5GZNC

Structure of neutralizing antibody bound to zika envelope protein
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
227
structure length
223
Chain Sequence
EVQLVESGGGVVQPGRSLRLSCAASGFTFSSYAMHWVRQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDNSKSTLYLQMNNLRAEDTAVYYCARDHLGWSSIWSAPESFLDYWGQGTLVTVSSASTKGPSVFPLAPSSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Genome polyprotein
publication title Molecular determinants of human neutralizing antibodies isolated from a patient infected with Zika virus
pubmed doi rcsb
source organism Zika virus
molecule tags Viral protein/immune system
total genus 42
structure length 223
sequence length 227
chains with identical sequence H
ec nomenclature
pdb deposition date 2016-09-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5gznC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5gznC01
4M62L 4OV6F 4U1LB 1F58H 1FBIL 5TF1H 2L4OA 3WUWG 1CFVL 5JOPE 5AD0B 3BGFB 1DN2A 3L5JA 5EIIB 4X99A 3MGTA 3K2MC 3P30H 4MSWB 3Q3GB 4P59L 5CSBA 1SEBB 5KSBF 3MO1A 3AFLA 3H9SE 3O3BA 3ZSTA 1JYNA 1S7QA 1FZOB 1U0QA 1U8JA 2UZXB 1VB9A 3ARGB 1LO4H 1AXTL 2NCMA 1HK6A 3CSBA 2H32H 5IK3A 2DLEA 3IDGB 2CJUL 1QFWH 3HG1B 5F70A 4YQXL 5CJXA 4YBLC 2DQDL 3MJ9H 1KPRB 2J6EA 5HHOB 3JTSB 5EBLA 3L3HA 4GS7B 5F8RC 3K2UH 2CKNA 1UB5A 5IB5A 5D72L 2VH5H 3WUZA 3W5MA 3EDFA 3O4LE 1AIFA 4Z9KB 3NA9L 3VG9C 4G8EA 5I73C 4LFHD 1IAOB 5T3XL 4MJ2A 3VXUD 4M93B 3ULVL 3GHBL 5ADPL 2FL5B 4P46A 3LMJH 4K9EL 3CH8A 3B4NA 5ILTH 1Q94B 4E41D 1C5BH 4K7FA 1MLCA 1LGVA 4PLKC 1A1MB 1QYGH 5F1KC 4MB5A 2AK1H 2Z35B 1JYVA 2CH8A 4F7CB 3GSNB 3QB7C 1F11A 4KK8D 5C0AB 5IVNA 2VIRB 2YWYA 35C8L 3RVTD 5IHUL 1HE7A 1QNZH 1RUAH 3OXSA 1NCDH 4R4FL 5EC1A 5TQ2H 2X89A 3HC0A 1T5XB 1YY8A 4PB0H 3LZFH 2OXHA 2YBRB 3MLRH 2AI0H 3P40A 2XTJD 1OAQH 3HZYA 1OP9A 1NAKL 2FBOJ 4DVBA 3BQUB 1NMAL 1PLGL 5FYKU 2BNRD 4OGAC 5EORH 1O5DT 3KYOA 2HKHH 3B3IA 1I9IH 3ZL4L 1TCRA 5IVXB 3LVEA 4JY5L 5EU6D 5MHSD 5DK0A 3MRDB 4AIXA 3FN9A 4WI6A 1JRHI 1X44A 2P5WB 2GCYA 3MJ8B 3QDGA 4IIQA 3ZDYE 4LVHC 4J6RH 1PZ5B 1FCGA 4NKOB 1KFAL 4TSAH 4Z7VA 5HDBF 4JFDD 3HUJA 2CDEB 2C1PB 2PW1A 5HYJB 4GG6F 4D9QD 4GMTH 2FR4A 1RJLA 2VN7A 5CEYB 4HXAL 1HI6A 3DO3A 1RZIA 1FJ1A 3H9ZA 4P23C 3HLAA 4JQVC 4ZAKB 5ANMA 3V52H 4P5KB 5HHVH 4CMHC 3N1FC 4LCUB 1BFSA 4JQIL 1NUNB 5TF1L 4YK4B 3E1F1 3TFKD 2BNQA 4PR5A 2NR6D 2JLLA 4ZS7H 4LCWD 4P5MA 2FD6H 4NHUB 5BW7A 5A43C 3OF6D 1A3LL 2A38A 3VRJB 2Q7NA 4F7PA 1LO4L 2XY1A 3V6ZA 1NEZG 4DWHA 3K8LA 3SHSA 3TO4B 1KYOK 2VN4A 2YWZA 5MENB 1YMHA 4X4ME 5GS2D 4PGEB 4EN3C 1HEZA 1T66D 1A1OA 2GK0A 3WHXB 1RHFA 3K2UL 5IT2H 2VH5L 2FIKA 4Y16A 1CDHA 4HJJH 4J12A 2AVGA 3KHQA 5I30H 3C5SB 3QO1B 4ZDHA 2GUOA 2R9HC 2XWBB 4QRPB 3LPWA 5C0CB 2Y72A 5GGRY 5EIIA 4L8SB 2CQVA 3MODH 5ILTL 5L6YH 1SEBA 1C5BL 3CFIC 2PO6B 3WJJC 4KJQD 5GGRB 3WL9B 1ZE3C 3VRLF 4PYGA 2YD5A 2XN9A 3RTQB 4PB9L 3IDGA 3TBSA 3HG1A 1K2DA 4QTIH 2WBKA 5D96B 2F53D 2R29H 5SX4I 3VCLA 2BHYA 5HHOA 1QNZL 1DR9A 3KYKH 1DSFL 1QPPA 5DUBA 3MLWL 2J3SA 2BERA 5TQ2L 3KPSD 5DJXA 3WE6B 3VDAA 4Y88A 4Z7QE 4RWYL 4ZFOA 2NZ9C 2VLKB 2X7LB 2NYYC 4XVSH 3MLRL 4UDUA 1OAQL 4FQ1H 4HX1B 4ZS6D 3F65A 5JIHA 5FO9A 4PJIB 1UB6A 1I9IL 5SX5K 1A1MA 1WAAA 3I50H 5DHVB 4PJBE 5FDWB 2Z35A 2D0GA 4F7CA 3GSNA 4GRWH 1Q8MA 4Z7WF 4J6RL 3UBXA 5GRJH 1BFOB 2VIRA 1MCFA 4QKXB 1ZTXH 4GMSH 2APBA 3SDDD 1NBYA 4BSWB 1T5XA 1KEML 4GMTL 3GRWL 3CGTA 5GGQH 4PJCF 3VFSB 5TPWH 3MRGB 4K55A 1N0LA 1QP1A 2GJ6E 2YN5A 3CK0L 3KG5A 4OSUL 2ICES 4KGLA 3V52L 3EOTH 4EI6B 4LSTH 2DTSA 1RZGB 4U6XA 3C5ZB 3RWGB 2JELH 5HI5D 3BIKB 3ZKNC 4MXVF 5HXMA 3LRGA 1X9QA 3C8KB 1D9KC 1YZZA 4ZS7L 3PUCA 1F6LL 3MJ8A 3GFUA 1PZ5A 2WBJC 5F7KC 4NO3B 1CE1H 3O3AA 5TFSH 3EO0B 4F57L 2CDEA 2IMNA 1GGIL 4MDIB 4U3HA 1GZPB 3C9NA 4X7TB 5HYJA 1GAFH 5C08E 4UBDC 3L9RB 1VCAA 4TTGA 1FFOB 1MF2H 1YN7B 5DC4B 5IT2L 5BZDB 3UTZA 3K8MA 3M45A 2IF7A 2OK0H 4ELME 5C2UB 4HJJL 2E7LA 3QHTC 3REWB 25C8H 5I30L 4E41A 3O4OB 3ILQC 1BEYH 3TVMA 4PJ7E 1J10A 3UTQB 3TN0B 1G6RB 1WSST 2ZCHH 4IDJL 4K2UH 5DUMH 2DWEB 1G7LB 5BJTB 5DMKB 1EGJH 1I75A 2J8HA 4K94L 1HINH 3DV4A 4K71B 3IYLW 4NHUA 5A40E 3MLSL 2VXTH 4KROB 3TZVB 5D2NC 3VRJA 1ZLUH 4GXVH 3G04B 2Y1VA 1NCNA 1W72H 1QUNA 1RIVH 3TO4A 2KZWA 1KOAA 5MENA 2R29L 5JR1H 4LPVA 3EFFB 4JG1H 2DIBA 5FYLL 5GSRA 2AXFB 4Y8DC 1IZKA 2QQNH 4KXZI 1MCPH 3MBEB 2UWEE 5D1ZB 4U1GB 5EZLB 3VXRB 4QYOA 5B3NA 4RQQB 2QR0B 3QO1A 1X5YA 1NFKA 1T4KB 5C0CA 3BVNB 1YUHB 3F7RA 4IRJC 4IRZL 4KKBC 5D8JH 1IT9L 2EIZA 5T3XD 3ULVD 1F3RB 1Y0LB 4HD9A 2PO6A 1NCUA 2NY3B 4LLWB 5GGRA 3WL9A 5DVKA 3I50L 1I1FB 4J3UA 2CK0H 4G80B 4HULB 3DRTB 5GJSH 1VHPA 5GRJL 2DI7A 1EAPB 4AM0B 1QTYT 2R4RH 1FYTD 2EZ0D 2VR5A 4XNZB 5DSCA 5CSGA 4MJ5A 4BSVB 3F7VB 2W9EH 3WE6A 4R2GB 5C0NC 2YZ1A 3ULUC 3M8OH 3HFMH 3MYJB 3QEQE 2X7LA 5TDOA 1I9RH 5TPWL 3T09A 3OG6B 2R0WH 4HX1A 1X3DA 1YQ2A 4PJ5D 1W0YT 4IBLT 4GLRI 4MMXC 3OB0H 2PUQT 5JHDE 2FX8L 2P1YA 2JELL 1JHTB 4BFEA 2PF6A 2Q20A 1P84K 3LKOB 4X6DE 2NXZC 3V4PH 4OZIA 5CSZA 1L4IA 4OD1L 3FRUB 4LPUA 5KOVC 4GAYB 2FCBA 4HIJB 1BFOA 3CDCA 5TFSL 4H25B 2FHCA 4HWUA 5IJVB 1I85C 4ETYA 4XPTL 4RAVB 3LKNB 4BSWA 2Y23A 1GAFL 4WUKL 1N7MH 2XPGB 1CICC 4JHZA 3MRGA 1UC6A 4FP8H 1MRFH 4PG2C 1G9NC 3MCKA 5D1QC 1J5OL 3ZDXE 4HWBH 4O51A 1XGRA 4JHAH 4YX2H 1RI8A 1RZGA 4LSVH 3LAFA 2OTWB 5F72S 3BIKA 2FHFA 3MNZB 5GS1B 1JNLH 4MD0B 1KIUA 3AY4A 5C70A 2AGJH 3MQIA 5D5MA 1EGJL 1HINL 5J7CC 4PTUB 4XPFH 2W65A 4M9OA 2V9TA 4NO3A 1JHKH 2F53A 3KPLA 4FQQB 1W72L 1ZEAL 3EO0A 1NAMH 5C9JA 1SQ2N 4AYFA 4HGKC 3CFEA 4MDIA 5H94B 3C60C 2F5AL 5E8DH 4JG1L 2WUBH 3F7PC 4O2EB 3NVQA 1ZXQA 5BZDA 2DM3A 2QQNL 3HMWH 5F89B 5ITFB 1BWWA 4W4NA 4NN6B 5DMYA 1FRGL 1MJ8L 5SWSE 4ODXA 5JW3L 2CDFB 2VDMH 2F8OA 4RGMB 4KY1L 2VXQL 1CDYA 4P2QE 1B0WA 2DQEH 1TZGL 3SE9H 5E7FA 1G6RA 5D8JL 5BJTA 5E2TH 3FTGA 1UXSB 4N8CL 3OR6A 3TZVA 3G04A 5DDHB 5KSAD 1DQLH 1XF4B 4FQCH 5DJCA 4PLJC 5IQ9B 4JY6B 3MRHB 2XZQH 3LEVL 5T5NF 2VLRB 2ZWLT 3EFFA 4WFED 3FN3A 2R4RL 1NEUA 2AXFA 2EXYC 1N59B 3TCLB 3VXSD 3MBEA 3SE4C 4FOMA 1K8IB 4P4RB 4X9HA 5D93B 1U3HB 1WEJH 5I9QC 1LE5B 3RJQB 5F9JB 3JXAA 2QR0A 2E3VA 3QI9C 4YXLL 3EGSB 3V6OE 4QXWA 1T4KA 3BVNA 1YUHA 5ISZB 2FBJH 4AJ0A 4OZHE 2Q87A 3S37H 4G3YH 4WFHE 4ZXBC 5EO1B 1Y0LA 2NXYC 3OKMB 1FG2B 3NGBC 2PYEB 3O0RL 3QPQC 3V6FB 4MQXC 3TA3D 3RU8H 1TCMA 1QO3B 3IDYC 2VDQH 3FT4B 3P0VL 3DRTA 1WT5C 3IDIB 4JFEE 2VZSA 2V5TA 1EAPA 4QOKB 3HPJB 2H32B 3D1MC 1HCFX 1MCOH 3VFWB 2ARJQ 3X14B 4KKAD 1B6DA 3BRDA 1N7ML 4FQXD 4JPVH 43C9A 5J57B 1A6UH 4M7LL 1RY7B 4J23A 3KLAB 4U1MB 1X5FA 4JHAL 4YX2L 1NJ9A 2C4FT 5DJAB 2VABA 1JHTA 3EJZD 1FDLH 4U1IA 4HZLB 3NZHL 1UYWL 1JNLL 3LKOA 2G5BB 3L3DB 1OWWA 3FFCE 4XNMA 4FXLA 3LPFA 3RGVB 1KLUA 3SBWA 4J3VA 1A6TB 4GAYA 4XPFL 3TNMB 5JZ7D 3OAYH 4EI5D 1AQKL 1JHKL 1EMTL 1BQHA 4IMLB 1Z6JT 1NAML 2B7DT 1II4E 1QBLH 1FL3B 3CZJA 5ESQA 4ZUSB 4RAVA 3SDCD 4Z7UE 1J1OH 2OZ4H 2XPGA 2ED8A 2BMKB 2B8OT 3LQAH 4M1CD 3MRIB 4IOFC 1E6JH 4P4KA 3IXTA 4CKVX 3BGMB 2ZUUA 5B21A 1R5WB 1I8MA 2ED7A 5EBWB 1IC4H 4ODHL 5D7JB 3MNZA 5GS1A 3VWJC 1XZ0B 4MD0A 4DAGH 1T2JA 1IC5H 2EYSA 4F9PA 5I19H 4ODTH 1M6OB 5E2TL 3WNNA 3HR5B 1BWMA 4PJFE 3GSWA 3RIAK 3ZLQC 1HWHB 4GRLD 1LE9B 2D4DA 2C3XA 1DQLL 1OLZA 5HI4C 5B39A 3MNWB 2IAMB 3G6AB 4PG9B 2XZQL 5H94A 1INDH 4XMLL 3KPMA 4Z7OE 4G7VH 5I8OL 2ICCA 1IQWH 3D2UB 4O2EA 3UAJD 1MWAL 4MCZB 4RISH 5C0FB 5F89A 3T1WA 1MJ7H 3FO9A 3DYPA 5FYLD 3BIBX 1WEJL 5T1LD 2F19H 2E9BA 5FYKL 2HJLB 3WS3A 4P49A 3U82B 5ID0B 5J13B 4BZ2L 2Z31D 4NIKB 1F4AA 2FBJL 1OM3H 2A2QT 4G3YL 5LGJB 3R8QA 3VXTA 4XP4L 4U6HB 5CJXC 1ZWIB 3C2AH 1K3IA 5C07D 1HXMB 5IFJB 5DDHA 1E4WH 3MX0A 5TDNA 4KQ4H 4FQJH 4Y2OA 5D7SL 3VWKD 5DD1H 2VLRA 3FQWB 1KLFA 1W0VA 5LXGH 3MV7D 3TCLA 2BOCB 4GH7B 4HLJA 4RSVA 1K8IA 1ZSDA 1HHGA 1JWUB 3PQYD 4XGZB 4P46C 3CAFA 4I3SH 4JPVL 4TRPL 1LE5A 1A0QH 4WI4A 5F9JA 5EUOB 5DFTA 3KXFE 3EGSA 3Q1SH 3VXME 5IUSA 5KSVB 5ISZA 2Y6SC 3RL2A 4RMSA 3GM0A 4JM2B 1Z9SA 3NAAH 3AREB 4QNPF 5EO1A 1WIOA 2ED9A 2G2RA 2DICA 3V6FA 2ZJSH 3TEUA 1KCRH 1QO3A 5JIKA 2BVOB 3PWPD 5DGRA 1F6AB 3FT4A 5AYQA 3ZDZE 5JDSB 3IDIA 1MFAH 1A9BB 5F9AC 1R24B 3UYOD 2NY5C 1Q9LB 2EDDA 2OX5A 3HZVB 2H32A 4MNQB 2BSRA 1IGCH 1QBLL 3VFWA 3BJLA 3LEYH 3MJ9A 1KPVB 3CDFA 2VKXA 4O9HL 1IKFH 3KLAA 3CFBB 1ZMYA 1E4XH 1RMFH 3LS5H 2E8YA 2R4SH 4EQ2A 4IIQC 3FJTA 3RVXC 5KS9E 4JRYE 2G5BA 1PSKL 5C6TH 4DAGL 1IC5L 1ZVSA 2FX9H 5I19L 4JN1H 3I02B 3WFHB 1ULVA 3VFMA 2Q7YB 2RAMA 4D0CB 2HTLD 2VDPL 4XNUH 1G7JB 2CRYA 5IHLB 1WAAF 4ZUSA 1OSZB 1INDL 3BAEH 3VXSA 4NO0B 1EJ6A 4G7VL 3AGVA 1IQWL 1SBSH 1H5BA 3QNZB 5BV7H 1QBBA 1Q9WA 2BMKA 3V9FA 1ZHBB 2LU7A 3BI9X 3GKWH 3MRIA 5DJ6B 1MJ7L 3BGMA 5LGKA 1MRDH 3ARDD 4PJHA 3A6CH 3QT2A 4KRLB 5MEQB 4JN2B 1J05B 1L9NA 3A67L 5EBWA 1YPZF 2DB8A 1XGTB 3O8XD 3OKYA 3WFZA 5BW7C 1XZ0A 1C16B 2AXHA 3FO2B 4OD3H 5I1HL 3I3DA 1OGTA 1YY9D 1ZANH 3CDGB 5HYQB 1Z3GL 1VFBB 3JV4B 1LE9A 1E4WL 3HHRB 2EH7H 3V5DB 5L9DL 5IVXF 3MNWA 2V2WB 2P47B 1RU9H 4O2CB 4Y16C 3I6GB 1D6VH 5EWIL 3O2DA 5T1DL 4MCZA 5C0FA 4FG6C 3BGFC 3FQUA 4MWFB 4I3SL 3GSUB 3Q5YA 1OAKH 3BD4A 1JTPA 4KI5E 1CT8A 2WQ8A 5ID0A 2B4CL 3BZ4A 2BFVL 1ZHLB 4APQB 3MNVB 5JOPD 5IB1B 2V17H 1UZ6F 4NUJA 1ZS8B 4DJMA 1ZWIA 2I24N 5E2UH 3BH8B 4HT1H 1KCRL 2N56A 2X70B 3GK8H 3H9SD 4GS7C 5GGTL 1CGVA 1JMXA 1Z5LB 1CL7I 1MFAL 2YD4A 1F4XL 1SVZA 2EDKA 4YHZH 4ZQKA 3DURB 4HW6A 2DF3A 3RNQA 3MRFB 1Q0XH 1NDGA 2LTQC 4X6BB 1IGCL 2NX5E 2FH6A 4JZJB 3LEYL 4XGZA 1MFCL 1FC1A 4CAGA 1IKFL 3NFPA 3OKLA 3S34H 3NN8B 3EAKA 3O4LD 4K23H 3VI4F 4P9HL 4NKDA 2HMID 3TGXA 1A7BA 1OY3B 2R4SL 3RZCB 1KGCE 3DUSB 2NY7H 2EYTA 4L4TE 2IJ0C 1QACA 3AS0A 3BPLB 3TJEH 5I1LB 2FX9L 1QZ1A 4HS6B 5GS3A 1JNHB 4N9GA 4PJXB 1A9BA 4HIHB 1R24A 1Q9LA 3HZVA 4XNXL 1TVHA 2VAJA 5GGSY 5FHBH 3THMH 5EG6C 1LEGB 4M7ZB 5HDLA 1KCSH 4KVCL 1KPVA 3BYYA 4KAQH 2I9LB 5BV7L 5T1LA 4XCCH 5DUPH 2VDKH 2Z31A 1OWRM 2F58H 4TVPE 5HI3D 1PEWA 4YHNB 1C08A 1C7SA 2J4WH 4F8QA 1OD9A 5JOEA 4Y2DB 1AGEB 4KV5F 5JTWA 3UPRB 4JR9H 2DYPD 3WFHA 3LKPB 4PJIF 1UWXK 2NMSA 2EH7L 5K93A 4D0CA 3ARFB 5EO9B 1QRNE 1CXFA 1DVFB 4PJDE 3UCRA 3U0TA 4ZAKC 1UH4A 1RHHB 3MV9B 3QNZA 2CKBB 3MJGX 5I0ZA 2E7LC 3C6LB 3DXAE 2MQ0A 4KZDH 3TVMC 5MEQA 4PY8J 4JN2A 1RVFH 4I48B 1J05A 1OAKL 3P4OA 1SMOA 4PRPE 4Y4HB 4RRPG 5DMGD 1N64H 1INEH 4D0BA 2UYLB 4PRBB 3F8UB 1C16A 2X1QA 3O9WB 1XCQB 4M3JA 5FYKD 1S9WA 3UTSE 1PX3A 4WUUB 4ERSH 3LSOB 4NKIH 1T1YB 1UKTA 3SDXA 4C56E 1R3IL 3CDGA 3TO4C 5HYQA 3CXHJ 2A1WH 1VFBA 5BOZG 3BKCL 1NCWH 3QRGL 2L0DA 2V2WA 3RL1B 3B8YA 5EU7C 4TSCH 3IGAB 2ITDB 4O2CA 5JDJA 3SE8H 3UMTA 4NHCH 1Q0XL 4WI5A 4QRRB 2OBGA 1XR9B 3BDYL 2VR4A 4X80H 5FV1L 3DPBA 1E27B 2AEQL 4DVRL 4MWFA 5SWQB 4L8SC 5IJKA 3K7UA 1LHZA 3N9GH 2QADD 1P2CB 4LVNB 5F93C 1JN6A 5EIQA 2PO6C 3KWWB 4I3RH 4K23L 2Q86B 4APQA 43CAB 1FORH 3BIAX 4BK5A 1YC8A 2I27N 2ORBL 3H2WA 5EUKB 4UU9B 3WYRA 2KKQA 4A2MA 1ZS8A 3INUH 2APVA 4WWKD 4W70A 5C3LD 4XHQA 4M6MH 3UJTL 2X70A 1M7IB 4MA7H 2YUXA 1NKRA 2DD8H 1S7SB 1Z5LA 2P8LA 4GQ9L 4OBSA 3DURA 5CZXD 4PJ8D 4X6BA 3S36L 4Z76B 2EDBA 3HS0A 2VITB 3N1MC 4HKJB 5IQ7L 3UO1L 3S35H 2XZCL 1A1NB 3G6JB 4RMUA 1KCSL 2D7OA 5GZNC 3QWQB 2NR6C 5C09E 3IVKB 3RVVD 2FECI 5EU5B 4EUPG 3VRIA 4ZSOE 3BW9A 1BBJB 3CUPB 4UINH 5BMFH 4GAGL 1ZLSL 4NPYB 4XP9H 3RZCA 3DUSA 3P3YA 2HT2D 2Q6WA 2QQLL 3SDAB 4L1HA 1U8HB 5I1LA 1AC0A 2DL2A 3LRSA 4I2XE 2CXKA 1JNHA 4PJXA 1XR8A 4HIHA 5M7QA 5AYUH 2AP2A 3HI1A 3BZFA 1AHWA 3LIZH 2JIXB 3MPCA 1QKZL 1A8JH 1CFNB 3EDEA 1LEGA 1RZKH 2P7TB 3CDYA 4BSJA 1JZ7A 3SGJA 5KSBE 5I74B 4ZODA 1FLRL 3DX8B 4GSDH 4ODVL 5LCVL 4HKZB 1BQUA 5GGSA 3JUYA 4LCCB 3C5ZC 4XBGB 1CVSC 1FNEB 2D9CA 5JIPA 4RFOL 4S1SL 1Q72H 4FFVD 1QSZA 4HJGB 3AY4C 4GRMA 1J87A 4MMZC 1Y18A 2GJ6D 3QFDB 1D5BA 2BXYA 4QHKJ 1N64L 4PP1D 2I60H 1QFWI 1AGEA 5CJQH 4XI5C 3T65B 4ERSL 4HKBB 2NY0B 3UDWA 3UPRA 3S5LG 3IFLH 2A1WL 5FA3B 1S7UB 3T8XA 3SOBL 3LKPA 5HYSG 4W6YB 5IBUG 5FKPB 1AO7B 5EOQH 4FFZH 4F2MB 4QHLA 4MAYB 1NCWL 2Q76A 5DD3H 4NQXA 1G9ML 1XGPB 3LKSA 1DVFA 5DJ2B 1BIHA 5FHAH 4TSCL 4X5WB 3MV8B 3LN4A 3CMOL 4NHCL 1G84A 5D6CB 4X80L 1I3GH 1ETZB 5C08D 1PZUB 5D6DA 2DRUA 2VISA 3O4LA 4PBXA 2OL3L 3AVEA 4I48A 4Y4HA 5GRYA 5DQJA 2UYLA 3PWNB 1ZVHA 1B9ZA 4HWBA 3TZVC 2NW2A 3UJIH 5CILL 3O9WA 2YK1L 4JFFE 2KZ1B 4WUUA 1T1YA 5KVFL 4KHTH 5J1SC 5SWZE 2ZOKA 1A6VL 2IBZX 4RZCA 5ID1A 3VDBA 4Y5VB 1TQBC 1KJ2H 3RL1A 2X42A 3LQMA 4TUOB 5DGQA 3MBEC 3QUML 3IGAA 2ITDA 4L8DB 4U1GC 1YDPB 3HC4H 4QRRA 3WN5B 5H35B 3EOYG 1E27A 3EOAB 5EZIL 3U4BL 1UG9A 3BP4A 1BMGA 5LKNA 1B4RA 3RZWA 4U2ZA 5HDBE 4F7MB 3KPRD 1P2CA 2ZUYA 4LEXH 3KWWA 2BSSA 4QRUB 3O2WL 1MNUL 1X5HA 1BD2E 3WSQL 43CAA 4GG6E 2VAAB 1FAKT 2EKSB 3SGDI 5IEKB 4XP9L 5EUKA 3VXUB 1CFQB 1MRCL 5TE4L 4FFWD 3BESR 2IFGA 4RCAA 1HHKB 1ZOXA 4NQDB 2DMBA 4FXKB 3T3MF 4QY8A 4R2GC 1LDSA 4RAUA 3WLBB 4V1DB 1UM5H 4LDEB 1CD0A 2CPCA 2DLIA 3TT1H 4Z76A 3LIZL 1ORQB 2VITA 3I6KB 3DX9B 1JZ5A 4U0QB 3ABZA 1A1NA 3H3PL 1OTSD 2AAVA 3RPKA 1FFRA 3HMXA 3DVNA 4EOWH 4FQIH 5EU5A 1L7IH 1HQ4B 3QEQD 1KIQA 1EUUA 3CUPA 3E2HB 1Z2KA 4NPYA 4P3CH 4X8XA 3SBWC 5M94B 3SDAA 3VGAB 1U8HA 2I60L 3BISA 2E9IA 3CVIH 4OCXH 4P2OB 1KTDB 1HOCB 3CSPA 2P4AB 5FEBA 3CIQA 2PTTA 4ODSH 1QLFA 4FFZL 3HRZB 5DC0A 3F58L 4BJLA 2A74A 4JG0L 1DQML 3DGCR 4P4KC 5FHAL 4JFDB 2HFGL 1N5AB 3IS0X 2UY7A 3VFRA 5GS0C 4YDIH 4WFFE 1P6AB 3VRLE 1BM3H 4LCCA 4JRXE 1I3GL 1J0KA 3JUZA 2A77L 3N0PB 1FNEA 4GO6B 1S3KL 4HUKB 1FIEA 1GL4B 5DMIH 5GS1C 1WJ3A 2B1AH 5IB4A 3P2TA 3TIEA 2HFEB 4M5ZH 1EIBA 4TUJB 1Q9KA 4F9PC 3OGCB 4POZD 2HT4D 3X12B 4GKSB 3UJIL 3B2VH 1T0PB 4OLVL 3WFEL 3WUWA 4O5LL 3T65A 3ARBD 1U6AH 1JPGA 2XA3A 2O5ZL 2IQ9H 4HKBA 5D2NE 1HILB 1S7UA 4UV7L 2SEBB 3VFGH 4JFYB 5FKPA 1AO7A 1U92B 1U95A 4MAYA 4HG4J 3L1OL 4GT7A 4Z77B 1KJ2L 3CVHB 4YHKH 2V2TB 1GVIA 4ZOEA 3BZEB 5DJ2A 2G60H 5HHNA 4LVEA 3MV8A 4NN6C 5D6CA 2GK2A 3EIFA 3MJ7B 4RGMC 1JZ6A 1X5AA 3BKYH 4NC0B 2OZ4A 5JNYA 3W5NA 3DIFB 3GJEB 4Z7WE 1D5IL 4TVPH 5LVEA 3BP6B 1YYLL 3RUGB 4D3CH 5C7XH 4JE4B 5SWSD 3ARXA 2EEBA 5EZOL 4L8BA 4CVXB 4P2QD 4BH8B 3EO9L 2YHGA 4RIRB 4Q74A 3U2SA 4ODUA 1YEHH 4Y5VA 4NZUH 4NO5B 3W0WB 2O5XL 4NBZB 4Q2ZB 5HHXH 3ET9F 4BH7B 4RMWA 1HKFA 4TUOA 1TENA 4Z8FH 1OP5H 3LH2L 1UM5L 1FPTL 4MXVE 5D93C 4OTXH 3WN5A 3G9VA 1YYMH 3EOAA 4Y5XB 3UZEA 2BSED 1RFDL 4JPIB 5EU4B 3VG0H 4XVJL 3QG6A 4F7MA 1IARB 2GJ6A 4QO1A 3KPSB 1L7IL 2VZ3A 1UCTA 1RUKH 4YHIA 2LAGB 5E9DE 4HJ0C 3KLHC 2LU3A 4HKXA 4X5XB 5IEKA 2QSTA 4MD4A 4P3CL 5E6IB 2H2PD 2FO4B 4TN9A 3NIDE 3CVIL 3W9DB 4WFHD 3OX8A 3RKDC 4NQDA 1C12A 4FXKA 1FQ9C 3GMOB 1MIEL 4G8GD 5F1IB 1RZJH 4ODSL 3WLBA 1GH7A 3VFTA 4BFBD 3B6SA 5E56A 4JFED 2FH8A 3DX9A 1CQKA 3QWRD 3S36X 3GMPB 5C08A 1BF8A 3MUY1 1U8OB 1P7QD 4JO1H 1GGBH 2VQUA 4ELMA 1HQ4A 4KRPD 5I17A 3MLUL 2B1AL 4TQEH 4TTDC 5GJTL 5HYEA 1DLHB 4HPYH 4XMKH 2XNAA 3ECBB 3RGVC 5KZCD 4FRWA 4PJ7A 1RIUL 5EUOF 3TYGL 2FB4H 1KTDA 5E6ZA 2ADJA 1HOCA 4NQCB 2DMCA 4PJ9D 3FFCD 4XCNB 5HHPB 4JM2F 2D31A 2JCCB 3NACH 4B50A 2EDFA 5CEZE 1H5BC 1FHGA 4YHKL 1OVZA 1W0WA 3C08H 2G60L 3REVB 1NEZA 1N5AA 5IBLD 2CDGB 1F45A 5A2LH 1YEDB 2FEEI 1OAXL 2A6IB 2FX7H 2UWEA 3BKMH 4WU5B 3BKYL 4LDOB 4AEIH 2HFEA 5LG1A 1F2QA 3FB8A 3X12A 4RX4D 4YIQA 5EOCH 3MXVL 4M7KL 5H2BA 1TLKA 3LDBB 4XMPH 3VXOB 1HILA 1IGFL 3KLSA 1HCVA 3AROA 1GOGA 3RVUD 2C1OB 4Z77A 3CVHA 5HHXL 1CXKA 3L7EB 3QDME 5DZLA 4Z8FL 4X98B 1MI5B 3QQ9D 5GHWH 4OTXL 2UUDK 1YYML 3M17B 3DIFA 4WTXA 5J13C 5DQDH 2YOCA 2R2CA 4X6EB 3VG0L 5IIEB 3BP6A 4MJIE 3GJFB 1HYSC 4J3TA 3RUGA 4YFLF 3VGFA 5DA4A 1OCWL 4JCLA 5JZ7C 1I1AD 5BRZD 3DUUB 2DQUL 5JHDA 4CVXA 1FZKB 4DKFH 3T4YB 2H9GB 3JV6B 2AJXL 4BH8A 4OAWA 3WD5H 4X6DA 1QHOA 4M3KB 4RIRA 1SJEB 4NO5A 3T0WA 4Q2ZA 1IVLA 1XGUB 4LU5L 3OAZK 3FCTB 1EPFA 2NY6D 2GEEA 1DZBA 5TDPB 3ZZ1A 4X83A 4JRWA 1DQJB 3GMLB 4WI9A 4WEUD 4GBXD 2MKLC 4URTB 4Y5XA 3PDGA 4M1GH 4JPIA 3DROA 2PTVA 1FYTB 3LN5B 4MA8L 2G9HB 4WNQB 4JO2H 4JM2C 3FZUD 1OOAA 2W0FB 5M95B 4N8VB 4PJGF 2BHUA 4HWEH 2EYRB 1VFMA 5F7UA 3JV5A 3VXMD 1KBGL 2X4NB 2YRZA 1FE8H 3GMRA 4KJYB 2Z8RA 3S4SB 1TZIB 1JZ4A 2K7QA 3QH3B 2YPVH 2NY2C 1IM9B 4UAOB 4F37K 5F7HA 3FHAA 2MNUA 5FUOL 5FO8B 2XYCA 4RGOH 5EOTB 5JXED 2GHWB 2XRAH 3GMOA 3NACL 5F1IA 1DDHB 2F54B 1WITA 2CUIA 5ECJE 1F13A 4PGBA 3IKCB 1J0YA 1TJIL 4G8IB 5CINH 5F7NC 3RQ3A 1AQDB 1U8OA 1VFAA 2A6JB 2Z31C 4WV1B 4R4BA 4X7SH 1LD9B 4Y1AE 3WIHH 3VMOA 3P73A 5T1MB 5LBSH 4PJEB 5SWSA 4Q6IB 1P7KA 2VTFA 4JFQB 1W8OA 3ECBA 5B3JF 5JUEH 2MHAA 4LSDA 1LVEA 4OM1L 1F6FB 2VLJE 32C2B 1I4FA 4G8FB 4HAGA 3BGAA 4XMPL 4KK5C 2Z4QA 4JRYD 4XCNA 4CJ1A 5E94B 2BY0A 3STLA 1CK0H 4MX7B 2X9YA 3TCXA 1GXEA 1OTUD 2DMKA 1OL0A 4HQQH 3QIUB 4DN4L 4G43B 5DMJB 3REVA 3OKDA 4YR6B 3MSPA 2CDGA 2GSGB 4MNGB 3SJVE 1CS6A 1YEDA 2W91A 5DD0H 5GHWL 1GRWA 5F9OH 1DL7L 2A6IA 2E6QA 3E3QE 4NQEE 3B9EA 5T5FH 2NNAB 4UV4L 4NQVA 4NWUH 1JZ2A 3VDCA 3V0WL 3SPVB 5KTEH 4EUPH 7FABH 1XF2B 2YSSB 5ITBL 3BMWA 1Z9MA 4YNYB 1G7PA 3NCMA 5J06A 5J56B 3O6MH 4NNXB 1MFBL 3VXOA 3WD5L 2X6MA 2C1OA 2WWKT 4JFEA 2DWDB 2DBLH 1RUPL 1KB5L 4OLYH 1H0DB 4J3SA 1YEFH 4X98A 1MI5A 1P7QA 5IJKC 1FVCB 3EZ8A 4LQFH 1ZA3A 5MEOB 3M17A 1BAFH 3P9MB 1VPOL 3MJ6A 3B9AA 5DC9B 4X6EA 4APQC 5FGBA 3V6BR 4WWID 3GGWB 4LLYB 3MLTB 1ZV5A 4HWEL 4I3GA 1OGAE 3WIIL 3DUUA 4KI5D 1FSKC 2BY3A 1WLHA 2H9GA 3G5ZB 3PGDB 3TJHC 1EHNA 2YPVL 1Q0YL 4XCYA 2J8OA 1J86A 1A2YB 4RGOL 4WHCA 2XRAL 1XGUA 3DV6A 3FCTA 1WBZA 4EDXA 1ONQB 5J3HD 1FNLA 5TDPA 5KSUB 4S11A 3UC0H 4Z7UA 5CINL 2YRPA 1SVCP 3LN5A 2B5IC 4WNQA 4F37F 5DEZA 2DQGL 4LCYA 2R1YB 5CMAB 3RZCC 4LPCA 2W0FA 1IMHC 3WS6A 2DM2A 1YECH 1TVBA 4Z95L 1MHCA 2A9MH 2KH2B 3O2VH 3V5HB 5F71A 1MQKL 3TBYA 2X4NA 1RPQA 1QSFB 5F6HI 1TZIA 5K33A 2A83B 2Z93A 1EHXA 2XA8H 5IMMB 1IM9A 3BP5B 3SKUD 1KGCD 4FXGB 5FO8A 4L4TD 1AHWC 1JRHH 1L6ZA 3CXHK 2I5YL 3WHE1 1DDHA 4M7ZC 3SGJC 1A7QH 3CLFH 1IRAY 2F54A 1Z0NA 3O6FD 3NOIA 4EI5B 1AQDA 2Y5EA 1QFOA 1BX2B 3PDOA 3BN3B 3DMMB 3WIFB 1CDBA 3GKZA 5F9OL 5GRVL 2H6PB 4GW4B 3DO7B 4LK4A 3EBAA 4ZFZA 5F96L 1P4BL 3SDCB 1CLYH 3I6LE 4PJEA 4PRNB 2HTKD 2VJXA 4Q6IA 1ACYH 5T5FL 4JFQA 1S7XB 4WU7A 3G6JF 4NWUL 5KTEL 3UDWC 1B2WH 4OZFG 1N6QH 1BZ9B 3P9WB 4P3DB 4LOUC 5IBTL 3DETD 3K4AA 4EXPX 3PIQB 2E9WA 3CFDA 4G8FA 2FATL 3MA9H 3O6ML 5A2IH 1OB1A 3QDHA 1S9VB 1MQ8A 1DVFC 5EA0H 5E94A 3IDJB 4Q9QL 1CLOH 2A6KA 4KUZH 5JW5A 3GSOA 2KQNA 4GRLB 3QIUA 5D6DC 1L6XA 4YR6A 5E2WH 4QNPE 1QRND 1G9NH 4Q9BA 4NZRH 4UNUA 1FVDA 3O6KH 4LQFL 5JW4R 2HMIC 4Y4HC 1BAFL 2Y06H 3BT2H 4V2BA 2NNAA 3JZ7A 3O9WC 1SJXA 2Y25A 3KXFA 5FA4B 3T08A 3DGGB 5IR1B 1XF2A 3QQNA 1HSAB 4KKLD 4PRDA 3LD8C 3EFDH 2DQFA 4RGNB 3SN6N 3UTTB 2CRZA 5IESL 4Y8AA 4PRPD 2C3VA 3HG1E 5E1AB 4NBXB 4RMQA 5JXEA 2VQ1B 4XP5L 4ZUTA 3PP3H 3PWUB 3UTSD 4KPHH 3FOLB 4YE4H 5CEZH 4YPJA 3C5JB 4YO0A 4C56D 3HRPA 1K8DB 1RUML 1A4KA 3VJ6A 2ADGA 2QSQA 5I1EH 2C7UB 4OLZH 3ZYZA 4U1NA 5EN2A 5L2JB 4IM8A 1U8NB 1V3JA 1E4XI 5MEOA 3IS1X 4LVNC 1ITCA 5CFHA 4NGHL 4DEPB 5EZJA 5L8JB 4LPTA 3EJYC 4KDVA 3GGWA 3OKEA 3C87A 2OM5A 3B8SA 3TC9A 1AJ7H 1WAAE 1YECL 2Z9TA 1DBBH 3O2VL 4GKNB 5CZVL 4QHKI 3UYRH 4WW2A 4LBEB 3G5ZA 1FNGB 5C0AE 5SX5H 4OFKA 2E8ZA 1U93B 1GPOH 3DX7B 3QO0A 2FJHB 1GJIA 5F7MC 3WXVH 4XNQA 1JRHL 4NNYA 2AQ1A 3HCVA 4U31A 5HGGS 1YPZE 1ONQA 3VH8B 3UX9B 4XX1G 4KH2A 4QGYA 4OLWH 3ULUL 4Q9RL 2AERT 5F8QC 2XQYG 1TIUA 5DMGC 5IM7A 4XPGL 1H3UA 2R1YA 5CMAA 5IVXE 1CLYL 5I1GH 5ESVA 3SDAC 5C09D 5IHZB 5LQBH 2P5WE 3VI3F 1B2WL 4LF3A 1IE5A 2EDHA 3PE9A 4OGAD 1KF9B 1NMBL 2C9AA 4L5FH 3GI8L 1OTTD 5DEFB 5C0RH 4TUKH 3ILPB 5D70H 5DS8B 1IGIH 2AQ2A 4ODWB 2ZSWB 5IWLA 3AB0B 1OPGH 3X13B 5EA0L 3MLZL 4EVNB 5EIVA 4GG8B 2VB5A 4XC3H 1CLOL 1RZFL 3U9UB 4KUZL 3TF7C 5CGYC 4LCCC 5C6WH 4B7LA 1JGVH 1BX2A 1UZ6E 1CQYA 3A6OA 4MJ6B 1G6VK 3SKOA 1G9NL 3WIFA 2H6PA 4GW4A 4NT6A 1H3PH 4XBGA 1Z9LA 3EOBB 2IH1A 4MD5A 4OCSH 4H1LB 3QQ4B 2XKUA 4Z7NF 4MZ3A 2NY0C 5INDB 1GGTA 3EFDL 3F5WB 3R06B 2HP4A 1NC4A 3PIQA 4MAYC 1KJMA 3MA7A 5CZXC 5FYJU 4J8RB 5MENE 4K3HA 3W2DL 4YE4L 2K9UA 4MXWH 4XBEL 3HE6D 4KTDL 2AQ3A 3VI4E 1FGVL 2O61A 5EO0A 4JEGB 4WJ5B 3FO0H 2NX5A 5TE7H 3LQAC 4JLRB 4QRPE 2CMRH 1DBAH 2VSCA 5C0CE 4KXZH 4OQTL 4LLMB 4PGCB 1WV7T 1P1ZA 2B20A 1HSAA 3KPQA 1D5MB 2X2YA 3QQ3A 4UIKL 4FN0A 2X4TA 5BOPA 2QQKH 2AV1B 4Y5VC 1KNOB 3MRCB 2VQ1A 3LS4H 3PWUA 4JFFD 3FOLA 2WUCH 4HF5H 4LAQH 2ADFH 5SWZD 5DVOA 3WXVL 3WN5C 4HIIB 4R97C 3LOWA 3O6FA 4C58B 1ZGLM 2VLKE 4TNVK 3D3VE 2EE3A 3F7YA 1TJHH 5L2JA 3GHEH 1U8NA 4OLWL 2GSIB 5E4IA 4KV5E 1L7TH 2ARJB 3QHZH 1I1CA 1YEJH 4XHJC 1NGWA 1ZT7A 2EECA 4PJIE 5CZKA 2NZ9D 2FDBP 3AU1B 2NYYD 5T33H 1MSPA 2CIKA 4GKNA 3WKMH 4GLRH 3GMQA 4U1SB 5I8CB 4LBEA 4OF7A 1FNGA 2VXSH 2J6EH 4U7KA 1BD2D 3ES6A 3RY5A 2FHBA 2XOTA 3DX7A 1D5XA 4DK3A 2FJHA 4DW2H 4TUKL 3U48A 5FF6A 1DJSA 5D70L 3RNKB 1T7VA 4N1EA 2BRRL 2YPLB 1OSPH 2ZUXA 3GSRB 2BSTA 1JPTH 3SKJL 3VH8A 1QRNA 1GSMA 1IEBA 4MGXA 1B0RB 4NSKA 1JIBA 4NRZB 2BVUA 2IG2L 1EEQA 4HXBH 2FWOB 5FOBA 2VOTA 1JGVL 8CGTA 3EYFB 4NJ9L 3FQRB 3KGRA 4XX1E 5DTFA 5HDQL 3E2HC 2LABA 1UADC 3DXAA 1EO8H 2AKRA 1XGQA 3O45B 4N0FA 1MHHB 3TT3L 4K3DH 3D39B 3OMZA 3VGAC 3Q6FB 1BZQK 1TXKA 1HKLL 1D6EA 5IGXH 4YWGH 4LIQE 1JF5A 3VMPA 3G6DH 4ZOCA 5FV2A 2CO6B 1EUTA 3D0LB 4ONHB 3QNXB 3QFJD 3ZKND 4MNHB 4U7MA 5DEFA 3N50A 3ILPA 4Y4KD 2VLLB 3RWEB 1KCUH 4ODWA 5FCUL 2ZSWA 1AGFB 2D3VA 4XWGH 3X13A 1ODAA 4OGXH 4EVNA 3B2UC 4O58L 2WBJD 4N90E 4Q7DA 2R2HB 3U9UA 4NKMB 5CWSB 3CXDH 4AL8L 3O3DB 3FOMA 1KEGH 2QTEA 5TE7L 4UBDD 4HC1L 4YLQT 2CMRL 3R1GH 1DBAL 3PWVA 3EOBA 3HI5L 4OZ4B 4DK6A 4JRXD 4I5BB 4P9MH 2I07B 5JMRA 4FFWC 3I2CL 5EC2B 2JJWA 4RA0C 5INDA 1E4JA 5CIPH 4DUVA 3F5WA 4M5YH 3S98A 1NBZA 2NTFB 3MRBB 3ILQD 2R1WB 1ZK9A 4D2NA 4NZDA 1DUYB 3ZE2E 3MLVH 1FVEB 2HVJA 2JF1A 4J8RA 1AXSB 1PW3A 5EULV 3CNKA 2WUCL 3F6IA 1EJOL 4CDGC 4JM4H 1JFQL 2ADFL 4LAQL 5JIIA 1FAIL 1I9JL 1RK0B 3QXAB 4H26A 5E2JA 1VSCA 4HBCH 3VXRE 3OKNB 2OLDA 3NPZB 1JWSB 1TJHL 2JCCF 4R6UA 2R2BA 4M4RA 3GHEL 3LCYA 3STBA 4JLRA 4G7YH 1QSVA 3BWUC 2ZKHL 4L4VD 4LLMA 5GZOD 4PGCA 2W9DH 3I75A 4ZSOA 2ICEB 5T33L 1FZMB 4TNVF 2AV1A 4I9WE 4IRJD 3HTLX 1KN2L 3OZ9H 3MRCA 2J6EL 3PABB 3CCHB 2DQHH 4JKKA 4MA1B 2MJWA 2VLME 3JWNC 4CBPA 4F7TB 3QIBD 2I9TB 1QSEB 5DVMA 4JCMA 3CH1A 5EDXA 4Y5XC 4WWKB 1A22B 1RURL 3MRRA 4DGVH 2P48B 2PKDA 4OKVA 4X9BA 5MEPB 5J12B 3VFVB 3T4AB 3T0BA 1B0GA 4KDWA 3X11B 3PGCB 1S7RB 2GSIA 1H9VA 4OFPA 5KSBA 4OLEA 3ZKMC 3KYAA 2ARJA 3O6LH 1NMCC 3MUGB 3G5VB 3NCEB 3KAAA 3ZT7A 3TV3H 3L7FB 2XWTB 1A7OL 4YHML 2DQIH 3AU1A 3HN3A 4K3DL 5F9DC 2IWGA 3VXNA 1JGDA 1CR9L 4YWGL 5I8CA 2BP3A 4PS4H 3UTPE 2CLRB 3QHFH 2CK2A 5HPOA 5E9DD 2Y5TA 5CEXB 4BZYA 4BKLA 3RWDB 1CN4A 1C5DB 4E5XB 3RNKA 2NXZD 3HE6A 1HXYB 2NY5L 2YPLA 4XWGL 3IETB 4OGXL 3RDTB 5A2KH 15C8H 3GSRA 4Y19B 4QXUL 1PG7L 4P2YA 5INCB 3D0VB 4FQLH 3ETBF 3IU3B 3VFPB 3OSKA 1M7DA 2ATKA 3ULVF 2FWOA 1VERA 3FQRA 5ETUA 4EIZC 1KEGL 5ICZB 1WWBX 3O45A 3P11H 1IGTB 1MHHA 5DVNA 4Z7WB 3IDUA 2ADIB 1X5KA 3Q6FA 5IF0B 3H0TB 4RFNB 4P9ML 5D1QD 4CN6A 2OQJB 5KW9H 2PCPA 4L8CA 3NFNB 3D85D 4WDIB 2AJZB 3D0LA 4ONHA 3QNXA 5I18H 4JFFA 4MNHA 4J3OC 4GUPB 4RRPA 3SEPA 2WZPD 2VLLA 4PJCB 3RWEA 4DGYH 4C55A 1KENH 1AGFA 5HY9B 4LDLB 5E6YA 4XPAL 4EIGB 5IOPA 1YMMD 1JNJA 4HAFA 4NKMA 5CWSA 5CEZD 4HBCL 1ZLVK 5BS0B 2ICWB 4TPRL 4Z78A 1O7SA 2Y4SA 4M43H 1J0HA 3DNKA 1LP9B 4DZBB 1JPFA 4WEMB 4NZTL 3T3ME 4I5BA 1JYXA 2H2PC 4XP6H 3WIHA 4WHTB 3LDBC 3GO1L 3GUTB 4U1JB 1NBVL 4JGMA 4KJPC 1BD2A 5JO5B 4GG6A 3MRBA 3GSQA 1FL5A 5CGMA 1S9XB 1FVEA 3OZ9L 4KC3B 2VLRE 1AXSA 2XKNA 3QCTL 2DQHL 3MRQB 4LSRH 2IEPA 3R0NA 4BUGA 2GITB 5AWNH 3QXAA 5IFAH 3V7AG 3OKNA 4PLJD 5GRUH 3QDMD 5FGBC 4DGIH 2DDQH 2CXGA 1S7WA 5CP7B 2MCG1 5HDOA 1MCCA 2WP3T 5ISZE 2EXYD 1H8SA 2X10A 1UZ8B 1CDIA 2VDRH 3AS2A 3TV3L 4L4JA 4B53A 1JGEB 1KSRA 2PN5A 2PYEE 3QI9D 4XPBL 2XFXB 1T7WA 4MJID 4N0CC 3FRPG 3LKQB 1B88A 5F7LB 3STZB 3QEGL 4OZFH 4Y4KA 3QHFL 3PABA 4HEPG 4YDJB 4ZXBD 4QOKE 2NXYD 1DE4B 3QA3B 4OFDA 2AV7B 2I9TA 1E28B 3QPQD 3U36B 1VA9A 1R0AH 1R5IB 5HGHB 1FV1B 4ZFOL 4G9DB 3MR9A 15C8L 1XT5A 2X9XA 3OPZH 3RBGA 4F58H 5L88H 3T4AA 3ZKQD 1IAKA 1MAMH 3WS6C 3MUGA 1T20B 1DN0B 3G5VA 4JRXA 2XWTA 3MLYH 1P84J 3P11L 1GGCL 1NGXB 3S3JA 3S7GA 1DBJL 1DUZB 2RCSH 1KTLA 4YHLL 4UAOC 4LHUD 3GSNL 3RWCA 4OM0H 4JJ5A 3S97C 2CLRA 4UIMB 5CEXA 5I18L 2YD2A 1KN4H 1AKJD 1C5DA 4HFUL 4NDMB 4HIEB 2VERN 4KRMB 5D2NA 4HEME 4E5XA 1AE6L 1MHPH 1KENL 4R8WL 1UWGL 2KDGA 4LSQL 2ZNWA 5JW4Q 5INCA 3S5LA 3IU3A 3VFPA 1HYRC 1MUJA 3K8KA 5E2VH 3SGEI 3PL6B 1DFBH 3WO4B 5ICZA 4JO4H 4Q6IC 4XAWL 5GISL 1IGTA 4M43L 5EFIB 4Z7WA 1IAMA 5DHVH 2ADIA 5IF0A 3H0TA 4IOFD 1A64A 1TZHB 1LK3H 5JLZA 2HVKA 4DGIL 5BQ7B 2OQJA 4N0YH 4OBRA 1UJTA 2AJZA 3WHE0 3KHOA 3BP7B 3VWJD 3L95B 2WINB 3QIBA 4PJCA 4FZ8H 2BJML 4YXHL 1ZHKA 3Q5TA 5HY9A 2IGFH 2VLJD 3QIUC 4R7DB 2M1KA 2GIYA 4WGWB 3ARBB 1EO5A 1IJ9A 3MMEB 4ZUVB 4HK0A 3U46A 5HI4D 4OLUH 1RZKC 4NUGL 4KTEH 5GRUL 4ZMAT 2ICWA 1UKQA 5IB2A 3SKMB 4HGWB 2DDQL 4ACPA 4O2FB 4JVWA 3SJVD 4M6OH 4PV9A 1NC2B 1R3KB 2PW2B 4N68A 2UV3A 5CBEB 3LHPH 4LIQH 4XXDA 4NQED 3GUTA 5D71H 4U1JA 5DK2B 5BO1L 3W9EB 5JHLH 5JXEC 1GC1H 4LLVB 4S1RH 3P0GB 5I66B 3PWLB 5D4QA 4F9LA 1NLBH 1VGKB 3QCVH 3K1DA 5D7IB 3QDAA 1XGYH 4W68A 2GITA 5IEHB 3U9PL 1CL7H 1A7NL 1ZLUK 4OT1L 4PJAF 4B0MM 3OPZL 2BX5A 5EUOE 2P8MB 3RPIB 1PKOA 4ZO7A 5HHMD 1G6RH 2HFFB 1J8KA 4U7SA 2QL1A 4Y1AB 4LLQB 3OBAA 1JGLH 4WW2C 1IKNA 4P46D 1U8IB 2DLHA 5ELIA 3D85A 3K80A 2DM7A 3ZTNH 4OM0L 5F1OB 2Y6SD 3BUYA 5FYJL 2QSCH 3OWEA 1CZ8L 4YDJA 3MZTA 4FTVB 1T2XA 4MNQE 1CBVH 1DE4A 1BQLH 1XMWA 2AV7A 3U36A 4QT5A 1R5IA 5DFVC 1CFTB 4H5SB 1FL6A 5DR5H 1AFVL 1QBML 3T0EB 2X89D 4OF0A 3EYOB 3B9KD 5TE6H 3TBVA 3GSXB 3D9AH 2A6DB 2ENSA 1SYSA 1OW0A 4G8GB 4ZPTA 1S8DB 1T20A 1DN0A 4JO4L 4MVBD 4G6JH 4OJFH 3DOSA 5KBNC 4YDLB 1WIUA 1X7QB 4R4ND 2IBGA 4HWZA 2LFGA 3HKFA 1ROWA 1J8HB 2R56L 4N0YL 2QHRL 4GRWF 2OR9L 1CU4H 4UIMA 4KRPB 5IWLC 5ALBL 3QDGD 3OB0K 3RVXD 3C6SA 4NDMA 4HIEA 3MV11 2OI9B 5D7LB 3TWCH 4GJTB 4XRCB 5E08H 4LVOC 3VXQA 1TQCB 4KUCF 1GGYA 4HWNA 4C83B 1PG7X 4KU1A 4GXUN 3PL6A 1BQSA 3SDYL 3S3SA 3BWAB 4J4PD 3PNWA 4LSSL 3U4EB 1XAUA 1N0XL 2OS7A 4ZFGL 1J0ZA 2XZAH 3ARSA 4I1NB 3PV6B 2ZPKL 5E4EC 1NCAH 1CGSH 3LHPL 5BQ7A 3U0PB 3I6LD 5D71L 3QBTB 3VGDA 2ZG3A 2R39A 3BP7A 2OJEA 2V7HB 4S1RL 1R3HB 3U6RB 2W92A 3LQZB 1MH5B 3OL2A 2OL3B 3DTXB 4R7DA 1NLBL 1WT5A 3P4LA 3E8UL 1DANU 1PEZA 5DJ0B 5HSFA 1YEGH 1XGYL 1U42A 1Y6MR 5DK3A 4IOIB 4PY7A 2XI9A 2VDOL 4GXUM 1WK0A 4HGWA 1ZT4B 2DLFH 4Y16D 3QEUB 1LEIB 4O2FA 1RAMA 2J1KA 1G6RL 1NC2A 2PW2A 2C3HA 4LAJH 1F2XK 1QR1B 4FG6D 1JGLL 3NH7H 2AEIT 4NZJA 3VD5A 3QRFM 1A14L 5ICXA 1MCNA 3QPXL 4HFWB 4LLVA 1NCCL 1NFDB 2LQRA 2XXCB 4S1QL 3ZTNL 1AKJA 4Z6AT 3EW3B 2Q8BL 1NSNH 3ARGD 3PWLA 4RNRB 5C0EA 4OUUA 2XN9D 5A1AA 2HYMA 2QSCL 2QKIB 4M02A 3LV3A 3O6FC 3FFDA 5BRZB 1IAIL 3HG1D 5GGVH 1VGKA 4ETQB 4NKQB 4R90H 4KMQA 4DTGH 5HHOD 5DR5L 1I3RA 5DRWB 5B3JE 3U7YH 5J89A 4DEPC 4JFZL 5TE6L 2HTKC 3M07A 1FFNB 4BFIB 5AZEH 4KMTL 1AR1C 2GJJA 3DYOA 4Y1AA 5JXAL 2GTZB 5IB3B 1U8IA 5KANI 3N1QC 3MLXH 2VL5B 5GRXG 4R26H 3U7WH 3FQNA 4HV8A 1E4KA 4PJXE 2GQHA 2L7JA 4TOYH 1T1XB 2VLJA 5E00B 1J18A 4FTVA 2VYRE 1SBBA 5C0AD 1BJ8A 1MFDH 5ERWB 4H5SA 4KZEL 5C0BB 2R0ZL 2RHEA 3GSXA 4NC1E 3DSFL 3IFNH 2A6DA 3V5KB 4PV8B 1ACZA 1MREH 3HNVH 3PP4H 3SJVA 4KKLC 3UJJL 3CLEL 4MQ7B 1MHEB 2Z91B 4MXQC 4NQEA 2VC2H 4FS0A 2BVQA 3CSYA 5DA0B 1H8NA 1KPUA 1F90L 2WANA 3RKPA 3WDIA 3JVGA 4UDTA 4ZUWB 3EYSL 1N3NB 1F8TL 3AB0C 2P5WD 2N1KA 6FABL 4YBQC 1QBAA 4JFPB 1NGZB 5JQHC 4HPOH 5CJOH 1DEDA 4J1UB 4P5TB 4XRCA 3MV9E 2HJKB 1RZJC 3QJHA 5HYJD 4C83A 3QWOB 5GS0L 3WNMA 4E42B 3U4EA 5DJZA 3QUYB 4ZAKD 1CG9A 2DLFL 3IXAA 3BO8A 1EHLH 2YA0A 4ORGB 4U3CA 3PV6A 1TETH 1A7RH 1U3ZA 2J8UB 1RJZB 1XH3B 4D8PB 5DXWA 1UM4L 4X4YB 4WUUE 3W11C 2VDNH 4YGVB 3TVMD 4NCDA 3U0PA 1KULA 5L7XL 2DM4A 4R96A 4U6YB 1OGAA 1V7NL 3QG7H 2R0KH 3N85L 3S88H 1JK8B 3L3JA 1YNLH 5KVEH 3UXFA 3BE1H 4KHXL 2DAVA 5MERB 3O3UN 2EC9U 1MH5A 1A4JB 3DTXA 1EEUA 1MCSA 2OXGA 3TO4D 4OGZA 3QEHB 4QRRE 1NBQA 2NY4B 1ORSA 5MEND 4I77H 3B9KA 4Y0GA 1HWGB 1YPZB 3FMGL 4YDKL 4UUJA 5F7YC 3MRNA 4IOIA 3U7YL 4L9LA 3DVFA 3FB6B 3QEUA 5AG8A 1LEIA 4JKMA 4XXCA 4DFIA 5L8KB 1J88A 2MKWA 1XIWB 1QQDB 1QR1A 4NJAL 4R3SB 1OTTC 5C0CD 3QUXB 3P4MB 3MLXL 4DKDC 2FECL 3QDJB 2A0LC 1FN4B 5I1DB 3U7WL 2PO6D 4XVTH 3SGDH 4K3EL 3SY0A 5CIPA 2ICWI 4M61A 3GIZH 4TOYL 4G9FB 3O2DH 3H7LA 3N06B 4ETQA 4OCYH 2CLZB 5FYJD 3SQOH 3MCLL 4B7IA 3G6JE 4XPHH 5DRWA 3BPOB 4J4PA 1AGCB 1FFNA 4BFIA 3IFNL 1R6VA 4X6FB 2VLKD 1AGDB 1F58L 2IPUK 1YEKH 5F1SA 4L3AA 2X4RB 2GTZA 4DOHE 5GZND 2VC2L 1P9MA 5KVGH 3VA2C 3OKKB 3P30L 5BXFB 1PX4A 4A6YB 5ACLA 3D5OF 3U79A 5IV2A 5HVHB 3HE6C 4I0PB 5E00A 1DLFH 4LKCB 1QFWL 2DKUA 3ALXA 4OZFB 1C1EH 4UMGA 5CJOL 3U30C 3ZKXC 3MJ9L 4U2YA 1BOGB 1J0JA 5C0BA 3FAXA 5HPMA 3DHJA 4D0DB 3FKUS 4L1DA 4PV8A 4U1LA 2H8PB 2PYFB 4QTHB 5T1KB 5A16B 1MELA 2D4FA 4P2CG 4MQ7A 5AD0A 2Z91A 3VXPB 3KYMB 3LMJL 2XKSA 3WXWH 2ZP0T 1TETL 2IMMA 4MSWA 3Q3GA 4WCYH 3C5ZD 2WLYA 4ZUWA 4JFXB 1FZOA 4DCQB 3X3GH 3SO3B 1QYGL 3ARGA 3CC5B 1AO7E 3QG7L 2R0KL 2AK1L 3S88L 2ENYA 4F7EB 1YNLL 1LO3H 1NGZA 1BP3B 4KVNH 3OJ2C 2ESVB 4UT7H 1KPRA 1NUFA 4XI5D 3T04D 4J1UA 4P5TA 1SMAA 2R69H 3JTSA 3MV8E 3UTOA 2ARWA 4NQTA 1RUAL 3HR6A 1NCDL 5HTSA 3W39B 4PB0L 1JF1B 4Y4FB 4N90D 3LZFL 4NC2B 3QR2A 1UWEH 4ISVB 3D3VB 4OF3A 2AI0L 2APTA 4D9RE 1IAOA 4E42A 5DFWH 3QUYA 2FL5A 3QUZB 1PY9A 3BH9B 2J8UA 1RJZA 5TF0A 4D8PA 1Q94A 1EH9A 4X4YA 4PJBF 5EORL 3JTTB 2HKHL 1I7UB 3TN0D 2VZ1A 4U6YA 3QXUA 1JK8A 1WFUA 2E9JA 1N2RB 1VADB 4KROD 4M7LT 5C0AA 3TZVD 5FGCB 4TSAL 5MERA 2HT3D 1CXLA 1SEQH 3O2DL 4UNVA 3H9HB 5AAMA 3HE7B 5I75C 4CU6A 2B1HH 3T2NH 1YPZA 3JSSA 2YBRA 1IEAB 3VI3E 1H3WM 5I8EB 3MBED 5D1ZD 2DI9A 3VXRD 4TSBH 3FB6A 3L3OB 5FKAB 5T3ZE 3BQUA 1SY6H 5HHVL 3NIFF 4X7DC 4H20H 3RX7A 1XIWA 1QQDA 3RGHA 5MI0C 4YBLB 4R3SA 3VXUE 1SM3H 5IVXA 3QUXA 4Y4KC 3MRDA 2FYYB 1FN4A 3QXTA 2P5WA 1TPXC 1CDCA 2FD6L 4MA1C 4NQDE 1LP9F 3PHOB 4PGJA 4NKOA 5L2KB 1VEMA 1G0XA 3TIDB 3VG9B 2EXWC 1P4LB 4V1DE 1DLFL 1DQQB 3MREB 4Y5YB 2C1PA 2NZIA 4PTTB 5J12C 4BK4A 1CWVA 1C1EL 3S3PA 3HAEH 4JB9H 5CEYA 3G5YB 3MXWH 2VLMD 4Z7NE 4YPGB 4R2GD 2C26A 1J1PH 4MCYB 4ZAKA 4X6FA 1AGDA 4P5KA 4WY7H 1G7HB 4LCUA 2CLVB 1TTGA 2X4RA 3RVWC 3DHMA 3NABH 4K8RC 3OKKA 3MODL 4WCYL 5TGBB 5L6YL 2BNRE 3L3IB 3MRLB 3RRQA 4A6YA 3OV6A 4HS8H 3EO1B 2GI7A 4WVRA 5MHSE 2WWMC 3SCMB 3D18B 4I0PA 3F62A 4LKCA 4OZFA 4PRIB 3UTPD 4QTIL 1CXIA 4UT7L 3WFBH 3A6BH 5E5MB 4PGEA 4JFDE 1FNSH 5FO7B 3KYKL 3WHXA 2EIEA 3IKKA 4HIXH 4PRAB 4D0DA 5GZOC 4HH8A 2H8PA 2PYFA 4QTHA 5T1KA 4AEHH 4LVHB 1URLA 4XVSL 3C5SA 5IMLB 4P4KD 2XWBA 4QRPA 4FQ1L 2H1PH 3KYMA 5GS0D 2FIRT 4L8SA 4O00A 3DSNA 3UYPA 4YUEH 4GW5B 4H88H 3ZYIA 4JFXA 3QIBC 2X09A 4FNLH 3CC5A 3F6LA 1A02N 4LCWE 4I0KA 3RTQA 3IFPB 2DLGA 4P23B 4NM4H 4F7EA 2ESVA 5EU3B 3FT3B 1D5ZB 1JPSH 1IGMH 1ZHNB 2HA1A 5TQ0H 1NGYB 1ZTXL 4GMSL 3W39A 1NQBA 1JF1A 2BRQA 4Y4FA 2B1HL 5GGQL 2VLKA 3D3VA 3RIFK 1TFHA 3KJ4C 5L0QB 1GYAA 1WZMA 1KELH 4LPXA 3RUGE 3EOTL 4LSTL 4PJIA 1GHFH 5J1AB 1KB5B 1I7UA 2IPTH 4EN3B 2D7NA 4O02H 1PVHA 4OCMC 1U8PB 5DHVA 4F9LC 5FDWA 4QHUB 1N2RA 2D0HA 3W0WE 2VNCA 2DQJH 1K4CB 1CE1L 4J2XA 1HSBB 1JGUH 2CKBH 4M6AA 4QRTB 1FC2D 2VLRD 3H9HA 3HE7A 5J6HB 3BFOA 3GMMB 4JZNB 4WFGE 4N8VG 2DKMA 2DJUA 4N1CA 1IEAA 3VFSA 3ZDXF 5K9KB 4NQUA 5I8EA 5BCAA 1MF2L 5JQ6H 4LASH 2CUHA 5FKAA 3L3OA 3KPSE 1IKNC 3S4SG 2OK0L 3QUKB 2CRIA 3ARYA 4N5UA 4Z5RB 4EI6A 3Q0HA 3S9DB 25C8L 3C5ZA 3RWGA 2APWA 1KACB 1MY7A 2MQ3A 1XF5B 1CXEA 1W8NA 4E0RB 1BEYL 1JJUA 5ISZD 1CDJA 1JBJA 3C8KA 3NPSB 2ZCHL 4K2UL 5DUML 1J1XH 5IP4A 5TH2B 2JJSA 4X7EC 1EX0A 3EUUA 3PHOA 2VXTL 2PYED 4HJ0D 4GXVL 3OKOB 3KLHD 3TIDA 5I2IB 2EIDA 1RD6A 1RIVL 5BVJB 3MREA 5I0DA 1N4XH 5GGVY 4KK6D 1GZPA 4X7TA 1CE6B 4MB3A 5JR1L 4U4BA 3RKDD 4QOKD 2NY1B 3MC0A 1OW0C 1FNSL 3L9RA 1FFOA 1YN7A 4YPGA 1ADQH 5FCSH 1MCPL 4MCYA 2HRLA 1FH5H 1G7MB 1UCBH 4CGTA 3VD9A 1PDKA 2FJFB 1G7HA 5D7IF 2EE9A 3REWA 2CLVA 2F74B 1V3MA 2P46B 2FEEL 3UTQA 3TN0A 2V9RA 2DWEA 1G7LA 1GOHA 5TGBA 5DMKA 3L3IA 4YUEL 3CPLB 1IGJB 2D03H 3BD5A 4K7PH 4RMVA 4NQCE 4TTDD 3EO1A 4OIIH 3SCMA 2JCCE 1EHAA 3D18A 3RGVD 2OJZH 5ICYB 2CK0L 1VACB 1FO0B 4PRIA 5GJSL 2GJZB 5DF0A 5E5MA 2Z0BA 4OZGB 3ULSB 2IH3B 1JPSL 1IGML 4YFDB 5DD5H 1LK2B 3BHBB 3QFJB 3HMXH 3PGFH 3PL6C 1GZQB 3WO4C 1D9KB 2EDWA 2WBWB 2W9EL 3B9DA 4G42B 4PRAA 5D1ZA 3RA7H 1GIGH 3M8OL 5EZLA 3L5XH 3VXRA 3HFML 5GIRB 2X40A 2YR3A 4YHPB 5KG9B 1R3LB 1I9RL 4RQQA 1RULH 1T0NB 4OZHF 1MVUB 3P0YH 4XNYH 5IMLA 1EAJA 2R0WL 4ELKB 5ACMA 1F5WA 5D7JD 4YBHA 5D2LB 1KXVC 2IPTL 4LLWA 4NFDA 4O02L 4ZO9A 1I1FA 3V4PL 5IMKB 2Y07H 4G80A 4IRSB 2JE8A 3FT3A 1D5ZA 4AM0A 1ZHNA 2UZIH 2IQAB 5I1JH 1MI5E 1NGYA 4BSVA 1NGPH 3F7VA 3GBMH 1NFIB 5CP3A 4P2RB 5I8KH 3UPAA 3WV0A 4HUMB 3MYJA 3D2UD 4IOSD 3JBG7 5D9SB 4EEEA 2PXYB 4FP8L 1AGBB 1MRFL 2CO7B 4LASL 3MRPB 4NN5C 1WZKA 5KOMC 4HWBL 3P9LB 3KR3H 4LSVL 4W4OA 5J1AA 1G7QB 5F7EH 4GQPH 1UH2A 2AGJL 1J1XL 1BREA 1HYSD 5A3IC 5T3XE 4L4VB 3FRUA 3ULVE 4JREC 4HIJA 1K4CA 4N1HB 2BY2A 4H25A 1HSBA 5K59E 5IJVA 4XB7A 2EDTA 1N4XL 3FB7B 1H15B 3LKNA 1NL0H 5J6HA 3GMMA 4JZNA 2A73B 1L0YA 1MJUH 1U8LB 3DWTA 4XTRC 5E8DL 1V3LA 2WUBL 3GMNB 2KUTA 1KTKE 1FYTE 2CIIB 1KJVB 3HMWL 2DIAA 3DRQB 3FO1B 1FCCA 1U3JA 1UCBL 1C5CH 3QUKA 5IW6B 1JF6A 3GZKA 4Z5RA 2VDML 2ERJC 2OTWA 3O11B 2D7TH 1S78C 2DQEL 5HD8D 4PJFF 1E4KC 3SE9L 4KZEH 4AMKH 1FIGH 4JM2D 2P8PB 3ARED 1M05B 3WFCH 4PTUA 3DX6B 2ATPB 2EDYA 4O4YH 4OIIL 1AI1H 5I2IA 1CVRA 4FQQA 2F54E 1YNTB 4FQCL 4R7NB 2DI8A 3GNMH 2NY2D 1CE6A 3IAQA 1B90A 1NFDF 2C5DC 3HMXL 3PGFL 5EBMB 1EBPA 1MFEH 4LHQB 5T3ZH 2AEWA 4LGSB 1G7MA 4YDLC 5ITFA 3E3QC 4JO3H 3L6FB 4PJEE 2CDFA 2FZ3B 1RULL 1KLGB 3JVGC 1EERB 4KJWC 3FQXB 3S37L 4G6KH 5DRNB 1OAZH 1UXSA 1IGJA 1CICB 4JDTH 5C0JB 2WLZA 1MIMH 2OI9C 3RU8L 1XF4A 2VDQL 2Y07L 1F3DJ 1FO0A 1VACA 4JY6A 5IQ9A 3DARA 3MRHA 4FMKA 5LGHH 4RDQF 3T77B 1TQCC 2GJZA 3ULSA 4NP4H 2IH3A 4QRSB 1LK2A 3BHBA 4KK5D 4MNGE 1MCOL 4X6CB 1N59A 1R5VB 1GZQA 1NGPL 5I8KL 4P4RA 1U3HA 4YHPA 2IFFH 5KG9A 2P5EB 1R3LA 1RZ7H 1KXTB 1A6UL 5KJRH 1T0NA 1MVUA 4CVZB 3JWDC 3G9AB 4Z18A 4NFCA 3MFFB 1S7VB 3C60B 5D2LA 3CFCH 1FDLL 5F7EL 3ZDZF 3OKMA 1FG2A 1RJYB 2PYEA 3F7QA 3O81A 5CCKH 4IRSA 5D1XB 3B9KC 2VKWA 5J11C 4QOKA 3HPJA 2IQAA 3K3QA 4F3FB 4K07A 4XCFH 1X5LA 1RQ5A 5HGAB 5FM5M 3X14A 1NFIA 5F7WC 4P2RA 4L9LC 4MVBC 1J1OL 2OZ4L 1MJUL 1SYVB 4XXCC 4TNWK 1J0IA 4R4NC 2PXYA 5FGRA 2XT1B 3LQAL 4CL7A 2DL9A 5DYOB 1E6JL 1UJ3B 5K9OB 4U1MA 2O26U 2G75B 1C5CL 3LEXB 1HHIB 3N1GC 3P9LA 5KS9F 4NCC1 2OSLB 5DJAA 1IC4L 4JGUA 4L3EB 2D7TL 4HZLA 4APQD 1PY4A 3B5TA 3L3DA 5DI8B 2Z92B 3RGVA 4ODTL 3LPGA 3VH8G 3CVHH 3WFCL 2J8UF 2HH0H 4YDVB 1A6TA 3TNMA 3KVQA 1P6FA 4KTYA 5I9QB 4O4YL 1JUFB 2WAHA 4IMLA 4ZUUB 5H37G 2DS4A 1WBXB 3T0DA 3MRKB 4OF8A 1FL3A 3TJHD 3ZTJG 4WTZG 3MOQA 4J4PC 3IAGC 3IB4A 2A73A 1U8LA 2YD3A 4WO4B 4YZFE 3QJFB 2CIIA 5SV4A 3NGBB 2GY5A 4RISL 5T3ZL 1YQVH 2UVEA 3RIAF 3FO1A 4HCRH 5IW6A 3L5IA 1P9MC 1R5WA 3DI3B 3DBXB 1K85A 2F19L 1S9YB 5D7JA 2M8XA 4X0KB 1QSFE 5DRZB 3RP1A 4ZNEE 2W07A 1U36A 3NCJH 1OM3L 1OAZL 1M6OA 1QEWB 3RZCD 3HR5A 4N0UB 3C2AL 4I18B 1MCWM 1MIML 4PGDB 4KQ4L 4FQJL 1YNTA 4R7NA 4LHUB 4LARH 2IAMA 3G6AA 1BVZA 4PG9A 5LGHL 5DD1L 2CR3A 3D69B 1GCFA 1EDQA 5LXGL 3D2UA 4H1LG 4PJGB 2HN7B 4AG4H 1VFUA 5EBMA 1DQTA 3HAEB 3B43A 4KI5F 1LDPH 4K3JH 3L6FA 2AJUH 4Z0XB 1LO5B 2MQCA 2ZCKH 1A0QL 2HJLA 5KJRL 2AJVH 1EFXB 3Q1SL 1NCBH 1YJDC 3RX5A 2HLAB 1UM6H 5CS7A 3ARGC 1WTLA 3NAAL 1WC7B 5LGJA 2AK4B 4U6HA 4PJAE 1HXMA 3I9GH 5IFJA 2ZJSL 3V79C 4P5TC 5FIEA 4LOUD 3FQWA 1KIPB 3TBWB 1HQRB 1KC5H 3ARFD 4QRSA 2VZVA 1HHJB 1X5GA 3VWJB 2BOCA 1DVFD 4M93C 3QUYC 1JWUA 2V7NB 3MACH 2P5EA 2P43B 5E8OB 1WTGT 5FB8B 2I25N 3C6LD 5EUOA 1XCTB 5KSVA 4JPKH 2VXVH 1E4XL 2BDNH 4WENB 4RGNE 5FYLE 3UTTE 1RMFL 3LB6C 4Y4HD 3LS5L 4JM2A 3AREA 5C9KA 8FABB 4HMCA 1RJYA 2IADB 5MP6H 3O9WD 2N4IA 5C6TL 1FNFA 4WUUD 2IC2A 2BVOA 5JDSA 5CUSH 1F6AA 4JN1L 4TNWF 4JJHA 3CVHL 2HH0L 2EO9A 4Z0BH 5D1XA 3MOBH 2MCPH 2V2XB 3MGTB 5C07E 3FRPA 5JW4N 4MNQA 4EZMA 4XAKE 3O3BB 4XNUL 3S8WA 5I1KH 5HGAA 1S7QB 3BAEL 3IDXH 4CU7A 3PHSA 1SYVA 4QRRD 1OD7A 2H3NB 3BQUC 1SBSL 3CU1A 1XIWC 5TJWK 3GKWL 1UJ3A 5K9OA 1YQVL 3HZMB 3CFBA 2DTMH 1MRDL 2G75A 9CGTA 3QUXC 3A6CL 5EBLB 1G7IB 4FABH 3PG2A 4KKCC 5DT1H 3OGOE 2OSLA 1UB5B 5IB5B 1X4YA 1MAKA 4M62H 3EJYD 4OD3L 3TO2B 1FBIH 1A7PH 1FGNH 1CFVH 2RJMA 3I02A 1ZANL 4YDVA 3KS0J 4C54A 2Q7YA 4HH9B 4P59H 4ZUUA 4PJDF 4CVWA 1WBXA 3MRKA 1G7JA 5JW4M 2VWEE 1RU9L 3BPOC 1OSZA 3IJYB 3Q2CA 5KVDH 4NO0A 1EFQA 3MUHL 2IANB 3H3KA 4M00A 3J8F7 1D6VL 1F11B 2CJUH 4ZPVB 1S9KC 1ZHBA 4AG4L 1ZT1B 2FEDC 5DJ6A 4FA8A 3GJFH 3V4VH 2DQDH 4PRHB 4G6FB 4YK4C 1LDPL 4K3JL 2AJUL 2ZCKL 3CJJA 3FQTB 1S9YA 5EC1B 2AJVL 1JWMB 3MFGB 2W9LA 4X0KA 3RWJB 1NCBL 1XGTA 1YY8B 5DRZA 1SY6A 1UM6L 2WIMA 3FO2A 5C86A 2V5SA 3SGKA 1QEWA 4I0PC 4J3WA 5T3XH 4GAFB 2V17L 3ULVH 3HZYB 3GHBH 5ADPH 3SDAD 4K9EH 3JV4A 5E2UL 3I9GL 4I18A 4HT1L 4MZ2A 4PGDA 3V5DA 3GK8L 2ZCLH 3B3IB 2VXUH 1NKOA 4LGPB 5DK0B 1M7XA 3D69A 5J1TC 1N26A 4YHZL 1RJCA 3I6GA 4PJGA 2OTUB 1L0QA 1PJ9A 1FFPB 2WM0A 4AEFA 3VD3A 3HAEA 35C8H 3MACL 3HUJB 4P99A 3GSUA 2AW2A 2EDNA 5CGYD 2PW1B 4XCEB 1EFXA 4PPTA 3S34L 3V4UH 2E7BA 4PREB 2FR4B 2VXVL 1ZHLA 3DYMA 3MNVA 5KANG 5IB1A 1FJ1B 1WC7A 3RTQC 3S37X 2AK4A 1QFHA 1NAKH 4LSUH 2NY7L 4K7PY 4TULH 3BH8A 3QIWB 4R0LB 5D96C 5MP6L 3TJEL 4OCNC 3JWOC 1QFUH 2YMXH 5CUSL 2NY0D 3TNNB 1EV2E 2PNDA 3MOBL 2BNQB 4PR5B 1AO7D 4XVUC 4MAYD 1HQRA 4Y4FC 4P5MB 3MRFA 4EKXA 1KCLA 5I1KL 1F42A 5FHBL 3THML 3ZKSD 3IDXL 4JZJA 3KDMB 2V7NA 3MV8D 4F7PB 4RA3A 4KAQL 5DVLA 5E8OA 5FB8A 4Q0XH 2KQMA 5HVWA 4XCCL 3A0OA 3NN8A 1YMHB 5DUPL 4HXAH 4YH6A 1HEZB 2VDKL 2B0SH 2GK0B 4D9RD 4FABL 2F58L 4DOHB 1N5YH 5GRVK 2FIKB 2J4WL 2X1XR 4LLAA 4Y16B 8FABA 3V8CA 2DBJA 1MJJB 4C57C 4JQIH 1T6WA 4HS6A 4ZDHB 1A7PL 1FGNL 2GUOB 1BF2A 4JR9L 2V2XA 5JA8B 3HE7C 1RK1B 4WGVB 4NN7B 4P3WA 1Y6NR 3R4DA 4HUUB 4CVUA 3GB7B 5KVDL 1A3LH 2CRMA 3PV7A 2UZYB 2XN9B 3KPTA 2H3NA 2I9LA 1ES0B 2WV3A 2CUMA 1TITA 3TBSB 3ZT5A 5GQBA 1K2DB 3ZHLA 3V4VL 1LQSR 3HZMA 3VCLB 3FL7A 4KZDL 1G7IA 1RVFL 5DUBB 5T3ZD 5J9PB 2JJSC 4YHNA 3L5HA 5DJXB 1INEL 4ZFOB 3DVIA 4XHJD 2LV4A 2LTQB 4Y2DA 3TO2A 1XF1A 4UDUB 1GC1C 4NKIL 4Y5YC 4QHNB 2YPLE 4HH9A 1LWRA 3IDNB 5FO9B 3ARFA 4NQDD 5EO9A 2ZCLL 1UB6B 3IJYA 1K4DB 2VXUL 1ND0B 2IANA 4V1DD 3X17A 4ONFH 1RHHA 3MV9A 3SE8L 3WJLA 4PB9H 2CKBA 4ZPVA 2X4UB 2MOVA 1ZT1A 3C6LA 3UBXB 2F8XC 4PRHA 3O4OC 1LMKA 1MLBB 1T21B 2E27H 3TN0C 3D39E 3EYUH 1DSFH 3FQTA 3MLWH 2R0LH 2H26B 1JWMA 3N9GL 4IHOB 4CRPA 1NBYB 5EPMB 3RWJA 4K71C 3V4UL 4RWYH 1IM3B 4PRBA 4KROC 4I3RL 1HH9B 2DKSA 1XCQA 2HT3C 1FORL 3SCMC 3LSOA 3KPNB 4QGTA 3WDJA 4LSUL 3INUL 4TULL 4M6ML 4P2OD 1QFUL 4U6XB 2YMXL 4MA7L 2DD8L 1JI1A 1G9EA 3BPNB 4UILH 1VESA 5D1ZC 2EDRA 1XR9A 2OTUA 5DHYB 1FFPA 3S35L 3B2UD 3O3AB 2YZ8A 1ZLVH 3U1SH 5SWQA 2IPUG 1AR2A 4Q0XL 1CLCA 4XCEA 1ADQA 3C9NB 1KEMH 2E5EA 4PREA 3GRWH 1A5FH 1ZKAA 2NY3C 2Q86A 1Y6KR 2B0SL 4UINL 2MSPA 5BMFL 2N7AA 3UTZB 1N5YL 4UU9A 4C4KO 3CK0H 4OSUH 3QIWA 4R0LA 3HI6H 4ZNCD 2H41A 3VGHA 1FNHA 1M7IA 5FYKE 3TNNA 4E41B 1S7SA 4XNZC 3TVMB 5AYUL 3E6HB 4HHAB 4G6AD 3DV4B 1MCDA 4HKJA 1IAIM 1RZKL 5L0QC 3KDMA 3G6JA 5JA9A 5SV3A 4BQCA 2EH8H 4F57H 4GSDL 2YUVA 1GGIH 1XEDA 3IVKA 4OZGF 4F80A 4W4OC 2EDOA 5DRXB 1PKQE 1IC7H 1BBJA 3LKRB 1Q72L 5GSRB 2XTJB 2Z8SA 3VD7A 1MJJA 5JHDD 5CJQL 2BNRB 4QYOB 3TP4A 1AXIB 4TVSa 3D48R 1T7XA 1QSEE 2XG4A 3IFLL 4OCLC 5EU6B 4IDJH 5D2LF 1RK1A 2EIZB 5EOQL 2XIDA 4K94H 5DD3L 4HUUA 3W0WD 2JIXA 3GB7A 3MLSH 1CFNA 3MGAA 2P7TA 3P77B 4MYWB 4ONFL 3PP3K 4MHHI 3DX8A 1ES0A 4HKZA 3RBSA 4WFGD 2J7LA 2XXMB 2E27L 3NPSC 5FYLH 3EYUL 3QCUH 4HJGA 5DSCB 4MJ5B 2R0LL 3QFDA 4MA3B 5J9PA 3ZKMD 1M71B 5TDOB 3X3FH 3GBLA 4H0IA 4WI8A 4KHTL 3AM8A 5FA3A 4QHNA 1JTTA 5E5UB 5E6ID 4IRZH 1IT9H 3IDNA 4LCWB 4F2MA 2NY1C 4Y19E 4UILL 1XGPA 1K4DA 1ND0A 1BJMA 1KT2B 1I7TB 4X5WA 1CF8H 4OZIB 3HC4L 5CSZB 4KRNA 4YEEA 2X4UA 5DO2C 1V05A 1LO2H 1ETZA 4U1KB 2DJ4A 3U1SL 4S1DD 4NRXB 1C7TA 1MLBA 1T21A 2BVEA 3UROR 5L8LB 3SGEH 2H26A 4IHOA 5EPMA 3BRGC 4LEXL 1IM3A 3PWNA 1A5FL 2O93L 2J5LB 1HH9A 1DTUA 3KPNA 1CI5A 3MCKB 1FLTX 4ZOBA 4PJCE 5FUZH 3AXLB 4HUNB 4MB4A 4O51B 4BZ1H 1XGRB 3HI6L 4YFLI 4P0DA 2FX8H 3D6GA 4NQCD 3NIFE 4MLIA 4S2SB 4L8DA 5H37H 1YDPA 5D5MB 3ULUF 4CNIB 1G0DA 1U3HC 5BS0E 4OD1H 3TT1L 3ZTJH 5B4MD 4AT6B 3LN9A 5DHYA 5H35A 2W65B 5ABDE 1UXWB 2J88H 3NTCH 2F53B 3KPLB 2EH8L 1LP9E 3KPPB 5C9JB 4EOWL 3CFEB 2HLFC 4XPTH 4FQIL 1PD6A 1IC7L 4WUKH 4QRUA 1A21A 2L7UA 4J3XA 2VAAA 2EKSA 4X4XB 3NIDF 3VXUA 1J5OH 4IRSC 1CFQA 4KK6C 4ODXB 4M7JH 4OCXL 2P42B 1HHKA 5FOJA 2Q3ZA 4KJPD 1P53A 4V1DA 3E6HA 4HHAA 3K4ZA 3FTGB 2PXYC 1ORQA 3I6KA 3OR6B 3U7AA 2CSPA 1ZEAH 1Q9OB 1HIMH 1MI5D 4H1LH 4YDIL 1MPAH 5DJCB 5T5NG 1Z9OA 1BM3L 4RAHA 4BM7A 5DRXA 3SDDB 2C4FU 1XF3B 3IJHB 5DMIL 4X6CF 2F5AH 3WFDH 2EIBA 1TQBB 3LKRA 3QNYB 1JMZA 4LP5A 3QCUL 3K46A 4M5ZL 3NCYP 3DECA 3KPRE 4UTAH 2QJDA 1FRGH 4KK9D 1MJ8H 5JW3H 3B2VL 2BNRA 3X3FL 4P2OA 1U6AL 4KY1H 2VXQH 2IQ9L 3BEVB 1TZGH 4XWOC 2C3GA 4N0CD 5EU6A 3VFGL 1G1CA 3HRZA 3BUTA 3OQ3B 4N8CH 4JQXC 1CLZH 3I85A 1QFWM 3P77A 4JFDA 1CF8L 1JNNH 3IJSB 2C3WA 4CN1A 1DCLA 4Q58C 4OCRH 3LEVH 1LO2L 5D7JC 1QD0A 2O5YH 5E7BA 5I15H 4TUJA 4TVPL 3BX7C 3OGCA 4MA3A 1M71A 5C7XL 4D3CL 3CX5K 4GKSA 4UT6H 1OP3H 3R8BB 43C9B 4YXLH 2IAMC 5FUZL 2SEBA 4JFYA 4BZ1L 1IM9D 4ZO8A 1U92A 1NJ9B 4LCWA 3C8HA 1YEHL 1ZLWH 2VABB 4NZUL 2V2TA 2NLJB 4AK1A 4U1IB 3BZEA 3OF6A 3O0RH 1KT2A 3U83A 1T03H 1I7TA 4XNMB 2F54D 1QR4A 3P0VH 1KLUB 3MJ7A 2J88L 3NTCL 1VDGA 4S10A 4U1KA 2EEDA 1BQHB 3GJEA 4NRXA 4H0HB 4EXKA 5IVOA 4BFGA 5ESQB 4OD2B 3ARPA 3ZT6A 1PFCA 2RIKA 4HCRA 5FGSA 1RUKL 4WRLA 4DUXA 1V7MH 4M7LH 5HYIA 5E99H 4P4KB 1V8HA 3IXTB 3G5XB 5C0IB 3AXLA 4CJ0A 1I8MB 1YN6B 1P69B 4M7JL 3W0WA 2VUOA 5HGDB 2KBGA 5I1CH 3IT8D 4BH7A 3NZHH 1UYWH 4S2SA 1JYWA 1RZJL