5GZOC

Structure of neutralizing antibody bound to zika envelope protein
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
219
structure length
214
Chain Sequence
QVQLQESGPGLVKPSGTLSLTCAVSGGSISSSNWWSWVRQPPGKGLEWIGEIYHSGSTNYNPSLKSRVTISVDKSKNQFSLKLSSVTAADTAVYYCARDRDDLSPFDYWGQGTLVTVSSASTKGPSVFPLAPSSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Genome polyprotein
publication title Molecular determinants of human neutralizing antibodies isolated from a patient infected with Zika virus
pubmed doi rcsb
source organism Zika virus
molecule tags Viral protein/immune system
total genus 37
structure length 214
sequence length 219
chains with identical sequence H
ec nomenclature
pdb deposition date 2016-09-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5gzoC02
5FO9B 4X6CB 5DRZB 3GRWH 3R0NA 4M1GH 3LQAH 1F3JA 1ZE3C 5JDSA 3KYKL 4ZQKA 2JCCF 3HE6A 4PJ9B 3OHXB 3QDMA 5EU6B 4HT1L 4PJEE 1CT8B 3GBML 4CDGC 1EHLH 2BC4A 4G7YH 3VRLE 5L2JB 3TA3B 4U1IA 4JDZB 1PQZA 4JDTH 4OCXH 3VRJB 2VISB 2Y6SC 5FV1L 1KIRB 5DQDH 4YAQA 1LHZA 5LGJA 2Q7YA 4KRPC 4MJ2A 2AK1H 1QPPA 1F90L 2VXVH 1MVUA 3FQWA 3T77A 3IF1B 3I50H 4HV8A 4JPVH 1N59B 1K4CB 4GO6B 4HIEB 4RIRB 2N7AA 4P4RB 4NWTH 3O0RH 1V7NL 4LK4A 3ZSTA 4JFEE 1AGBA 5LAXA 1U9KA 3IJHA 1MRDL 5F7FA 1MHCA 1XZ0A 5BZDA 5D7LE 2BY0A 2EH7L 1KIUA 4MAYD 5E2UL 4LGPB 3D2UA 1FL3B 1ZSDB 3MUZ1 1WWCA 4M62H 4OFIA 5CUSL 3S36X 1CR9L 3IJYB 2MQ0A 3WS3A 1AKJD 1CU4H 4M6OL 3MRRA 4M7ZB 4FQHA 5CJOH 1U8HB 2P8PB 3FO0L 4R7NB 1OSZB 1R0AH 3U9PL 2H32B 2FEEI 4HPYL 2P24A 4FQ2H 1JUFA 2D4FA 4XMLH 4Y7MA 3H9SA 3N1QC 1GVIA 4U6TA 2MCPH 3B2VH 3QCTL 1F2QA 3NCMA 1K8DB 1RI8A 1RD6A 5EFIB 3SDYH 4BUGA 4WHCA 3BZFA 4OB5H 1U8LB 1JGLH 2J88H 4JDVA 4OF8A 2VLRB 3FQUB 2ADIB 1CGWA 4GKNB 3HS0A 4M4RA 4MD4B 3CNKA 4ZUTA 5IFAL 1HKLH 3EHBD 3FB6B 1T1ZA 3Q48A 5MENB 1NLDH 2Y07L 5DF0A 5JA9A 5E08L 4HWNA 1C08A 4PJ8B 4XNQA 4PJAA 2R23B 1LWRA 1YNTB 1BJ1H 3DYMA 4PRIE 5F1KC 1A0QH 3OL2A 4MLIA 3VWKC 2XA3A 1QRNA 3KPMB 1BWMA 3HRZB 1KG0A 5C0AD 5D1QA 2J8UF 2X4UA 3VFNA 3PWNB 1AO7A 3GUTB 1YMHB 3CAFA 3MFFB 5DMIL 5KAQF 4R4BB 3W5MA 3CFEB 4X5XA 4L8BB 2JB6A 1BF8A 5CJXA 1Y18A 3EAKA 5F96H 3C8KA 3IFOB 3IETB 3VD9A 1T03H 3HFMH 3E0GA 4LCCB 1FPTL 5E6IA 5DHYB 1SYSB 1TCMA 4POZC 2J7LA 1OGAE 4JVPA 4OZFA 5CBEA 5DWUL 4JFED 2PYEE 5GRYA 4F9LC 5KZCB 4EN3A 3QPXL 1OAUL 5TFSL 3TLRA 4CU8A 1FBIH 5D7LD 3L3GB 1K6QH 3IDYB 4XHQA 4DJMA 3GHBL 2P8LA 4NCDA 4UTBH 1YEGH 3NABH 3IRZA 1WUNT 4G80B 5AD0B 2DQIL 2AEPL 1DQQA 4OI8A 3NPSB 3AU1B 2HG5B 3X14A 3DMMC 5A2KH 5TH2B 1BAFL 1ZLVK 3RGVD 4H5SA 1B0GB 4BSWB 3NTCH 3NVQA 3V6FB 1QBML 4GW1A 3VA6A 3RX5A 3T1FB 1ZHKB 5CBAB 2AKRB 3ZDXE 1OSPL 5BVPH 3MBEB 5IGXH 1FIGL 5KG9B 3SJVB 4FG6C 2PNDA 2V9TA 4JRYE 1CFNA 5IK3A 3K74B 1B6UA 5ILTH 1H5BC 2BVQA 1VPOH 2CDFB 3EO9L 4G9FE 1XAUA 4KUZH 4FFWC 4LARH 4S1RL 5ACLA 3SHSA 4P5MB 1FHGA 1NCAL 3WEXA 1RHFA 1OCWH 1F6LL 1PDKA 1R5VA 1ADQL 2O5ZL 2B5IB 1KUMA 1E0OB 2X4QB 3QEGL 5F7LB 2I60L 3O41B 4U49A 1JFQL 4P5KA 1KCUH 2X89D 4MD5A 3WE6B 3DPBA 1NGYA 1CDJA 4L8DA 4WUUA 5E94A 1L7TL 1T1YB 4XBEH 1I85A 4EQ2A 4DKEH 4JM2B 5KSUB 1X7QA 5J8OA 2UVFA 4JR9H 5E1HB 4PRID 1GHFL 4S1QH 4QRSA 2HFFA 1HI6A 3FT3B 4PGDA 3WJJC 4JPWL 4Y5YA 3VI4E 3MNWA 2EXWC 1GAFH 4IMKC 4UTAH 5C07D 4YPJA 3LKRA 4V1DA 1KCSL 3OB8A 3TC9A 1KTLB 1XGQB 3SGDH 4PJFB 4DUWA 3T0DA 3SKOA 4APQB 5I17B 2QV2A 4P23B 4PJ5E 2VKXA 7FABL 4E5XA 3BH9A 4DUVA 4KZEL 5EN2B 4L5FL 1OGAD 4C57C 5EOCJ 3TO4A 3O3DB 2X7LA 2Q8AL 1T1WA 4JCLA 3PUCA 3QEHA 5TQ0H 4D0DB 2NXYC 2IC2A 4Z7NF 3H0TA 3VFMB 5FM8A 4NQEB 3B2UC 3ULVC 1A1OB 3O6LH 2VXTL 1XIWA 3IDUA 1KB5A 1G6RB 3CFIC 4ZPVA 1A7PL 2Z35A 1KXVC 2IPTH 1H3VA 3S5LG 5DD0L 3ZE1E 1WQVT 5E99L 2MHAB 4ZXBC 1INEL 3IDXL 2HFTA 4PJIE 5D6CB 5DQJB 5BZWA 2DYPA 4B41A 1P6AB 5ADPH 3C2AH 4ZDHB 4I48A 2BFVL 4NBYB 3BP7B 3RTQC 3QXAB 4NZUL 4TNVK 1V3KA 3QUXA 4JANA 4L3AA 1RIVL 5D5MF 3LZFH 2NY6B 4JRYD 1Q0YL 4U1MB 2AJVH 2YRZA 1YNKL 4XPFL 4G9FD 2V5TA 4HMCA 5DMKB 3STBA 2G75B 1PSKL 4CMHB 1JMZA 1OP9A 4JY5H 3VXMB 1Z0NA 3G5VA 4WCYL 1CGTA 5I8KH 1ED3B 2LV4A 3D3VE 1OPGL 3FRUA 4NJAH 3U4BH 4JRXA 1HHHA 3QI9A 1FNHA 4JLRA 1FE8L 2UWEE 3VXUA 1M7DB 5I71B 4UT7H 3QDGE 3CH1A 3GI9L 3W9DA 1TFHA 3L7EA 3BX7C 4I5BA 1NEZG 1VCAA 5EC2A 5CJQH 4JFQB 5E2JA 1X5XA 3VGBA 5IB2A 2PW2B 2O93L 4TSBH 3FRPG 3GSVA 1IL1B 5GS2H 2OXHA 4R9HA 3HE7B 4Z7VF 1U3HA 4LQ1A 5GSVB 1G1CA 1A6AA 2P8MB 4PLKD 5J11B 3P11H 1NC2B 2WBJD 4PJ5D 4UV7L 3V95A 2OK0H 5E8PA 2OLDA 1ZWIA 3IDNA 4PRDB 3PQYA 3L6FA 4L3CA 2YEZB 4WEBL 5IFHH 3KR3H 4MCZA 1A02N 5HDQH 1JWMA 3SN6N 1QFWI 3MV7B 3ARDD 2N7BA 5D93B 5C0EA 4M7KH 3VXNB 1AXSA 3C5ZB 3DO7A 4P5TD 4B53A 1EXUA 3MA9H 1S9KC 1NGWB 3D25B 3UYOD 4FS0A 1PVHA 1BLNB 1UB5A 5F1OB 1R3KA 2IFGA 2OTUA 4YHKL 3TIDA 3T2NL 3E3QC 1RJLB 4YC2C 4LP4A 4F8TA 1WAAF 1JGVL 3OAUH 1A6WL 4XP6H 4OCYH 2A6DA 5FDWB 4UT6L 4AQ1B 4UDUA 3TVMA 3I6GB 4N9OB 1HHIB 1QLFA 3TFKD 1BVKA 1MCLA 1BZ9A 1HIMH 4NUGL 4P3CL 4KAQH 3TBTB 3O6FD 2KDGA 2DIBA 1JNLL 5AAMA 5E1AA 4KK5D 1KENL 1WBXB 3KPSA 1K2DB 1G7QB 4G3YL 4KXZH 4LBEB 4QRUB 4Q6IC 1CXHA 1OF2A 4MAYC 3KG5A 5GRVL 5I1KH 3O3EA 3DX9B 1FRGL 3SY0B 1AH1A 4NO3A 5IJVA 5JLZA 3PIQB 2JLLA 3GO1H 4R0LB 4YK4B 5FO8B 3O11A 4PY7A 2Z91A 2XWJA 1YMMA 1IVLA 2JIXD 3ZE0E 3QDGD 3PWVA 4PGZA 2CR3A 1IC4H 1NAMH 3O2DH 2FR4A 5CILL 1U8NB 4WDIA 1I3GL 1VFAB 3OKNA 1FG2B 4AL8H 5FUOH 2AJYH 3QIWD 1DUZA 3HNSH 3DV6B 2JK5A 2X09A 5HYSG 3GJFA 4YLQT 1E4XI 2IANB 3G5ZB 1R5IA 4OD1L 1EAJA 2PXYD 5K33A 3O4OC 4H0GA 3EHBC 4ONGL 3A6OA 2J5LC 3WXWL 4QRPD 2JCCB 1NGQL 4O2EA 4LFHG 4ORZC 5E2TH 1PKQA 5GHWL 3R06B 3RUGE 3BGFB 3H3PH 1KLGA 1E28B 1C8PA 5CZVL 3M45A 2OMNA 3L3HA 4K7PH 1VADB 2NY7L 1BMGA 1N2RA 2YD9A 2P5WB 3OQ3B 3B43A 1OWRM 2ZUYA 4LHJB 5HGHB 2B1AH 1WBZA 4PJCE 3ES6A 5DJXA 4D2NA 5BRZE 4HUWA 4NQSB 1CFQB 3IFNH 1HNFA 4C83B 4GKZB 1KTDB 5T1LA 4PRAB 1UM4H 1SEBA 3BDYL 3RKPA 1ACYH 4FQXB 2AK4E 2WV3A 2Q86A 3ZSSA 3K8LA 3MJ8A 4HKJB 4IRZH 5IM7B 4NQTA 3DO3A 3S35L 5KVGL 4YX2L 2F15A 1WICA 3QCUL 3LRSB 1MFBL 5ERWA 5I1AB 3IKCA 4LNRB 4L3EB 4DCQA 1KPVB 5H8DA 2Z31D 1E4WL 1WIOA 1Y6NR 3D69B 1WZ1L 3SQOL 5KVEH 4GW5B 1U8OA 1X5YA 4FQJH 5FYKH 3QNYB 2GCYA 3QEQA 3RGVC 1IZJA 3S9DB 2R1XB 4D8PA 1NC4D 3T0BA 1OARL 5D7JD 3V8CA 5FGBA 1FYTB 4UUJA 1VENA 3EOBA 1IC7H 4EQ3A 3QHFH 3L1OH 1I7UB 3ESUF 1GOGA 2CMRL 3HC3L 1Q9WA 1DE4A 1YEKH 1NDMA 3QDJB 3QUZB 3C60B 4RQQA 4CN6A 3MLRL 4I3RL 2YUZA 3MRFA 2X4RA 4DKFL 3T2OA 2XRAH 3L3OA 1HHKB 4JO3H 4RFOH 3H3BC 3CUPB 4XNYL 1A1NB 2XZQL 4LKXA 3QQ4A 5INDB 2PO6B 5I75B 1N8ZB 2X1WL 2O26U 3G5XA 4MSWB 3VFRA 4FQLH 5CGYD 3JWNC 2FWOA 1NDGA 4I2XE 3QO0B 3K7UA 4ERSL 5KSAD 5D1ZB 1OQXA 5FYLL 1Q38A 1XGUA 2FL5A 4HAFA 5CSZA 5J12C 4Y5VB 1IMHC 3BD4A 1DLHB 2GSGA 5BRZD 3KS0H 3ZKSD 5J9PA 4MX7A 5EOTA 4D0BA 2X9XA 2HJLA 3O3AA 1LE5B 5D8JL 2J8UB 4CAGA 4JGJA 4Y16B 3IDGA 1J88A 4X5WA 2CJUH 3ZKXB 4JPIA 2QQQA 1FJ1B 2AK4D 1KEML 3LQZA 3F7VB 3SO3B 2XKUA 3HLAB 1ADQA 1I4FA 5DJ0A 1M71A 5IWLA 1W72L 4X4ZA 5F6IC 3MJ7B 2A9ML 1RURH 3JXAA 4AG4H 4FQ1H 2BSTB 3VXRE 5B8CC 3RIAF 3PDDA 5DTFA 5B38G 5C0JB 2LTQC 1CLYH 1KLUA 1CK0L 1YUHA 4E42B 4YZFE 3U4EB 1FZOA 2UZYB 5CEZL 1NSNH 2DJUA 2A6IA 5IKCB 3QG7H 4PJDE 3MRJA 3TBWA 3BEVA 4KMLB 2HP4A 1L7IH 1J87A 3M17A 3FOLA 4P46D 4Z6AT 4DWHA 2NNAB 3G6DL 3T4AB 4PLOB 2WUBH 4WHDA 3NH7L 2QLVB 3BKJL 3LKQA 5TQ2H 3MUGB 2ZUUA 4JFFB 3DURB 2HAZA 1K5NA 3GFUA 4LHQB 1P6FA 3HA0A 5LVEA 2EE6A 4OCSL 2IQ9L 4EI5D 4XBGA 5AYUH 2YPLA 4ODUA 4ONHB 4RWYL 5DGQA 3DSFL 4JZJB 5KVDH 1U92A 1YDPA 2GT9B 5D1XD 4LVEA 4OFYD 2ZKHL 3VRIA 3TPUB 2A2QT 3EYSL 1RK1B 2DQCL 1T04A 5FF6A 4YHML 3VD4A 1J8KA 5IHUL 2UZXB 1FNAA 4H0HB 1FAIL 3T0WA 3CMOL 1T21B 4L1DA 4FP8L 2X4NA 4ODTL 3CXHJ 4JHAH 1UH4A 3HAEA 3QJFA 1EUTA 2C3XA 1IEBB 4HGKC 4Z95H 5FHBL 2V9QA 5C09A 4ORGA 3WN5B 1MCNA 2FX7H 2CPCA 2H6PB 4ZOAA 4UNUA 4KI5F 4LQFL 3QXDB 2AXGA 2XQYG 2ZPKH 4LDOB 1NGXB 4R4ND 5JNYA 1PD6A 4MJIA 4DAGH 5C1MB 4PLKC 4I18A 5M95B 1RUKH 2ZCLH 3UTTE 4FFYH 1BX2A 4U2YA 2WBJC 3BRFA 4G6MH 3SE9L 4NHUB 1KT2A 2A6JA 2GJZA 3S5LA 4J1UB 4NOBA 1QLEH 2OJEB 1UWGL 3G04A 5C0DA 3ARDC 4HBQA 4LPWA 4M00A 1CICA 1GCFA 5FM5M 3U0TB 4YHZH 3KYMA 4MQ7B 4P5TC 3VFOB 1C1EL 1X44A 2CIIB 2QQKL 2XV6B 4QHKJ 3VWJB 2A73A 4KPHH 4FXKB 3T0EE 4LHUB 1CF8H 5HYQA 3D85D 1MJ7H 1G7HB 2A38A 3FB7A 5DUBB 4AIZB 1XGYH 2FNBA 2XN9E 3PHSA 3QISA 1IGIL 4X80L 4X4YB 3VRLF 4LEOA 4M6ML 1F3JB 1LP9E 4D9LL 5JDSB 3DROA 3X11A 1HH9B 2DQEL 1CVRA 3P2TA 3TFKC 5D5MB 3SE3A 3RDTA 5HGAA 1VEOA 3KPQB 3O6FC 1A6UH 4M61A 4KK5C 1H15A 5GZND 2L4OA 2E7BA 5GRXG 3GSNH 3GSRA 1I7TA 1PQZB 3WO4B 3MR9A 4Z78B 1NEZA 5D2NA 5D7KE 1T5XA 3LHPL 3GSUA 5D96B 2Q7YB 3FRPA 4AQOA 3LN4A 2WIMA 4HJJL 1EFXD 1LEKB 1MVUB 3T77B 4HV8B 3O4LB 4WGVB 3ZMRA 4KRLB 4IS6B 1QSEA 5HI4D 4AEHH 2CKBB 2AJXL 1YEIH 2VC2H 3RI5F 1OAQL 4OZGE 4K3EL 2HFEA 4Y5XA 3QIWC 1AGBB 3U7YL 5I1IH 4ODWA 1MHCB 4Z7VB 3DXAE 3H7BB 5BZDB 2YD5A 3UTTD 3PHQA 4X5LA 3V6OA 1A21A 5CHNA 1QD0A 1T0MA 2PXYC 1RZJC 2ICEB 5LGHL 5C3TA 2H32H 3JV4B 2VDNL 5ESAA 2ADFL 4XVUD 2QQLL 4MNQE 1LMKA 3VFTA 3MRRB 5DA0B 4L4VB 3QFJE 3P0YL 2DWEB 4HKBA 3W11D 3ZYIA 5EWIL 3V6ZB 4NQDA 5CZKA 4NZTH 1CGSH 1F4XH 4L4TA 1BD2A 1FYHB 1KLFA 1QHPA 3T0ED 4JFPA 1J0JA 3VXTA 3X3GL 4HJGA 4UQ3B 2VDLL 4GSDL 3BAEH 4N9GA 4HFWB 3BH8B 2HH0L 5CP3A 4ZG1A 4HKXA 1CWVA 2XN9D 1JHTB 1N64L 1LO4H 3MRMA 1RZ8B 5J13C 4IOSD 4JFYA 1GC1H 1T1ZB 3VFUA 5EZIL 4WTWA 1WCQA 1GJIA 1UJ3A 2XKSA 1B4JH 5IVXA 1C08B 1NGPL 1E27A 4QF1B 1F97A 2R8SL 3FN0H 1G9NH 2B4CC 1LEIB 4M43L 3MLWL 1YQVH 3F7PC 3KHOA 3C6SA 4XVTH 3BRGC 1IAMA 1QBBA 2G60H 2HLAA 2Z31C 5D7KD 1HSBA 5FEBA 4U7MA 1KG0B 1ES0B 4GAGL 5FECA 5D1QB 2CIKA 3VFNB 5HYSA 3VFVB 3LDBC 2YRLA 2EDQA 2WANA 3RNKA 3MRNB 3SGDI 4X5XB 2XY2A 1A3LH 1KCLA 2JB6B 4ZTPL 3UBXB 5D7JC 1Y18B 5H2BB 4YDIL 5KJRL 3OF6D 4U1GC 1FVEA 3G08B 1LDSA 1MSPA 1NGZA 4KY1L 4M7LT 3K8KA 1YN6A 4ZFOL 1ZHNA 2CKNA 2YKLH 4OZFB 4PRHB 5E00B 2QQNL 2X4TB 3SOBH 3DUUA 5IVNA 1IE5A 3ARPA 2EYTA 3DXAD 5F89B 4YHLH 1JTOA 4WWID 1OOAA 2P8LB 3QHTC 3A6CH 2R69H 4QWWD 3C5SA 5C0BD 1EGJH 3DBXB 3ZDXF 5IMOB 2YD3A 3OMZA 4MNQD 2X10A 3IDJA 4NP4L 3ULVL 3QFJD 5T33H 1CXLA 1KJ2H 2VZ3A 3A0OA 2ZUTA 5CGYC 2ESVA 3QH3B 5KS9E 3RKDD 1YNLL 3G6JE 1MNUL 5E24E 5KSAC 3LH2H 4GT7A 1ZVSA 2GY7B 5D7SL 4YXLL 3LRHA 1RJCA 4KKCD 4NNYA 4U1NA 1C16A 1CFNB 5IK3B 3MXWL 3LRGA 2XZAL 4IIQC 3BE1L 4UI2A 5DRWA 3MODL 4Y2OA 3TZVD 1KPRA 1X5LA 3WEXB 1R5VB 1RZIA 5F9DC 3C2SA 4WFFE 4MD5B 1RZKC 3KLAA 4I4WA 4JZNB 2YMXL 1NGYB 1ETZA 1I1FB 1RV6X 2PW1A 4L8DB 4TPRH 5E94B 3HI1A 1HWHB 1FFNB 4Y8DC 5L9DL 4G8GD 4BZ2L 1X7QB 1ZEAL 3QNZA 4R26L 2DM4A 4RAVA 1IM9A 1J1XH 1TJGH 5F70A 1HH6A 4QRSB 3CVHH 2A0LD 2HFFB 1T22A 1MFNA 4PGDB 5ICZA 3NN8A 3UPRA 3PXJA 3LKRB 3TH2T 5DRNA 4P46C 1K8IB 2X70A 1P7QB 4KDTA 2VITA 1EAPA 3SKOB 3EOYG 4XPHL 1BFVL 1L9MA 2R2BB 5C0RL 3B9KA 4MQXD 4K3JH 4EI5C 1JMXA 2I07A 4X7FC 3TO4B 1IT9H 1T1WB 3GIVA 1G6RH 1W72A 4PJGA 3NFSL 3QEHB 3FFCB 1MIEL 1KJVB 3H0TB 4PJIF 2VYRE 3L9RB 4ZXBB 3MLUL 1JN6B 1Q1JH 3QHZL 1U0QA 3SPVA 1XIWB 3W0WE 1KB5B 4ZPVB 1EIBA 3AXLA 5FO7A 1MFCH 3RTQB 1MPAL 1TTFA 1SJEB 4HUVA 2JJVA 4J6RL 4RMRA 5CLWA 2DYPB 4AM0B 5IB5A 2HVKB 1IGJB 1INQA 2WK2A 1AR2A 3VD3A 1ZA6B 5JIPA 4WO4A 4J3WA 3RAJL 4EDXB 4X8JA 3QUXB 5IJKA 2E6PA 3BO8B 1DTUA 4KTDL 4TSCH 1WFNA 1L4IA 4NN5C 1P4BL 3ELAT 1FGVH 2CUMA 5E70A 2EDTA 1JF1B 4HIJA 4R4NC 4FZ8L 1TNMA 5B38A 2WBKA 5I76A 1C5CL 2DMCA 3KLDA 4ZFFA 2BRRL 1OHQA 2UWEF 5GISH 3SE4C 4RNRA 5ELIA 5CAYB 1MHEA 4WFFD 1AHWC 4KXZI 3WIFA 3G5VB 4K8RD 2M1KA 5AG8A 2V6HA 4YPGB 4R4FL 3QUYA 1PJ9A 5J4MA 1K85A 5D6DA 4P2RA 3O3UN 4JQXA 4HX1B 1VEPA 1XR9A 4JRXB 1HHHB 1EPFA 4JLRB 5C0FB 5ESQB 5C70A 2CRYA 2NTFB 3ARXA 3W9DB 2BK8A 3L7EB 4OCRL 3BHBA 3L3IA 5DO2D 5HGBA 5EC2B 3VD7A 1N3NA 1ZAGA 3VFGH 1MRCH 3PGCB 1F4WH 4F80A 3GSVB 1S5IL 3JWOH 4MXVF 4C56B 5HY9B 1BIIA 2KZWA 2BERA 1OGTB 3BWAA 2IFFH 4FQQB 4PBXA 3KDMA 2NY1D 3IYLW 2ZCKH 1R6VA 4EUPB 4O2FA 1WTGT 3I6KA 3PQYB 3L6FB 4X0KA 3O6KL 4R2GD 5MP6H 4OSUL 5C0ND 1FZMB 5AZEL 4OLYL 5DD3H 3MV9E 5GZNC 1QTYT 1EXUB 4NBXB 3C9NB 5AWNH 3RZCA 3GB7B 3CDGA 3W0WD 4NFDA 4O5LH 5EOQL 4DN3L 1P69B 4X83A 5EPMA 3D1MC 1UB5B 1YPZA 4LCWB 2ZG1A 2OTUB 1Q9LB 2NY3B 12E8H 1IAIH 1A4JB 2ZUVA 5A2JH 5A2LH 2YS4A 4ZS7L 4NN7C 5F6HJ 4OIAA 2KKQA 2WBWB 3ET9F 3TVMB 1X9QA 1S7TA 2J12B 4NSKA 3DARA 4XB7A 5HI4C 1QLFB 1E4KA 4MAYB 1BZ9B 5HYJA 5IVXF 1JV5A 5E1AB 1NMBH 4ZUWA 4NDMA 1CQKA 1XGRA 5DSCB 4QTHB 4ODVL 4QLRA 3DSNA 5IHZA 3BEWB 2OZ4A 3IS1X 1HOCA 4J3XA 5JLZB 3G6AB 4BFEA 1HEZB 1KB9J 2P45B 4XVUC 5JHDB 1P5UA 4PY7B 1A7RL 4OV5A 4KMTH 1W8OA 1YMMB 1YYLL 3W11C 5IV2B 2AGJH 4GRMA 1FVCB 3TO2A 2ZOLB 2E7HA 3T1WA 2ED8A 3TH4T 3VWKA 3QSKB 4Y4KA 1RY7B 1FNEA 1RUPH 2AI0L 3EJYD 4J3UA 3BPLB 2ICWA 5DI8B 3UCRA 1IZKA 4LLYA 3T0EC 3OKNB 1R5WA 3O4OB 3KXFA 5CIPA 1DUZB 5FUCC 1TJIL 4OLXH 4OJFL 4LRNL 3TBYA 1FNSH 3ZT6A 3O81A 3RUGF 3W5NA 4H8WC 4QCIB 5AUMB 1UWXK 4C55A 4UINH 3WSQL 5GS0C 4GXVH 3WNOA 5HVHC 3MZTA 3TWCH 1ZVHA 3OV6A 1D6VL 1NFDE 1NCBH 4F9LA 4F7CB 1KLGB 1NCCL 5ANME 1YEDB 3MV9D 1S7XB 3UTPE 5I1DA 2B1HH 3S36L 4M1DH 2DLTA 4WW1B 1BBJA 4D9RE 1AIFB 4QNPF 4LLUB 2EDBA 3DMMA 1LO5B 3Q5TA 4RA3A 1KCRH 4X9BA 5TDOB 3QRFM 3UX9B 5CEYB 5E95B 5T1MA 1MLCB 2ATPA 1BF2A 1U8PA 3BKML 5T1KD 4MJ5A 1BM3H 4X6FA 3SKMA 2WWKO 5T1LB 4HWZA 1J8HA 3HCVA 5H94A 5K9JH 1XR8A 2Q86B 1MELA 1DFBH 1EO7A 5D7LB 3MJ8B 3RU8L 5F3HA 3VU2A 2XKNA 3DIFB 4NKMA 4H1LG 1IKFH 2NX5A 3MRCB 1UJTA 1H5BA 5GGSB 4XP1H 1KBGL 4QXUH 2ZOKB 3QWQB 5ERWB 3IKCB 3ARGB 5FYJH 3O2WL 2VDQL 4GKOA 3SEPA 3F7QA 1FH5H 2YBRB 3FN9A 1SJHB 3TN0D 4QWWC 3MLVH 1U8OB 1I8MA 2IBGA 4IRJB 3WD5H 3WNMA 3ULUE 4WEMB 3LEXA 1JHLL 2GCYB 3PGFH 3SKJH 2ZCHH 4PJHA 2NPLX 3RKDC 1GGCH 2R0ZL 3WJJA 4JO1L 4QRRA 3RX8A 2B8OT 3DX8A 3LY6A 5FAAA 3P73A 4KKCC 1QKZL 2OTWA 3KPLB 4DFIA 1QNZL 1Q9WB 2ORBH 4HC1L 3EFDH 3BP5A 5L88L 3EDKA 3R1GL 2FH8A 5TPWL 3TZVC 5LXGH 3CK0L 5L2KA 1LNUA 4NQVB 3ZL4H 1GXEA 5C0CA 1LEGA 1MCPH 2H3NB 4PRIB 4LKXB 4PGBB 2VKWA 3HZMA 1OAKH 4YHNB 4YDKH 4BH8A 2CH8A 1YQ2A 2FWOB 1NDGB 2UY7A 1H3TA 2J3SA 3UTPD 1MF2H 5FYKE 4LSVH 1QYGL 2HFGL 3BQUA 3F6LA 3T3ME 1XGUB 2EDFA 2NY5H 1TVBA 4KK9D 3RWHA 2GSGB 2VABA 5EBLA 5J9PB 5EOTB 4PFEA 4XPBH 4D0BB 2HJLB 3QZWA 4HXBH 4XVJH 3GMNA 2APFA 2PYEB 2HKFL 1YEFL 3DX7B 4MQXC 4XNMB 4YZFF 2Y36L 1I4FB 3WKML 1M71B 4JQIH 3U9UA 5JOFA 3VGDA 3GDBA 3E2HC 5T1DH 3HN3A 5DTFB 2ICWJ 3E8UH 1KLUB 1YEJH 4HDIA 2CUIA 1BEYH 5I73B 2BVYA 4ODSH 3GSXA 4XCNA 1QFUH 3AAZA 2ITCB 5CINH 3MRJB 5B39A 3BEVB 1IILE 3DTXB 3NA9L 4HBCL 1WT5C 5F7DA 3ULUD 2AABH 4G8IB 2XWTB 4MWFB 4YIQB 5A1AA 3VI3E 3OAZK 2VJXA 2O5YH 2EYSA 3LKQB 3CFCL 3AREA 3BIKB 5F8QC 4Q9RL 3SBWC 4OZIA 4EBQL 3WIIH 4G9FB 4G6AD 2FB4L 1JNNH 2Z8RA 2IH1B 5HDLA 2YPLB 3KPRE 5JIIA 1MJUL 3MBXL 1IM3B 3BW9A 3HPLB 2Z0BA 1MCHA 3GSQA 4C4KO 4MZ2A 4I0PA 5GRUH 3C08H 5D2LE 1P7KA 1Q0XL 1T04B 5FF6B 2FZ3A 3QP3A 3GZKA 2A74B 5HDBE 3BPOB 1IARB 4K8RC 5DJZA 4Y89A 4KHXH 2X4NB 1GGIH 4UIKH 4EDWL 2Y06L 4GLRH 3I2CH 5TF0A 4UOJA 1N4XL 5FYKD 2YN5A 2ZSWA 3OKDB 4XWGH 4Y4FD 1DJSA 4YHYC 5EA0H 2DTSA 3WXVH 5C09B 5IOPB 1FCCA 1A9EA 4I3GA 2IBZX 2K7PA 5DO2C 4PJ5B 4LSQL 4FTVA 4GUPA 1SMOA 2RQ8A 2DBJA 3D39E 3QJHB 5JNYB 5B4MD 3BFOA 2QSCL 3GMQB 4MJIB 1F00I 4N0FB 5DJ2B 5F1SA 5J0BA 3HI5L 4UNVA 3WFDL 4ODBD 1HWGB 5DJCB 2NY1C 2CD0A 1KJMA 1KT2B 4ZYKA 4R2GC 3CD4A 3KPOA 3HMXA 5C0NC 3EYVA 3GMMA 3G04B 4PJBE 5C0DB 4IOIA 5HYIA 3W39B 3WIHA 1CICB 4F58H 1A14L 1RZJL 4P4KA 2P4AB 4OLVL 1WIUA 1T2XA 2NLJA 3BPNC 3THMH 4PJIB 1MEXL 1IC5L 1AXTH 5H35A 5IB3A 4GQPH 5FA4B 1LP9F 3CDFA 4Z9KB 5JOEA 4KU1A 1FLTX 3WS6C 5DK2A 3V2AR 4JKPL 5TDNB 5LWYL 2BXZA 1ACZA 3MOAH 3ZE2F 3UTZA 4HAGA 4X98B 5ESVA 4E41E 3KPRD 4CL7A 3DROB 5TE7H 4E0RA 1DANU 4GH7B 1FP5A 2MJWA 3CFBA 4YR6A 4K3DL 2R1WA 2B20A 3D3VB 2HT2D 1EMTH 4P59L 4EEEA 3MA7B 4FHBD 1EO8L 4HCRL 3GEWB 1BQSA 1SVZA 4WHTA 4MGXA 5C08E 1J12A 1UM5H 1I7TB 5CZXD 5DEFB 5I1HL 1D5BA 2DLIA 2UWEB 2JIXB 1B2WL 1PX3A 5D2NB 3VXOA 4OQ1A 3ME0A 3QDGB 4EXPX 1Z9SA 2B4CL 3B9DA 3GSUB 2W9LA 4PJEA 3MRHB 3ALXA 3LN4B 3ARRA 4OZGF 1LDPH 1HKFA 1DEDA 5F9JA 2LQRA 3BXNB 4X6CE 3ZT5A 1S9WA 2X9YA 3QIWB 4Y4HA 4UIMA 5KSBA 2FJGA 5HPMA 2BRQA 1QSEB 1CLOL 4OM0H 3EJYC 1I9IH 4LVNC 4Z8FL 4OF0A 5C0AA 5ID1A 2HFEB 2BVTA 1ZLSL 4ODWB 3D39D 2Q8BH 3TT1L 5IQ9B 4HUKB 3MLZH 1NCDL 2CQVA 3OB0H 4M5YH 3L95A 1T3FA 4K9EH 3TBVB 3R0MA 2Z9TA 1GOHA 1T0MB 1P84J 5EOCH 2DQJH 3VFTB 3KYAA 4XNXL 4HPOH 3ZLQC 1ZHLA 1SEQL 4XPTH 2FIKB 2H2SD 3MLTB 4NQDB 5C7XH 2D9QB 3UTSE 1U8QA 5DJYA 5GGRY 3EO0B 1ZGLA 4FMFA 4X7SH 5D70L 4ZTOL 2DDQL 2H2PD 2AJSH 3MRBA 1GSMA 3PWPE 4N9GB 4FABL 4KTEH 1C5BL 4HKXB 3ISWA 1MFAL 3QO1B 3BI9X 4Q0XL 4E41D 3FQTA 1TQBC 2F8OA 1ZLUK 3TNNA 3MZGB 4JY6A 1QSFA 2BNQE 2WUCL 4ETQA 5IESH 3MRLA 3QAZC 4XC1H 1EJOH 5E7FA 1MJJA 5IVXB 1E27B 3QXWA 3RVTD 2V2TA 5F1NA 5C08D 3VFPA 3GJEB 3O9WA 1RZKL 1KIPA 3C6SB 4K7PY 2HLAB 5GIRB 1HSBB 4YBLC 5D7JB 3K2UH 4X6DE 3TN0C 2ZNXA 4Z0BH 1IAIM 4D0CA 2YK1H 1RK0A 3M1BA 3MRKA 3N9GH 3I02A 2VLRE 5HYSB 1KYOJ 4OLWL 5IBUG 4OTXL 2HN7B 4N0RA 4OZFH 5MENE 1B0RA 3WLBB 4PJ9D 2XNAB 4L1HA 1DLFL 3TV3L 2Y4SA 4I13B 4RAUB 1FVEB 1EVTC 2E27L 5C07A 1ZHNB 3QCVH 3FZUD 2FX8H 4YQXH 3QDAA 1KEGH 3DUUB 3RWEB 3UYRL 3MROB 1DQML 5ADOL 3RUGB 3INUL 1JPGA 5KS9F 3IFLH 1QBLL 3G6JF 1PBYA 3TJEH 4KJPD 1N5YH 5C6TH 2LAGB 1E4JA 3DRTB 5MEQB 1NFIA 5C0IB 4LU5H 5B8CA 5BV7B 3JUZA 5I1LB 5BRZB 2ESVB 2BY2A 4YHIB 1H8OA 4P49A 1ZVSB 4HS6B 1FN4A 1MCWW 4S10A 4U1LB 4U6YA 2AK4B 4LPCA 2OQJA 4NIKB 1Z2KA 4H1LA 4KK9C 1CBVH 1MCCA 3F12A 2XTJE 4XNZC 1H3UA 3BPCB 1KCVH 3ARBA 4PB9H 5I8OH 5EU3A 1BVZA 2FGZA 3DUHA 3MO1A 3NZ8B 3QBTB 3GIZH 4U1SA 2ZJSL 1KPRB 4HC1A 1JRHH 3UP1A 3MRIA 1RZIB 3RWIB 3TNMB 2CDEA 1QRKA 3QRGL 2PTVA 5F7EH 1G9MH 3KLAB 3QWRD 2XWBB 5GJTL 2LU7A 1DQTA 4RGMC 2F5AH 3HNVL 3HNTL 5TE4H 5KTEH 5DZNA 1E4XL 2ZSVB 3C6LA 4W4NA 4RAVB 2L0DA 5EBWB 2F53A 3SJVE 4WUKL 2O5XH 1TVHB 4N90E 1S3KL 3ARSA 1QOKA 2VLRD 5DRNB 3O6ML 3P4NA 5FKAA 3ULUC 2PTUA 4MHHI 3EZ8A 2P44B 2X70B 1YYML 3VG9C 3MACH 2VITB 5MEND 4HZLA 5EZLB 1JZ4A 3B9KB 3V4PL 3LKOA 4BFGA 4G6AC 4XCYB 4PJ8D 4XNUL 1RVFL 1JPSL 4OAWA 1GH7A 3EYFB 1P1ZB 3GIVB 1RU9L 4K3GA 1KB5H 1MJ8H 3UDWC 4DN4L 2RB8A 5JW4N 1ZT4A 5F88B 4ELKA 2WBJA 5LJYH 1CXIA 1H0DA 2LU4A 4POUB 4YUEH 2R29L 3SPVB 3AXLB 5FO7B 1IQDB 4TTDD 1I7ZB 3V8OA 4NNXA 2DBLH 1M7IB 1MCQA 4PJFE 1FZKA 1D9KA 3AY4C 4IMLB 4BKLB 3PP4H 1KN2H 2AJZA 1IAII 4HG4K 4Y4FC 3FFDB 4YDVA 5E0QA 4QXWA 4HWUA 3RPIA 2C7UA 3T4YA 1KN4L 2C3GA 3T8XB 5D72L 2DMKA 4LSDA 5KZCD 2XTJD 2IADA 1SY6L 4IM8A 5ACZA 2VLJA 4HIJB 2BOBA 5B38B 5B4MC 2V5YA 1FG9C 5I76B 2DQTH 2R0LH 3VXRB 1GGBH 4XPGH 3QUKB 4C58B 5EO1A 1EEUA 2V7NA 3U82B 3UAJD 4JAMB 1R3IH 1CD9B 3MCLH 3QUYB 3QXVA 4JM4H 2IJ0C 2VN4A 1NCWL 1FNFA 2V7HA 3QUMA 4GW4B 2VZOA 5KSBF 3D85B 4JE4B 3PXHA 4Y2DA 2IBZY 3TGXA 4ZD3L 3SJVD 3P30L 4DQOH 2EYRB 3BHBB 5GRWA 1N5AA 3FO9A 2XPGA 1MCSA 4N90D 1N3NB 4OGXL 3ZDZE 1SMAA 2NY2B 1BIIB 2UZIH 1J0KA 1U93B 3MREA 1UB6A 2FO4B 3BWAB 4O9HL 4WW2F 3VXME 3U2SB 3KDMB 2WQ8A 4MJ6A 2OS7A 4X0KB 1X5AA 5JUEL 2QSVA 2D3VA 4H8WL 4JO4H 4JM2D 2CDGB 1RFDH 4Y0GA 1RIHH 4JJ5B 2HT2C 2P7TA 4UILL 4U0RC 5I1GH 4K7FA 3RZCB 1RIUL 4U7SA 1EFXB 3BVNA 5CZXC 2VH5L 1LO3H 3QULA 4QRPA 2OP4L 4J8RA 3IFPA 1DQLH 1BP3B 1UCBH 2FRGP 1P4IH 4MNHA 1X4ZA 4RWHA 3OKLA 2MSPA 3BIAX 5SX4H 1NAKL 3O3BB 4APQD 5M7QA 1XH3B 1IAOB 2R4SL 4P23D 2AEQH 5IIEA 1UWEL 4DW2L 1S7VA 4HT1H 5DLML 1CGXA 4JZOB 4MHHG 9CGTA 3GBMH 1S7TB 4JN2A 2VO5A 1F02I 1C12A 3VGGA 2YA2A 1K4DA 2ZUQB 4NQED 2APWA 1DQDL 4YNYB 1XGRB 4HCRA 1U58A 1WZMA 4GG6A 1HDMA 4AT6A 4Z7WA 4BSVA 3K1KC 4P57B 5CJ5A 1F90H 5EG6C 1Q9KB 4MAUL 4YE4L 4TVSa 3T0EB 3PL6A 4PV8B 1EHLL 3L7FA 3NIFE 4BZ1H 3TO2B 4UU9B 2H2SC 1V7NH 3U83A 3EUUA 3GJFH 4JDTL 4OCXL 2CSPA 2NY6D 5DQDL 5JTWA 3MRGB 4JCMA 3S96B 1LP9B 3IGAB 1U2CA 2GTZB 2H2PC 2K7QA 2AK1L 1EHXA 4P3DB 4FQIL 1H3GA 4QT5A 2EH7H 2NW2A 1NFDF 5E2UH 1NC4A 2E5EA 4ZUUA 1VESA 3FONB 4NQCE 3OJVC 1N26A 3VXMD 5CUSH 1CR9H 1FVDA 4NC0B 3FO0H 2FDBP 4LEXH 1YEEL 4NWTL 1OAZH 4OLUL 2DQDL 2VXSL 4HPYH 1IKNC 2IPUG 4NYLA 3BMWA 3RVTC 2A9NL 5IMLA 3ROOB 1CDYA 3T09A 2BCKA 4FXLA 1FAKT 4NZJA 3QCTH 1IGCL 4EI6B 4LLDB 2VR5A 3MUHL 1K3ZA 2MKWA 5GSRA 1D5XA 1GPOL 3UTOA 1TZGH 5EO0B 2KZ1B 5I1CL 3HE7D 2AW2A 2RR3A 4YWGL 2W91A 3CFJA 5JPMB 4HLZG 4OZGB 4MJ5B 2IANE 4X6FB 1NC2D 2C1PA 4UQ2A 5IFAH 3SKMB 5KSAA 3MXVL 4QOKA 5H94B 2Y07H 4IRSC 5I16A 4AENA 4KGLA 5GGQH 5E08H 4PJ9C 2JCCE 3KWWA 4Q9QL 2GKIA 3MV7D 2XKNB 5FKPB 4K3HA 4LLVB 5CD5D 4X4ME 4NKMB 3S7GA 3WL9B 4IIQA 3FZUC 1J18A 3KS0J 4H20H 3ROLA 3OKMA 2XIDA 4P2OA 4MNQB 2EIDA 4OB5L 3TESA 2J88L 1M7XA 1ODAA 2P5WE 4U33A 2CK0L 2Q87A 1NUFA 4KJPC 2FO1A 4U3XA 2ADGA 3U30B 4FRWA 4ZOCA 1AGFB 3RWGA 1IAKA 1CTOA 5ETUA 3LEXB 3SDDA 4M03A 3WJLA 5GJSL 5IW6A 2OL3L 4I8DA 3OG6B 4OZHA 1T6VN 1FPTH 3RVUD 4QRRB 1QFPA 1OB1A 2DM2A 3V5HA 4UDTA 4KQ4L 1H8NA 3BZEA 1G7MB 3DX8B 4U7KA 5ENWB 1CFVL 3N1GC 3QPXH 5TFSH 1IGTA 3P73B 2OTWB 2UUDH 1U91A 4OKDA 1F3DJ 3GHBH 5FB8A 4L3EE 5K9OA 3BZDA 1J1OL 2DQIH 2AEPH 4HS8L 4OIIL 5DXWA 4WI4A 35C8L 5FM4A 5K59F 5IFJA 5L2KB 4YXKL 1BAFH 5C0CB 5FYJE 3T3MF 4M7ZC 4NM4L 4LVOB 4ELME 4NO2B 3HZMB 1QBMH 5D1XA 1WZKA 4OFYA 5CKGA 4GAYB 1OAYL 1OSPH 3BKCL 1NCTA 4JHWL 4PTUB 3EKCA 4GLRI 3MNZA 4K8RL 4Y1AA 5GGVY 4UTBL 3R8QA 4ZAKA 3BQUB 2SEBA 4XWOD 1TVBB 4U6HB 4M8QB 3RWHB 3JV0A 5F7HA 5EBLB 4S1RH 4PJ7F 2I9LB 1NCAH 2C4FU 2IAND 2O5ZH 1ADQH 3GMNB 3QEGH 3MGTA 3DWTA 5EZJB 1QR1B 3RJDA 4F2MB 1RJZB 1XF2A 5JXED 1L7TH 4R96B 4M02A 4PJ8C 1R3JA 1IEAB 1GC1C 2EICA 3OAYK 1T89A 4DGVL 2DQHH 1T0PB 4G8EA 3LN9A 4JPWH 4KUZL 3RVVD 2P5WD 1S78D 4HDIB 5KS9B 3E6FA 3G6JB 4Q97A 1G9NC 1KCSH 3GI8L 4TOYL 3AAZB 3KLHD 4N5UA 1FLRL 2WMPA 4QXTA 2J8UE 4TTDC 2EO1A 2DI9A 1S7WA 4RCAA 5JW4Q 2HJFA 4Z7QF 1F11A 1OY3B 1TZHB 3AREB 4FQXD 4R7DB 3NCBB 1HILA 7FABH 2X4OA 4HSQA 4JR9L 1MI5A 1X4XA 4L5FH 3ECBB 2Q8AH 4LCCC 4S11A 1PEZA 5KSVB 1B90A 5HDBF 3VGAB 1H3PL 4UTAL 3X12A 2XTJC 1HHGA 5J7CC 2AAVA 4L3ED 3IDYC 3PF2A 3FJTA 2FSEB 1EHNA 2QR0A 4OFDA 3EO1B 1P7KB 1OLZA 1A7PH 2EECA 3DYPA 2DTMH 2FZ3B 3MV01 3NPSC 1S5HB 3LMJL 5DD0H 5E99H 3DVNA 3HAEH 3BP6A 5FYJD 2DWDA 3UAJC 1GGUA 3IDXH 4DK3A 3H9ZA 5DQ9B 4JFZL 1UKSA 2C3WA 3BDXA 4MA3A 4NZUH 1FYTD 1RMFL 4XXCC 1MCRA 3VMPA 1FFRA 4O2CA 1RIVH 1VEMA 3HG1E 1T7YA 4NPYA 1Q0YH 1A9EB 4TVPH 1VACB 1X5JA 4ZNEA 1YNKH 1S9VA 3IT8D 2OCFD 3QUZD 3C60D 4G8FA 3IKKA 3UZEA 1PSKH 2W0LA 1R24B 4LRIC 5I74B 1SY6A 1UFUA 4N0UA 4WCYH 2B5IC 3WDJA 1D6EA 2EIZB 3S34L 1M4KA 4GG6F 2BXYA 2VUYA 1KJMB 1RSFA 1UXSB 2PO6D 1JGEB 2ARWA 4ZPTA 3W0WB 3FAWA 3EYVB 3GMMB 2O61A 4JM2C 5D1ZD 5DDHA 4P9HH 4P4KB 2C3VA 2NLJB 5DUMH 1LK2B 1NCNA 5I8CA 5JQHC 5IB3B 3ZTJH 4DGIL 1HSAB 2FYYA 5I8KL 4MLSA 2X4SA 3MLXL 4Y16D 3AFLA 2DIAA 1YN7A 3AM8C 3U4BL 4APQC 4UV7H 4NJ9L 4MDIA 5DVOA 4P23C 3PNWA 2FJFA 5ESVB 4CN1A 3WLWD 3HUJE 1O5DT 2VDPL 4OBRA 1ZLWH 2EIEA 4E0RB 3O45B 3UZQA 4YR6B 2CLRA 4TSBL 2D7TH 2YA0A 4KV5F 1IGYA 4Z7NE 2YA1A 4BUHA 2XN9A 4M6AA 4ZUVB 5DD6B 1G7LA 3H6JA 2DMBA 4F7EB 4WI7A 3QR2A 3NCFB 4YHKH 4BQCA 2OK0L 4TULL 3T2NH 1F4AA 3C8DA 3CC5A 2GSIA 3KR3L 5SWQB 3OXSA 3RVXD 3AVEA 4LVNB 4ISVA 1JGVH 1A6WH 1FO0L 2EC8A 4M7KL 4N1HB 4Y4HB 5KSBB 2FJGB 4JFOA 3KJ6L 2BMKA 4NUGH 3MGOA 2P1YA 4P3CH 2LABA 3IJSA 3QDME 2NY6C 1JNLH 3KPPA 1G7IA 4X6BA 1CGVA 1KENH 3VFSA 1CGYA 4NO5B 1D5ZA 5EBMA 1IGFL 1MVFA 3H9YA 4JRWA 4G3YH 4LPXA 5INCA 4GBXA 4CMHC 3Q5OA 4D9QE 3L95B 1MRFH 1T3FB 3GGWA 5L6YL 5HHQA 4WW2B 4XP6L 1U3YA 4X4XA 3D0LA 2ENYA 1A5FH 4WWKA 5DYOA 3X3FL 3I75A 5F7NC 4K23L 3RNQA 3O4LE 4PS4L 3W81A 4OZHF 5CILH 1I3GH 4XCCL 5IMMA 1EEZA 5DJYB 5CP3H 1ZGLB 5HJ3A 5C0BA 5A2IH 4A2LA 2D7OA 4C54A 3HE7C 3MRBB 5EU5A 3QIBD 3DGGB 4OD1H 3WMSA 5J11C 2Z8SA 1T1XA 2HLFD 2P5EA 4IOFD 4EZMA 3WXWH 1T2QL 1NGQH 3JWOC 4RISL 3BD3A 4CU6A 5CEXB 3U0WL 4OQTA 1N6QL 2H9GA 3NACH 1WC7B 1JRHI 4JY6B 3QA3B 1HE7A 1JHKH 1QSFB 3F7YA 1YJDL 1S9YB 2ATKA 1V3LA 5CZVH 4X6DF 5FUOL 5T3XL 5CD5C 4YBLB 2V2TB 1PW3A 1JYWA 3U0PA 8CGTA 4LKCA 5F1NB 1FV1B 3O9WB 5HHVL 1T20A 1JWSA 3TZVA 4OFKA 4Z5RA 3VWJD 3WNKA 5ITFA 4LHUD 3TJHD 1YEHL 4Z77B 3OJMB 4WJ5A 1VFOA 5HHXL 4D0CB 1D5MB 3M1BB 3BDYH 3I02B 5E2TL 3HC0B 3EDEA 4G8GA 3CZFA 3K3QA 3MCG1 4R3SA 3EJZD 3JV6B 4GRLA 1Q9OA 2DICA 4K7PL 4G6JH 2DQFB 3RVUC 3ULUL 1SYVA 3S35H 5KVGH 2E7LC 4QTIL 5IMKB 4YX2H 3CU7A 3QCUH 3SCMB 1RZFH 4H26A 2HTLD 1NMAL 1E4WH 1NFDB 5CJBA 4XP9L 4D9QD 4YBHA 5FHAH 4MDJB 3CXDL 4XAKE 1WZ1H 3SQOH 5BV7H 1CD8A 1UQSA 4XCEB 5ANMB 1EEYB 1QRNE 1BFOA 1F4HA 2ADJA 2GK0B 3W2DL 4R0LC 4YK4C 4IRZL 1AO7E 5DFVD 1NBZB 1WBYB 1NFIB 3F6IA 4P2QA 5A43C 3O4LD 4WENB 4MA8L 4NZDA 4XRCA 5SWZA 1NAMB 3IAPA 5CWSB 1FNGB 1P5VA 2Y5TA 3GNML 2OL3A 3ZYZA 1JWUB 3P3YA 2CMRH 3HC3H 5DZLA 1S7SA 4XWOC 1JBJA 2ED9A 32C2B 3ZKND 3MLRH 3ARBB 2DOCA 4I3RH 1OQOA 4LLQA 4ODXA 2VZTA 4DKFH 3M07A 5JDJA 3B3IA 5D7IA 4XNYH 5JXEC 2CDEB 5JPNB 1WGOA 4L4VD 3QHFL 4R8WL 3BGFC 2H26A 4LCUA 4ERSH 2G2RB 5KOMC 1G6VK 43C9A 5FYLH 1TTUA 3FT4A 4PRBA 3C6LB 5SV3A 2OSLB 4L29A 3RVVC 1FORL 5ICYA 1S78C 4NT6A 3VG9B 3VXSA 3ARFA 2D31A 2ED7A 2F53B 4BA8A 1ONQB 4RFOL 3KLHC 2IF7A 1NJ9A 2AQ1A 2ICES 2VAAB 4MCYA 1XF4B 4LIQL 4ALAL 4X7TB 3P4NB 5FKAB 1CCZA 4KJYA 1AI1L 1KNOA 1CDIA 4G42A 4NUJA 1WISA 4FQXC 1W72H 1HINH 1T7VA 3FB8A 3CFKA 4WUUE 2A9MH 1MCJA 3EJJX 4XX1G 3OKOA 4OAWB 3ILPB 2J6EA 1CK0H 5CD3A 4HMEA 5CEZH 2A83A 2P48B 3L5HA 4QHUA 1TQCC 3IXAA 4XAKD 2PR4L 1QRND 1E6OL 5DVNA 3G6DH 2EKSA 4QEGA 5D1QD 4V1DE 4Y4FB 5CMAA 3NH7H 1AO7D 2CRIA 3BKJH 4NNXB 1UYWL 4WEUD 1MOEA 3CPLA 1DDHB 4LF3A 2AVGA 2IQ9H 4KKLD 4OCSH 4IJ3B 5SX4I 4XH2B 2AJZB 4RWYH 4OCMC 3RPIB 2C7UB 3DSFH 1SBSL 2W0FB 4YDLB 4S1SL 4XC3L 2ITDA 5DJ8A 2ZKHH 4N8PA 5LG1A 4WV1A 3EYSH 3QUZC 4EN3D 2A6KB 3C60C 4G6FD 4PJ7B 4YHMH 2VLJB 5ACZB 5IB1A 3ZHDA 5IHUH 5CGMA 3SDCA 1YY8B 1FAIH 2AJ3A 3CMOH 3OZ9L 4FP8H 3PGDA 4ODTH 2PO6C 4OGYL 4A2MA 4U1KB 1T6WA 5I18L 3C8HA 2RIKA 3JZ7A 3QUMB 5D1ZC 4WI6A 3U36B 1JPFB 3PWJA 4Y2DB 1S9XA 1MIML 4LSPL 5CCKL 1JVKA 4Y16C 2ZZUT 5SWSA 5IVOA 1CD0A 3ZKXC 3SE9H 3SO3C 4JFHD 3HKFA 3QQNA 3A67L 3WLWC 1UWGH 4GG8A 4ZOEA 1SQ2N 4XMKL 4JRXE 4PLJD 4HKZA 1RPQA 3HPJA 3VXUE 1NBVL 4PG2C 2QQKH 1CGUA 4DAGL 5L8KB 4L4JA 4V2BA 2BSSA 3RL1A 4V2CB 3QULB 4G6ML 4V1DD 4PR5B 4M9PA 3LIZL 5BW7A 5JO5B 1IGIH 3RVXC 4X80H 3OJ2C 2FATH 4GKSB 4JG1L 4D9LH 3BSZL 3B2UD 3ZZ1A 3N06B 5IIEB 1RUAL 3T04D 1DL7L 3PQYE 2DB8A 5I9QC 1MREH 1JZ7A 1U8KA 3TO4D 3ESVF 2IH3B 1CTNA 4O02L 3W9EB 3LKSA 5JW5A 3FFCD 3R4DA 1JYVA 2GJ6A 4CNIA 3FQNA 2OZ4H 5T3ZE 1ZV5A 1AE6L 2JJUA 4KROB 3OKEA 2W0PA 1XIWD 3NIFF 1E6JL 3LHPH 4KHTL 4KH2A 1U58B 1U3JA 2J4WL 1YY9D 3D18A 4GG6B 4JQVC 4HJJH 3WHE0 2VOTA 5MERA 2DYPD 2RHEA 4ZUSA 3PL6B 4J3OC 3U46A 3PV6A 3RP1A 2XG5A 5CIPH 3RRQA 2AJXH 1FO0A 4KGJA 4K3EH 5CP7A 3QUXD 5B21A 1VHPA 4TNWF 3WN5C 3V0VA 3Q6FA 4KKBD 4QHKI 1A22B 3ZT7A 3MOQA 3NBNA 4HWBL 4KI5E 4RZCA 2FJHB 3QIBC 4N5ED 3VGFA 3KPSE 5FM5O 2HLFC 1BQUA 5IROA 4ZOBA 4IOFC 2VDNH 5C3LD 3MX0A 2QQLH 3RY6A 1FVDB 4PPTA 3V7AE 4I1NB 4W4OA 2I25N 3TF7C 1YEIL 2VC2L 4JRXD 3QI9D 2F8XC 3J7HA 1YMME 5EWIH 3OPZH 2JJSA 3VXUD 3ETBF 2PTTA 2BCKB 4G6KL 5FIEA 3VWJC 3AS3A 3X3GH 3MYJB 4QHNA 4IRSB 2VDLH 1D5XB 4Q6YA 3TJHC 3MLPA 2XT1B 4AK1A 2HH0H 4LVHC 4C56D 3SDAB 2YD2A 1OP5H 1N64H 2DI8A 1Z5LA 1UGNA 3CFJB 1UZ8A 2C1PB 5D4QA 2V2XA 3EJZC 5EZIH 3BT2L 4QOKB 4AENB 3PQYD 1Q72L 4F57L 3HE6C 4NZTL 3KWWB 3O8XB 1NGPH 4S0SD 5GGRA 2R8SH 5BCAA 4HXAL 1I1YB 4M43H 3MLWH 3QNXB 3QFDA 4HLJA 2Y9RT 5T3ZD 2ZUWA 3GSNB 5EUKA 3ROLB 3OKMB 2HTLC 4P9ML 4P2OB 5IG7B 3UMTA 3WO4C 1OWWA 1FQ9C 4NRYA 3PDOA 1W0VA 4GAGH 2WP3T 4JB9L 4LCWD 2XA8H 1GC1L 3UC0L 1F42A 2AV1B 5D96C 3BIBX 3UTSB 1A7QL 1AGCB 2E8ZA 2Z92B 3DX6A 3ZKQD 2NY3D 5DFVC 1NQBA 4Q58C 2W9EL 4ZTPH 3SDDB 3VCLA 4Q7DA 2BVEA 5IW6B 3FN0L 1G9NL 4YDIH 5KJRH 1GZPB 5DC9B 3PWPB 4OZHB 2VLLA 4KY1H 4IHOA 3TVMD 5EORL 3V5HB 3BDBA 4M7LL 3CLFH 4UDTB 3BZEB 3FQRB 2QQNH 4H25B 1TCRB 1ORQA 2XICA 4YHPB 2Q6WA 4KI5D 1A9BA 4JO2H 2AXFB 3ZKNC 1CN4A 4XCFL 2BNQB 4OUOA 4ELMF 2XACC 5EZOL 2V2WB 1S7RB 1QEWA 2F74A 4L9DA 1BWWA 4KJWD 5CLTA 1AD9A 4ZNCD 3P77A 5IFJB 3JVGC 3ULVH 3SO5A 5BJTA 2BSED 4NO0A 4QGTA 5JHDD 5DHVA 1SBBA 3QEQE 1MNUH 1YMMD 2YKLL 3GKWL 4X6DB 2BNUA 5IR1A 1GOFA 1I1AA 4FMKA 5EC1B 5LBSL 4BQ9A 1ZXQA 4YXLH 2XI9A 3RWCA 1J0IA 4S2SA 1YZZA 3MNZB 4Y1AB 3FOMB 1IBGH 2YUWA 4ZAKB 5KVMC 1F4YL 3A6CL 3MXWH 2XZAH 1T7XA 1TTGA 3MV11 1W0YT 3AY4A 4FQCL 4WU7A 5FK9A 3MGTB 4Q9CA 4TNWK 5GGVL 4CKVX 2YMXH 3LH2L 4LGRB 1KFAL 1X6NA 2X4PA 1A3QA 2NZ9D 3S98A 3HC4L 5L9DH 4BZ2H 4R26H 4E9LA 3S3SA 1PYWB 3V4VL 5LQBL 1HK6A 1UADC 4OM1L 3KGRA 3C5JA 2F8VA 2WINB 3MCKA 4GAFB 3QIUA 5D1QC 3FO1B 3G9VA 5KANG 2F19H 4ETYA 1ROWA 1UKQA 5TGBB 5T1LD 3H42H 4XPHH 1BFVH 5C0RH 2HJFB 4OCNC 5CJXC 2XTJB 1F11B 5ITBL 4KKLC 1V3JA 2EE9A 4BZYA 2X4OB 1INDL 1T0NB 2FX9L 3NFSH 1MIEH 1BFSA 4EN3C 1LO2L 1HHGB 5JHLL 3ARGD 3QHZH 2FHBA 4J7RA 4UOW0 4I9WE 3HB3D 4MD0A 1MPAH 3ZO0A 4L8SA 4OCWL 4ZO7A 4TYUA 4IRJD 3GMPB 1MUJB 1KJ2B 4J6RH 3QEQD 4OZ4A 4NNPH 2UYLA 3OXRB 2GUOA 4FZEL 1G6RL 4N0YL 3RAJH 4MA3B 5D2LA 5J6GA 1I9RL 4F7TB 4KTDH 2YPLE 1JL8A 4ZO9A 1L0XA 1QFWM 1FC2D 1JPTL 3LD8B 4NPYB 1BZ7A 2HVJA 4BSJA 5E6ZA 3H2WA 1A4KA 1CFTB 4FZ8H 3HRPA 1ZVYA 4G8FB 1AP2A 5DD1L 1NUNB 5E8NB 2BRRH 1CL7L 4F3FB 4AH2A 3SKNA 5ID0B 4AY0A 3HMXH 3BUYA 4R4FH 3H7LA 4WRLA 5EU7E 3WIHH 4RGOL 3QEUA 4IDJH 2JELL 4KFZC 4EVNA 1I85C 4U1HA 4PLJC 2O61B 1MWAA 1XCQA 1G9MC 1WWAX 4PD4J 5DDHB 1BECA 3CVHB 1VGEL 3H9HA 4OCRH 3K1DA 1LE9A 5IF0A 3HAEG 5C09E 2VQ1A 2YXMA 4Y5YC 2E9WA 1BQHG 4QYOA 5DS8B 3P9LA 1S5IH 1ZGLP 2IAMB 3HUJF 1JF6A 2FYYB 1DQJA 2X4SB 1B6DA 3QXTA 1YN7B 4PJBA 3NIDF 2PYED 2P43B 4MJIE 2VIRA 4TVPE 3OR7A 1HHJA 4MDIB 1F58L 3PNWB 1AQDB 3O6KH 1DSFL 2FJFB 3LN5B 2PN5A 3TO4C 4PJXA 2I24N 5IBLD 1TITA 4KKNA 5EUOA 3VFGL 5EU4A 1U8MB 2W59A 4OLYH 1DVFA 3C09B 1IGYB 4TQEL 5I66A 1HCFX 5ECJE 3JV5A 5B3JF 2MTPA 1FFPB 2Y23A 3LKPB 4I9WD 1XIWC 4E41A 3CX5J 2XZZA 4U3CA 1YY9C 4PY8J 2LVCA 1A6VH 3F5WA 2CRMA 3X13A 3OXSB 5MP6L 4YEEA 5IEKA 1RZ7L 2NY0B 4ZS7H 3CSYB 3TIEB 4A6YL 4BH7B 1LK3H 2YPLD 4JFOB 4U4BA 3ZTJG 4D3CL 5HGDA 3MGOB 3QUXC 3BN3B 3IJSB 4KKBC 1J0HA 2H8PA 3KPPB 3G9AB 1G7IB 2N4IA 4X6BB 2E7MA 3BD5A 2G9HA 1D5ZB 1KPUB 5EBMB 4PGJA 4N5EC 4X8XA 5DRZA 2CR6A 4GBXB 4ODVH 12E8L 3OKKA 2YPVH 2DF3A 2R4RL 4PJ9A 5D2NE 3OHXA 5EU6A 2A77H 1FFOA 5T5NF 1A7RH 5IEHB 4HGMA 3NCCB 4WGWB 3D0LB 1YYLH 4WWKB 2OMBA 3QI9C 3WFEL 5DYOB 5L2JA 3I75B 2R2HB 2EEDA 1A64A 3TA3A 4JDZA 3IU4L 3BISA 1KIRA 4JHBA 3ULSA 1DP0A 4EJ1C 1OLLA 5C09D 2YD4A 1QSEE 5IMMB 3OR6A 1EEZB 5DJAB 1TJIH 7CGTA 4MB3A 4LRNH 5GZOC 3RIFF 1FDLL 4MXVE 4MJID 1N59A 4TVPD 2DQUL 4HWBA 6CGTA 1SM3L 1T1XB 3S37X 3V6OE 2P5EB 3WSQH 4GXUN 1K4CA 2AGJL 4HIEA 2IG2L 1ULVA 3LPWA 1RJYA 1D6VH 4PGCB 5F6HI 5HI3D 2VDKL 3IRPX 4K2UH 1NCCH 2GTWB 4GS7B 2YWYA 1LILA 1MLBB 1CICD 2BDNL 3S36H 3HR6A 2VAJA 1EDQA 1OVZA 2BSRB 3AS1A 4LKCB 3U0PB 2KQNA 2L7JA 3ARQA 1MFDL 1N0LA 4NQDE 1FL3A 5LCVL 5I1JL 4HUXA 1JWSB 4ZFGL 3VFWA 4L4TE 4B7LA 1MCEA 3V0WL 1JP5A 2VXQL 1XF1A 2WSKA 1U8HA 3TWCL 4R7NA 1OSZA 2XFXA 5ALBL 3VJ6B 2NY3C 5DEGA 2WLYA 1KOAA 1BOGA 4JKMA 4PJAF 3X17A 1Q9OB 2B1HL 3TVMC 4M1DL 1FL5A 1SHMA 5GGSY 4NQCB 1K8DA 5DK3A 3UROR 1SYVB 3RDTD 5IVXE 3D3VD 1U8LA 3I6LE 4HS3A 3FQUA 4KI5C 2ADIA 4H26B 2OYPA 4GKNA 3SE8L 3O2WH 4U6VH 1Q94B 2VDQH 5GS1B 4MD4A 2Q3AA 3EYUH 3FB6A 4KJWC 3VDBA 1JGUL 2G5RA 4LCYA 1IJ9A 2CGRL 3WNNA 5BQ7B 1JHLH 3MRQB 3EZJB 3FL7A 1NKRA 2R23A 1YNTA 3GHEL 4JPKL 3MLSL 3DOSA 3EOTL 3OG4B 4LCIL 5C0GB 4XRCB 5F7MC 5SWZB 4H1LH 1IEHA 3WNPA 3D5OF 1QSED 2KUTA 3KPMA 2OL3B 2D9CA 3BPLC 4DGYL 4XXDB 1QKZH 4TSAH 1QNZH 1S7SB 4G9DA 3PWNA 1KJ3H 1NKOA 4OD2B 3GUTA 4LAQL 4HC1H 3DRQB 3MLVL 4J23A 2JE8A 4R4BA 5L88H 4DTGL 4L8BA 3R1GH 2VDMH 4CADA 1VA9A 1OM3L 3CK0H 3IETA 1PX4A 1SYSA 1QO3A 1P7HL 4PBWD 2NZ9C 2GITA 3D0VA 3KVQA 1QACA 2ESVE 3L3GA 3Q6GL 5KAQG 1QYGH 3WHE1 2HFGH 2ORBL 4NQDD 4PRBB 5AD0A 1NBYB 3LB6D 1KXTB 3PP3H 3AU1A 4HFUL 4L29B 2HG5A 4UV4H 5ICYB 4QNPE 3HMWL 2D0GA 2D31B 5ICXA 2Q3ZA 5TH2A 4PBVC 4OIBA 4W6XB 3IXTB 1NJ9B 2F54A 1MCPL 3K4AA 5IVZB 4GMTL 4BSWA 2VE6A 4BFIA 2HKFH 3GMRB 1YEFH 1S7QA 1KNOB 1ZA3B 4G42B 4NUJB 2GAZB 3UPAA 3MBEA 4LP5A 1MF2L 5DVKA 3WKMH 2PCPB 1TQCB 3FB8B 3CFKB 4XBPB 3RIFK 4KVCL 3OB0K 2R1YB 3M8OL 4HH9B 2AERT 2CDFA 3S3JA 3I6LD 3OKOB 4XPBL 4P5MA 4LLWA 4HXBL 5CD3B 3ARGC 5TF1L 4ELMB 2KH2B 3IXAB 3O41A 5HHOB 4HBCH 3WE6A 5FYLE 3HB3C 2VDOL 5F7YC 3N1MC 1T1YA 3QDHA 4IRJC 4YEFA 2PYFA 3CFCH 1NANH 2YD8A 4JM2A 5KSUA 4Q9RH 1HZHH 1LD9B 3CPLB 4BQBA 3K8MA 4EBQH 2YN3A 1KTRL 2FB4H 1JZ6A 1CIUA 3FT3A 5FGBC 3E8UL 4CJ1A 2FECL 2V5RA 4LFHD 5HHME 4ODSL 1AXIB 4M5ZL 4PJXF 1JZ2A 1EUUA 5EUOF 3AM8A 5DJ8B 4PJGE 1EZVX 4WV1B 3RWJA 4PJFA 1I1CA 2AABL 1Q0XH 4WY7L 4L9LB 1PG7X 4M48H 1T83C 3EYOA 3SDCB 4NKIL 3MRPB 3PGDB 5EN2A 5FCSH 3QUMH 3WNLA 5CEZE 5EIIA 4EDWH 2Y06H 3WHXA 4RBPH 1UWXH 2DI7A 2R0KL 1N4XH 4D0DA 2EZ0D 2ESVD 3VFMA 4NQEA 1IGML 2X42A 1A1OA 2ICWI 3GBLA 4YGVB 4TUOB 4ZSOA 4M1CC 3UTQA 1U8JA 4LSQH 3MLYH 5FV2A 3TYFA 1BQLL 4F37F 2MHAA 1PFCA 2HJKB 2QSCH 5D6CA 2D2OA 2VL5A 5DQJA 1JK8A 3HI5H 1S8DB 5DVLA 4ZDHA 3WFDH 2FGWL 3UEZA 4XWGL 5MHSE 2AJUL 1CXFA 5E9DA 5DA4A 5IWLC 3WFCL 4GG8B 4U1MA 2GY5A 3KPNB 5IBLC 1F3DH 1RZJH 1J05A 3FO2B 4OLVH 3GKZA 4QXGL 4G5ZL 4HKZB 4HIXL 2G75A 1IM9D 1Z9MA 1A6TB 3HPJB 1A7OL 1BBDL 1MEXH 4PTTB 1GGYA 1IC5H 5I73C 2HRPL 4Z18A 3VXMA 5JQ6L 1ED3A 2YC1B 3RL1B 4JFXA 5JXAH 2CRZA 4JG0L 2DM7A 2ZWLT 3BP4B 4JKPH 5I9QB 1W0WB 1WIPA 3HG1B 5LWYH 4NQXB 1D5IL 3ARUA 1M7DA 3RJQB 3VMNA 5JOPE 3LS5H 4XP4L 3B9KD 3CCHA 3DVGA 5IB4B 4TUJA 1MCIA 5HHMD 5I8EB 4JFQA 1T4KA 2PW2A 5DD5L 4K3DH 4POYA 1IL1A 1F3RB 1I7RB 4P59H 3KJ4C 1ZT7B 1EO8H 3LKSB 4HCRH 3LEYL 2P8MA 2EC9U 3FQNB 1NC2A 5I1HH 1GGTA 3I85A 4PP2A 1B2WH 2EE2A 4PRDA 2J8HA 3BPOC 4GAJL 2YEZA 4NRZB 1BQHA 3VG0L 5C9KA 5EU7C 3D18B 3DVFA 4RFNB 1YPZE 4WHYG 3MV7A 3D6GA 3LV3B 5ALCL 5MERB 4N1CA 5I6XC 2BVOB 5JR1L 3VXNA 3C5ZA 3F62A 4ZUSB 3U46B 25C8L 3NAAL 4NKOA 1EMTL 1MH5A 4HK3J 3GK8L 1NGWA 1CLOH 3QIBB 1QLRA 3NFNB 3D25A 4Z8FH 4A6YA 1BLNA 4O4YL 3V0VB 3Q6FB 5HYJE 2G5BB 4MXWH 1ZLSH 3HZVA 4JEGB 4Z76B 2IALA 15C8L 3HUJB 1A1MB 2XY1A 5KN5A 3VXRD 2CKBL 4I18C 5FDWA 1DBJL 5KVFL 5J6HA 2EDRA 3I6GA 1HHIA 3Q1SL 5MHSD 3P4OB 5FOJA 3CDCA 3QUYD 2E7LA 5HI3C 2CLVA 3TBTA 4UOW1 5B3NA 4UB0L 4XNXH 1SEQH 3HTLX 1WBXA 1CICC 1FL6A 4QHMB 2EO9A 1K2DA 4LVHB 1G7QA 5DT1L 2Q8BL 1OP3K 3DX9A 3SY0A 5D70H 4ZTOH 3EDDA 3PIQA 4P9HC 4R0LA 5FUZH 1B3JA 2E6QA 2X1QA 3KXFE 2Y72A 4ZQKB 3HE6B 2NY2D 4XP5H 3QDMB 1MFAH 3ZE2E 2BC4B 2NXZB 2V2XB 4DOHB 1U8NA 3WDIA 2WUCH 4F37K 1FG2A 4U1IB 1KACB 4YAQB 3RL2A 5LGJB 2DQGL 3P9MA 3DV6A 4UT9L 2C3HA 3RDTC 1V7ML 2LAAA 2AJSL 3QFDB 1EJ6A 3RIAK 1RZKH 2IANA 3G5ZA 2XQBH 3UBXG 3RZCD 2P42B 2E9JA 3FQWB 3PDOB 5D2NC 5JXEA 5FGSA 4KDWA 1WLHA 3R06A 4URTB 4OLWH 4OTXH 3DX6B 1E28A 2FD6L 4NQUA 1VADA 5LAXB 2LU3A 1RQ5A 3IJHB 1DLFH 3BKYH 1OAXL 3ARVA 4N8VG 3TV3H 2VLLB 1XZ0B 2E27H 1G0DA 5HYJD 3U6RA 3D2UB 2NX5E 4Y5XC 4C83A 3UYRH 4GKZA 1DQMH 1A9BB 1KTDA 1Y6KR 5ADOH 3INUH 5J1SC 3WS3B 1U36A 3LPGA 3SGEH 1QBLH 4FQHB 4FQXA 3V6OC 1QEWB 4ZFZA 2OR9L 2P24B 1JUFB 5IM7A 3H9SB 2VLKA 5BJTB 1P2CA 1ZGLM 4NO0B 4OT1L 3LRSA 4PJHE 1NLBL 1NEUA 4U1JA 4MVBD 5E5MA 5IR1B 4UMGA 3BZFB 4NC1E 2VSDA 2X1XR 4JDVB 4QRRE 4Y4KD 4S2SB 4Z7UA 4Y19A 3LB6C 2VR9A 3HS0B 4GW5A 5BS0A 3P40A 3V4UL 4ZUTB 5GS0D 4F9PA 3QNYA 2R1XA 1F13A 3RQ3A 2ZJSH 1DBAL 1J11A 1DR9A 2YWZA 4R90L 2AP2A 4XNQB 1FYTA 1WWWX 3QRGH 4PJAB 1TETL 5L2KE 5GJTH 5C0CE 4MXQD 3L5XH 1I7UA 2X4PB 3AB0B 3HNVH 1UJ3C 3HNTH 3QDJA 1CE6A 1QRNB 3C60A 1QP1A 5C6PB 1HQ4A 4AIXA 4P48A 2X4UB 1AO7B 3NIGE 5DMJB 1HHKA 4WUKH 2OR7A 3EIFA 4PLNC 1A1NA 1S3KH 4PUBL 4JKWA 1PG7W 3Q3GA 3C8KB 3O6MH 4EOWL 1N8ZA 1YYMH 5E6IB 2BVUA 2E9BA 3GJFK 1UACH 2CO6B 5CBEB 4H88L 1I9JH 4DVBA 2W9DL 3DECA 5D1ZA 3B6SA 5TE4L 5KTEL 1CLZL 3QZWG 2D7PA 4EN3B 2AV7A 4G6FB 4Y5VA 2IGFH 1RVFH 1JPSH 1RU9H 2NX5D 1LE5A 1DQQB 4DN4H 3X14B 1TXKA 2EDYA 2QADB 3SGKA 4OD3H 4K94H 3F7VA 4LSTL 2R29H 4H5SB 3L3JA 4GW1B 4MD0B 4YXHL 2BOCA 2CXGA 3JWDH 3S6CA 4WFHE 5BV7C 2BSTA 2DIJA 5B39G 2N56A 2MOVA 3L5IA 5F7KC 4HQQL 2EZ0C 2GUOB 4E42A 3U4EA 1P9MA 2BVQB 4QRRD 1AD0A 1AFVL 2N1KA 3CXHK 5D72H 3VH8G 3RI5K 3B5HA 1EZVY 1SY6H 2NNAA 2HVJB 5CKAA 3U79A 4P5KB 1CE1L 3WDHA 2E9IA 2E3VA 3FHAA 4UNTA 4WUUB 2A1WH 4JFFA 3DURA 1HXMA 4LSRH 2RJMA 2MMXA 5KBNC 4HF5L 2Q1EA 5L2KD 4FFZL 5C0CD 1VERA 2QHLA 5HPOA 4JZJA 1HI6B 3ARWA 1NCWH 2OI9C 1B9ZA 3UXFA 4Y5YB 1N6VA 5BVJA 3MNWB 2F5BH 4F8QA 2ICCA 1ZHBA 3GMOA 1ZLUH 3TPUA 1WVZA 1RK1A 1GIGH 1UA6H 1BFTA 4V1DB 1KGCE 4R97C 2EXYD 5F9OL 1MWAB 4J4PA 3P30H 4LASL 4ACPA 4EUPG 2DQTL 3BQUD 3IDMA 3B4NA 1T21A 4XPGL 4OGXH 4I0CC 4ONOA 5C86A 3NFPA 4FTVE 3RZWA 4E5XB 3BH9B 1KV3A 1QR4A 2XTLA 2X7LB 1X3DA 4TRPH 3CDYA 5J57B 4KDTC 3VXPA 3B9KC 1AJ7L 3F58H 1MAKA 5JUEH 3ZKMD 4H8WH 2H6PA 4PJXB 1NPUA 2QHRL 4UILH 1NGXA 2Z35B 5EUOB 1MQ8A 1ND0A 3H3KA 1RIUH 2VLME 3FTGA 4YHOH 3GBNH 2VH5H 5BZWB 4U6XA 4NOFA 2OP4H 1UCTA 4NHUA 2DD8L 3RWFA 5C8JA 4J1UA 1DBML 2EDHA 4I48B 1MCDA 1OW0A 2VZUA 2OJEA 5I0DA 1L6ZA 4WFHD 3F5WB 5T3ZL 4JANB 2R4SH 4KK8D 2R15A 1XT5A 2FEDD 3ARED 3U0TA 3UO1H 1UWEH 5SX5H 3VFOA 4DW2H 1UENA 3SGJC 2EDNA 5DLMH 4CRPA 2CIIA 3K2MC 1QA9A 4WO4C 4FXKA 2GFBA 1C7TA 1OT1A 2NMSA 1K3IA 3AMLA 2H8PB 1UCBL 1DQDH 2G9HB 4I0PD 5DUBA 3UJIH 3FRUB 4FNLL 1MCFA 4I3SH 4X4YA 2HKHL 3OKKB 3QI9B 4K71B 3MJ9L 2AEQL 1HH9A 5GGUA 3VXUB 4MAUH 4YE4H 5D5MA 2RCSL 3CH1B 1FFOB 3FMGL 3QUYC 3U7WL 5D6DC 1J9CT 4I5BB 3KPQA 4JQXC 1EA9C 1AY1H 5IB2B 1KGCD 2WNGA 5KSBE 1U3HB 4OBSA 3T0AA 2X5PA 3ULSB 1G1YA 3IDIA 4Z78A 1A6AB 3ARZA 4WFGE 3OR6B 5F9WB 4LAJH 5HYEA 5C0AE 4FTVD 4FQIH 4AIOA 5E8PB 1ZWIB 3IDNB 1LEKA 4L3CB 2NY2C 4MCZB 4OQTH 1PY4A 1JWMB 3LVEA 3O4LA 5DUPL 4WFEE 2DLGA 4IS6A 4FA8A 5C0EB 5C2BL 4MA7L 3DO7B 1AXSB 4BZ1L 2CKBA 4KJQD 1RJYB 1YEEH 3L5WA 4OLUH 3RPKA 2DQDH 2VXSH 1Y6MR 2A9NH 4Z7OF 4Z7VA 5I19L 4RDQG 3H7BA 1R3KB 4P4KD 2VLMD 3TIDB 1IGCH 3RZCC 1LO0L 1UZ6F 3B9VA 4Z7UF 5TJWK 4HUXB 4PRPA 1GPOH 2ICEA 3VFWB 3JV4A 2D7NA 5FXCH 5I1CH 2OTPA 1MHPL 3JVGA 1CZ8L 4YWGH 2A6DB 4J3SA 4UDUB 4L4VA 3EGSA 4XGZA 2UV3A 2DWEA 4LEXL 1BVKB 2XFXB 1OAZL 3MXVH 3KYNA 5E8DH 2D03L 3G5YA 5DEGB 1N0XL 1RUML 3V6ZA 1FGNL 1BOGB 4Q9QH 2V5SA 4M7JL 3FHQA 1FSKB 5KOVC 3KPSB 1QSFE 1FL5B 3SDXA 1E4KC 1OF2B 1CS6A 4N8CL 4UQ3A 5E2WL 3O3EB 1TZGL 2QBWA 4NO3B 2ZUQC 4HFWA 3WBDA 5IJVB 3BH8A 1H3XA 4HS3B 4XVSL 1JHTA 3VDCA 3O11B 1WAAA 1RZ8A 4RRPG 4RX4A 2CK0H 2Z91B 2XWJB 2EDKA 5I1EL 4HLZH 3PWVB 4LCYB 5GGQL 4PV9A 4QF1A 2FR4B 5GJSH 4WDIB 1DBBH 2OL3H 4W6YB 1CG9A 1LEIA 4Y4HD 1NANI 4MVBC 4H20L 2JK5B 4KQ4H 3GJFB 4WFGD 4NM8H 1EFQA 4Y4KC 1CFVH 4AEIL 1R5IB 1ES0A 3MV8A 4TNVF 5C07E 5F44A 4AMKL 4G9DB 3VFVA 2BNRA 1J1OH 4GFTB 4HS8H 4O2EB 4OIIH 5EIVA 2R56L 2EH8L 3MRNA 1PKQB 1TENA 4WFED 3UBXA 4ODHL 35C8H 1ZLWK 5H2BA 4CADB 4YXKH 3WFBL 2JTDA 3G08A 3L3HB 5D71L 1QO3B 4P3WA 4NM4H 1N2RB 4MXQC 4PRHA 5E00A 2X4TA 2GITB 1JI1A 1XMWA 2MFNA 3D0VB 4JN1L 1OAYH 3BKCH 2JB5H 1WBZB 4K7PX 5F89A 4JHWH 3ES6B 5DJXB 4HUWB 3S88L 4K8RH 4H0IA 5FCUH 3B8SA 3HI6H 4N8VA 1N6UA 2B0SL 1SEBB 5GS2D 3DBXA 5IMOA 2DLHA 5ICXB 3AMKA 4OI7A 3N50A 1JJUA 4DK6A 4EIZC 2F54B 3QH3A 5F93C 1P53A 4WVRA 2VE6B 4BFIB 4ONFH 4B7IA 3LQAC 1S7QB 5I30L 1F6FB 4YBQD 3CMGA 2J6EH 4DCQB 1MCOL 1PLGL 1QSFD 1RZGA 2HMID 5GRVK 5FYKU 2EDJA 2W92A 5HHNA 5J56B 4DGVH 3BYTA 2VQTA 2DRUA 3O9WD 5DR5L 4LLWB 3QEQB 3GI8H 4TOYH 5FGCB 4D8PB 2F53E 1FLRH 4JZNA 2I9TA 1F8TL 1I1FA 3U30C 4MJ4A 4UUJB 4IMKA 1FFNA 3EOBB 2PYFB 3TT3L 3CFDA 4G7VH 1QBAA 1N7ML 1QVOA 4PJGF 1DE4B 2RGSA 2UY6A 1NDMB 2DQHL 3U1SL 2EDEA 4NC1C 4ZFOA 3MTRA 4RQQB 5J06A 2M2DA 1YA5A 1QSZA 1H3PH 4J2XA 4NGHL 5DURB 4JFDA 3MRFB 2X4RB 3SCMD 3DVIA 3L3OB 1K8IA 4WNQA 2I5YH 3LEVL 3RWJB 2HWZL 1P7QA 3QQ4B 2WIIA 4ZODA 3G5XB 3VFRB 2R2BA 3LMJH 4XAWH 3EYOB 2K1MA 3O2VL 1V5JA 5K59E 1HYSD 2NY4B 3UJJH 3K0WA 1PZ5A 4D9RD 5EIIB 4KRNA 4OLZH 2FL5B 3WHXB 4LVOC 5CSZB 4JFZH 3GM8A 3FFCA 3T2QA 1KJVA 4HUMB 1RMFH 4MX7B 2C1OA 3IAGC 3O3AB 3L9RA 4ZXBA 2EXYC 1JN6A 2FEEL 4NCC1 4L8CA 3IDGB 4X5WB 1T80A 3BQUC 4ZSOB 3UTQB 2DTML 4JPIB 1U8JB 4O00A 3RTQA 3LQZB 3TYFB 1SJEA 3V52L 4WTZG 3ARBD 1J5OL 2XG4A 3D48R 4PJ7E 2R39A 2VLJE 2VL5B 5DJ0B 4AM0A 1JK8B 1MCKA 2HVKA 1CDUA 1IGJA 4NBZB 1MQKL 2WM0A 1X5HA 1ZA6A 2MPAH 3S34H 4I77L 2YD6A 3PG2A 4BJLA 2I27N 4EDXA 5K9KA 3BO8A 4UAOB 1YUHB 1FZOB 5E9DB 3ZKMC 1EX0A 2A6IB 4TVPL 3CLEL 3TBWB 1JF1A 3N1PC 2NQCA 5BMFH 1J05B 3M17B 2IMMA 3C6LD 3FOLB 4DFHA 3CVIH 1EEQA 5ISZA 2F53D 4NZRL 1A7BA 3VH8A 2ID5A 4NN6B 4DGIH 1K5NB 3MLXH 4YPGA 5F97E 4JFXB 4XBGB 4NWUH 4HX1A 2MWCA 4KUCF 2VN7A 1UEYA 4ODUB 2LE9A 3AC0A 4NJ9H 1HXYA 5HVWA 4KK8C 5MEPA 2FEDC 1F6AA 2WW8A 3AREC 1RUQL 3KJ4B 4HK3N 5ESQA 4Z7QE 5C0FA 1U92B 1YDPB 2RBLA 4MNGA 5AEAA 4P9HL 4PRNA 2NTFA 2VDPH 3CCHB 5JIHA 3VRIB 3DVGB 3FB5A 4TUJB 2R0WH 1T4KB 3I9GL 3PGCA 1LGVA 5DUML 3VGAC 1IQWL 4C56A 1KC5L 2X2YA 5HY9A 1YPZF 3T65A 4OI9A 2D4DA 3RWDA 5BOZG 5FGRA 1OGTA 4I0PC 4FQQA 5I6XB 4PP2B 4EUPA 2JKXA 3HAEB 3QJFB 4TULH 1Z9OA 4QRPE 1BQHB 4Q2ZA 2ARJQ 4P2CG 1FZMA 2KBGA 3V5KA 4ORGB 1BGXL 1FO0H 3VW3L 3RY5A 1D9KD 4HUUA 2D7TL 2Y25A 5HI5D 1IC1A 1T5WA 3C9NA 1KB9K 3KJ6H 4NKOB 2KQMA 3GB7A 2AXGB 1MH5B 4PB0L 1QLRB 4A6YB 4I18B 2MCG1 1BZQK 3SDXF 4LCWA 1BX2B 3ZYJA 5HTSA 1IGFH 3HZVB 1Q9LA 2IALB 1JTPA 2A6JB 1D3CA 2VLJD 2GJZB 1A4JA 3FQXA 5TE6L 3S5LB 4GXUM 5I74C 2BY3A 5KN5B 1QUNA 5L6YH 4O51A 3SGEI 2IQAA 4M6NL 5J6HB 1MAJA 4GG6E 3VXQA 4Q6IA 3KYMB 4Z7WE 4MAYA 4M4PA 3TYGL 4KJQC 3MJ9A 1JE6A 5GRJH 5DC0A 3X3FH 2CLVB 2A73B 4K23H 1AC6A 4MS8D 4PS4H 1DEEA 1WF5A 1AKJA 5HYQB 4XCCH 4GMSL 1QFOA 2EDOA 1FL6B 2Q20A 5DSCA 3PABA 4P4KC 1ZANL 4QTHA 3S97C 4Y2DD 3BEWA 3FB7B 4DVRL 3OAYH 3MUJA 1MRFL 4TUKL 3G6AA 3K4DA 1HEZA 4LEOB 5JHDA 2FCBA 3X11B 2B2XL 2XZCL 5IV2A 1VFBA 1A5FL 1FVCA 3RDTB 2ZOLA 1T2QH 5HGAB 3LPFA 4RISH 1N6QH 3U0WH