0A 2VXTH 1X6LA 3TC9A 4W4OC 3L3KA 1AGFB 3AMKA 1QO3B 2DYPD 2GSGB 4OGZA 2WINA 2VDLH 3KPTA 3O2WL 4Q9CA 4QNPF 5F97E 4OLZL 5HGDB 4UINL 3GSNL 4OZIB 5DQJB 2R15A 1F58L 3OG4B 1T2XA 2VL5B 2H1PH 4YHML 3VFRB 1X5IA 4QHMA 5I1LA 3TVMC 5I15H 2IFGA 3HUJF 4LCUB 5KJRL 2CKNA 1XGRB 1OAKL 1HKLH 4M61A 1CDHA 3G5VB 2CDEA 4LQFH 4EI5A 1UC6A 5GS1C 4XAKD 3CXHK 5F72S 2Q6WB 3ARBA 4IIQB 3MUJA 3TBVB 3D69A 1KLUA 3BVNB 3RDTB 5JW4R 3V6ZB 3O9WD 4JKWA 3ME0A 3SBWA 2RIKA 2EIZA 4HFWB 5DJ8B 4PJFA 5J1TC 4RNRB 1S7RA 1M7DB 4J6RH 5ESAB 1OQXA 4Z0BH 3GJFH 4D94A 1L0YA 5L2KE 3IDUA 3ZDYF 3UTZB 2DWDA 3IDYC 3HR5A 3BSZH 5JOFB 1HZHH 5F70A 1P1ZA 4KXZH 3EOYG 3JVGA 4P3CH 4G3YH 3O2DH 5ANMB 2AXGA 5IESH 4XWGH 5M94B 4JDZA 1QYGL 2VXSH 4ODWA 5LXGL 3I02B 1MELA 3O3EB 4BSWB 3PWVB 4UNUA 1CICC 4JDTH 4ZFGH 2W60B 4I0KA 1S7WB 4OLXH 4KQ4L 3GK8L 3P4MB 3BIKA 4M8QB 4M93B 5CMAB 5FF6B 5KVFH 3HNSH 4V2CB 2BFVH 2MJWA 4Y4HB 5C0AE 1I8MB 1HWGB 2JCCF 4UDUA 1PG7W 5DJZB 1RIUL 4Y4FA 2DJSA 2XFXB 2HKFH 3GKWH 5GGRA 3FCTA 4R7DB 3RX8A 1TZIB 4K7PL 4GMSH 5FGBC 1XFPA 3GSVB 5F7MC 3VH8G 1IC7H 3DETC 4J1UB 4K7PX 2AAVA 4KMTL 2V5RA 1FIGH 2Y06L 3QIWA 1EEYB 1XF4B 3EYOB 2EYSB 3QXUA 1BWWA 2X4QA 5HHOA 3GSUB 5DRZA 3WE6B 2BCKA 1N8ZA 3L3HA 3CU7A 1F4WH 4TTGA 5IOPB 4YFEA 4GW4A 1WISA 4AIXA 2FB4H 1OY3B 4FTVB 5E2VL 1SYSA 1JPST 5CSGA 3UZQA 1M71B 4YK4B 2ZG1A 1AXTH 4WW2C 3MJ9L 2I60H 4MQ7B 1RZGA 3OAUH 1AQDA 4QXGH 3NFSL 3LKNA 4LPTA 3ZKNC 3MNWB 2RR3A 1YPZF 3DIFA 1MNUL 4PJAB 5FB8B 3B9DA 4A2MA 2ZUYA 3N50A 2YD7A 5IJKC 1BZ7A 3V0AC 2EDNA 2FD6H 4V1DD 4G5ZH 1FP5A 4K7PY 1QQDA 5IB5B 2FL5A 5TH2A 1OAZL 3WFBH 1G1YA 3K80A 3FQNA 5HHXH 2WQRA 4G9FD 5C0IA 1KPUB 3CFCL 4JFOA 3H9YA 4APQD 1IM9D 1DQMH 2H8PA 1I3RA 4Y0GA 3VI3E 1IC4H 1AY1L 3VXMB 1A3RH 2BY2A 3DXAD 1RUKH 4LLMA 2XWTB 4OD1H 1AFVL 3QIBB 4XXCA 1H8SA 4O58L 3SE8L 2GY5A 2NY2D 3WS3A 3UAJC 5CHNB 4JFEA 1OAYH 1J8HD 5DJXA 4UMGA 3HMXH 4WFHD 1C5CL 5E2UL 5A16A 5ADOH 1PY9A 3MZTA 5IT2L 3O8XA 3OKDB 4HJ0C 3ILPB 2EH7H 1LO3H 4KJQD 4OLWL 4P5TD 2ARJA 4PIRF 4QOKA 5IROA 2FZ3B 5E24E 1CDCA 4FXLA 4KK5C 3KPPA 2EDEA 5DHYA 5IR1A 1IBGL 4ISVB 3BO8B 4KRMB 3VD4A 4CADB 1LK3H 3DBXB 1JZ8A 1FVCA 3IKKA 3KPRE 2YSSA 2EH8H 2MKWA 3QXVA 4RAVB 2BHYA 2P8MA 3I84A 5FK9A 4YHYB 5D7SH 1QSFE 2VZSA 4LAQL 2FIRT 3WFEH 5IVXA 1OP5H 5CSZB 1P69B 5C0FA 1T03H 4GKOA 1L0QA 3W2DH 1TTUA 1KB5L 4NNYA 2K7QA 4MCYA 4P2QB 3QEHB 4AK1A 1BIIB 5BJTB 3QUXB 5HYFA 1MHEB 5EH1A 4CNIB 3TESA 4PGJA 4CVWA 2VLKD 5HGGS 4D9RE 5I1JL 1T7WA 1UM6H 4PGBB 4LEOB 3ETBF 1FYHB 4M48H 5HBBA 5FOJA 4LP5A 4HIJA 2E7CA 4HUMB 1N0XH 4GRWF 3MXVL 3EUUA 4H0GA 3DROA 3FO2B 3UCRA 1E4WH 1HHIA 3PWPD 2ZNXA 1CXHA 2YWZA 3HHRB 3DX9A 1L7TL 4LL9A 4ELMF 2JB5L 2WSKA 4R4ND 1W8NA 2MHAB 1QSED 3U4BH 3AB0C 4QHLA 4AEIH 3V7AE 4H0HB 4U6YA 4Q97A 4PJCE 1OF2B 1FFPA 1YYML 3UPAA 5EUOE 1A7PH 3WUWG 1LE9A 4N8VA 4NKQB 4Y16B 3VXRE 4QTHB 4LVHC 1Q0XL 1O7VA 3IXAA 3ABZA 5FYLD 4L5FL 4JR9L 1F4YH 1U3YA 4KQ3L 2KQNA 3SKNA 1KIQA 2DI9A 2KDGA 2VDPH 1VGEL 4WO4D 5D70H 5DMGD 4JQIL 4OFVA 4Y7MA 4NUGH 3Q5YA 4Z95L 3TPUA 3AUVA 4Q6IB 2QR0B 3IFOA 2ZCLH 5C0BA 4ZAKD 2Z92A 1ORSB 1NDGA 3MRBB 4WHTA 4WW1A 3QSKB 1MCRA 3LRSB 2CR3A 2CIIA 5ITFB 4YHZH 5J6HA 2H3NA 3L3IB 2IG2L 1NUGA 3OAZK 4JY5H 1MRCH 4ZFFA 2UWEA 4XH2B 3GSWB 1GPOH 4LCCB 5ISZD 1JRHI 1QUNA 4JVPA 3O3BB 2P5WA 1OAUH 4P0DA 3GEWB 3ZTNL 1AE6L 1RZJL 5EWIH 2B4CC 8FABB 1FLRL 3CVIL 2P44B 1T66D 3T4YB 4HF5L 3RVVC 3QQ4A 4XX1E 2FX7L 4FFWD 3B5HA 3IFNH 2DI7A 2XICA 1OGAD 5JPNB 3DV6B 2XACC 4JN2B 3IVKA 3EZ8A 4WNQB 1JPFA 3RUGB 3IYLW 3W39B 1MVUB 1IJ9A 4M5ZH 1KJ2A 4ZOBA 4XWOC 2X6MA 4PFEA 4UV7H 1UENA 4NC0B 1A5FH 1YEDA 4U1NA 4UTBH 4K3EH 4M02A 3DUUA 4G9DB 3SQBA 3LMJH 1HK6A 4QRPD 2QQLH 2AABH 3OKMA 5E8NA 3AS3A 1EX0A 2XN9E 3IU3A 2ZCHH 1G0DA 2R1XB 3SKUD 4LRNL 5JDSB 2BRRH 3LPFA 2CLZA 5AZEH 1PGRB 4D9LH 5FA4A 5I1KL 4BSJA 3EYFA 2AJVL 1GJIA 2G75B 2AXHA 4MXWL 1X5LA 4R8WH 4X6DA 1BVKA 1P4LB 2BP3A 3OZ9L 4WWKC 1W0WB 1O0VA 2E7MA 2AK4B 2F54B 4GJTB 1NDMA 5I74C 3TBYA 4OZGF 2OJZH 1MHCB 1T0MB 4AQ1B 2EIEA 4OBSA 5GRWA 1OM3H 5DRWA 5KN5A 2OI9B 2XZCH 3MJ7A 3MLPA 1BVLB 4GKSB 3GMLB 4NCC2 4O2CB 5MEND 4CMMA 2DYPA 4MA7H 5GZOD 3A6BH 4X4YA 1EJOH 1P7KA 1AR2A 3FT3B 5DFVC 4KV5F 2DMBA 4Z7OE 1DR9A 4NO0D 3GNMH 5GGTL 2ZOLB 1IGYB 1A2YB 2R2HB 3UTTE 5JO5B 5IB1A 3QUYA 4HAFA 3D1MC 1RJZB 4HKBB 3OB0H 3QB7C 1QHPA 1GGBH 2OBGA 3C8KB 4F80A 4NZTL 4M6OH 3RIFK 2M1KA 5KSAD 3IDMA 3QEQE 4YDJB 1JYNA 3C08H 3CH8A 3O4LB 3VG9C 3O9WA 3RHWF 2X89D 4R96A 5C07D 4JFEE 1DQTA 2YBRB 2P5EB 4F57L 2WLYA 3OX8A 3MNVB 1R24A 2V7NB 1XF5A 1UJ3C 3RPIA 1E27B 2EZ0C 4KVCH 3MUY1 4NPYA 5DRNB 1YNTB 3MQIA 4ZO7A 5DJ0B 1AD9A 3IFPB 4H25A 5DMYA 2Y5EA 2AQ2A 2VISA 2Y07L 2GJ6B 3SE4C 2X2YA 2H45A 4FQXD 1PVHA 5SWSE 3TT3L 5FKPB 1X5GA 3FFDA 2EYRB 2HJFB 1UXWA 2Z31D 4DZBB 4OV6F 2DI8A 3SGEI 1Q0YH 2VXQH 4D8PA 1MIEH 1VGKA 4GLRH 1IGIL 1HHHA 1A7BA 3V6OC 1A6ZA 4LCYB 5JW5B 2P42B 4YE4H 1T5XA 2GTZB 4ELKA 4P3WA 5DVNA 2R29H 4OFDA 3L3DB 3ARSA 3OXRA 2G5BB 1BJ1J 5FUOL 1ZLVK 4OD2B 5KW9H 4JPVH 4NZDA 1LEIA 4CVUA 2V2WB 1GGTA 5KVGH 3LOWA 1KTDB 4GRMA 5F89B 3GM8A 1NC4D 4XT1C 2CO6B 4JHBA 4YHPA 3QDMD 3ZMRA 4LU5H 5IQ7H 5GS2H 3GIVA 2N7AA 1ZT7B 2IALA 2ESVD 4EDWL 2G2RB 4OCLC 2FJHA 3U7AA 1J11A 1WCBB 4RZCB 1OGTA 1XCTA 3DARA 1RHHA 5D72L 3CH1A 5B8CC 4PD4K 3WIHA 2EICA 5F1IB 1V7ML 1YY8A 2AXFB 5FCUL 3U82B 2APVA 4DN4H 3KHQA 2OR9H 1FNGA 2X44D 5LKNA 4PB9L 2VLLB 2A83B 4YHKL 5DUMH 5J3HD 4PP2B 3X11B 2R1YA 1DVFD 5DO2C 3FQTB 3UTOA 4CVXA 4FQ1H 1FL6A 1A22B 2OXGA 5EU7E 1QRND 1JF1A 5EPMB 4ZUSA 4M43H 4XNZB 3FRUA 3MLZL 1Q38A 4OI8A 5GS1A 1P4BH 1U91A 5ENWA 2UZIH 4NQEB 4P4KD 2OK0L 4KKBC 3O6LH 4XPBL 3EO0B 3OKKA 3ARWA 3PDDA 4OCRH 1PEZA 5HJ3A 2VDQH 3SKJL 1FO0H 2UWEE 4GAYB 3WLWD 4G6KL 5F7KC 3OV6A 3HG1B 4YHLL 1JZ3A 5DC4B 2OM5A 1HSAB 4HH9A 2BX5A 1U8HB 2NXYC 2YN3A 3HC4L 4LNVA 3MRHA 1RZ7H 4YR6A 3BIAX 1S9XB 5H94B 3WHE0 3MOQA 2LU4A 1XCQB 2NX5D 4PJGB 4X98A 2E5EA 2V2TB 4WI3A 4PJDB 5C09E 1IGCL 3T8XA 1GIGH 1ZA3A 4LARH 1KT2A 5CP7B 2L7JA 1OB1A 2VRAA 4NSKA 4BJLA 2ATPB 1JGUH 1U8KA 1RZKL 4NIKB 3RTQD 1CXKA 4O51A 3MA9H 1A4JA 4PTUB 1KN2H 1PQZB 2HFFB 1Z9LA 5H37H 1T1WB 3I50H 3HMWH 1PG7L 2ARJQ 3Q5TA 1NFDF 3CFKB 4K3DH 4OGYL 1EPFA 1IFHL 3VRLE 2R2EB 4ZUVB 4NUJA 1PG7X 1AO7B 3ARRA 2ICWJ 2ADJB 4LCIL 5HYSA 4PPTA 1JPGB 3ARXA 4C83A 1CFQA 3BZ4B 3KYMB 4LKXB 3JSSA 3BKML 5MP6L 5CJOL 2H6PB 3FOLA 1HQ4A 1HCFX 5AAWA 4NGHH 1IAOB 4X9HA 2E7BA 1CGXA 3G5XB 1W0YT 1YYLH 1YA5A 2J8OA 3LH2L 4N5UA 3BWUC 4PLNC 2ZUXA 1G9NL 5AD0A 5I73B 1WIPA 4YBHA 5EOCH 3G9VA 3I75B 2DQFA 1GHFH 4JLRA 4KKLD 3AY4C 1CT8B 3WNLA 2F74A 2HTKD 5DI8A 2ICEB 4NWTL 4DUVA 1UKTA 3C5ZC 1MFBH 3MLYH 4WW2A 1Z0MA 1G7LB 2VDMH 3CFJB 4PY7A 1AKJD 2P49B 3FB7A 3RJDA 1KFAL 1HCVA 1RJYA 1EXUB 1QSEA 3MUGA 1FSKC 3IGAA 4DKEH 5EU6D 5FYKL 4X5XA 1FNEA 4U33A 4ZDHA 5TQ0H 4YAQA 5ID0B 4Y4KD 1UQSA 4OJFL 5IJKA 2HMIC 3LEVH 3L3KB 3LIZL 4I2XE 35C8H 2WINB 4PRNA 1CR9L 1FORH 4I3SL 4JO3H 4C56D 5F9JA 4R4FH 4P5KA 4ETQA 2X70A 2FLBT 1L4IA 4JO1L 1C5BL 2R0LH 5F6HJ 1HXYA 1XR8A 4WO4A 4QHMB 3CK0L 5I1LB 4KDTC 5HHVH 1B9ZA 3WEXB 2W91A 5DD1H 4PJEF 12E8L 4ZAKA 3WXVL 5A3ID 1FGNL 5I9QB 1CU4H 2CDEB 4JHZA 4EI5B 2XTJC 1PSKH 4Z7VE 2H41A 4QRRD 1C1EH 5C6TL 2MQCA 1RIVL 4FQHA 3QHFL 3ARBB 5JR1H 4LASH 5K9JH 3TGXA 5L9DH 4NM8H 2DDQH 2EIZB 4PJFB 4XVTH 1S7RB 3SGDH 2W0KA 5ISZA 1MFDH 3LS5L 1PKQA 1R5VA 5HPMB 1DLFL 4OQTL 4I9WD 4MGXA 2A1WH 2DWDB 1HWHB 5KOMC 1SY6A 3U30B 3HR5B 4XNQA 4AYFA 3EJZC 2XA8L 4YGVA 1AI1L 2IH3A 1OGAA 2FR4A 1P1ZB 1QPXA 2HKHL 3HE7C 4GMTL 5F3BA 4FQCH 4HWBL 4G8GA 5I2IA 2AXGB 1QFPA 3E2HC 1KJMB 4EUPG 4JDZB 5A2LH 4AL8H 1U41A 3U0WL 4PS4L 3CVHL 3DI3B 2E6JA 2EXYC 4I4WA 1AD0A 1I9IL 3D39D 2VITB 3BIKB 5KANG 4IMLA 1S78D 5IHBA 4Q74A 2YS4A 4XBEL 3MGOA 2XT1B 3HZKA 5GRJH 1IC5H 4Y4FB 4P59L 1DQLL 4XP4H 1I8IA 4EOWL 4GQPH 5E2TH 4JM2D 5GGRB 3FCTB 4ZXBC 4RMQA 1KJ2H 3RY6A 4P2RA 1RUMH 4ZNEA 4POYA 1EFQA 1EGJA 5E8DH 4JQVC 5MENA 4DAGH 4E42B 5SWZE 1NEZA 5HY9A 5CEXB 3KS0J 5F8QC 5A2FA 3QIWB 3FKUS 4XMLL 2X4QB 5HHOB 1BREA 4QHKJ 4NCC1 1IZKA 3BRGC 2BCKB 3V7MA 1N8ZB 3L3HB 1K9TA 4NJ9L 3VMOA 1B4JH 3I2CL 3O6KL 4GW4B 1CWVA 4YXLL 2NY0C 5KSBE 3BP6A 1SYSB 2X7LA 5J4MA 4YBQC 2NY3C 1QFWM 4OZ4A 1RZGB 3X13A 3WD5L 4FABH 2VLMD 3LKNB 3KPMA 3MX0A 4LPWA 3QNYA 5CZVL 5BS0D 1T4KB 5E6IC 4JGMA 2J8UE 4OAWA 1H9VA 5L6YH 2X89A 3T0WA 1BZ7B 4F9PA 3VU2A 5ADPL 1JGVH 4WI7A 3UJIH 4Y19D 4TUOA 4PJBA 1QQDB 3VXSA 3QHZL 2FL5B 3FHAA 1ZK9A 3UTPD 4BZ2L 3NH7H 1U93A 4MYWB 3FQNB 1EO8H 4GLRI 5DXWA 2DQUL 3U46A 2B0SL 3CFIC 5C0IB 4JFOB 4NWUL 4YEEA 5E95B 2WP3T 2H8PB 5IMOA 2FO4A 1I3RB 1YEFH 2YUXA 5MEOA 2DL2A 2WAHA 1OW0C 3WFHA 5CKAA 1MF2L 4Z7NE 4LLMB 1J0YA 1S7VA 3V52L 1U8NA 5KSVA 3QQ3A 4OF5A 3TZVD 2RB8A 4O02H 2IPUG 4R2GD 3FO1A 3WS3B 4PLJC 5DJXB 4QXUL 1OCWL 3D48R 5D93C 5A16B 1WSST 1MY7A 4QOKB 5LBSL 2ARJB 3ULVC 4KFZC 1NLBL 3KPPB 5DHYB 3STLA 3B9KC 5IR1B 5DD0H 1YJDH 2BSED 4MAUH 3GJEA 4ZD3H 1WTLA 1SMAA 1FVCB 2YSSB 4GRLB 4NKOA 5D2NC 1TENA 2P8MB 1A7RL 3ECBA 5FK9B 3QDJA 5D9SA 2BXYA 3C87A 5IVXB 1UA6H 3QDMA 4L4TE 1XGUA <