5GZNC

Structure of neutralizing antibody bound to zika envelope protein
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
227
structure length
223
Chain Sequence
EVQLVESGGGVVQPGRSLRLSCAASGFTFSSYAMHWVRQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDNSKSTLYLQMNNLRAEDTAVYYCARDHLGWSSIWSAPESFLDYWGQGTLVTVSSASTKGPSVFPLAPSSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/immune system
molecule keywords Genome polyprotein
publication title Molecular determinants of human neutralizing antibodies isolated from a patient infected with Zika virus
pubmed doi rcsb
source organism Zika virus
total genus 42
structure length 223
sequence length 227
chains with identical sequence H
ec nomenclature
pdb deposition date 2016-09-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5gznC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5gznC01
1JPTL 1ND0B 1WWBX 5KAQG 5AZ2H 2VQ1B 4JPVH 4UTBH 3DURA 4OGAC 2BOCB 1G7LB 3IDMA 2R2BB 2CK0H 5A2JH 5DMIH 4YNYA 5JW5A 1ITCA 1F11A 3RAJH 1MF2L 2QQLL 4D2NA 1I9JH 3JV6B 4YDIL 4LCUA 2B5IB 2A74A 1N3NA 3U4AA 1LEIA 1IAOA 1SMAA 4RBPH 3SDAA 4IJ3B 3SJVE 3OPZL 2ZUYA 5H35A 5E08H 1JK8A 3C5ZD 1HH9B 4HGWA 4UDTA 4L8SA 3QDGA 3WNKA 4ZFZB 5CHNB 1XGPB 1HILA 5EU4A 4YBLB 3OB8A 5J1TC 3MLWL 5F89A 3MJ7A 3OKOB 1FV1A 3ZKSD 2VXVL 1NCAH 4G7VL 1EGJA 1PX4A 1BZ9A 5J06A 2JK5B 5J12C 2A9MH 4YGAB 4FFZH 4AEHH 5C3TA 4MAYC 1KN4L 4NGHL 1S7UB 3U6RB 4NO5B 1TJHL 1IGTA 2OTWA 2JE8A 3IDMB 4HAGA 2CDGA 3RWIA 4CN1A 3MV7E 2JELL 5D7LA 1U8HA 4PPTA 4PRAB 4WHCA 3GBMH 3VXSE 3UZQA 1ZHKA 2DRUA 4YNYB 5HHOA 5JW5B 1F11B 4HJGA 1QKZL 3G5YA 1T89A 4CAGA 5C0IB 1AHWA 1YEEL 5ESVB 4G9DB 4LCUB 5ESQA 1N3NB 1LEIB 1CL7H 1KPUA 1IAOB 2OK0L 2JTDA 4EXKA 1FVDA 2ZNXA 3CC5A 3GRWA 3KJ4C 3DMMC 2R8SH 3QDJE 1JK8B 3VXRA 1SYSB 4HGWB 4UDTB 4L8SB 1NC2D 3QDGB 1BFOB 1BVZA 1EUUA 4JRXE 1KJ2A 3N1GC 5DFWH 1NH6A 3BUTA 3BOVA 5EU4B 1SBSL 1DBJL 4DW2L 5DJDA 5I15L 3MRCB 2V9RA 4NM4L 5F89B 3MJ7B 1KLGA 3QH3A 2WBKA 3M8OH 2AGJH 4KU1A 1BZ9B 1GGIL 3FRPA 4HWNA 4ZOBA 3AM8A 3D3VE 2D7OA 4LFHD 5BOZG 5HXMA 1D7FA 5I1AB 1INDL 3VFGL 3VG0H 2ZUXA 1RUMH 1XEDA 4YHOH 5DDHB 3FHQA 1IGTB 2OTWB 1RY7B 2CDGB 5CP7A 3CFEA 5D7LB 1U8HB 1DLHA 3NCBB 2I9TA 1ZHKB 5HHOB 1D5MB 1JPSL 2QJDA 2XQYG 3ZMRA 5JOPD 3G5YB 1BX2B 1AHWB 2O5YL 2ZJSL 4G8GE 4BM7A 4FP8L 1KPUB 2D0HA 2HTKC 2CR3A 1FVDB 1DANU 4C83A 3CC5B 1CT8A 1XIWC 5DQJA 3VXRB 1Q72L 5D8JH 3FQWA 3MCKA 5E8NA 5DJDB 1I7TB 5ERWA 3RWHB 2NXZD 2VXQL 2FJGA 4LPYA 2ENSA 4V1DD 1KGCE 1KLGB 3QH3B 3JZ7A 1G6VK 2BY2A 2PTTA 4HQQL 5IHBA 2W38A 3SGKA 1BWMA 4F7CA 3PP4H 1ZV5A 3QIUD 5CUSL 1J10A 1J1PL 2P5WA 4WU7A 4OFDA 3JBG7 3TEUA 4IS6A 4LNVA 5DEGA 1DQQA 3RJQB 5F9DC 1BD2B 4MMXC 5IP4A 5CP7B 3I75B 3CFEB 4F9PC 3AAZA 2X4OA 2I9TB 2Y07L 3TBYB 1PDKA 3SKJL 3VD9A 2VDNH 5EOTA 3NGBC 3WJLC 2ED8A 5DTFA 3JWDC 3S37H 4C83B 3ZT7A 3O4LE 3WXVL 3O45A 1K8DA 3ARQA 3MJGX 5DQJB 3KNBA 2EIBA 3VW3L 3CK0H 3QUXC 2AJSL 2GAZA 3JSSA 2XRAH 2F58L 4YDLC 1ZGLP 2XWJA 1EHLL 2APTA 3MCKB 3C8KA 5E8NB 4KUCD 1FL5A 5IV2A 4V2CB 1PKOA 4W68A 1UZ6E 1KCRH 3WKNA 3VGAC 4BQCA 4X4YA 4OLXH 3WXWH 5ERWB 2IAMD 2FJGB 4Z6AT 3AFLA 2YK1L 5DD5L 3D1MC 2PTTB 3PGFH 1HXMA 2FIKA 1MLCA 5IMMA 2BNRA 4U1NB 2P5WB 4WU7B 4XHQA 4O2FA 2C3VA 4IS6B 2BERA 4XPBL 5D2LE 1IC7L 5DEGB 1OSZA 3WIIL 1BF8A 1DQQB 1CLZH 3RX8A 4BJLA 1AGFA 1WISA 4BQBA 3AAZB 4GXUM 2X4OB 5CGYD 1X5ZA 4UAOB 3ULSA 4E41B 2DQGL 7FABL 2IPTH 4M5ZL 4F33A 3S34H 3GUTA 1UZ6F 5EOTB 2EH8H 1MUJA 5ELIA 1JUFA 3LQMA 2IG2L 4NC1C 3ARYA 4LLYA 5D72L 5DTFB 1RUKH 5I2IB 3AU1A 3O45B 1K8DB 1J12A 4MS8D 2BK8A 5ACLA 1CD9B 2YKLL 1YMHA 2GAZB 4RCAA 5FYLL 1JWSA 3C8KB 4PJGA 3DRTA 1FL5B 3I6LD 2X10A 3LIZH 2PXYC 5D2LF 4N0CC 4GRWE 5E7BA 4ALAH 1FSKB 3DXAA 5JUEL 4X4YB 4Z7WE 1EHAA 1T83C 5FK9A 5DD6A 3CFCH 4S10A 5T3XD 1T04A 3DSNA 4IRZH 3OKMA 2WBJA 1BREA 2EXWC 1HXMB 2FIKB 3GIVA 1LP9A 3HCVA 4ACPA 2OMBA 4JO3L 1MLCB 4GMTH 4EJ1C 1F8TL 5IMMB 2BNRB 3BP7A 4MNGA 4O2FB 2C3VB 2VSCA 3ZHDA 1KIQA 3ZO0A 1OSZB 4M4PA 1YEKL 4MA7L 2E27L 2GJ6A 3QDHA 3FO0L 1AGFB 5F9JB 4LSPL 1S3KH 3MRDB 2DQJH 2VQUA 5HYJE 1BAFL 1K8IA 2APBA 4YFLI 2RBLA 4FQ1L 4F33B 4K3GA 3GUTB 5I17A 3S35H 1MUJB 1JUFB 4Z7WF 3WLWC 1NLDH 1BGXL 4LLYB 3MBXH 3AU1B 3OF6A 4MA1C 2UVFA 1BBDH 4P59H 2P46B 2BFVH 1YMHB 3OMZA 5FM4A 3LH2H 5EOQH 4PJGB 3DRTB 1IEAA 3DXAB 3T0EA 5HHXH 3AS3A 2BY3A 3QYCA 4RAUA 5DD6B 2F8VA 1CL7I 3RRQA 2Z31A 5KOVC 4LVNB 2XZAL 3MJ9A 2WBJB 3JXAA 3DI2B 4OZHE 3GIVB 1LP9B 3HCVB 1NAMA 4H88H 1MCKA 4HJ0D 4NSKA 3GK8H 4MNGB 2NY5L 1KIQB 1IM9A 3VJ6A 3QA3A 1LWRA 4HUKB 2VO5A 4OGAD 3VXUD 1A7OH 2B7DT 4XBPB 3WHE0 2GJ6B 5B3NA 1IT9L 3GSNA 1KG0B 3HI6H 3NFPA 3STZA 3ZTNH 1U6AH 3WIHH 5K9QI 3HC4L 5ISZE 3IFNH 4PJDE 5FDYA 4QCIA 3X14A 4LRNL 5GRVL 2BVUA 2VDQL 4M7KL 4U2YA 1F4HA 1VPOH 4OZFH 5ALBL 5ADPH 1Z9OA 4PB9H 1RIHL 2Y1VA 2FEDC 4EOWH 1YEJH 3UPCA 5C92A 5J7CC 2P5EB 1U3HC 1IEAB 4TUKH 2BX5A 1KT2B 5KJRL 3RPKA 1TTUA 4MAUL 3NA9L 2UV3A 2Z31B 2QQNL 1GPOH 3OKDA 2ZWLT 1NAMB 5D1QA 4GRWH 1A8JH 3UJTL 4DEPC 1DQTA 5EZIH 4NSKB 2EDJA 1IM9B 3VJ6B 3QA3B 4EQ2A 2XWTA 4ELMF 3ULVH 3H7LA 6FABH 1CU4L 4KTYA 5T33L 2WUBL 3GSNB 5EIIA 1PD6A 5ENWA 3A6OA 2BMKA 3NFPB 3MLTA 4JRYA 3STZB 5E6ZA 1QSEA 2ZCKH 3L7EA 2VLRD 1JI1A 2EO1A 4NOBA 2NY7H 4HUXA 4C4KO 4M4RA 3BJLA 4QCIB 3X14B 2CUHA 4KZDL 1HI6B 2OCFD 3TJHD 3QCVH 1BEYL 2HVKB 4D9QD 1KSRA 4WI6A 1BOYA 2CXKA 1VADB 3S3PA 2ZG1A 5IQ7L 2P49B 1J8KA 4MYWB 1JFQL 1YC7A 4I48A 1A7PL 1OGTA 2P45B 4MDJB 3K1DA 3F62A 5LCVH 1SMOA 2NX5A 5GRVK 4WRLA 5K9JH 5D1ZC 4M61A 1JZ2A 2B1HH 4NWUL 3Q1SL 1MFDH 5D1QB 1MCHA 3E6HA 3MNZA 5F6HI 5TDOA 4K3DH 4TSAL 5DJZA 1JF1A 3OAYK 4MNQE 1I1AD 1JZ6A 1G1CA 1HKLL 1L0QA 3LQZA 2JJWA 2XWTB 3ZT5A 5EB9A 2FL5A 5GXBB 2HMID 3RGVA 3V5HA 3S7GA 3TYFB 5EIIB 5ENWB 1OW0A 1N0XH 2BMKB 3MLTB 3G5XB 4JRYB 3SE4A 3SBWA 1QSEB 3HPJA 1MCWM 4RISH 3G5VA 3L7EB 1IGML 3WDIA 3PGCB 2EDWA 4I3SH 4PJAE 5FECA 1P4BH 4HUXB 4U1KA 1B3JA 5IB3A 4LCWA 2HTKD 5BW7C 5CIPA 5GS2D 2BC4A 3K80A 1ES0A 3H2WA 2F54A 2G60H 1XIWD 3G6JE 2A0LC 2IBBA 3CX5J 4D9RD 4HBCL 1UA6H 4I48B 1KXVC 4RMTA 4Y8DC 4OZGE 4M9PA 4YC2C 4YUEH 2JLLA 2NX5B 1WBYB 3GMQA 3PXJA 4Q9RH 1PVHA 5LGHH 5IG7A 4QXGL 1F3DJ 5CILH 2P7TA 4LF3A 4FXGA 1TJGL 3LKPA 4HH8A 3V95A 1JHKH 5DMGC 43CAA 3E6HB 3MNZB 4S2SA 5TDOB 2H45A 4KKNA 4JN1L 4PJAF 5DJZB 5BVPL 1FHGA 3LQZB 1K4CA 1GIGH 3HKFA 5I1IH 3V0WH 1X5JA 2VUYA 3SDYL 3G6JF 3CVIH 2AXJA 4P4KA 1A7BA 4GSDL 3PIQA 2AP2A 2QSQA 3G5VB 4OZGF 2OZ4L 2OJZL 2FX7H 3BVNA 3MRQA 4TN9A 4W4NA 2X7LA 1K5NA 5FECB 1FLRH 4LLDB 4EZMA 5BQ7B 5IB3B 5C0FA 3L5HA 4IRJB 3O2VL 4LCWB 3LS4H 5CIPB 3M1BA 1EVUA 1RJLA 2BC4B 2ADFL 4OLEA 1ES0B 5D70H 3DX6A 1RZFL 5I75B 3L3DA 2F54B 2X1XR 4HBQA 4TOYL 4OT1H 1EAPA 5CCKH 1BZQK 2ADIA 5FM5M 5C6TL 4WI2A 3VDCA 2NW2A 4B7IA 4J3WA 4P2CG 3HNTH 4J3OC 5IBTL 4N0RA 4PTTA 3HZMA 1D5ZB 5F96H 4YK4C 4JDTL 5E4IA 5IJKA 3OJVC 3VI3E 5IG7B 4M7ZC 3TGXA 4HK3N 4FXGB 4LF3B 3LKPB 3IVKA 2DAVA 43CAB 32C2B 1CIDA 4S2SB 3QDMD 3EYUH 1FLTX 5IHUH 5ALCH 3VXMD 1UH3A 3HUJE 3UO1L 1K4CB 1KN2L 3O2WH 4DTGH 5JLZB 3W5MA 4P4KB 1BQSA 4PBVC 4NM8L 1N5YH 3TN0C 1MI5A 2HA1A 4UDUA 3EFDL 3AS1A 3BVNB 2DJUA 3MRQB 3B5HA 1E6OL 2PUQT 4DJMA 5E8PA 1K5NB 3BKYL 3T0VA 4RFOH 1RULL 2Q87A 5C0FB 3BDXA 1RJLB 4IRSC 3DX6B 1MRCL 1VEMA 5IWLA 4CU8A 5I1DA 1EAPB 3PUCA 4ZO7A 1BIHA 2ADIB 2OP4L 5IFAL 2NW2B 4K7FB 4KUZH 1MAJA 1QLEL 2PXYD 4C4KT 1MHCA 1A6PA 3HUJF 2R56L 1KC5H 3HZMB 2BJML 4F80A 3EBAA 4KRNA 1QQDA 5J56B 2VSDA 3MUZ1 5F7LB 3IVKB 3Q3GA 2EXWD 2XYCA 3EFFA 4JZOA 4Q9BA 2ITDB 1S9VA 3BP5A 5I9QB 2W9EH 4NNXA 3T2NL 4YHYC 3VRIB 3RIFF 1QRNA 4F7TA 4TQEL 5E6IA 4J8RA 1P4IL 2Q7NA 1JNHA 3MLUH 3OHXA 5IK3B 3D85D 3EAKA 4NZDA 3IS0X 4UDUB 4U6VL 2VKWA 4LK4A 4CKVX 1EO5A 3MV9D 5E8PB 3BDBA 5GGUA 3WLWD 2BNQE 1C5CL 3ARGA 3OGCA 3MLRH 1TDQA 4Y4FB 3GO1L 5F6IB 4TVPH 1LQSR 4LVHC 4HKZA 5I1DB 4P0DA 3VG9B 4DVBA 5FB8A 2DYPD 4NO3A 1X5YA 2E9IA 3AMKA 1MHCB 1LGVA 3C2AL 3UP1A 1QBLH 2IWGA 1HNGA 1JGEA 3PL6C 4HEPG 3QO0A 5T1LA 4AENA 1QQDB 5GGSB 3ES6A 4QY8B 3Q3GB 2NY4B 3EFFB 1IC5L 4JZOB 5BZDA 1X44A 4JKMA 4UV7L 2ZUQC 5AEAA 1SY6L 4JQVA 4I18A 4TUJB 1RZJH 1S9VB 3BP5B 4NNXB 1U92A 1ZOXA 4DOHE 2VDOL 4IIQA 2WQ8A 4RNRA 1QSFA 2F19H 3QPXL 1IRAY 1V8HA 5J0BA 1BQUA 4F7TB 2Q8BL 3HA0A 4GT7A 5EC1A 5E6IB 1WBZA 5E99L 4J8RB 4NN7B 2EYTA 1JNHB 5HYEA 3T2OA 3OHXB 4OB5H 4WUKH 3P0GB 2VXUH 1ZXQA 4M6AA 2VXTL 4HWBA 1ZLUK 4O9HH 3TJEL 3RVXC 3BPNB 2Y36H 1U93A 3ARGB 2X9WA 1YEFL 1C12A 4HS8L 1T5WA 4OLZL 1L7TL 3QNXA 2BXYA 5I8EA 3MGTA 4XNUL 4HKXA 5FIEA 1FCCA 3B9KC 5GRXG 3L3OA 1T80A 2DLHA 4AZ8A 2AK4A 5FB8B 4K9EL 4OAWA 1U3HD 2MWCA 4NO3B 3DPBA 4TVSa 1NBZA 3N9GL 1JGEB 4G6AC 2VLJB 3DV6A 4ZFOL 3QO0B 1MJUL 5T1LB 1OM3L 5KVEH 3FB7B 3D2UA 4PRPA 2K3TA 4HJJL 1FH5L 4U1GB 5E95B 5HSFA 3ES6B 4RSVA 5HHNB 4I13B 2AABH 5BZDB 2CKBA 2DJ4A 4P2OD 4C56D 5MENE 1WZ1H 3FFDA 1U92B 2Y6SC 1J5OL 4IIQB 5CP3H 1QSFB 4OD3H 4P2QD 5KVGL 5I6XB 4YE4L 4L9DA 2JIXD 5EC1B 5CZVH 1WV7T 5A16A 1WBZB 2EYTB 4DWHA 1JN6B 5D71H 4P5TA 3BPCA 3VWKD 1JWMB 1VKXA 5CJQL 4FQLH 4BZ1H 1FG2A 4YX2L 1K3IA 5FO7B 1NFKA 1T2JA 1K6QH 1U93B 2A77L 1HIML 3N1MC 1CK0L 1UXSA 5I8OH 4AH2B 1P7QD 4MD0A 3WN5B 3QNXB 2FGZA 4HPOH 3MGTB 3K8LA 4HKXB 3V9FA 2EDXA 2W0LA 3L3OB 2UYLA 2AK4B 4U1MA 4Z7UA 5BRZE 3VU2A 4OAWB 1E4KA 4QTIH 1BM3H 1NBZB 4KPHL 5HHVH 2Q8AH 3QFJE 5K9QG 4Y2DA 1IKFL 1FGVH 5D1ZD 3DV6B 5DJ2A 2D7MA 3U0WL 5IGXL 3D2UB 1LO0L 4IOSD 4JFDE 4PRPB 4OLVL 3Q5YA 3WKMH 2HT4C 4NKIH 4DZBA 1YJDH 3PHSA 1VFOA 3ARSA 4JKLA 4NJ9L 2CKBB 3ZKNC 1JNLH 1TENA 3FFDB 3U79A 1BQLH 2OYPA 3MREA 4OD1L 1KPVA 5A16B 2QSVA 3H3BC 4X6DE 4PJEA 3QRGL 5KVFL 4P5TB 4UTAL 1L7IH 3BPCB 4QOKE 1RK1A 1VKXB 1MJ7L 1SM3H 3P4LA 5EUKB 5FYKL 3TVMC 5EO0A 8CGTA 4M1DH 1BJMA 3KWWA 3H42H 1FG2B 4X80H 1RIVH 3O8XD 3SGDH 1UXSB 2P8LB 4OF3A 4MD0B 3RWCB 2C4FT 2BRQA 1PG7W 5C0NC 4QLRA 1ZT4A 3WJJA 4U1MB 3DSFH 3NFSL 1NBYA 2HN7A 4Z7UB 5GRJH 5IB5B 5JA8B 3HNVH 3OAZH 1NJ9A 4Y2DB 1CLOH 4GBXC 5DJ2B 3GI8L 3MXWH 3HC0A 4X6DF 5DD3H 4AG4H 1FG9C 4KK5D 2X1OA 4L3ED 5JPMB 5L8KB 4KVCL 3BPLC 3SEPA 4DZBB 1PG7L 5C3LD 3DVIA 1O7VA 4NZRL 2XZCH 2LQRA 1RSFA 1SEQL 1H8SA 4LU5H 3MREB 2P1YA 3NA4A 4HSQA 1KPVB 3DJ9A 4BZ2H 5FO8A 2JB6B 5L8LB 4PFEA 4PJEB 3NTCL 4CDHA 3BIAX 1RK1B 1A6UL 3W0WD 3WNNA 4XCYA 1A7NH 1RUAL 5EO0B 2XKSA 2GFBA 2DM2A 3KWWB 5D9SA 1G9EA 1CGSH 1V7NL 3U9PL 4ZS6D 4A6YH 3RP1A 5JHDA 3D9AH 3KPPA 4NP4H 1T0NA 4XPGH 4ODHH 3D39E 4KK8C 2O93L 1ZT4B 1A1NA 1NGYB 1GGBL 2GK0A 3FO2A 2AI0H 2HN7B 2ERJC 4Y1AA 3MTRA 1UADC 1HHGA 3EJJX 4OZIB 3BD4A 1NJ9B 1Q0YH 1DBML 2AJUH 4BQ9A 3ZDXE 3CU1A 5ACMA 3CAFA 1T2QL 4FXLA 1UACL 2NPLX 5D7SH 5D93C 5GGQH 4ZXBC 3LEXB 1OT1A 3RX7A 3NN8A 5CSZA 4EUPG 5E8DL 2YWZA 4IM8A 5FM5O 1LDSA 4MA8H 2X42A 4HIEA 5L7XL 4NN5B 4EVNA 4JKPH 3TN0D 3ARBC 1W0WB 2I5YL 3NACH 1JTOA 1YEIL 5A3ID 1J05A 4P23C 2OZ4A 1WITA 3UXFA 1S9YA 2GFBB 4D0DA 4JN2B 3I2CH 1MFCL 3O0RL 3TH4T 1FJ1A 1RZGB 3ZDXF 4PB0H 4KAQH 3S98A 1FNSL 3KPPB 2YHGA 1XR8A 2P4AB 3LVEA 5F9WB 4NQDE 3TV3L 3C5ZA 3QCTL 3BW9A 2GK0B 3U46A 2V5RA 2D9CA 5DO2C 1HHGB 4O58L 1G9MC 4D3CL 5DJ6A 3D25B 3L3GA 3QO1A 5I1CH 1TQCB 1JMZA 2AJVH 1CXEA 1BVKA 3B3IA 4GAFB 5JXAL 4R0LA 2IANE 1N2RA 2C1PA 3NN8B 4U0RB 5CSZB 4LARH 4NFBA 1MEXH 1OD7A 1ULVA 3CSBA 4DAGH 4YXLH 4HIEB 3MOQA 4PLKC 1T4KA 4LHUG 4BSJA 5IMKA 4DKEH 4EVNB 1JL8A 5DRZA 4HF5L 3KJ6H 4DUXA 1J05B 5FGRA 3KR3L 4M5YL 5J3HD 2LU4A 1S9YB 4D0DB 1J8HD 3S3JA 3TFKC 3ULUE 1FJ1B 2DD8H 1HH6A 1AGBA 1UYWL 4ISVA 3FMGH 4PJIA 1XR8B 4C57C 2NY2C 2MHAB 1WSST 3DOSA 4W6WB 4UIKH 3C5ZB 3BW9B 1MF2H 5MI0B 3MOAH 1NC2A 3GSVB 4BK5A 4X7FC 4YDIH 3GKWL 1T03L 2ICWJ 4AIZB 5IFHL 1D5IL 4H1LH 4JDZA 4LOUC 2AQ1A 1GH7A 4JQIH 3OPZH 1DVFD 4NRYA 2YD6A 1A0QH 2NLJA 3L3GB 3TO2A 3MLVH 3QO1B 5C0CD 3O6ML 4YHML 4ZPTA 1JBJA 1BVKB 3B3IB 4LNRA 2IF7A 4PV8A 4AK1A 4R0LB 1SEBA 3ULUF 4LP4A 1N2RB 2C1PB 5B38A 3P77B 3EO9H 4S11A 4OUUA 2XQYK 4LGPB 1MCFA 5TE6H 3MV8A 3BHBA 1T4KB 4RQQA 5IMKB 2A9NL 3CFDA 3L3JA 4PYHA 1OGAE 4U6YA 5GSVA 5HDQL 1Q9WA 4XNXH 3Q6FB 5MEQA 3QFDA 4ZSOA 1KN4H 2FX8H 3RVXD 1JHLL 4HPYH 4L8DB 5JQ6H 1WBXA 1HH6B 4Z76A 3SE8L 1AGBB 4ISVB 5HI5C 4PJIB 5FGCE 1Y6MR 5B39A 5FEBA 3V6BR 3JTTA 3QB7C 1TMCB 3MODH 4QXTB 3B9KD 3OKKA 3DO7A 3PWPE 3O6FA 3ARFA 5CS7A 5E1AA 5T1KD 1NC2B 1YEEH 5BS0E 3UTTE 2ESVA 1UWXH 3JV5A 5C2UB 3SGDI 3C6LC 5EBWA 2NLJB 3TO2B 5DJXB 3MOBL 2DBJA 1G7MA 5EOCJ 1GOHA 2ZCHL 4LNRB 2Y6SD 3FN9A 1SEBB 3QIUA 3ARXA 4DW2H 3LMJL 1JPST 5B38B 4Y19A 4OUUB 4AM0A 4NM4H 2L7JA 3K4DA 3MV8B 3BHBB 4W81A 4P48A 1IQWH 3VRLE 2KPNA 4RWYL 4U6YB 5GSVB 4B41A 1FIEA 1Q9WB 1GGIH 1OTUC 2EDRA 1VFMA 5MEQB 4DN3L 3QFDB 5HI3C 2BHUA 4TSBH 4ZSOB 1INDH 1QA9A 4NKDA 3V7AE 3KPOA 4WI4A 2AJYL 1GGYA 5B39B 1WIOA 5T5NG 1MCLA 3JTTB 1GVIA 5ITFA 5E94A 3OKKB 4JFHE 3DO7B 2UY6A 5DXWA 3O6FB 3J7HA 3ARFB 1G0XA 1YMME 3ARED 5E1AB 3ULUH 3PQYA 4K94C 3EYQD 3HC3L 5ICZA 2ZJSH 5TQ2L 35C8H 4FP8H 2H6PA 4ZFOA 2ESVB 1ETZA 1PKQE 2HKHL 1OPGH 1LNUA 2PO6C 2YRPA 1ZGLB 1KBGL 3MLZL 3VRLF 3U7WL 1TZHA 4LQFL 3NAAH 3BZDA 5EBWB 2HT4D 2NXZB 2IAMA 4I77H 4V1DB 3KPRE 1G7MB 3O11A 3ZKND 2CIKB 3KPSA 3QIUB 5EU7E 4MWFA 1EEUA 5LAXB 4AM0B 3AC0A 2D7TL 1CD1A 1PSKH 4GRMA 5LWYL 3I3EA 3B2UC 3HB3D 4HX1A 4V2BA 5IVXE 3F8UB 3EIFA 4H0HB 4G8IA 1VACA 3BD3A 3MLXL 3TVMD 5HHME 2B2XL 1MJ8L 1VDGA 1J1PH 1QA9B 3SDCC 3KPOB 1G7JB 3WYRA 1WT5C 5J4MA 2YOCA 5D1XD 4XPFL 4JRWA 3CMOL 4L1HA 5T1MA 5ITFB 4FG6C 5E94B 1KJMA 1BFTA 1HZHH 4L29A 5HJ3B 3HMWL 4XNZB 5JHLL 5H37G 3WFEH 3HI1B 5ICZB 2E7HA 4QRRD 1EBPA 2H6PB 1RAMA 4GBXD 1ETZB 1LNUB 3VXSD 5EU5A 3FAXA 3VA6A 1CVRA 1UQSA 5JXEC 1F5WA 3BD5A 2CLVA 1FE8L 1NC4D 2IAMB 3GFUA 4Q9CA 2ZKHL 2Z93A 2YD2A 3O11B 3GSRA 2VABA 1DUYA 3KPSB 1I3VA 5CSGA 1IBGH 4WHDA 2QHRH 3VGBA 4PG2C 2LTQC 3DTXA 1KFAL 4M48H 4IJ3C 2DLFL 4JRXD 5FCSH 1CD1B 4GRMB 4MJIE 2YK1H 5DD5H 5CWSA 4HX1B 4XTRC 1J0IA 1IGIH 3K4ZA 4G8IB 4S1QL 3SO5A 2PYEA 2H9GA 5SX5K 2E8YA 4YBLC 1MY5A 1HDMA 1KELL 4EI6A 4J6RH 1X4YA 4ZPVA 2J1KA 1P9MA 3NZHL 4KK8D 4YHNA 5T1MB 1DTUA 1KJMB 4JR9H 2DOCA 1HHIA 4L29B 3QCUL 4TSCL 3QHZL 5T5FH 7FABH 4WFHE 4DK3A 3RA7L 2V2XB 3U7AA 2B8OT 4F9LC 3ROLA 4I3RL 4WI3A 4PY8I 3GHEL 1RJCA 7CGTA 1MCIA 3GMOA 1CGUA 5EU5B 3T2QA 1V5JA 5IB1B 1UQSB 5ANMA 1WF5A 3TT1H 2C3GA 4HUMB 2CLVB 4RAVA 2R2EA 4N68A 2Z93B 1CDJA 2MKWA 5F71A 3GSRB 3B9AA 2VABB 1DUYB 1A6AA 5HPMA 5F1IA 2AV7A 3DTXB 5L88H 2APVA 5EZJA 3IB4A 3SDAC 1L9MA 2UZXB 4FZ8L 4ERSH 4XP5H 1JPGB 3F6LA 3H3PL 3ARBD 2LU7A 3VXUA 5CWSB 2IJ0C 4L8SC 4HC1L 4UNUA 4P23D 1RQ5A 1UWEL 1F8TH 3OR6A 2FX9H 3KPMA 1RMFL 2H9GB 3F65A 1HDMB 3B4NA 4N90E 4EI6B 2IQ9L 3FO0H 4ZPVB 1I7RA 1NCBH 5GGTH 4LSPH 4YHNB 5ITBH 3UEZA 1HHIB 1F4YL 4LHUD 1OHQA 1B9ZA 3UYRL 1N59A 5IEHB 1A1OA 5DO2D 3ROLB 4FQXC 2JJSA 1OP5H 4OCYH 3WSQL 1I8MA 1JP5A 3TNMA 3GMOB 4QHLB 3QQ9C 3LN4A 1WGOA 4XMLL 1P6AB 2PYFA 2VE6B 2OL3L 5CD5C 5T3ZE 4J2XA 2P44B 5GZOC 2H32H 5ANMB 4PJCB 4RAVB 1AQKL 2CPCA 2R2EB 4GAGH 3VFMB 1DBKH 3MLPA 3WFHA 3UTZA 1JHTA 1G9NC 4MXWL 2DL2A 1T89C 3E3QE 1A6AB 5HPMB 1AHWC 2F5AL 2A1WH 3FQRA 3T77A 1GOGA 3LQAC 2MPAL 4HUWA 5FYJE 2AV7B 1J18A 5EZJB 3EUUA 3GIZH 2HYMA 2E7LA 1PG7X 4N0UA 43C9A 3VXUB 1WAAA 4R97B 12E8H 2BRRL 2GIYA 1WZKA 3H9YA 5D6DC 4HCRL 2WP3T 3OR6B 1CFVL 3KPMB 3ZSTA 2VLRA 1UM6H 1T6VN 3UYOD 2GUOA 3TFKD 5SWZE 3IJSA 1OAXH 4CRPA 4K23L 1YY9C 2JB5L 2HWZL 2E3VA 5FOJA 2NY2D 1I7RB 2FEEL 3K2UL 3VD7A 2PNDA 4F37K 4FS0A 2EXYC 4L1DA 4NQEA 2BXZA 3HC4H 4NNYA 5E9DD 3KYKL 1A1OB 2DTSA 4PJBE 1CFTA 2EKJA 1I8MB 3SDXA 4LOUD 3GI9H 2QBWA 3LN4B 4F8TA 2PYFB 5IMOA 1XGYL 2OXHA 3C8HA 4K71C 4KHXL 3WFHB 3UTZB 1ZANL 1WVZA 1JHTB 5GRZA 3T3PE 2NY0C 5GS0H 5KS9A 3FQRB 3T77B 4HUWB 3MUGA 4RMQA 1I3GL 1V7MH 1W72B 1I1AA 3S5LA 3ZE1E 2ZPKL 3IDUA 4G43A 4A2MA 1NMAH 3LDBB 3NA9H 3FRPG 3MV01 4MAUH 4N0UB 1JF5A 5CD3A 3FQXA 2QQNH 3DUHA 43C9B 2R29L 4KJWC 4A2LA 5LVEA 3ALPA 4QGTA 3DECA 1XGRA 4EI5C 1LK3L 5A1AA 5F7YC 1GGCH 3ABZA 2IALA 4HULB 2VLRB 2GUOB 3FB5A 1JTTA 3ULVD 5HI5D 2B4CL 2FHBA 5DLML 5GGVH 2XKNA 3SGKC 1XIWA 3T3PF 5JW4N 4NNYB 5JW4Q 1NEZG 2QR0B 1CFTB 1WC7A 4BK4A 5HBBA 1H3UA 2GITA 1WLHA 5C0GB 1OVZA 4XCCL 4M6OL 2C1OA 4K7PL 1ADQH 1WEJH 1JFQH 3MCG1 4ODTH 3S88L 1AKJD 4Z77A 3IF1A 5T3ZH 5C71A 4GKSA 3MUGB 5F88A 1I1AB 4OCWH 2DQTL 2WIIA 2GEEA 4FQQA 2ZCLL 3KYOA 1DBAL 1WUNT 4LVEA 2YN3A 5CD3B 4G5ZL 3FQXB 3ELAT 4LDEB 1OTUD 4TULH 1R3LB 4LLMA 4ZMAT 1MHPH 1XGRB 2J4WH 3BX7C 2DWDA 4F58L 5JDSB 1WFUA 1PGRB 1EEZA 1ORSA 1NGPH 3WO3B 1HKLH 3FB5B 1KEGL 4XVSL 1U0QA 2FH6A 2X5PA 3WJLA 1GL4B 2GCYA 4ELKA 3EYSH 3GJFH 2XKNB 3MJ8A 1XIWB 1M1SA 1IGMH 3MYJA 4CVUA 3BGFB 1HCFX 4JPKH 5EU3B 1YQVH 2GITB 4U1IA 4F57L 5AAMA 2VAJA 1KCUL 1Q9OA 3VD4A 2C1OB 1GAFH 1CGTA 2EC9T 3UTPD 4LRIA 4PRDA 3QDGE 4HBCH 3NIFE 4Z77B 1HWGB 2NQCA 1RU9H 2CGRH 2H2SD 3QDMA 4GKSB 4LCCA 4P2RD 5E70A 1GGUA 3BH9A 4MCYA 2WIIB 4FQQB 3KYOB 5IEKA 4QXGH 2J8OA 5B4MC 1KNOA 3B2UD 1NGWA 4RGNE 1J87A 5EUOA 2VDRH 2F53A 2PTVA 4LLMB 3DYPA 4WCYH 2DWDB 4JN1H 1P7HL 1EEZB 1ORSB 4PD4K 2ITCA 3PDDA 4DZ8A 5BVPH 4JO4L 3B6SA 1YDPA 5C2BL 2GCYB 2AVGA 5AZ2L 1U8PA 4JPVL 4ELKB 1UM4L 1GCFA 4FG6D 4GSDH 2WBJC 5D7LE 3MJ8B 4Y5XC 2VZUA 4U31A 2X2YA 3MYJB 1DN2A 4OGZA 4U1HA 2ATPA 2CK0L 4XB7A 3W2DH 4Y4KC 4B53A 4PJFE 1E6JH 3T4YA 1I9JL 1RZKC 2VDLH 2BVTA 2DQHH 2AJZA 3BKCH 4U1IB 1F97A 1F58H 1RZFH 3VGAB 5JXED 4HIXH 2B39A 5IF0B 3BZEA 3UPRA 4MD4B 4PRDB 3VXRE 4AMKH 3AB0B 5C6TH 4LLQA 5DHXB 5HYIA 4K7PY 1CD0A 2X9XA 4NUJA 4LPTA 4U1SA 4NZUH 1PQZA 3QDMB 2DLIA 4LCCB 3JV0A 3BH9B 4MCYB 1FFNA 4JDTH 4XCNB 3VXMB 3MRFA 2BNUA 1KNOB 4HZAA 1C08A 4XPAH 4XTRD 2KQMA 1NCUA 2X40A 3HS0B 1NUGA 1F4WH 2OQJA 1U58A 2A9ML 4AEHL 4FFZL 4DZ8B 2R9HC 3UO1H 3H9HA 1AI1L 3T0EC 3B6SB 1YDPB 1AIFA 3MGAA 1BD2E 4APQC 1U8PB 5CJ5A 3DX7A 2Z31C 4I1NB 2GJJA 4KY1H 5FUCE 3TT3H 1JRHH 2ATPB 1RPQA 4DGVH 5DGRA 1E6OH 1XF5A 3BKYH 2DYPA 4H8WH 1EO7A 3HFML 1DQML 3CGTA 2PXYB 2AJZB 4OD2A 5GPRA 1H3VA 2MQ0A 3IDIA 3UPRB 1FNAA 2Y23A 2YD9A 3IDJA 3NMEA 4G9FD 1CDHA 2R8SL 5DK0A 4LLQB 1EV2E 4KKLC 2EYSA 4U05A 1PQZB 4F7MB 3LCYA 2BJMH 3SDAD 2IADA 4RBPK 2BNUB 4HWEL 1F42A 3ZTJH 3E2HB 1J1XL 4D94A 1C08B 1N6QH 5HGBA 2CMRH 5EFIA 3P30L 3T2NH 2VH5H 2FGWL 2OQJB 2P5WE 1U58B 2GJZA 1I4FA 3AY4A 3VG0L 4OKDA 2NYYD 3H9HB 1RUML 1KB9J 1AIFB 4YHOL 5CBEB 1WIUA 1Y6KR 3JV4A 3VI4E 3DX7B 4FQHB 4MA1B 3KVQA 4U6VH 4E41E 4OM1H 3NFNA 2I07A 4ZUSA 1VEPA 4BSVA 1WTLA 4FQXD 3LN9A 5F70A 2DYPB 4TVPD 3QQ9D 2I25N 3W9DB 3NCFB 4OD2B 5CD5D 1G6RA 1YPZB 1RZ7L 5GZOD 3IDIB 5I1LA 3IDJB 4WUUD 5HHOD 1AFVH 2EYSB 3QISA 1QRKA 5FHAL 3C2AH 4LAQH 4P2OA 4C56A 3EDDA 4JB9L 1A3QA 4P2QA 3ARTA 3VI4F 2JIXA 1Z9LA 4HC1A 5KVMC 1IC5H 4PJHA 3GMLB 1PLGH 3VWKA 4UV7H 1SY6H 5EFIB 2ZOLB 3PP4L 2VDOH 4LIQE 4UINH 5KW9H 3QPXH 2GJZB 1I4FB 1YY9D 2OR8A 1X4XA 2ICCA 1MCSA 5DHYA 2YA1A 1G84A 3PWVA 1P7QA 1FNGA 4AY0A 2X4PA 5EC2A 2VXTH 3NFNB 2I07B 4ZUSB 4YR6A 4ZTPH 3TJEH 4BSVB 4OLWH 3V8OA 4HUVA 2C9AA 3DRQB 2PW1B 2VDNL 2BVYA 1G6RB 4J3SA 3RGVC 1L7TH 3QUMH 4G8EA 5D1ZA 3S37L 4XNUH 1OW0C 2J6EA 5I1LB 3CSYA 1KV3A 5EBMA 4CBPA 2IFFH 4I9WD 3SBWC 5E2TH 1R3HA 2XZQH 4K9EH 3CK0L 2NY0D 5DK3A 4KKBC 2XRAL 4PJGE 1P69B 4P2OB 4C56B 4M02A 5JORA 3OGOE 1MJUH 4P2QB 3UTOA 2OMNA 3FKUS 1CXFA 5I75C 4OLXL 2JIXB 3ZLQC 2XPGA 3B5TA 1UM5L 4JCLA 3GSUA 4PJHB 4EI5D 1LP9E 3VWKB 1I8LC 3LS5L 4MNGE 4LMQE 2V17L 4HZLA 5SX4H 1S78C 3O8XA 5IVZA 5DHYB 3IDYB 1DFBH 3PWVB 1P7QB 4XWGH 1FNGB 2IQAB 1ZMYA 2X4PB 5EC2B 2VWEE 3P11L 4LSVH 3UTSD 4YR6B 4PJGF 3GBNH 4IMKA 4HUVB 5HHPA 1J86A 4YX2H 4QEGA 3S34L 2EH8L 3ZHKA 3CNKA 2WUCH 4G8EB 5D1ZB 4P4KC 1RUKL 4KJQC 4FA8A 2VOTA 1LP9F 2W65A 3CSYB 3V6OA 5EBMB 3F7QA 5I1HH 1R3HB 4MHHI 4U3XA 2P5EE 4KPHH 3U83A 5JZ7D 4L4VD 5JORB 1F3JB 1R3JA 4ALAL 3P9WB 4OLVH 4K55A 2XPGB 3CFCL 4YAQB 2ED9A 4QRTA 3GSUB 4WW1B 3VMOA 4IRZL 5ABDE 4BFGA 5D7KD 3QI9D 1NMCC 2YUWA 3W0WA 1KJ3L 4ONHA 4HZLB 4OD1H 5IJKC 2ARJB 3O8XB 1MFAL 5IVZB 3QRGH 3P73A 3ZYOA 3EYOA 4KJPD 4P3CH 1A9EA 2JCCA 4LEOA 3PGDB 5GGRY 2BNRD 5CLTA 5I9QC 3BKMH 1HKFA 1IGFH 5HHPB 4B5EA 4YC2B 4FN0A 2V2TA 5CMAA 1NLDL 3MBXL 4GAYA 4QRPA 2VXSL 2W65B 5GSRB 3W9EA 1OOAA 1BBDL 1IFHL 2BFVL 3NFSH 1JRHI 5EOQL 4Q74A 1B4JH 5F6IC 1R3JB 1X9QA 1OWRM 3PWNA 4IDJL 5HHXL 5DI8A 3UBXI 5IWLC 3VXPA 5DYOA 5C07E 1CZ8H 4GW5A 4QRTB 3VG9C 3WS3A 2CLZA 3TN0A 4LL9A 5IW1A 4YEFA 1CTNA 2HKFL 5M94B 3W0WB 3BFOA 1MNUH 5JIPA 2J88H 3WIFA 2EDNA 4ONHB 3GK8L 4XPHL 3DXAD 1P5VA 4YPJA 3B5GA 4YFEA 5MEND 3NTCH 1A47A 3P73B 5F7DA 1A7OL 3EYOB 1A9EB 2OTUA 5J8OA 4JRYE 4LEOB 3MCLH 1QSEE 3HI6L 1RUAH 4I3GA 4Y4KD 3ZTNL 3MRKA 4U1JA 1W0YT 3WIHL 1TIUA 4U49A 4LP5A 1V7NH 2V2TB 3K2MC 3IFNL 3IDGA 4NHCH 4RWHA 5E6IC 1FNEA 4YK4B 4GAYB 4GW4A 4M7ZB 1IVLA 3BJ91 3W9EB 1VPOL 3QJFA 5ADPL 2X1PA 1GGBH 3T1WA 2WWKO 1AO7A 3QNYA 4EOWL 1NCWH 2NX5E 3C60C 3L3IA 4K7PX 4N0FA 4TUKL 3PWNB 3BGMA 4B7LA 3MNVA 5BRZD 1B0RA 5DI8B 3VXPB 5DYOB 4S1SL 4EEEA 4GW5B 3WS3B 2CLZB 4GRLC 3TN0B 2H1PH 4OQTH 5EZOL 1I85A 4ZNEA 5E8DH 1KTRL 1MVFA 5DUMH 4ODWA 1RV6X 5EZIL 2BVQA 3T0ED 2CRZA 1MVUA 1J8HA 3MJ9H 5L7XH 4APQD 2HRLA 4U1GC 6FABL 5LBSH 3G6DL 1YEIH 2OTUB 3P2TA 3SPVA 2K1MA 3D6GA 5IESH 4I18C 5IJVA 1U2HA 1OTTD 3MRKB 4U1JB 4IIQC 1ZHNA 5D7JD 3O0RH 4FQJL 1N7MH 1OAKH 2NY7L 4I0CC 4LCWE 4JFFD 5CJXA 4JE4B 3IDGB 4NNPH 3HR5A 1FNEB 5AZEH 2F54E 3W5NA 3QCVL 4KRMB 3HRPA 3CSGA 1DVFA 3L95A 3OBAA 4WTZA 4KKLD 3QJFB 1KLFA 1GC1H 1ZVSB 2CO6B 3QNYB 2O26U 3UPAA 3UAJD 4EN3A 2EIZA 2E9BA 3CFJB 3P0VH 3L3IB 4O00A 4N0FB 4D3CH 4G3YH 4JKKA 3BGMB 4PP1D 3MNVB 3WFZA 1B0RB 4LPUA 1HQ4A 2OXGA 4FFWC 1EFQA 4OCLC 2FJFB 4HXAL 5JXAH 1T3FA 2NXYD 5EO1A 4WEBL 1T7XA 4XVUC 1MFDL 1ITBB 1A1MA 4K3DL 4L4TA 4PJ9A 1H5BA 4ODWB 5J89A 2Y7QA 4QF1A 2BVQB 1MVUB 1J8HB 1S8DA 4PREA 3NCMA 2VDML 3SN6N 1QYGH 3SPVB 3KR3H 1N0XL 2C7UA 1AGEA 1HSAA 2NY5C 5ESAA 5IJVB 1ZLSH 2HFFA 1ZHNB 4NZTL 5T1KA 2NY3D 4I3SL 3ZDYE 1P4BL 1UENA 5D4QA 2A2QT 4TRPH 3HR5B 5F7MC 1P6FA 8FABA 5LXGH 1Z2KA 3ZE2E 4P5TC 1FQ9C 1DVFB 3L95B 1JPFA 2G60L 4XP9L 1IE5A 5J11C 5C0CB 5J6GA 3EO0A 4X9IA 3QEGL 3GKWH 1T03H 3CZFA 5IFHH 3OSKA 1D5IH 2Y5TA 4YUEL 4KQ3H 1CXLA 4AYFA 4Q9RL 3K3QA 1DQLH 4JM4H 1FO0L 1HQ4B 3BEVA 4XVTL 4YHMH 3F7VA 3QSKB 3U30B 4JGUA 1JHKL 2EEDA 4R2GC 5EO1B 1HSBA 1A1MB 1E4KC 1MAMH 4RZCA 3ZE0E 4L4TB 1IAIM 3ZDYF 2Y7QB 4Y2DC 1OAYH 2CSPA 2AV1A 4OGYH 4OI8A 1S8DB 3ZE2F 1GIGL 5I1IL 5E2WH 3V0WL 3ZKXC 4PREB 5HDQH 5C08A 1J7VR 2VLKE 3CVIL 5C8JB 5JOEA 1BJ1H 1C7TA 5DEZA 5LG1A 1AGEB 1HSAB 1VFAA 1X5KA 1XAUA 3BUYA 2L7UA 3QUKA 5ESAB 3NCJH 2HFFB 4N5UA 3AREA 3SKNA 1F02I 1EUTA 2E7MA 5T1KB 3P0YH 4HGKC 3JWDL 3EJZD 1JZ8A 1X6LA 3RGVD 1U8KB 3CDGB 3LS4L 1MIMH 1EO8H 8FABB 2ENYA 5D70L 1GHFH 3T4AB 5J6GB 5CCKL 3DBXA 3L3HA 4KKCC 2ICEA 1T7VA 4KKBD 3REWA 1ZGLM 3PV7A 3CZFB 2Y5TB 4DN4H 4RMSA 1HHHB 2OI9C 4KDVA 2BY0A 2DI7A 2GTWB 3MPCA 3F7VB 2KQNA 2WWKT 3UJIH 3WJJC 1HSBB 4HK0A 4JLRA 4RA0C 4RZCB 3EYUL 4R7NA 3IT8D 5ALCL 2AV1B 3UCRA 2NY1C 3VGEA 5CEZE 3HE7D 3O2WL 5D1XA 4GS7B 4DTGL 1DQJA 1MELA 4R8WH 4L3CA 1I1FA 2DIJA 2GT9A 1N5YL 1EMTH 1KTKE 1VFAB 3QUKB 3BUYB 3AREB 4OCXH 4ORGB 1SBBA 5E7FA 1DLFL 3SKNB 4JREB 2W9LA 3V6ZA 4QRRA 4GBXA 4X4ZA 4HLZH 5GRUL 2EDDA 3VXSA 4JPIA 2H2PC 1YYMH 3H9SD 5HGHA 3DBXB 1VEOA 3L3HB 3REWB 2ICEB 4YBHA 3BWAA 3OB0H 1ZA6A 4Q0XH 5L0QC 3IAQA 4KUZL 1OCWH 2IEPA 2VLJE 3ROOB 1L9NA 1Z9MA 4X6CA 4M93B 4U6TA 3Q48A 1MRFH 4JHAL 5BV7H 5F9WC 1DR9A 4JRXA 5EBLA 3VFOA 4C54A 2A6KA 3UDWA 4JFED 4HK0B 1WWCA 1KCSH 1Y18A 3I6KA 1QSFE 2W9EL 3DUSA 2IPKA 4NOFA 3RWEB 4R7NB 4HFUH 2VN4A 3V7MA 4EDWH 4Y4HA 5E4EB 1CFNA 5HDBE 5D1XB 4ZOEA 3TCXA 3NCYS 4EUPA 4KK9D 4L3CB 3MLUL 3MMEA 1WIPA 4IDLA 4J3TA 3V6ZB 4QRRB 4GBXB 4R6UA 4BFIA 3BE1L 3VXSB 4JPIB 3L3KA 1MI5D 2QLVB 5HGHB 1NC4B 4G8GA 4Y8AA 3NOIA 3BWAB 1ZA6B 3S37X 3UJJL 1XCTA 1MLBA 4X6CB 4PRPE 4C58B 4HWZA 4TNVK 4JRXB 5EBLB 5BS0D 3VFOB 3ARBA 1HN1A 4XBGA 2Y72A 4DVRH 2IC2A 2ORBH 4P23A 1EAJA 3I6KB 4UT9H 1RZJL 3DUSB 2IPKB 1F00I 2F19L 4MHHG 2DLFH 5CKAA 1CFNB 2DMKA 4EUPB 4WENB 1TFHA 2RFXA 4S1QH 3MMEB 5GHWH 1MFEH 1X4ZA 4OB5L 4WUKL 2VXUL 4JM2D 4Y2OA 4R0LC 5EA0H 1QRND 5CEZH 4GXVH 4ZODA 4OJFL 4QHUA 3FB6A 1KELH 1TJIL 2ADJA 3JUYA 4BFIB 4N5ED 4K07A 4CNIA 3L3KB 4F2MA 3WFBH 1NCTA 5D93B 4PG9A 3RA7H 4QRQA 4Z7UE 2XA3A 3C60D 3GHEH 5KSBB 1Q8MA 2J12B 1W8OA 3O4LA 3BWUC 1XCTB 3EYVA 1MLBB 3FN3A 4UU9A 5CJOH 5L2JA 2YPLD 2KH2B 1NANH 3LPWA 5KVEL 4HWZB 5CBAA 4GRLD 2HAZA 4WWKA 5FYLD 3ARBB 5C2BH 4XBGB 5C09D 1BOGA 5DJ0A 4P23B 4HV8A 1R3IH 3ARUA 5CZKA 4OD3L 3OG6B 4GMSL 3GSQA 5JO5B 9CGTA 3DVFA 3WFDL 3OKLA 2B0SH 4PJEE 5CZVL 3D18A 2ZUSA 1V3JA 5D71L 2RFXB 2GTZA 3HN3A 4Z7UF 3UBXG 2R1WB 3WIHA 1V3KA 4CJ1A 4LHUB 5D2LA 3H8NA 1NQBA 4FQLL 5CINH 5E9DA 4QHUB 3FB6B 3RI5K 3IGAA 1K6QL 4F2MB 4N0YL 2YRZA 1QBML 1IEHA 4HPOL 4PG9B 1OTSC 4WO4D 3ZTJG 1U8QA 5TH2A 3SO3B 4OZIE 4QTIL 4NN6B 5HHVL 3EYVB 4UU9B 2Q8AL 4PGEA 4PJEF 4J12A 1FGVL 2XXCB 1HYSD 5CBAB 2EDLA 1T1YA 4WWKB 2AK4D 3AUVA 1LVEA 1OD9A 3O6FC 3ARFC 3WKML 4NKIL 2CJUH 1YJDL 4XVUD 1BOGB 1NFDA 4GG8A 5DJ0B 2P24A 1UWGH 3K81A 3SOBH 4HV8B 2MPAH 3QHTC 3QXWA 4OGXL 1U42A 1BQLL 4RDQF 2EZ0D 5C86A 2GSIA 1NMBH 4IOFD 5C0DB 3GSQB 1J9CT 2CKBH 3D18B 5F8RC 4PRNB 1WWAX 2NY2B 2PKDA 3MRIA 2GTZB 2GK2A 1ED3A 1SM3L 2ARWA 4NDMB 4P57A 3QIUC 3INUH 4XX1E 3FOLA 4AIXA 5E9DB 5ADOH 4Z7OF 4K23H 4X80L 3RBGA 3IGAB 3IKKA 5HYJA 4HXBH 4NKOA 5LGJA 1IILE 3P4MA 2QTEA 5DQDH 4ODSL 4ZQKA 1AKJA 5GRJL 1U8QB 2AXFA 1LMKA 2CXGA 3HNVL 2Y4SA 4PGEB 1XGYH 5DD3L 1JYVA 4AG4L 4AJ0A 4KHXH 1T1YB 4R2GD 3RHWK 3F7RA 4GRWB 1NFDB 4YHPA 1CGVA 2P24B 1QG3A 15C8L 4LSQL 2EEBA 1WZLA 2GSGA 2GSIB 2XZCL 3CXDH 4LU5L 1S9WA 5FYJU 1JGVH 3MC0A 5J9PA 4NQCD 4OZHA 5D5MA 5HY9B 4DK6A 2IAMC 1DL7H 1KCVH 3OKYA 5HYFA 3MRIB 4D0BA 1LK3H 1ED3B 4QHKI 3UTQA 1MFNA 1ZVYA 2WQRA 4P57B 2NZ9C 3O3BA 3AS2A 1QTYT 2A6DB 1NBQA 4UQ3A 3QQ3A 4D0CB 4WFFD 5CFHA 4P9MH 5DLMH 4PJXE 4A6YL 1JE6A 3D9AL 3MBEC 4NP4L 3T2PA 5LGJB 4ODHL 1FZOA 4K8RH 3P4MB 5EORH 4PJDA 4LSSH 1I7UA 4RA3A 3MUJA 1X5XA 5CGYC 2LVEA 5JDJA 2HVJA 5HD8C 4ZQKB 5EH1A 3L9RB 1AKJB 2AI0L 4X7SL 4P2YA 5BO1H 4M6OH 3I6GA 1RK0B 3DVGA 2AJUL 3KXFD 3FONB 3SDDD 1MREH 3SGEH 3R0NA 2EYRA 5D7SL 4MS8C 5GGQL 2WINA 3HMXL 3E1F1 4YHPB 2CK2A 5DUBA 1S7QA 3MFFA 4LSUH 3OAZK 2DQTH 2PCPA 2GSGB 3GGWA 3QQ4A 2NY1D 4HDIA 1S9WB 5J9PB 4G5ZH 4MA8L 4OZHB 2N56A 5D5MB 2C3WA 2Y9RT 1YC8A 4NO5A 4X6FA 2DQCH 4JKPL 4D0BB 4F58H 5E1HB 3IJHA 4ZS7H 3NACL 1NGQL 3UTQB 1JWUA 4G80A 3O3BB 2EH7H 1OF2A 4YWGH 2VISA 3I2CL 3QQ3B 5TGBA 3NH7L 1CFBA 4KAQL 2H2PD 1KB5B 3U82B 1LK2A 5JXEA 3IJYB 1U8IA 4U3CA 4PJDB 1HHJA 1I7UB 4OF8A 2HVJB 1QSVA 4HHAA 5FHBL 4JFPA 5I1EL 1HWHB 4PG2A 4G6FD 4P2RB 5JHDD 1KCUH 3I6GB 3DVGB 3QXTA 2VLMD 2Z91B 3TP4A 2COQA 2EYRB 1IZKA 5DFVD 4Y1AD 2WINB 3FAWA 2AJVL 3IU4L 2PF6A 1TZGH 4MMZC 5DUBB 3MFFB 2FCBA 3MQIA 2PCPB 3GGWB 4PJIF 4LARL 4TPRL 1MEXL 3QQ4B 4HDIB 4DAGL 2X05A 4X6FB 1NANI 4MNQA 5MHSD 1XCQA 3IJHB 1W2KT 5J13C 4LASH 4ZSOE 2EO9A 1R24A 1JWUB 3TBWA 3MJ6A 5JOPE 1NGZA 2VISB 2PETA 4MB3A 2DD8L 5TGBB 1SJVA 3X11A 1UM4H 4XAKD 3FMGL 2BDNL 4R97C 5F7HA 1LK2B 1PBYA 5F1SA 4M1GH 3DNKA 2ZOKA 4G9FA 3OL2A 3CVHA 1T2XA 4UIKL 2GY5A 1GJIA 4QTHA 2B1AH 3BXNA 4HHAB 3HHRB 5I71B 3MOAL 5FAAA 4JFPB 2KUTA 3WO4B 2LTQB 2OLDA 3DI3B 3BSZL 3FFCD 4YJZL 4YDVA 1QPPA 2EDBA 1KEML 3FJTA 4JQIL 3MA7B 4OV5A 2VDPL 3O41A 4V1DE 1A0QL 3MLVL 2FO1A 2P8PB 2Z35B 4G6JH 4DGIH 2JJSC 4UOW1 2HP4A 4NPYA 4LKCA 3K0WA 3EO9L 3KYNA 4FZEH 5TE6L 5IVNA 3BIKA 1OAZH 1XCQB 4XMPH 4XNXL 1MCWW 3PF2A 3JWOC 4LLUA 4M03A 1R24B 1H3GA 1FVEB 3TBWB 2HG5A 2FX8L 1AI1H 1NGZB 4FQXA 4HPYL 5M7QA 3LDBC 5JQ6L 2E7LC 1GZPA 3X11B 2DDQL 3DURB 4LVOC 3VGDA 4U7KA 2LV4A 3VH8G 4HLJA 4CU6A 3MODL 3SKUD 4G9FB 4WUUA 3CVHB 2YZ8A 4QTHB 3BXNB 1KPRA 3HFMH 1DQMH 2DQEL 4HKBA 2A74B 4G6MH 4YDVB 3SDAB 1VESA 1WZMA 3TJHC 1GOFA 1CDBA 4ZTOL 4OV5B 5H35B 2FEEI 3MA9L 3TYGL 3ME0A 5D6DA 1QFOA 4KQ4H 2UWEA 1HILB 2FD6H 3FT3A 4NPYB 4JFOA 3QIWD 4OIIH 4HWEH 4LKCB 5GZND 1VCAA 1J1XH 1IQWL 1FV1B 2HFTA 4FQ2H 4XC3H 3P30H 1S9KC 3PWUA 2FGWH 4NCC1 3HUJA 4LLUB 4KROD 4TSBL 2HG5B 4KUCF 1IAIH 4FQXB 1I1AC 5I8KH 3W81A 3MV8D 4Z95H 1GZPB 4ETYA 2QSTA 2HMIC 4XRCA 2A73A 2RGSA 2MQ3A 3RWIB 3GMMA 3IXAA 4EBQH 1EERB 1OTSD 3BIBX 1KIRA 4WUUB 2EIDA 5DC4B 3ULUL 1INQA 4HJGB 3U7YL 4HKBB 5DWUL 4Q7DA 1TCMA 35C8L 3I6LE 1HNFA 5ESQB 1RZ7H 2Z0BA 1OPGL 5MP6L 1NEZA 2LAAA 1AR1C 3MNWA 3TLRA 3NAAL 4S1DC 5T3XE 1ZK9A 3O6FD 3ARFD 1IM3A 4I77L 1JYWA 3S5LG 4EI5A 3BGFC 5FHAH 1KJ2B 2UWEB 4JB9H 2ESVD 2SEBA 5CP3A 1U8LA 4BUHA 1UWXK 4JFOB 2HLFD 3DYOA 4X7EC 1N64H 3WUWG 1T6WA 4MB5A 1MCCA 1PSKL 2DI9A 2Q7YA 3PWUB 3SGEI 3I85A 3UTSA 1H3PH 5C0RH 1FNLA 2IH3A 4Y19D 5DR5L 5IBUG 5F1KC 4XXCA 5DQ9A 4DCQA 3FQNA 3X17A 2MCPL 2A73B 3GMMB 3IXAB 4K71B 1DLHB 2FRGP 3AVEA 4KMLB 4LHJB 1HZHL 5FGSA 1KIRB 1NBVH 2BNQA 5AD0A 4HT1H 2W9DH 3N85L 1INQB 5DJ8A 3KPTA 3WFEL 5LGKA 2NY0B 1Z5LA 4FHBD 4JCMA 2DLGA 4L4VA 2D0FA 1F3RB 5GS1C 4S0TD 4NQUA 1NEZB 3QEQD 4PJCE 1TPXC 1CT8B 3MNWB 1FNFA 4N8VG 1QEWA 3QXDA 1IM3B 4B50A 4JO1L 3PQYD 5B8CA 1F6LL 4FNLH 4EI5B 3S3SA 1IC1A 3FQWB 2SEBB 3QI9A 1R6VA 1U8LB 1IBGL 1NPUA 4N1HB 2QHRL 1UKTA 4N8PA 3RTQD 5B3JE 2R69H 2DQDH 3GJEA 4M48L 2VB5A 3BN9D 3IKCA 1UM5H 4LRIC 4LGRB 3VXUE 1MCBA 5KAQF 1CE6A 3AB0C 3BGAA 2Q7YB 1IGIL 3LS5H 4F7CB 2NZ9D 2NR6D 3KPSD 3UTSB 2V17H 4DKDC 4L8CA 4LCCC 4LQ1A 2IH3B 1BLNA 1Q1JL 5DQ9B 4DCQB 2GHWB 3FQNB 5F7UA 5C9JA 4NQTA 5TQ0H 4PJCF 3NCYP 3MBED 1E4JA 4J6RL 4KKAC 1UT9A 4D9LH 3TH2T 3P11H 5D2NC 5J1SC 4P9HH 4JR9L 2WMPA 3QWOA 5AD0B 2FHCA 5HD8D 5T5FL 1BHGA 1Z5LB 1PZ5A 1MWAL 5B3JF 4L4VB 1E0OB 4O5LH 3JTSA 1FZKA 1MPAL 4R4ND 1K9TA 3TT1L 3QXDB 3KNBB 2IPUK 5B8CB 4GO6B 4AQ1B 1ORQA 3B9EA 5FO9A 3IETA 2XWJB 1X5FA 3OAUH 3QI9B 1RIUH 5IV2B 3RVWD 1PW3A 4R96A 4CVXA 5L88L 3GJEB 4N0UE 2C4FU 4U4BA 1D6VH 1Q9KA 3IKCB 4NRXA 4ERSL 4XP5L 1WAAE 1BPVA 5MENA 3QHFH 4X5WA 4Y5XA 3TWCL 1OB1A 3QUZD 4YXKH 4XP6H 3QWQB 1FAIH 4HLZG 4RMVA 1KJ3H 2VLRE 4BH7A 1IL1A 4L8CB 1UB6A 2FX9L 4Y4KA 3LRSA 1BLNB 1NLBH 2M8XA 4QXWA 1MFAH 5C9JB 4A6YA 4KVNH 3E2HC 3CJJA 5FYKD 1NCBL 2AXHA 5GGTL 5ITBL 1OT2A 3ULSB 3QWOB 5DF0A 2PYED 4OSUH 1PFCA 4OCYL 1VGEL 3JTSB 1WAAF 1FZKB 2VXSH 5BRZA 1IFHH 1TZIA 1RHFA 4MD5A 4ZNCD 4GAGL 1DBKL 1G0DA 2ZSVA 4MX7A 4NKMA 1ORQB 2F8OA 1A9BA 5FO9B 3IETB 1JWSB 2VL5A 1JJUA 3QG7L 5HYSG 2A1WL 4IDJH 5IIEA 4IBLT 4N9OB 4R96B 4CVXB 5FK9B 1Q9KB 3GIZL 4YHZH 4NRXB 1T04B 3IRPX 2DQUH 4W4OA 4APQA 5MENB 4MJ6A 2FZ3A 2P42B 3OKMB 4X5WB 12E8L 4Y5XB 1OB1B 2F74A 2HKFH 4RMUA 2LVCA 1I3UA 1IL1B 1X5HA 3BP7B 4XPHH 4Y4KB 3LRSB 2YEZA 1UM6L 5D7JA 4QOKA 2AEPL 1OAXL 4A6YB 4JFFA 3QRFM 4AEFA 4NC0B 5HI4C 5TF1H 1BQHG 2OTPA 4D9RE 1K8IB 3QXVA 3RY6A 3JUZA 3AY4C 1P53A 4YBQD 2R39A 4DGYH 5I17B 1OSPH 5GRYA 2Z8SA 3BO8A 3GI9L 5CSBA 4ELME 4G8FA 4G7YH 2YRLA 5BRZB 1TZIB 5FFLA 4MD5B 1T0MA 2M26A 1AP2A 4JJ5A 1RUQH 2ZSVB 4IHOA 1NCCL 4MX7B 4NKMB 4X7TA 1OP5K 1A9BB 1S5HA 1C5BH 2VL5B 4XNYL 2VZSA 5GS0L 5D7IA 3BPOB 1V7ML 3T0EB 4MJ4A 4RAUB 3VCLA 1NMAL 3D69A 4S1SH 4APQB 3MZTA 4MJ6B 2FZ3B 2I9LA 1F3DH 1W72H 3QULA 1CFQA 2F74B 5EZOH 3QDAA 1A6TA 2BHYA 1GGCL 4P2OC 4NC2B 5E0QA 4ETQA 2Z92A 5DJYA 2XG4A 2YEZB 3KGRA 5D7JB 1FDLH 4QOKB 5FGBC 2LABA 4JFFB 3CXHK 2NCMA 5C0JA 1A7RH 3TA3C 3G6DH 3NPSB 1MIEH 5GGVL 3D5OF 1CE1H 3VWKC 4HEME 1WFTA 3UMTA 3LPFA 2X6MA 4FQJH 5TF0A 3K74B 5DZNA 3BO8B 3IDYC 4LPCA 2CRIA 2RAMA 4M43H 5HHQA 1ADQL 4NQED 1KULA 1T0MB 4NUGL 4JJ5B 1WEJL 3SE9L 1L6XA 4IHOB 2V5SA 2Z9TA 4ODTL 2NXYB 4X7TB 1YEDA 3QDME 4Q9QH 2FHFA 4MVBC 1S5HB 5T3ZL 3I9GH 5D7IB 3VXME 3C5JA 3LSOA 4OCWL 3VCLB 2J5LB 4KH2A 3LPGA 3GB7A 1J1OH 4PGBA 4HXAH 1CDCA 4QHNA 4WEBH 3OKDB 3QULB 5FF6A 1CFQB 4TULL 5FYJL 1MHPL 2J4WL 4WI9A 1A6TB 1X5IA 3OR7A 2FH8A 4ETQB 1UKSA 2Z92B 5DJYB 1NGPL 1SJHA 5C07D 3KYAA 1ZLVH 4XHJD 4NC1E 2NY3B 3WMSA 2QL1A 4MZ2A 2YUVA 1J0HA 1G7HA 5C0JB 3VGFA 2VDMH 4XNMA 2FLRT 5I18H 3EYSL 5EPMA 2R4SH 3Q5OA 5DD1H 1CTOA 4NZTH 2CLRA 4H0IA 3KHOA 1VGKA 4JPKL 3LRGA 1YQVL 3O8XC 2W0KA 4NHUA 2ZG2A 1AR1D 4S1DD 5EUOF 4XP9H 1GAFL 5HHQB 1XF4A 4LCIL 1FBIH 4LCYA 4WY7L 1NUDA 3QEGH 3FRUA 4IMKC 1OGTB 1I8LA 3AXLA 1YEDB 2YD1A 1B90A 1RU9L 4OUOA 2CGRL 2DI8A 5JQHC 3LSOB 4M61B 1FO0H 3KPLA 4XVTH 5I1KL 1U95A 4FQPA 3GB7B 3V6OC 1EJOL 3HE7A 4KK5C 4Y16C 2IANA 4QHNB 5SWQA 3P4NA 4FXKA 2VDRL 5FF6B 1KJVA 4WCYL 2F5BH 3OR7B 1JF1B 3RZWA 1SJHB 1ZVHA 3MV9E 4NWTL 4UILH 3GMNA 2FL5B 4ZO9A 3RGVB 4WHYG 1G7HB 3V5HB 4IMLA 1KF9B 4XNMB 4Z0BL 1T66C 5CEYA 3RY4A 3HPJB 4HUUA 3H9SA 3FCTA 4Z7NE 3HAEH 5GGVY 3CIQA 2CLRB 3QNZA 5E2VH 1VGKB 3W2DL 3JWDH 2B4CC 2L4OA 1E6JL 4CJ0A 4U1KB 4RX4D 2VDLL 1YPZE 4NHUB 2DQHL 1YY8A 3BKCL 1IJ9A 4HMCA 4ZS6C 6CGTA 1F58L 3O2DL 1VFBA 3GJFK 4Z9KB 1LEKA 1OAUL 4HIXL 1XF4B 2LU3A 1FRGL 4AMKL 3FQTA 4LCYB 3FRUB 3BQUD 1S7WA 3AXLB 4JFEA 2RQ8A 4JFQA 4NZUL 3TNNA 2MTPA 3GMQB 3KLHC 3VA2C 1JZ7A 4ZFGL 2P7TB 3HE7B 5EDXA 4XPAL 2IANB 2APWA 5SWQB 3CX2A 4FXKB 4Z7NF 1KJVB 3ALXA 1URLA 1F4WL 4F15B 4KK6C 3L5WA 3LKRA 1YPZF 2E6JA 3RWJA 3RVVD 4YHIA 1AJ7H 1B6DA 2AXGA 3CDCA 2UUDH 4JY4A 4KKAD 5IR1A 4IMLB 4HMEA 2F53D 5C0AD 5CEYB 4KY1L 1UCTA 3PIQB 1MRDL 3TT3L 2YUXA 5IBLC 5A3IC 3IFOA 1JRHL 3H9SB 3FCTB 2J8HA 1S9XA 1DLFH 3QNZB 3R1GH 1NKOA 1AE6L 4KXZH 4DGVL 1VHPA 2X7LB 4H8WL 1TVHA 5GRUH 3M1BB 1YY8B 3OXRA 3PWPA 3PWLA 2GQHA 1VFBB 3L3DB 1LEKB 3EZJB 2KZWA 4CMHC 1QNZH 1T20A 2XT1B 4BSWA 2ICES 5BS0A 3V4VH 3FQTB 1H9VA 4LPVA 4Z78A 4RIRA 4UB0H 1S7WB 1NMCB 4JFEB 4C56E 4JFQB 2XTJC 3TNNB 1ZWIA 4PTTB 2N4IA 2O61A 4OFYD 2VZOA 4JHAH 2DWEA 2ID5A 3F7YA 2XV6B 1BBJA 4HMDA 4PJHE 5A2FA 1N6QL 3VXNA 2CMRL 4N1EA 1NAKH 2A6JA 2VH5L 4JM2A 2BOBA 3VXTA 1D9KD 3L5WB 4Y7MA 5MEOA 3LKRB 3RWJB 4OV6F 4XX1G 1VA9A 4L5FL 3U4BH 2AXGB 1JTPA 3U48A 1UCBH 1YECH 4JY4B 5IR1B 4UUJA 3V4UH 1MI5B 3IFOB 4OM1L 1I85C 1J0ZA 1S9XB 4C59B 5J3HC 3C60A 3RQ3A 1TVHB 3GSXA 4KI5D 3BE1H 2XIDA 1HOCA 3PWPB 1XGQA 2DTMH 4PJHF 2VQTA 2YPLA 1T20B 5F7KC 3T09A 3GZKA 4BSWB 5BS0B 4JO2L 4GRLA 2YMXH 4KRLB 5KVDH 3RKDD 1PKQA 3LQAL 4RIRB 5C09A 5BZWA 4AL8H 1AFVL 4MJ5A 3UJJH 4LAQL 5CZXD 1ZWIB 5CJXC 3V0VA 2O61B 3WD5H 4NBXB 2WLZA 1OP9A 1T7ZA 1DVFC 3F7YB 1BBJB 1G0YR 3O6KH 1Y0LA 2HFGH 3VXNB 1PLGL 2QQQA 1T0PB 1H3XA 4EN3C 2A6JB 1YNLH 4JZJA 4UV4H 4JM2B 1TETL 2BOBB 3VXTB 4UINL 5KW9L 5MEOB 1QRNB 4PTUA 5SWSD 5BVJA 2QSCH 3OQ3B 5IVXA 1G7PA 3FT2A 5HI4D 1TNNA 5GGTA 3HTLX 3L5XH 4LDLB 4UUJB 3U30C 2VMFA 4J3VA 1EBAA 2XN9D 3U0TA 4NQXA 3FN0H 5GJTH 4ZOCA 3EOTH 4ZTPL 4OJFH 4PJ9C 4OLWL 1H5BC 1Z0NA 4QRSA 5FV1L 1TJIH 3C60B 4WO4A 5GGUB 4WTZG 3OGCB 3GSXB 1HOCB 1WCQA 1CICD 2H32A 3QUML 4JJHA 3WBDA 5F9OH 2YPLB 4HKZB 5JIHA 3V6OE 1F4XH 4TTGA 4BKLA 4L3EE 3ZYJA 1TCRA 4DVBB 4GRLB 1TTFA 2IFFL 1CDYA 3RDTD 3U0PA 5E2TL 1PKQB 2XZQL 5BZWB 3GSOA 1G6RH 5C09B 4MJ5B 5CGTA 3S36H 4RFEA 3LRHA 2UZIH 2YPVH 4J23A 3V0VB 3LHPL 1OLZA 3G6AA 4ZD3H 4ZAKC 3CMGA 4AENB 3Q5TA 1CI5A 2CDEA 3VRJA 2R4RH 4M6ML 2XFXA 2NTFA 3W0WE 4I18B 5E56A 4JZJB 5IOPA 4LBEA 4R4FH 4RNRB 4PTUB 4MJIA 5JR1H 4R3SA 4GMSH 2D7QA 3TPUA 5AYUH 3WFDH 1G7PB 1QOKA 5IVXB 1R5WA 3FT2B 4HS3A 3TA3D 3X3FH 2D4FA 1FAKT 1DFBL 4XWGL 1RURH 4WVRA 2Y25A 3QAZC 4QT5A 4NO0A 2R0KH 3U0TB 4NQXB 4LSVL 3V4PH 4R26L 1PY4A 3GBNL 4WFGD 2WIMA 4WO4B 1IEBA 1H0DA 3Q2CA 5HVFB 1C12B 4YXHH 4XCEA 4GS7C 4N0YH 1T5WB 4HFWA 1QBMH 2WUCL 4D8PA 5I8EB 3R06A 3UZEA 4BKLB 3D0LA 1TCRB 4OFIA 3U0PB 5I1HL 2B20A 3AREC 3GSOB 3PNWA 4J4PA 3RNKA 4MVBD 4ESKA 4JREC 3EYQC 3G08A 1XFPA 2X89A 2YPKA 3VFWA 4RFEB 2DKMA 3VXQA 5LQBH 2JCCF 4NQCA 3VRJB 4NYLA 2XFXB 4DFIA 4TNWK 4GH7B 4XZUA 2NTFB 3B2VL 5IOPB 4OGXH 4LBEB 1BJ8A 4AQOA 4MJIB 4R3SB 2GI7A 4M93C 1R5WB 4HS3B 3SCMA 4NFDA 3HB3C 4P3CL 4LIQL 4PRID 4QT5B 3MGOA 4NO0B 4CN6A 5J11B 3V5KA 5FUOH 3THML 3BKML 1IGFL 2IGFH 2CD0A 4LSTH 1IEBB 1H0DB 5E4EC 4XCEB 5D1XC 4RMRA 4HFWB 2HJKA 4D8PB 2F9BT 3KXFA 3R06B 3SDDA 3U2SA 4XAWH 3P9MA 2UYLB 5C6WH 4ODSH 4R2GB 2FYYA 2OS7A 3PNWB 4PRHD 1Q9LA 3RNKB 1P5UA 3MO1A 3FQUA 5F3BA 2YPKB 3VFWB 4U3HA 1B4JL 1PEWA 2L0DA 3VXQB 3VWJC 5IM7A 5L2KD 5EBGA 4WV1C 4Z7VA 4NQCB 4Y16D 3ZKXB 1U41A 1CZ8L 4NYLB 4XZUB 4PR5A 15C8H 4LSQH 4X8XA 3QR2A 1MNUL 2J88L 1JZ4A 1J8HE 3MUY1 3O3AA 4X4ME 3BDYH 2GY7B 1T66D 1QFHA 3K7UA 3MGOB 5SWZA 3UDWC 2FBJH 3MCLL 2APXA 3V5DA 3V5KB 2NY6B 1S7VA 3A6CH 5HVHB 3EKCA 1QFWM 3AMLA 3EHBC 4Y4HC 4NHCL 3VDAA 1A02N 2OI9B 5KZCD 1KYOK 4N1CA 3KXFB 3SDDB 1KTDA 4PJBA 5C0CE 3PABA 3U2SB 3P9MB 1FL6A 4WWID 1NBYB 1I1RA 1Q9LB 1YYLH 3MO1B 3FQUB 1NCWL 4X7SH 3KLHD 2BY1A 3DO3A 2P43B 1CXHA 3L1OH 4QRPD 3HC0B 1UJTA 3ARDD 2NY1B 1T21A 2YUZA 4Z7VB 4XP1H 3HMXH 3T3ME 1A7QH 2XA8H 2H1PL 4PR5B 4CW1A 4OQTL 1BVLA 3CFKA 3CLFL 4KK6D 5C70A 1INEH 1CQKA 5DUML 4JHWH 3BAEH 3MJ9L 5FO8B 2WSKA 4M6NH 5LBSL 1NGQH 5IBLD 1U91A 4GUPA 5J6HA 4XCYB 4XC1H 1ND0A 3FTGA 4MB4A 1JI2A 3V5DB 3G5ZA 5IESL 1S7VB 4PY7A 1T1XA 5D9SB 2X44D 2WBWB 1N7ML 5L0QB 4E0RA 1OAKL 1ZEAH 3NH7H 2EEAA 3EDEA 4G6FB 5JHDB 4NNPL 3FFCA 5F1OB 4YFLF 1T0NB 5AZEL 2R0WH 4M7LH 3T3MF 1JNJA 4PJBB 3PABB 4BUGA 1A1NB 1FL6B 4X4XA 5FHBH 3FO2B 5TE4L 4Y1AB 1GC1L 4POZC 3F58L 2XTJD 5I1EH 3OG4B 4KZEH 5I73C 3HE6C 3P0VL 3TO4D 1RFDH 4G3YL 4Z7QE 4UQ2A 1T21B 3LAFA 3DGGA 4FTVD 4YQXH 2E7BA 1AO7D 3IU4H 3EDJA 1UZ8A 4OFVA 4CW1B 2QEJA 5EOCH 1BVLB 2VDKL 3CFKB 3SO3C 2VR9A 3OKOA 4NN6C 4TPRH 3QUYD 4BYHA 5KSAC 1CDIA 3PDOA 2UVEA 2ARJQ 4WWKC 4O4YL 1OY3B 1S7UA 4GUPB 1QYGL 1Z9SA 5J6HB 2WM0A 3BT2H 3FTGB 2RIKA 3G5ZB 2HLAA 1ZA3A 4H26A 4PY7B 1ZLSL 1T1XB 5DHVA 1ZAGA 1BFVH 2X4TA 3UBXA 4E0RB 4GXUN 4Z7QF 4PRAA 4PJ5E 3D87B 4UMGA 2BDNH 2HFEA 4TRPL 3FFCB 1TXKA 2D9QB 5LXGL 5C0IA 2BVPA 5ESVA 4G9DA 1P84J 4LEXL 4X4XB 2DLTA 3U46B 1E27A 2VZVA 4JKWA 4M1CD 3BSZH 1SYSA 4KQ3L 1Q38A 1KEMH 5DJ6B 1H15A 5K33A 3QIWA 1BFOA 4UQ2B 1TVDA 2VDPH 1DQLL 2VZ3A 2J3SA 3DGGB 4JM4L 4PD4J 3TC9A 2DQIH 4X8JA 4EN3D 1UZ8B 4ZUVA 2OJEA 4ZYKA 4BFBD 4UT7H 1AC6A 1E4XL 3MRCA 4N8CL 1MAML 3RL1A 3VFVA 4TTDD 1OAYL 4QO1A 1HINL 3PDOB 4OGYL 5I0DA 3TF7C 5GISL 5DRZB 5I1AA 5E2WL 1MY7A 2NW3A 4XCFH 1CDGA 1I75A 5DDHA 3RZCC 4NKQB 4GFTB 4L4TD 4PJ9D 2HLAB 1ZA3B 4H26B 3HG1D 2AJXL 3NCJL 5DHVB 5JW3H 2X4TB 4OZFG 3P0YL 3UBXB 4QRRE 3ULVC 1IQDA 4JY5H 3WDHA 2DDQH 4K3JL 2HFEB 5GRWA 3O9WD 3T04D 4UNTA 2FATL 1MIML 1D5MA 2XOTA 1EO8L 3MACH 5FV2A 5BOPA 2BVPB 1BX2A 4PJFA 1GHFL 5F72S 5TPWL 1N5AA 1PZUB 2DQEH 1E27B 3C08H 5C0BE 4JDZB 4ZAKD 4X6CE 4DN4L 1H15B 4I5BA 3QIWB 3IFPA 4ZTOH 4NRYB 4NCDA 5E03A 4AEEA 3MA9H 3TYGH 5HGDA 4X8JB 4ZPTB 2HT2C 5DD0L 1SY6A 3RIAF 3UJIL 4ZUVB 2OJEB 4ZYKB 4PV8B 1I7TA 3DV4A 2EDHA 3RWHA 5DA4A 4KROB 5E5MA 1QFPA 3RL1B 1MHEA 3VFVB 4RGNB 4DQOH 2CRMA 4RQQB 3L3JB 3CFDB 5F7EH 4YPGA 2NW3B 2JJTA 4FQCH 4R8WL 3WEXA 3WDJA 1JYNA 1EMTL 1KXTB 4P46C 1BD2A 4OCXL 4I8DA 5EWIH 3I75A 4PIRF 4X6CF 1WBXB 3RX5A 3U4EA 4Z76B 1IQDB 4YHKH 4QWWC 3QUMA 5C08D 1X5AA 2R0LH 3TBYA 1LD9A 5CEXA 1YYML 3QEQA 4L9LA 1WJ3A 4PJFB 2KKQA 3U7YH 1N5AB 5KSBE 5DWUH 4K2UL 1FYTE 4MXVE 4Q0XL 2OR9H 4EIZC 5MP6H 4PJ8C 2Y06H 1OCWL 4I5BB 5DVOA 3IFPB 3RTQA 1MRFL 2FECI 5BV7L 3CPLA 4MQ7A 2DICA 1G1YA 5HGDB 4UIMA 1KENL 3DV4B 3SJVD 4FABL 1KCSL 1ACZA 2H2SC 5E5MB 1DZBA 1RZIA 1MHEB 4Y19B 4XVJL 4OCRH 4HFUL 4EDWL 3MUHL 2A6IA 2ICWI 2XKUA 2O5ZH 4U1NA 3MBEA 2BZDA 1I9IH 1N4XH 4P99A 4YPGB 4L4JA 1DCLA 3WEXB 3QG6A 5HPOA 1H8OA 2AERT 4E42A 4Z8FH 4HGMA 5KSBF 1T1ZA 2YD5A 3Q6GL 4HG4K 4NKDB 4MXVF 5DR5H 3KHQA 5J1AA 3C6SA 3U4EB 4XT1C 4Y5YC 3QUMB 4E41A 5FA4A 2MCPH 1LD9B 5CEXB 4L9LB 3QEQB 2QADD 2AS5M 3N85H 3PQYB 3TZVD 3CUPA 5MEPA 5I2IA 3NCEB 1ZS8A 3MV7D 4ZFOB 1UH4A 4ODBD 4PLOB 3VWJD 1TZHB 3RTQB 4JO1H 3CPLB 3WCYA 4MQ7B 3PHQA 1O0VA 2H8PA 3GSWA 1MH5A 4UIMB 4DVRL 3OB0K 1FIGH 5I71C 3QUZA 2ORBL 4MWFB 3WO4C 3QDJD 4UT9L 1EJ6A 2M2DA 1RZIB 5DZOA 2HRPH 1Z3GH 2ZP0T 3WLBA 3C8DA 3I02A 4NJAL 3HAEG 2A6IB 2UY7A 2GYSA 2PR4H 3MBEB 5JTWA 1VSCA 4AIOA 2W1NA 1VACB 3QG6B 4ZOAA 4E42B 5GHWL 1MFEL 3IU3A 1T1ZB 5FYKU 4KI1A 1F90L 2EDFA 1Q1JH 4K3EL 5EA0L 5E9DE 1AQDA 5CEZL 3MRRA 4GXVL 4EUPH 5J1AB 1ZLWH 3EHBD 4Y4HD 5F9JA 3C6SB 1XF2A 4UT6H 4XBEH 3MRDA 3D3VD 4NZJA 5FA4B 1NSNH 1B2WH 1NGXA 1LO3L 3L6FA 1L0XA 1RI8A 3B9DA 3WFBL 3V52H 3GHBH 3TBVA 3CUPB 5MEPB 1JYXA 1B0WA 1ZS8B 1MWAH 1KCKA 5A2KH 4JY6A 4U1LA 3MLYL 5CJOL 1MPAH 2Z4QA 2AEQH 4U7SA 4WDIA 1U3YA 4G8GD 3PHQB 2H8PB 5F21B 3GSWB 1MH5B 1NFDE 5TE7H 5E2UL 3QUZB 4O02H 4HW6A 3NBNA 1FFQA 2CH8A 1R3IL 3S8WA 5FUZH 3ULVE 3WLBB 3I02B 2B0SL 3DROA 4I2XE 1N6VA 3ETBF 1RVFH 4KMTL 3TWCH 1U3JA 3ARRA 3IU3B 3IFLH 1NCDH 2PYEB 3AROA 4XBPA 1KGCD 1PAMA 1AQDB 3MRRB 5CINL 1KG0A 2G5RA 2NYYC 1XF2B 3SGJC 2DB8A 2WAHA 3N0PB 1NGXB 5E8OA 5HDLA 3L6FB 1HYRC 4HWBL 4GRWF 1NFDF 3WL9A 1I1YA 3TBVB 1G9MH 4POZD 3VH8A 1VGEH 5F6HJ 3HE6D 4JY6B 4JVWA 3ULVF 3X12A 4U1LB 1BZ7A 2YD4A 2Z4QB 4JAMA 4CUCA 3R8QA 4WDIB 1J88A 2P5EA 4KC3B 2VZ1A 4OM0H 2KL6A 4LSDA 1YEGH 3WFCH 4OQTA 1KT2A 4X9GA 5J13B 2CJUL 3MRBA 3BZ4A 3QG7H 1UWGL 5I30H 3O4LD 3SOBL 5F1IB 5EZLA 3T8XA 2RHEA 3MX0A 1KIUA 1M6OA 4S0SD 5KSAD 1KXQE 1NMBL 5D5ME 1S5IH 5EU6E 2OSLA 1KTLA 3DROB 4WWKD 5GGSY 2CKBL 3ET9F 4YHLH 3DWTA 3E8UL 5CKGA 3STLA 5T5NF 3LKNA 1D5BA 1RZJC 2XQBL 4JQXA 3INUL 2AEPH 5ADOL 1RD6A 4G6KL 5E8OB 4HXBL 4PP2A 3UTPE 1FL3A 2BSRA 3WL9B 1CLYH 1I1YB 2P8MA 1N59B 1HI6A 1CLCA 3RU8H 3BI9X 1CBVH 4J3UA 5DQDL 2HVKA 1CCZA 3VH8B 5DJCA 5I19H 2EC8A 4P2RE 4OZHF 3TNMB 5D5MF 1VADA 3X12B 2XG5A 1BZ7B 2W92A 4ZO6A 4JAMB 1OAQH 3QXUA 4MDJA 1NCCH 1FFPA 3W11C 5JW4R 3MRBB 3HI5H 3BZ4B 4XNYH 2ZUTA 1MCOL 1MCPL 5EZLB 3T8XB 5C07A 1M6OB 3CXDL 1JGVL 4LVOB 2OSLB 1KTLB 4MAYD 3SY0A 5GJSL 4PJDF 1DL7L 1KCVL 3STLB 2Q3AA 3RZCD 3ARZA 3LKNB 3WUWA 1D5BB 5IQ9A 3R4DA 5SV3A 2O5XH 3IJSB 3IDXL 4LSRH 3TYFA 1IGCH 2J8UA 3G5XA 4MSWA 3X3GH 4P9ML 25C8H 1ROWA 3PGCA 4PP2B 3I50H 4HIHA 4MQSB 1WFOA 4ODVH 1FL3B 2BSRB 4K8RL 4NQEB 2CDFA 5EORL 5FKPA 4LSSL 2AW2A 2P8MB 3K4AA 3C2SA 2Q3ZA 3DMMD 5DJCB 4XXCC 5CJBA 2VERN 1U9KA 2C26A 3SDXB 1K3ZA 5BO1L 5HYJD 5IMOB 1MREL 2JKXA 1DQDH 4NUGH 4FFYL 3SE9H 2HT2D 1WBYA 2FIRT 1FFPB 3REVA 1II4E 4WNQA 3ARWA 5KS9B 4N8VA 4PYGA 5IHLB 5JZ7C 2XI9A 3L7FA 4LSUL 3S5LB 1FCGA 5C07B 4G43B 4WTXA 1PYWA 4FFVC 3B9VA 3SY0B 1YJDC