5GZOC

Structure of neutralizing antibody bound to zika envelope protein
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
219
structure length
214
Chain Sequence
QVQLQESGPGLVKPSGTLSLTCAVSGGSISSSNWWSWVRQPPGKGLEWIGEIYHSGSTNYNPSLKSRVTISVDKSKNQFSLKLSSVTAADTAVYYCARDRDDLSPFDYWGQGTLVTVSSASTKGPSVFPLAPSSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Genome polyprotein
publication title Molecular determinants of human neutralizing antibodies isolated from a patient infected with Zika virus
pubmed doi rcsb
source organism Zika virus
molecule tags Viral protein/immune system
total genus 37
structure length 214
sequence length 219
chains with identical sequence H
ec nomenclature
pdb deposition date 2016-09-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5gzoC02
2ICES 4HUKB 1ZTXH 3SDAC 4XP1L 2YZ8A 1FNEB 2R0KH 2JJTA 3H0TB 4EDWL 4UNVA 4XPBL 1T4KA 1ZHKB 1H5BA 5HHQA 1PZUB 5ITBH 4XPGL 4GAYB 1PKQB 2IH3A 3GMQB 4ETQA 3SQBA 5DD0L 4LKCB 2R1XA 4NOBA 4GQ9L 4OCSH 2CK2A 1T80A 3O6MH 2JK5B 1ZT4B 1OPGL 2VL5A 3ZDXF 1G9ML 4XCNB 1DE4A 1AD0A 3KPRD 1TDQA 5HYFA 4RGNC 3TIDA 4XXCA 3VFGL 2DWEB 2MPAL 4KTDL 1T0NA 1HHJB 3B6SA 2CIIB 2X4PB 5DQDL 3KYMA 4OLVH 3SGEH 2HWZL 5A2JH 4YR6A 3C60A 1ZTXL 5GS0L 4MJ2A 2XYCA 4MNHA 3P4NA 4PRNB 2R0KL 4JB9H 3U7YL 4HS3A 4KWUA 3TP4A 3EOAB 5SWZA 3BYYA 2NXYC 3I75B 3C5JB 3ZE0E 3TV3L 4I4WB 4V1DB 4PLJD 3HPJB 2H26A 4QHMA 2FIRT 3EBAA 3KPNB 4OCSL 3O6ML 1GAFH 3H7LA 3MUY1 2LTQB 1ZSDB 4QWWC 2VXTH 1C1EH 5CEZD 2XA3A 2FEDC 1JN6B 1N2RB 1RI8A 3P9WB 4NQXA 3FRPA 1PW3A 4XX1E 1XF2B 4DN4L 3HG1A 2I9TB 4QYOA 4LBEA 1UVQA 2OTWB 1CGSH 2ATPA 1YPZB 5JXAL 2WLZA 1R3LA 4P48A 3ELAT 4OLVL 3UTOA 4JFZH 4LVHB 4NQEB 3WDIA 4U1HA 4CDGC 4JB9L 4P3CH 2EYSA 3OKNA 5GGTA 4G80A 4KQ4H 5F8QC 4HG4J 5GZNC 1BIHA 4LOUD 4MJIE 5CJOL 3T09A 1GAFL 4UT9H 4GT7A 2VXTL 4H88L 1LP9B 4Q6IC 4MX7B 3JSSA 1OGTA 2DIAA 3Q48A 1BIIB 3DVIA 1NDGA 3FQUA 3HE7C 1N5AA 5T1LB 5F9JA 3CD4A 4LLYB 3L6FA 2XRAL 4KUCF 4NZUH 4KI5E 3V8CA 5HHNA 2O61B 3LPGA 3IETA 5F70A 4JFZL 3WN5B 3GB7B 2X1XR 1R5VA 1NBZA 4HIEB 2MTPA 5DHVB 1F2QA 4P3CL 4E42B 2VUYA 2AV1A 2A6DB 1PYWA 5E5MB 3QEUA 1H3GA 2XWTA 2RB8A 5E8OA 4Y19B 1AH1A 5FGBC 3TCXA 2ICCA 4GG6A 2AJVH 5KBNC 4ODHH 4NNPH 1A6AA 1FNGA 4JFDD 2E6QA 3L95B 2I25N 3IU4H 3QIWD 3TO4C 3S97C 3G08A 3QP3A 5D7LE 4N0UB 3FRUA 1QR1B 1ZV5A 2VN4A 4RX4D 4EXKA 2VLJB 1IM3B 4X99A 1CQKA 4KJYA 2FDBP 4KI1A 4NZUL 3V6OE 3UTTB 2NLJB 2IAMC 2WQ8A 3JVGC 3DLQR 4XXDA 4JG1H 2R0WH 4CNIA 1A9EB 1KCVH 5DJ6B 5KG9A 2YPLE 4X98B 4LEOA 3CH8A 2PN5A 5K9QI 1KB9J 3BIAX 1SEBB 3JTTA 1QBBA 4ZFOL 2FGZA 4PJFB 1IC7H 2MWCA 3BI9X 1JHTA 4NT6B 4LLMA 5D7IB 4HMDA 3QI9B 4K07A 2GFBA 3RDTB 1PZ5B 1L6ZA 4ODHL 3FCTB 3MRFA 3U46A 2DM2A 3SGDH 3IU4L 2GAZB 5BMFH 1OGAE 4U6XB 2X4SB 2XN9D 4GAJH 2O5XL 2VDRH 4KI5C 1S8DB 2XIDA 4WDIA 3A67L 4I18A 5FA4B 4XH2B 1MJ7H 1F8TL 3BGFC 5EOCH 5DJ8A 2IBBA 3B9KA 2O26U 4OCLC 3C09C 1JGDA 1S7VB 5TE7L 3BP7B 3LKQA 1DQQA 2R4SL 3PL6D 2P8PA 2AXGB 2OR9H 2ZNXA 4KK9C 5EU7E 2WNGA 1WAAA 5IV2B 4HUNB 3OR6A 4H0HB 1IC7L 1FNHA 4MAUL 4I3SL 3KYNB 1KLFA 1HSBB 3QFJE 4BQCA 1A1MB 4R7DB 4MJ6A 4QHLB 3QEQB 5DTFB 5BVPL 3MRDB 2EH7H 1X4YA 4N8VA 3DYOA 4RZCB 3VE0B 5BMFL 1FZOA 3AGVA 3BP6B 5IHZB 5LXGH 2VZUA 2VDRL 3EYFA 3OKOA 1U6AH 3S96A 1MJ7L 4Z9KB 4PP2B 5EOCL 2BNRE 4Z7OE 3H9ZA 5GGQH 3HLAA 4H25B 4M6AA 3BPLC 2OR9L 1CD1A 4L4TB 5F7EH 4MDIB 1FVEB 3MRMA 4UTAH 4PLNC 5D6DA 1Q38A 1I1YA 3D18A 3KPRB 3LSOB 5J13B 1KENH 2FX9H 5F1NB 2YRZA 4S1DC 1PBYA 5I2IB 3MCLL 3C2AH 1RIVL 2EH7L 4E41D 2ZOLA 2LAGB 2R0LH 1JHKH 3IRPX 5BS0A 4ORGB 4S0TD 3BHBA 1BJ8A 5LXGL 1LQSR 2FGWH 4WFHD 3DWTA 1VDGA 5CEXB 1KIRA 3C5ZA 5K9OB 1U6AL 1BF8A 2QHRH 4GRLC 3ARBA 4DK6A 5B21A 1I85A 3MCG1 1AXSA 3ZMRA 3B3IA 4Y4HD 1Z6JT 5JDSA 4MCYA 5EU7C 3PWPD 5CILL 3WJJC 4HDIA 4OZ4A 1U93A 5H35B 3PXJA 2WP3T 1IL1B 5FYKH 5F7EL 2AXFB 3QDGD 5JA9A 5HI5D 4GRWB 5T1MB 2YA1A 1DP0A 3EW3B 3RTQC 4YDKH 4RAVA 1KENL 2KBGA 2FX9L 1YEHH 3VFWA 5A2FA 4WEMB 3JV6A 3T0EC 3V4UL 5E4EC 2DTSA 1TMCB 2GHWB 4FQJH 4PD4K 4NKOB 1JFQH 1GGBH 1ZA3B 3BP5B 1T04B 2C4FT 3MRCB 3EOBB 3RGVD 4AL8H 5FDWA 3MGOB 3OF6D 4LRIA 4QXTB 1ZWIB 4IRZH 2C1PB 3SOBH 2QHRL 5KSBA 3QUYD 5HY9A 1OARH 1B4JH 4U3CA 2APXA 1EHNA 1G7HA 3CSPA 5J56B 1QG3A 5BW7A 4K7PH 2XOTA 4HSQA 3RPIB 3KJ4C 3VRJB 4QOKE 3ZYZA 4PJ5E 4HWBH 4X80H 2W9DH 3EDKA 1D9KD 2X4TB 4A2LA 1YNKH 4M4RA 1MCOH 5CKAA 1MNUH 2CR6A 3KPSE 3ZKXB 2HFFA 4W81A 5MERB 2IANE 1GGBL 4NCC2 3SDXE 1M7DB 4XHJC 1N0XL 4OZFB 5CGYC 4AL8L 5E2JA 3O2WH 3NTCL 1H8NA 2OMBA 3SOBL 1OD9A 4NQCD 3BGAA 5C3TA 1B4JL 3LB6D 3ARSA 1NL0H 3GGWA 5IMMB 2UYLB 4K7PL 3CH1B 3TH4T 5CIPB 4PP1C 1A14H 5GRVL 4JFDB 4QRPD 3QIWB 3D2UD 1RHHA 4HWBL 4BKLB 1J8HE 1ZA6B 2W9DL 4NPYA 4K8RD 5IR1A 2AKRB 4HV8A 3SGKC 4UU9B 4LARH 4C56E 1YNKL 3T2OA 5KANI 1BZ9B 1MNUL 2P44B 2V2WB 3IJSB 3X14B 3QUZD 1HH6A 2NY2C 3HI1B 3OPZH 3AMKA 1R3JB 2R9HD 3T3ME 3P40A 2XZZA 4FTVD 5EOQH 3U36B 5FECA 2XA8L 2P7TB 3SO3B 2AVGA 2V5TA 3EOYG 4FP8H 1KPRA 5I1DA 5EBMA 1DDHB 5EU6A 3SO5A 2C3VA 3MBXH 3OB0H 2WIIB 4ZYKB 3GBNH 2FRGP 4G8EB 3GKZA 3LN9A 4L9LC 1MFBH 1VACB 1A14L 1XH3B 4XC3H 1E4KA 5LVEA 2FZ3B 4O2EA 2Y06L 5JDJA 1NH6A 3A0OA 4TSBL 3PWVA 5I16A 2XN9B 4BFIA 2A0LD 1G0XA 5AAMA 1YQVL 4FXKA 3SBWA 2Z4QB 2EIBA 4BZ2H 4KZEH 1Z0NA 3MV8E 2GT9B 2H2SC 4V2BA 3SGJC 1VCAA 3MACH 5EOQL 1RIUH 3PL6B 4ZUUA 4MJ5A 2R4RH 1UEYA 5B39G 4FP8L 4P23C 2CO6B 3E6FB 1JWSB 3BE1H 3MBXL 2QSVA 3H7BB 4TUOA 1HK6A 1MHCB 4NKDB 3QXWA 2J8UF 3GBNL 4KDTC 3W2DL 4KKAC 3WEXA 4DGIH 1B4RA 1MFBL 2QQKH 1KSRA 3VFSA 3IDNA 4ONHA 4OKVA 4X5WA 2C26A 4YBQC 3U0TB 4S10A 4QXUH 1IZJA 3RA7H 2Q3ZA 3ILQC 2QHLA 1T2QL 3QJHA 1KPUB 2EDBA 1RSFA 2Z92A 4NWTL 3K8KA 1XZ0A 1NLBL 1YY8A 4YH6A 4L3CB 2R2EB 4BZ2L 4KZEL 1CFNA 4X6BB 3MACL 2Y4SA 3W81A 3U7WH 3WE6B 4NYLB 1RIUL 1YEEH 3VWJA 4P9HH 2R4RL 2FLRT 3MXWH 3UTZB 2QV2A 3BE1L 4WTWA 2Z93B 3CFKA 4JY4A 5DUBB 3U2SB 3K4ZA 1DL7L 2R0ZH 4MQ7A 5ENWA 1GYAA 3VG9B 2AEQH 2XG5A 3PDOB 3O81A 4FQ1H 1QSEA 3QO0B 3BH8A 4Q9RH 5J11B 2QQKL 4E41B 5FO7A 4YHYC 3RA7L 5K9KA 1Q9KB 5JPMA 2Z91B 1ZVHA 3D39A 3C5SA 4HEME 4LSUH 4LVNB 3F12B 4YXLH 1ZLWK 1WF5A 1UG9A 3LKNB 1MJ8H 1ZXQA 4RNRA 5GGSB 1JGVH 3U30C 4KJWC 4M7ZC 4Y4HB 3INUH 4GMSH 3U7WL 3MJ9H 3PGFL 1YEEL 3PWPB 3Q6GL 4P9HL 1CT8B 5GS0D 1AGEB 4QNPF 1VGEH 3QDGB 3MXWL 1CFSB 2IMMA 2QSQA 1IQDB 5D7KE 4Z7VF 1XCTA 2R0ZL 3MLTA 3CFDA 5C09A 1EVTC 2AEQL 5KVEH 3IDJA 3MRHA 5JZ7C 5HDLA 3JTSB 2ZG3A 4Q9RL 1KIQB 4OZHA 2IBZY 3LVEA 5GSVB 3FKUS 1BD2B 2DL9A 3U4EA 3RWDB 1OAYH 3CMGA 1WZMA 3ARGD 3RGVB 1NC2B 5C0EB 4YHPA 5IW6A 3FT4A 2CUMA 4GSDH 4KZDL 5IWLC 3DV6B 4LSUL 4AM0B 3IFPB 1EO8L 2HLAA 3W39A 3CZJA 3EFFB 1MJ8L 4M43L 1JGVL 1T7YA 3L3DA 3MJ9L 3P4LA 4JPKL 1C5BH 3ZHDA 1RZGB 5TPWH 5HHOB 2PW2B 1VGEL 4YC2B 3ULVE 3I9GL 2Z31A 4CJ0A 5JXEA 2HRLA 1D9KB 2VWEE 4X6EA 5KVEL 2YKLH 3P4OA 3I50H 3PV7A 1IGIH 3B5GA 4FQLH 4PGDA 3GIZH 5CINL 2AQ1A 2F54E 5C07D 4MNGE 3JWDC 5LQBL 3CXHK 4JO2H 4AQ1B 1UXWB 1OAYL 4ZAKB 4E9LA 4HZAA 4D0DB 1B2WH 4XI5D 1T6WA 4GSDL 4W4OA 3L5HA 3QWQB 3G6JB 4HW6A 1CGUA 1JGEA 4ISVA 2PCPA 5T5FH 3RL1B 2E7CA 4M3KB 4WGVB 1C5BL 3CVIH 5DK0A 2VISA 4QRPB 3TA3C 3D2UB 3AUVA 2EYRB 1AD9B 3QCVL 1VFAA 2B1HL 5DJ2B 4NZJA 1T22A 2PXYC 2YKLL 4F9LC 3KYOA 3I50L 4YFEA 3V5HB 1JZ8A 4HIJB 4MDJB 4NN7B 4F3FB 5DFVC 3M8OH 5B3JF 1NAMB 4GMTH 4FQLL 5LCVH 3QUZB 3GIZL 3K4AA 1MPAH 5HYJA 2WV3A 5E8EA 1IKNA 3K8LA 4FTVB 2HTKD 5I74B 3MGAA 4I9WE 4HC1A 1B2WL 3GEWB 5CSZB 3DXAA 5C0JB 5B38B 2VIRB 4WW2A 1NGYA 4KK8C 3N1GC 1C08A 3QO1B 5T5FL 2YUWA 3UCRA 1KEML 4ENEC 3CVIL 5SWZE 2H32H 2IQ9L 3ULVC 3X3GH 4BFGA 4Z0XB 3NBNA 2VWEC 3GHEH 2EXYD 3HZKA 4WEBH 4J1UA 5I1GH 1TNNA 2DTML 4PIRF 3LKOB 3T0XA 1AC6A 5FGSA 3NAAH 4IJ3C 1AJ7H 4GMTL 4JZNB 2WWKT 4EDXB 1FFNB 3HG1E 3WIHH 1MPAL 4XBPA 4Z5RA 5IOPA 4I2XA 5FYJH 3FMGH 5L0QB 3V52L 2C3GA 2IEPA 3KLAB 3BWAA 1RUKH 4NN5B 1T1ZA 3DMMB 1CDUA 1H5BC 4JRYA 3NPSC 1UZ6F 5C2UB 5I9QC 1EEUA 2ORBH 3CX5J 3JWOH 4EN3A 3PP3K 4TTGA 4OCMC 3PHQA 4WEBL 4K3GA 2ED7A 5I1GL 4H1LA 2BMKA 3BUYA 4RGOL 2ADJB 1AJ7L 1I9JH 5C9JB 5DJZA 2PW1A 5GZND 3QG6A 3LRHA 1MAML 3RVWC 3NCYP 3WIHL 4B41A 4DGYH 3OKLB 3SDDA 2M1KA 4HWZA 3QUXA 4KKNA 3SDYH 4AJ0A 3O3EB 4F15C 4GJTB 1R3KA 3DURA 5T5NG 3QRFM 3SQOH 1RUKL 3DTXA 1MH5A 4XWGH 2D7TH 3VXMD 5EU5B 4ZNCD 3JWOL 2AV7A 3WMSA 3FQNB 1QFPA 5DJCA 2ARWA 3S88H 5F6IC 5GS2H 4GG6E 1XT5A 1OCWL 3QQ3B 3HI6H 3AM8C 3C8KA 3I6LE 3IKCA 4OLWH 1UJ3C 5IJVA 5KSVB 1I9JL 4O2FB 1P7QA 4AQOA 4LLDA 5JOFB 4DGYL 1G1CA 1QQDA 2YPKA 4F7EB 3FN0H 4ZFZB 3SDYL 1RHFA 4R4FH 1MCKA 1LO3H 1J7VR 1CQYA 1UC6A 3NACH 2CR3A 4HBCH 2XQYK 2V7HA 3PNWB 5JW3L 2D7TL 4JCLA 1FV1A 5A16B 1YUHA 4XB8A 2LABA 5GJTL 3S88L 3IDYB 3K2MC 4HHAB 2K3TA 1LNUB 2X70B 5DMIH 1IC4L 3ARGB 1N7MH 4Q74A 3HI6L 3QXUA 5C0CD 4GUPA 4N5EC 1KCKA 1WZ1H 4OLWL 3X3FH 2ZG2A 1J0KA 1IM9A 3QDJD 1N4XH 3IF1A 3MRGA 3P2TA 4KHTH 2YUVA 3BVNB 1U9KA 2NY1B 3LHPH 5C0DA 4JFQB 5HVHC 5DC4B 1BBJA 2J8UA 4R4FL 3GJEB 1IEAB 3FTGB 1CDCA 1KACB 3L7FB 4ODWA 5FB8A 3NACL 4HBCL 1OOAA 3V5KA 3DROA 1WAAE 2CLZB 4K7FB 1TJGH 1I8MB 4DZBA 2Y36H 4M7LH 9CGTA 4M7LT 5C07B 1IVLA 3CFBB 5DMIL 4H5SB 1N7ML 2BY1A 3TBTA 5DMJB 4OD3H 3X3FL 1LEGA 4B7LA 1N4XL 1QZ1A 3HNVH 4WI9A 4KHTL 4G9DA 4JGMA 3OGCB 4PGBB 3WDHA 4U1JB 3H42H 1B90A 1HE7A 4PJBB 4PG9B 1MJUH 1ERNA 5CBAA 1KTLB 4NBZB 5SX5K 3RGHA 4JFHD 4LPWA 4GBXA 3MYJA 2QEJA 4KPHL 3PF2A 2D03H 2G9HB 2V17L 3RAJH 1ODAA 1E27A 4QHKI 3ARDA 1TJGL 5MP6H 3AXLA 1N64L 3S7GA 1AO7A 1Z5LB 2Y36L 1U8QB 2FB4H 2C7UB 1ZLVH 1T1YB 5DD5H 4XRCA 1ZANL 4OD3L 5EZJB 4JCMA 5BS0E 3ULUF 5J12C 3HNVL 4GOSA 4I18C 3MOAL 3SKUD 5A1AA 2J5LB 4OGXH 2PTVA 4XTRD 4DCQB 3H42L 3QUKA 4TVPE 2OM5A 4F7CA 4Z7VA 5EC1A 1MJUL 3RX8A 1G7IB 2DKSA 3V7MA 4ZFOB 2PUQT 4JZOA 4G8FA 3RAJL 2D03L 1EFQA 1HKLH 5DZNA 1CL7H 1A8JH 3HCVB 1JRHI 5MP6L 3WFDH 3BP4A 3HTLX 5DJXB 4U2YA 1U92A 3QA3A 4OCNC 5CBEA 2FB4L 4LDLB 5IB2A 2Q86A 1EEYB 5DD5L 4G6JH 4JZJC 1DSFH 1X44A 1GOGA 3S36H 1I9RH 4XCYB 1A4KA 3V6ZA 2A9MH 1EFXD 1A5FH 3FO1A 5KSBE 4ZXBA 1YPZF 5H8DA 4WTZG 3F6LA 3LN4B 4OQ1A 3IT8D 4HS6A 3P9MA 5HGGS 3PGDA 5MEQB 2BXYA 1JMXA 1HKLL 5D6DC 5DXWA 3WFHB 1PX3A 3M1BA 1CL7L 1R5IA 3R4DA 4UT7L 5HI3C 5TE4H 1HCVA 3WFDL 2HVKB 2SEBB 4MNQD 2HG5B 5H37G 4Y5VC 5J8OA 3VXPA 3WNPA 3ARVA 5DFWH 2ZP0T 3O6LL 1FFRA 3FB7B 1LP9F 5DT1H 4G6JL 4G9FA 3C5ZC 3MFGB 3QIUA 1MQKH 1A4JA 4GS7C 3S4SG 2A9ML 1BHGA 4R26H 1I85C 2YWYA 4JRXD 3HR6A 1S9WA 3ZDXE 4WRLA 3SJVD 1R3HA 2GSGB 3K81A 4I48B 2ATKA 3LKPB 2Y1VA 3IXAB 1J12A 1I8KB 1RZJL 4F80A 3I3BA 1IGCH 4LSRH 3O4OC 15C8H 4BFBD 1N26A 2L7UA 2OL3L 5TE4L 3RWIA 1K2DA 2VAAA 1M71B 3V2AR 1BPVA 5TF1H 3PQYB 1HOCB 4Y16A 3HMXA 1L0YA 2X42A 3Q5YA 1VFUA 2H8PA 1S7TB 4N0FA 3BEVA 4LRIC 5IMKB 5ICYA 2UZIH 1MQKL 1C7SA 5IVZB 4I0PD 2YBRB 4R26L 2C1OB 4YFLF 4WUUD 5GSRA 1PJ9A 5F1SA 5BW7C 2VDLH 8FABA 5EC2A 5EU6E 5EBLA 3VFUB 3E3QC 4QRRD 3TEUA 1X5GA 5I1HL 1BQHG 1FCGA 3T0AA 3TYGL 3TN0A 3D69A 5A2LH 5B8CA 3OWEA 4OD2B 1IGCL 4LSRL 5C0CB 4NQDD 3X13B 4EI5A 2XV6B 3QDJB 4PJFF 5J3HD 4HUVA 5D2NC 1QA9A 5D7IF 3VGEA 3R06B 3ECBA 1YMMA 3QH3B 5TF1L 3S5LG 5HPMB 3U83A 3DX7B 4KJQD 3ES6B 2V5MA 5GRZA 5BXFA 2UZIL 5C0ND 5I1LB 4IS6A 1QLFB 1QBML 4P2QD 2F8VA 2EXWC 2BDNH 4XVSH 4DOHB 4Y5XA 2VDLL 4YIQA 5LAXB 4TVPH 4XHQA 3OX8B 1OTSC 5EZOL 3I84A 1I7ZA 1N5YL 4XWOD 1NEZG 4D0CA 1RJLB 1LK2A 1M6OA 3QBTB 5ID0A 2H6PA 4X6FA 3DX8A 3OXRB 3TF7C 4PRIA 3ZSTA 5TH2B 1T66D 4APQC 2AI0H 2HFGH 3BKCH 4ZOAA 3W9DA 2BJML 3KR3H 3MRPB 1HH9A 3CFJB 5ICZB 4PLOB 1S3KH 3X12A 4X7FC 2YSSA 4NWUH 2BC4B 1QSFD 4NM4L 4JAMA 3GSRB 5DHYA 4ZPVB 2GJZB 1YZZA 1VPOL 3MRBA 4X7EC 3HC4H 4KJPD 3CFEA 1QSEE 4ZG1A 1CK0H 3G9VA 3P77A 5E03A 3VFVB 4HWNA 4LCUA 1NFIA 3VXUB 1T1WA 4NO0A 1OLZA 3D39E 2H9GB 1AFVH 3BKCL 5EIVA 5EO0A 1UADC 3KR3L 3TT3L 4LEXL 3B9EA 3PGCB 4CGTA 1S3KL 4U1NB 4POUB 3RIFK 5KS9B 1CI5A 2FH8A 2C3WA 2BNUB 2DIJA 4XX1G 3PP3H 3QCTH 3MUHL 4IRSD 1C16B 1TJIL 2ADFH 4GRLB 5C09E 4DFIA 4JN2A 3HC4L 4TVSa 2IBGA 1VERA 1M05A 2YD4A 3V4VL 1KGCE 3OL2A 4NKQB 1U8HB 4OZHE 5DF0A 4O02H 1G9EA 3FOLA 4OUUB 4CADB 3NA4A 2XTJE 5J4MA 4D3CH 3VFNA 2NTFB 1EO7A 1FPTL 4HUWA 3RTQB 1EFXB 3TPUB 5EN2A 1AFVL 3CMOL 3I02B 2BVOB 4J4PA 1FJ1A 2VN7A 4UV7H 2D7MA 2XWJB 3GUTA 1CFBA 2P8LB 3VWJC 1OAXH 2KL6A 4NNYA 2A6IB 4S11A 5GS1B 1NGQH 2X4UA 4IRJA 2GUOA 4DW2L 2YUXA 3HA0A 3QCTL 2DQFB 5D2LB 5I66A 1A6WH 3T4AB 3OJMB 2WUCH 4YBHA 4MNQB 3LV3B 2NYYD 1N6QH 3VDBA 2HT2D 4IOIB 1MIML 5KVDL 2OI9C 2YC1A 2P49B 4LNRB 3FHQA 2CKBH 2ZUVA 5T3XH 3QDHA 1RJZB 4MXQC 1XGTA 2OQJB 4N1EA 3QB7C 4GRMB 1S9VA 5M94B 1CR9L 4JRXB 5CSBA 1FNEA 3HRPA 2DLFH 3H0TA 5CWSB 4O9HL 2CIKB 4UV7L 3O2VH 3SJVB 1NANI 3N1QC 3LS4H 1OAXL 4GAYA 1PKQA 3GMQA 3L3IB 4FQHB 2VR5A 3S37X 4HUUA 4LKCA 4ELKA 5D1QC 4FZ8H 3VCLB 2JK5A 1KCSH 1ZT4A 5HDOA 1UJTA 3P0GB 3HZYB 4XBEH 2WUCL 1EXUA 1VEOA 2DM3A 1LVEA 4XCNA 1TZHB 1XF4B 1N6QL 1U42A 3VXTA 4AK1A 2HT3D 3BYTA 4PGCB 5EU4A 4A6YL 3KLHC 2CIIA 5HYJE 2AJZB 2X4PA 2CKBL 4KK6D 5T3XL 1A7RL 1TQCC 2OMNA 5JQ6H 4I0PB 4Z7WB 2NNAB 3G04B 3DXAE 4L4JA 1U2HA 2HH0H 3O3BB 4PRNA 2DLFL 4LSPL 1CGXA 3NA9H 2DQDH 1CDJA 3QQ9C 5KVGL 4QRRB 5DFVD 1DVFC 4MS8C 1LEKA 3ULSB 3I75A 3C5JA 2HMIC 1KELH 2EE6A 3HPJA 4JO1H 1W0VB 4XAKD 3KPNA 5EUOB 4NQDB 3U9PH 3GSVB 2EKSB 4F33B 1JN6A 1N2RA 4XBEL 1A1NB 3KDMB 5SWSA 3P0YH 3QAZC 3JV4B 3WLWD 1XF2A 1AGCB 5E94A 5JUEL 1RUMH 2I9TA 2HKFH 1EUUA 2OTWA 4HH8A 3TPKA 2W59A 3JWNC 5E2WL 1HYSD 4W4OC 2C9AA 2Z8RA 4OZIB 5JQ6L 4I2XE 5TQ2H 4NQEA 4P2QB 1EHLH 4PJ9A 5I75C 1BVLA 3NA9L 2UWEB 2DQDL 1MHPH 5SX5H 4JRYE 5TFSH 3WL9B 2CK0H 1I1AC 3QULB 4HXAH 4OUOA 1KB5H 4YHIA 1KELL 5F7DA 1KUMA 4GG8B 1MLBB 4JO1L 3SKNB 1FAIL 3BIBX 2CRZA 4M3JA 4GXUN 3U9PL 1ZHNB 2B1AH 1LP9A 3UPAA 4MX7A 5T1DH 1BIIA 3P0YL 5T1LA 3TBSA 1EMTL 1TVHB 1RUML 4NUJB 4PYHA 4X8JA 2HKFL 4LLYA 5MHSD 4XNZC 1IKNC 4HFWB 3GK8H 5I1CL 2PYED 2K1MA 3UDWC 2A6JA 4MSWA 1M4KA 1EA9C 2H45A 2B4CC 3M45A 3VFOB 3WN5A 3WUWG 3GB7A 3QRGL 5DUML 1QSFB 4JHZA 1EHLL 2VKWA 2AABH 5DHVA 4E42A 2A6DA 5TFSL 5E5MA 2CK0L 1BAFH 4Y19A 2DKMA 2DQJH 4HXAL 2IADB 1KB5L 2FYYA 3KPTA 5K9QG 5D9SB 5KAQF 4PJAB 2X4QB 4NRXB 3C9NB 2DWDB 2B1AL 4KV5E 3IXTB 4QGYA 1T83A 4N0UA 4LU5H 5T1DL 1QR1A 4MD4B 1X5ZA 2JJSA 3CXDH 3GK8L 2NLJA 1E4WH 3OR7B 2VZTA 3BPCB 2GYSA 1SY6L 5DJ0B 5HGBB 5I71B 1A9EA 4X98A 1QACA 4XP5H 1LE5B 2AABL 1SEBA 4IRSB 2NY4C 4JGJA 4PJFA 3VI3F 4WI8A 1BAFL 2DQJL 2EZ0C 3RKPA 3QI9A 5FEBA 4ZFFB 3RDTA 4PJDA 3FCTA 3G6AB 4TUJB 3V5DB 3BDYL 1F3DH 3BAEH 2ID5A 4R90L 1HINH 4JLRB 4U6XA 1JYNA 1AI1H 5HHXH 1B0GB 4JR9L 1OQXA 1S8DA 4ZO9A 4AT6B 2EDTA 3CXDL 5FA4A 4BYHA 4XH2A 1CG9B 1G7PB 1DFBH 1OLLA 1S7VA 3ROLB 1C7TA 2J8UE 4Y5YB 2BXZA 3ZDYF 1EHAA 1AC0A 1F97A 2AXGA 4XP5L 3HZVA 4HC1H 4N5ED 2NY3D 4HUMB 2AJ3B 2W91A 2H32B 2B4CH 4ESKA 3HN3A 3MRIB 3LS5H 2VQUA 3KYNA 1HSBA 4PJIB 4HJJH 4R7DA 1Y6NR 4C83A 5ISZD 4QHLA 3QEQA 5DTFA 3MRDA 1UB5B 4WJ5B 1I8LC 3VE0A 3BZ4B 3LN5B 5L88H 3BP6A 1AI1L 2YA2A 5GZOD 1VADA 5IHZA 4XPAH 1FVDB 4RMQA 3QUML 3DHMA 3V9FA 1BGXH 1VEPA 3WS3B 3LCYA 4PP2A 3GSOB 4LNVA 1NGXB 3FFCD 4PV8A 1BOYA 3GDBA 5C70A 4H25A 2L0DA 1S5IH 4QTHB 3GMOB 2FL5A 3G6JF 3GNMH 4L4TA 4MDIA 1G0YR 1FVEA 4NC2B 1KTKE 3LKSA 1MJJB 3MOBH 2B4CL 4XNMB 3KPRA 1ZS8B 2NPLX 4AH2B 3LS5L 3LSOA 3VA2C 1AO7E 3HAEB 4MAYC 5F1NA 5HGAB 4LCWE 3RI5K 5I2IA 4KVCH 1E6OL 5J06A 3MNVB 5L88L 4ORGA 5ETUB 1FYTD 4JHBA 4P4RB 1MCSA 4KMTH 4U1SB 4QNPE 4CRPA 5M95B 3F7RA 5K9OA 5T1KD 5IEHB 5BZWB 1UYWH 2BP3A 1TTFA 4NM8H 2NCMA 4Z7VE 4Q9CA 1KIPB 3UZEA 5TJWK 1GGIL 4K94L 4Z7UB 1S5IL 1F4AA 2WBJC 2IALA 1XF3B 3FO2A 2ZSWB 1IL1A 2AJUH 4LIQE 2ZWLT 2R15A 1YDPB 3MOBL 1MLCB 5E4IA 3NCBB 3EOTH 3EYQC 2DDQH 1D6EB 4PJCB 12E8H 3S34L 4KVNH 1C8PA 1UM6H 4KVCL 3TBWB 1VESA 2ZNWA 3BN9C 5HHMD 4WCYL 1CU4H 3WIFB 1VGKB 5KW9H 2DLGA 2OSLB 2NX5D 3BP5A 2VLKD 1T04A 1KXTB 3MRCA 4W4NA 4KMTL 4PYGA 3MGOA 4IOFC 3U79A 4OQTA 4UMGA 4IJ3B 3T0WA 1QEWB 4NM8L 1EO5A 2XWBB 4M62H 4P2RA 4PJGB 1S7WB 1QD0A 5DDHB 3NABL 4RQQB 1JF5A 3VRJA 4X4YA 1WFOA 1PY4A 2AJUL 4B0MM 5E00B 2Q8AL 1YYLH 5SV3A 2JLLA 2VXUL 5HTSA 2VITB 3BW9A 2BSTB 1G6RH 3NPSB 12E8L 1NBQA 4KVNL 4PGEB 5D1XC 5CZVL 1U8PA 3UBXB 2PYEB 3GMPB 3IJHA 1CU4L 5MERA 4YE4H 1KPVB 1M7DA 5F1IB 4WI3A 4DN3H 4OZGB 4G9FE 4YDLC 2VLRD 2M2DA 5KANG 2NY5C 5IVOA 2CLRB 3RPKA 5DGQA 4DEPB 3HB3C 3V6BR 1XF5B 5C2BH 1TLKA 4M62L 4ZTPL 1CVSC 5IMMA 2UYLA 1ORQB 4ALAH 1P4LB 5CIPA 5ILTH 3DO7B 3VW3H 4S1RH 5B3JE 4OFYD 4JFDA 1NDMB 1SJEB 3QIWA 1YYLL 2CDGB 5BQ7B 5D5MA 3VXRD 4XGZB 1DTUA 4U0RC 4RX4A 3BESR 2AKRA 3D25B 4UU9A 5H94B 3CZFA 1BZ9A 5I17B 2V2WA 3IJSA 3P9LB 3X14A 5GGRY 3HI1A 1R3JA 4YE4L 1YJDC 3QEGH 3U36A 3MLVH 4DN3L 2P7TA 1EV2E 2FX7L 2VDQH 4UUJB 4U3HA 3MLRH 3R8QA 3O3DB 1UJ3B 4PGZA 3N1MC 4R97B 3WHE1 4ZXBC 3O9WC 4OSUL 4M6NH 4Y88A 3IAQA 2A1WH 4PG2A 4ALAL 4ZYKA 3MBEC 4G8EA 2FR4B 1OW0C 3VW3L 5IJKA 1VACA 4S1RL 4MJ4A 1XH3A 1QRKA 2FZ3A 2CRYA 4LHUG 2XN9A 3GIVB 4L8SC 3ZKMC 1HXYB 2ZOKB 3BMVA 1YMME 2Z4QA 1AR2A 3UAJC 2GT9A 3HR5A 5D6CB 5IB5B 3QEGL 3TJEH 3PL6A 4TNVK 1GJIA 2VDQL 3TWCH 2C3HA 2NY3B 5C0AD 3MLRL 1B3JA 2CDFB 3VXNB 1JWSA 5CJQH 3PG2A 4K3JL 3H7BA 4M6NL 5DEGB 1MHCA 2A1WL 5ISZB 2NY5H 4Y4KC 4RGMC 5J57B 3OQ3B 3O2DA 4L8CB 2GKIA 4U6YB 1GIGH 4FG6D 5ACZB 5AZ2H 3PHSA 1KPUA 1IAIH 3MQIA 1II4E 2VSDA 5SWQB 1RMFH 1TVBB 2D7QA 4Y16C 4GH7B 4OAWB 4PRIE 1KJ2L 5I1IH 4U7SA 1P84K 4U1GC 1UA6H 5IF0B 4P49A 2DI8A 1OTSD 3RQ3A 5CP7B 3WE6A 2G5BB 2J8OA 4NYLA 3TJEL 3GHBH 4RMUA 1A2YA 2KQMA 4XP9H 3REVA 3TWCL 5AD0B 3UTZA 3L1OL 1RJYB 2Z93A 5DUBA 3U2SA 4JDVA 2OCFD 4PJBF 4OM1H 3FO9B 2QJDA 1C5CH 3QO0A 4AIZB 3TN0C 5B8CC 3L7EB 1U3JA 5BJTA 2OL3B 3VGHA 4EI5C 5KSAD 1FYTB 1IAIL 1YEJH 1AHWB 3VGBA 5T1KB 1WBYB 2VLMD 3F12A 5I1IL 3TJHC 1Z2KA 3LKNA 1FGVH 4NCC1 5GGSA 5IM7A 3LIZH 5T3XD 4Y4HA 4V2CB 4JG0H 1KG0A 4X4ZA 3GHBL 3PWPA 3ZTJH 1CT8A 1AGEA 4XP9L 3RY5A 1DQMH 1CFSA 1T7VA 5J12B 1IQDA 1KXQE 3FRPG 5DRZB 3X11B 5I1JL 4OM1L 4K71B 5HSFA 1JL8A 1HSAB 4IDJH 3JTSA 1Q9OB 5IBUG 1KIQA 2W9EL 5HHMB 5GSVA 5I1AB 1BD2A 3RIAK 3RWDA 2VLKB 1E4XH 4HIXH 4WWKA 3RGVA 1NC2A 1NMBH 5C0EA 4JY6A 3DV6A 4AM0A 3QG7H 3IFPA 3BZEB 2ITCB 2BZDA 1FGVL 1Y0LB 4IM8A 1WCQA 1EGJH 3LIZL 1CGWA 1B0RB 3A6BH 2MKWA 5F8RC 1MI5D 5EUKA 4LCIH 4JZJB 1RZGA 3HMXH 4YNYB 5HHOA 2PW2A 3V7AE 4K3EH 5GHWH 1OSZB 1D9KA 1YC7A 1MREH 4IDJL 5IIEB 1G7LB 4XAWH 1JF1B 4ODSH 5DWUL 4OV5B 1MCWW 4OTXH 2B39A 5HGDA 4GKOA 4P5TC 3E8UH 3BJLA 1UXWA 3BIKB 4ZAKA 4HIXL 5EO1B 4D0DA 2VLRB 3O3AB 1OAQH 1D5MB 2EDXA 4HMCA 3H9HB 5E6IA 3QG7L 5E1AB 6FABH 4RMVA 1XGRB 2LFGA 4LASH 4Y5VB 3WHXB 1U8MB 1JZ3A 1FO0H 2ERJC 4J23A 5AWNH 3Q6FB 4EI6B 4LCIL 1DBBH 4LFHD 4M6MH 4ZOCA 1PKQE 5IHUH 1GOFA 4Z0BL 4JQVA 4MD5B 2EYRA 1AD9A 2LU7A 3VXRB 5DJ2A 1SYSB 1MREL 3V5HA 3LD8B 5GXBB 4HIJA 3GBMH 4MDJA 4F3FA 3ULUE 4ODSL 1NAMA 4LQFH 4OTXL 3QUZA 2I27N 2RGSA 1ROWA 1K8IB 3E8UL 4FTVA 1SVZA 5GRXG 5CSZA 1OAQL 2Q8BH 2DM7A 1HI6B 2OLDA 1DZBA 1HEZA 2RQ8A 2VIRA 4X4MA 5DMKA 6FABL 2AS5M 4XVUD 3VWKC 5FAAA 4LASL 4TSCL 5BZDB 1X6LA 3QO1A 4NN6C 2NY0D 4UV4H 3QDMD 3KVQA 5AWNL 3DX6B 5TGBB 4FQQB 3AS0A 5IHUL 4Z0XA 3BXNB 4HPOH 1FL5B 5MEND 2NMSA 4W70A 4RCAA 3GBML 3V0VB 5SWSE 4JZNA 4LQFL 1AR1C 4EDXA 4MS8D 1FFNA 4NDMB 1NCDL 4MJID 4JY5L 1CVRA 3DECA 5DRXB 3BT2H 3PWNA 3WYRA 4B5EA 5AYUH 3TNNA 2Q8BL 5C0AB 5F1KC 3KLAA 4NQEE 1NBYB 4ZS7H 5HHPB 1AXIB 3DMMA 5C86A 4BSVA 1ZEAH 2KKQA 2OS7A 3U9UB 4LGSB 4N8VG 4DZ8B 1AIFB 1CDBA 1KXVC 4HPOL 2HP4A 3ULUC 1LP9E 1MFDL 2W60B 2BRRL 4LHQB 3C08H 4JFFB 4ZOBA 5C9JA 1J0IA 2GIYA 5T3ZH 1ZK9A 1P84J 1T0MA 1JBJA 4TOYL 3ILPB 4JM4H 4R7NB 4U6VH 5JLZB 1R0AH 5D7LD 2PO6D 4ZS7L 1NAKH 1ZEAL 1KC5L 5C1MB 4WFGE 5EU5A 4APQB 4WENB 1ZT7B 4U1LA 3FQNA 3VDCA 4Y19E 4O58H 3U0WH 3L5XH 2LTQC 1JPFB 5KSAB 1WIOA 4YHZL 4HAGA 1PG7H 3QQ3A 4KDWA 1PEZA 4N0UE 1VHPA 2DRUA 4A6YB 5KSVA 3C08L 4O2FA 1A7PH 1KNOA 5JOFA 4J2XA 3WUZA 4Y7MA 3O4LD 2CKBB 4PREA 3RNKB 5T3ZL 1MHHB 4WHTB 4F7EA 1JNLH 4LVHC 3HC0A 4ZFZA 4HK3J 1U95B 2ARJQ 5IBLC 4FQXC 4U6VL 1R0AL 3B9DA 4XPHH 1YNTB 2D31B 1NAKL 3BPOB 4B50A 4HZLB 4MXVF 2GI7A 5A16A 2W92A 4PJFE 1S7RB 1A6ZB 5C08D 5GGUB 3L5XL 3RUGF 3ABZA 5KS9F 2E9WA 2YPVH 3BO8B 1LNUA 2X70A 4HHAA 4PJDE 1F6LL 2YK1H 5GGTL 1JZ2A 4QHUA 3ARGA 2O5YH 4TPRH 3VMOA 5IFAH 1BWWA 4N5UA 2X4OB 4X7SL 1A7PL 3QISA 1S7SB 3N06B 3W9EB 1RK0B 3BVNA 3FQTB 5DQJB 3QFJD 1AY1H 5DJAB 3VMNA 4JFQA 5ANMB 1MI5B 5I30H 1JNLL 3WKML 3TBVB 1N59B 3GJEA 4JPWH 5T33H 1IEAA 3FTGA 3L7FA 1J88A 1MRFH 2QTEA 1U8OB 4JE4B 5DLMH 4JVPA 4MQXD 2CLZA 4K7FA 2IQAA 4U6HB 5EIQA 5ICXB 3EJYD 1NUFA 4D2NA 2BNRD 2H3NB 3EUUA 1QR4A 3EO1B 2YPVL 5C0IB 2YK1L 3MRLB 2Q20A 3QEQE 4X9GA 3GMNA 4H5SA 4QRUB 4TPRL 4K23H 43C9A 5IFAL 4X9HA 2JJSC 3UX9B 2GK0B 3F8UB 2EE2A 3OGCA 4PGBA 1AY1L 1BLNA 4U1JA 5EH1A 1LD9A 3D5OF 1FP5A 4PJBA 5I30L 4PG9A 1TETH 3UJJH 5DVKA 1KTLA 3QDAA 4XC1H 1MRFL 4AEEA 2HFEB 1YN6B 2G9HA 4XMPH 5DLML 4L4TE 3VRLF 1KB5B 5MEPB 3QI9C 3SEPA 3MZGB 4KRPD 1NCBH 3KPRE 1Z5LA 3O45B 3RDTC 4PRBB 5L6YH 3O8XD 4JJHA 2LE9A 3MRNB 2L7JA 5D1QB 1T1YA 5DI8B 4PRAB 2EDFA 3V0AC 4RBPK 5EZJA 4NUGH 3T0BA 2AK4B 1IAOA 5FDYA 3DGCR 3VJ6A 2WWMD 1BQLH 2H1PH 4DCQA 2OJEA 4BQBA 2NY0B 4ERSH 3QDMB 1YYMH 4EQ3A 5I8OH 5JMRA 1G7IA 4NQUA 2BNQD 1HDMB 1QLEH 4XC1L 4ZFOA 4Z7WF 2XXMB 5E08L 1ZVYA 4Z76B 5CEZE 2APWA 3STLB 5MENB 3HCVA 4GRWE 1NCBL 3IDGB 3QWRA 5DJXA 1DVFB 2PYFB 5E99H 3DETC 3IKKA 5DZOA 5EUOF 4GLRH 3S98A 1EEYA 1OB1B 1ORSB 4PJ5D 4HAFA 4XCYA 2FIKA 5EU3B 2DQCL 1X4XA 4XCFL 1BQLL 5FCSH 3RFZC 1MIEL 3BMWA 1YYML 4UQ3B 4DGVL 3BN3B 3UPRB 5A43C 5I8OL 2NY6D 1ITBB 2DYPD 4P2RE 3C8DA 3QNXB 4OZIF 4D8PB 4UOW1 1QLEL 1ZLUH 5MEQA 3BH9A 4BH7B 3WFHA 1FAKT 1X5AA 5IFHH 3MX0A 2UWEF 5CZKA 2G75A 1KYOJ 1Y6KR 1IJ9A 2HVKA 2SEBA 2HG5A 1P7KB 3BDBA 5EDXA 1I1AB 3HZMB 1OAKH 5E99L 3RNQB 4F58H 3UTSD 5DVOA 2JELH 4F37K 3WD5H 4Q6IA 3QUMB 5D7LB 3L5WB 4OD1L 2PO6B 3P0VL 4FQCH 1NSNL 1FNAA 3HE7A 3FZUD 5M7QA 3WCYA 1GHFH 1R3IL 4EIGB 3S37H 4FXLA 4PLJC 1UT9A 2GSGA 3MUZ1 3LKPA 3IXAA 7FABH 1LEIB 4I5BB 1RZFH 2YA0A 4JFDE 5HXMA 5IFHL 1DQTA 5D5ME 5DJYA 1MCJA 1JHLH 4OB5H 2DLTA 3HB3D 4WI7A 3O4LB 1M71A 3CU7A 3M07A 1OAKL 3PQYA 1HOCA 5ELIA 4M48H 4PJAF 2FSEB 1MAKA 1S7TA 3BPNB 4M61A 2JELL 5IMKA 5IVZA 4LF3B 4P9MH 1P6AB 2YBRA 2C1OA 1MFCH 2KH2B 3S37L 4LOUC 3VFUA 5C08B 3MV8D 4FRWA 1QNZH 5GRYA 4YWGH 1XR8B 2MCPH 4ONFH 2Y6SD 1F02I 4OD2A 3T77A 1XFPA 3X13A 4DKEL 3KNBB 4JM2D 1CD0A 5DGRA 4Z7NF 2O93L 3QDJA 4JKLA 1JTPA 4JJ5A 2XN9E 2YD8A 1A22B 1JHLL 2E7MA 3R06A 4OB5L 3QFJB 3QH3A 1S7UB 3ZYIA 5HPMA 3KPPB 4M48L 3DX7A 4XT1C 1A6VH 4Z7QF 1IQWH 1BMGA 4L4VA 3ES6A 4LSTL 1IKFH 4ZSOB 1CLOH 4KROD 1CE6B 4TN9A 4EEEA 3IFOB 1DQLH 4OLYH 5I1LA 3HS0B 3PP4H 1QLFA 2Y07H 4P9ML 1MFCL 2FH6A 1HHHB 3ZKMD 1D5BB 5LAXA 3ARFD 3AB0C 3PJSB 4YHNB 3OX8A 3RVXC 1QNZL 3QIWC 4BQ9A 4ONFL 4WHYG 5F6HJ 3F7QA 1YEGL 4HF5H 5HDBF 1UH4A 2VLLA 4HK0B 2YD3A 5CEZH 5K59F 3FONA 4NRZB 3OXRA 5CZXD 4C59B 2N4IA 2XZQH 4PJIF 1JTOA 3DSFH 2MNUA 1JPGA 3DVGB 1S9XB 1IGFH 4XBGB 1IQWL 4E0RA 2AJYH 3CFJA 3SO3C 3H3BC 3T0DA 1IKFL 5ICZA 2XG4A 1CLOL 4EUPH 1E6JL 3IGAB 3NIGF 1YEDB 2Y07L 2BC4A 1UWGH 1KJVB 3S3SA 1P2CB 1EBPA 5HHVH 4ZPVA 4L3AA 4KRPB 2GJZA 1U3YA 4S1SL 3E2HB 1JIBA 4MA7H 5FUZH 1JRHL 3NIFF 2V5YA 5IJKC 4OF5A 3SKMA 4HWBA 4OFKA 4M7KH 4MA3A 4HF5L 3VFVA 5EFIA 3VXUA 5D7KD 2H9GA 3DSFL 3IVKB 1MFAH 4RISH 4FFZL 4MAYB 3H9SA 1P4IH 2AJYL 4M6OH 1EX0A 3PL6C 3PGCA 2BNQB 3Q2CA 4KUZL 3QNYB 1MUJB 4U1NA 4HLZH 3PABB 2KZ1B 3PWPE 1IAMA 5KS9A 1CFVH 1UWGL 2YZ1A 2BOBB 5K33A 2BNUA 2DQGH 4JN1L 4OZFH 2EDWA 5ALCH 5HHVL 1W2KT 1C16A 4CN1A 4GRLA 4G3YH 5FUOH 5FUZL 4M7KL 4OCRH 3IJYA 1U8HA 2EDKA 1BD2E 3TCLB 3WJJA 4PJ5B 1RZIB 5ESQB 4OUUA 3BKJH 1I7UB 1YECL 3MRJB 4CADA 4PPTA 4G8GD 1NCCH 3UYRH 2NTFA 1WBZB 4LAQH 5ESVB 3RTQA 1EFXA 1MFAL 2HJKB 3TPUA 4EBQL 1NLDH 3DRTB 3I02A 1ETZB 4HK3N 1P4IL 4M93B 3TIEB 1JNHA 2XWJA 2DYPB 3T0EA 2P8LA 2A6IA 3FFDB 3RZCD 4H1LG 2BY3A 4OFIA 4DVBB 5HHOE 2VXSL 3B8YA 4O4YL 4KRLB 3VG9C 4AY0A 2DQFA 5D2LA 3T4AA 3LV3A 3QJFA 4PJGF 5FUOL 5J11C 4NZDA 4FZEH 5CGMA 1OT1A 2ZJSH 4UILH 4IOIA 2FO1A 3MO1A 1CWVA 3G5XB 4I3RH 1NJ9A 2JF1A 3UTSB 3NZHH 4UIMB 2BRQA 4Z95H 3BKJL 4LNRA 3FO0H 1KJ2B 2OQJA 4LVNC 1NCCL 3QPQD 3UYRL 4GRMA 4LAJH 1F4WH 1RD6A 2QSTA 3LEYH 4Y4HC 5CWSA 5BOZG 2CIKA 3OXSB 3SE4C 3SJVA 4O5LH 5DO2D 4KHXL 5E2TL 1TQBB 3L3IA 4FQHA 3PE9A 4OZGF 5HI5C 1MCRA 3VXOB 1G7JB 2HTLC 3MLXH 4I9WD 8CGTA 4GKZB 3MJ6A 4HUXB 3VCLA 4YDLB 3SKOA 5I1EH 1GZQB 4PJXB 3HZYA 2XQBL 4DTGH 5I8CB 3EAKA 1TZHA 3FQXB 5J9PA 4JRWA 2V5SA 1ZGLP 2B5IB 2ZJSL 2GJ6D 4CKVX 4HKXB 4PGCA 4UDTA 5AG8A 2DQEL 4I3RL 3ZDZF 5HDQL 3RGVC 4Z95L 2AJZA 3QFDB 3FO0L 4FTVE 4EQ2A 2VO5A 3O2DH 3L3KB 3QUYC 3HHRB 4I0PA 1F4WL 4Z7WA 3AU1B 3G04A 3ME0A 3DX9B 3LEYL 3SGKA 5T3ZD 3O3BA 4X4ME 3EO9L 5DD1H 2BY2A 3C6SB 3PDDA 3MV8B 4QRRA 3LEXB 3HG1D 2J6EH 5DC9B 4LVEA 1N3NB 4YDVB 2Z8SA 2FHFA 3MLXL 4YC2C 5JHLH 5J6GB 4NOFA 4NQDA 1YNLL 1D9KC 1MF2H 3MV9D 4JM2B 1N6UA 2V2XA 2OBGA 3GSVA 4F33A 5I1EL 1A1NA 4Q9QH 3KDMA 2I5YL 2FHCA 3JV4A 1AGCA 3FB5B 3ZTNH 3DVNB 3IU3B 2N7BA 5CCKH 5DK3A 3D0VB 1WJ3A 4P2QA 1J05B 3LB6C 3VFTB 3MJ9A 1SMOA 1KCUH 2UWEA 2R2HA 4R4ND 3SE8H 3QULA 3ARFB 2AEPL 2J6EL 1AR1D 5L9DH 3SGJA 4JQVC 4GG8A 1MLBA 3SKNA 3CSYA 4K8RC 1MF2L 1ZHNA 1J1OH 4G5ZL 3NZ8B 3UROR 4P23A 1WICA 5IMLA 4NN7C 4Q9QL 1DBAH 3IS1X 5IB3B 3WLBB 1DBJL 1TVHA 4NUJA 3ZTNL 2R9HC 4LRNL 4RBPH 2WM0A 5I74C 2V5RA 5HYIA 5CCKL 2MFNA 1RUPH 3MFFB 4HFUH 5FYLE 2JTDA 5L8KB 3LQAL 2XZAH 3VFOA 1QSFA 5T5NF 1FRGL 4OJFH 1HN1A 1DN0B 1KCUL 4F9PC 3FB8A 3U7AA 4JO3L 3ORJA 1VFBB 3IDUA 2IADA 4N1HB 2WLYA 4R6UA 3PWJB 5FFLA 1MVUB 1IT9L 5D9SA 2ICWI 2X4QA 4LLWB 4NRXA 5I8KH 2A0LC 2DWDA 3C9NA 3J7HA 2Z35B 5I76B 1I3UA 3IXTA 5I19L 1SHMA 2DD8H 1GPOH 3CDFA 4MD4A 2JCCB 4I1NB 5GGRB 1NBVH 4PRPD 5IP4A 3P30L 2ARJB 2DJSA 4AEFA 1MCWM 3BPCA 5DJ0A 5HGBA 1X5HA 4HFUL 5L0QC 1A0QH 1QKZL 3SKJL 3KPOA 4OJFL 1XGPB 3RRQA 1LE5A 3RY6A 4DAGH 4ZFGH 3HRZB 1OTUD 2HLFD 1BREA 5C9KA 2IH1B 3LKRB 4HGWB 3G6AA 4HT1H 4C57C 1A21A 4TUJA 3V5DA 2WW8A 3WFBH 3MODH 1EDQA 3OAZK 4FQXD 1GPOL 4G8GB 4JLRA 1LO5B 1J0HA 5DEFA 2AEWA 2DICA 1MCHA 4K8RH 4M9OA 1OP9A 4G7YH 3QHTC 1X9QA 3DUSB 2GITB 1A6UH 4PTTB 3RZCB 1G7PA 5AG9A 3N9GL 4MB4A 3ROLA 4Y5YA 3RKDD 4HXBH 4PY8I 3A6OA 3LEVH 4OLUH 5K9JH 4DAGL 3HNTH 3K2UH 2X10A 1H8OA 2H32A 3VA6A 5EIIA 3MRIA 5JW5B 1FZJA 4XPFH 4PJIA 3GM0A 1G9MC 2XKNB 2QADD 2IH3B 1UB5A 1QFWM 3BKMH 3WFBL 4WJ5A 4UNUA 2A74B 5DD6B 3BZ4A 3LN5A 4P3DB 2JB5L 1D5XB 5D7SH 1DBKH 2VL5B 4RSVA 1FVDA 2BK8A 3WIHA 3G5YB 4G7YL 2DQHH 3WS3A 3ZT7A 5F9DC 3GSOA 1F5WA 5GS0C 1RIHL 1NGXA 4TNWK 1NMCC 1T0NB 4PJBE 4P5TB 3B6SB 4JPVH 4P3WA 1LILA 2PR4H 3UEZA 4QTHA 3GMOA 1F6AB 4OFVA 5IVNA 1MCQA 5BS0D 5K9JL 3K2UL 1PEWA 2NZIA 3EHBD 4XNMA 5E9DA 1A1OB 1ZS8A 4AH2A 1ZHLB 3HAEA 2GJ6B 2ERJB 3IDYC 5HGAA 1KBGH 5A3ID 3THML 3LRSB 3ARGC 2VUOA 3TNMB 3MNVA 2H26B 4QHMB 4P2CG 5FUCC 5ETUA 5D7SL 1DBKL 4P4RA 3TVMD 1LHZA 2DQTH 4U1SA 4MD0B 4F9LA 2MQCA 5IEHA 3D3VD 1X3DA 5BZWA 2EDYA 3P11H 2DQHL 1UEMA 4NQXB 3HG1B 4JFEA 1UVQB 1V5JA 1KIPA 2ATPB 2PR4L 4Z7UA 4MMXC 1I3GH 4G7VH 3MV9B 3MLSL 2ZSWA 5E8NB 4PR5B 2JE8A 4XP1H 4P4KD 4U1HB 4R4BB 2X41A 1YDPA 1VFOA 1MLCA 3V0WH 5F3HA 1D6EA 4L8DB 4PJCA 1CXEA 5DRWB 1Q9LA 1KBGL 4MA1B 3TBWA 3CGTA 5HD8D 4GQ9H 4C4KO 4XI5C 2IPUG 3WIFA 1VGKA 2F53D 1OPGH 3VFPA 1FG9C 5F9AC 2OSLA 4PRHB 2K9UA 2FBOJ 2DQTL 1KJMB 1T1XB 1TITA 2NW2A 3TGXA 1N5AB 1QEWA 3P11L 1T6VN 3U6RB 3JUYA 2XWBA 1EEQA 3L6FB 4PJGA 1S7WA 4FMFA 2XTLA 4RQQA 1I3GL 2AERT 3DI2B 5EOCJ 3WFCH 5GS0H 5E00A 1R5VB 3U7YH 1NBZB 1X5XA 3RVUD 3V0WL 1CLYL 3D6GA 2BSTA 2MQ3A 5E8OB 3TV3H 4PGEA 2HTKC 4TUKH 1X5YA 4NO2B 2LAAA 3UBXA 2YD7A 3GMPA 4DKDC 2GEEA 1S9YB 3H2WA 1I1RA 2EC9U 4OF8A 4NNXB 5F1IA 5IK3B 2BVPB 3IYLW 3QNZB 2J5LC 1NQBA 4RMRA 3ZKND 4Y0GA 2FX8L 4DN4H 4LSVH 1U2CA 3ZYJA 5E6ZA 1XF5A 2W0PA 4HULB 5JXAH 1XAUA 1ORQA 1H9VA 4U0QB 5GRUL 3ZZ1A 2EXYC 1P4LA 3DO7A 3WFCL 3G5VB 4F57H 1NDMA 3B8SA 2VZOA 2CDGA 5BQ7A 4CJ1A 4XGZA 2ZUQB 2X89D 2VAJA 4PRPB 3D25A 5H94A 3RWCB 1FBIH 1JHTB 1NGZA 1AKJB 4TUKL 5CJOH 3PHOB 4U7KA 5I17A 3PQYE 4CAGA 4H88H 1VEMA 3AM8A 1RZKH 2FBJH 4UUJA 3O3DA 1UJ3A 4LSVL 4XNYL 2IPTH 2XRAH 4WDIB 5FCUH 1MY7A 3RBSA 4PJEA 3ZT6A 2MMXA 4F57L 5L2JB 4FQXB 4R0LB 5H2BB 3GIVA 3QDJE 5IMOA 1FBIL 1HXYA 1Q94B 4PB9H 5E24E 4ONOA 2P8MB 4HIHB 4JFPA 4MJ6B 5D6CA 1WGOA 3V7AG 4QXGH 5LWYH 3VXQB 4L4VE 2GQHA 3D1MC 4N8VB 2X9YA 1RZKL 1FZOB 2FBJL 4MCZB 2X4RB 4OGAD 3RWHB 2IPTL 1GGCH 1YQ2A 5DEGA 2AK1L 4DOHE 5FCUL 4LHJB 5ISZA 1INQB 4UIKL 2QADB 5FYKE 4WFED 4Z18A 4PLKC 4U6YA 2CO7B 1CD1B 5ACZA 1XIWD 1FC2D 4P2OD 4S1QH 4XZUB 1JJUA 1TVBA 4PB9L 4OAWA 3CVHH 4YXKH 5IF0A 1QSED 3MLPA 4NC0B 2DI7A 4QXGL 3RVXD 5LWYL 3E6HB 2G5BA 1CDHA 4GO6B 5BS0B 3OKMB 2O5XH 5A2KH 3A67H 1RJYA 3D39D 1BJ1J 1F8TH 2EYTB 1GGCL 3LH2L 3FO9A 3VI4E 5TE7H 2ILLA 5F9WB 4AIZA 4L3ED 2R4SH 3U4BL 3L7EA 2AJXH 5F7MC 1O7VA 2A77L 2ESVD 4N90E 2CLVB 1FYTA 3TVMB 4KKLD 3U82B 3ARQA 4I3SH 4MAUH 4R2GC 4S1QL 3VXUE 3D3VB 1WBYA 3CVHL 5JW4M 4JDZB 4YXKL 2EDHA 5BVPH 1I1CA 1KN2H 3H9SE 3JV6B 5ITFB 2I60H 3RX5A 5CEYB 3S9DB 4M7JH 1XCQB 2XTJD 4P4KB 5KS9E 1DQJB 3ROOB 4PRDB 3UP1A 4NO5B 1FDLL 5DRZA 1K6QH 3WXVL 3X11A 1OWRM 5HY9B 4AMKH 4UTBL 1Q9OA 2BVQA 2AJXL 2VH5L 1ED3B 5I1AA 4LSQL 1I4FA 2J88L 2F53B 3WFEL 2VLKA 4H8WL 4U4BA 3ARTA 5EO9A 1RVFH 1IGML 2Z31D 5JXED 2X5PA 2ITCA 4POZD 1P9MC 2ZCKH 3DUUB 3MCLH 1RIVH 3ZT5A 1KN2L 2VR9A 3W0WB 3T0EE 1NMAH 4YGVA 2I60L 4LPTA 4NCDA 1QOKA 4J3UA 4JZJA 4M7JL 4MZ2A 1D5ZB 4TRPH 4YNYA 1BX2A 5K93A 4R8WL 3BSZL 4F8QA 1LO4H 1DLHB 4EZMA 4GAGH 1K6QL 3RWFB 2J12B 4BH8B 5D2LE 5IESH 1QRND 2I9LB 3D9AL 4AMKL 5IIEA 1G7LA 4IMKA 3U4AA 1JF1A 2WINB 4OV5A 5IHLB 5CILH 1IGTB 1A9BA 3BIKA 5EO1A 1P53A 4FA8A 4HS8H 1JNJA 4XTRC 1RVFL 5L8JB 1D5MA 2CSPA 4NPYB 3H9HA 4EXPX 5IR1B 5E1AA 1Z9MA 4KFZC 3EJZD 5EULV 2PETA 3DVFA 4UAOC 5JORB 1XGRA 2ZCKL 1OTTD 4Y5VA 3WHXA 3EJJX 3VRLE 3V4UH 5ALBL 2YS4A 3OKKA 2P24B 3SJVE 1UM5H 1NMAL 3Q6FA 4EI6A 4IEFB 5HYJD 1MCFA 4OFYA 4TRPL 4BUGA 5FECB 5E70A 4MD5A 1LO4L 1UWXH 3VXRA 4GAGL 3DXAD 1S78C 1ONQA 5IESL 2BCKB 5I1DB 2HN7B 3CIQA 2Q87A 3SDCD 3HE6C 4KKCC 1K8IA 4QRSB 2HTLD 4ZD3H 1WWWX 3AFLA 4HS8L 2N56A 1EEZA 2UZYB 3OHXB 4FQIH 3KPQB 4OF7A 4KY1L 4WI6A 3PWVB 1HI6A 4Z7WE 2JIXA 4BELD 4BFIB 4WHCA 2OJZH 4JQXA 4EUPB 3GSWB 4YAQA 1BFTA 3NCYS 5HVFB 1UM5L 5GS1C 4QRRE 3DX6A 5TGBA 2VXQH 4FQQA 1N0XH 1HIML 3RVTD 2KZWA 3NTCH 4U05A 1TXKA 4ZQKB 4NQDE 1FL5A 1BVKB 3ALXA 1NUDA 4JRYD 4TUOB 3V0VA 3L5JA 3CNKA 3ARED 3ALPA 4NDMA 3PXHA 4M1GH 4ZD3L 2NR6D 4RFEA 4X7TB 4FQIL 4IOSD 5C0AA 3VH8B 4LP4A 1ADQH 5D2NA 4P2QE 3OMZA 1NBYA 2OJZL 1H15B 5HHPA 1HHGA 2UWEE 3G5ZB 2OZ4H 1M7IB 1CFNB 3U9UA 2VXQL 3FB6B 1TPXB 1BJ1H 4Z77B 2XA8H 4DZ8A 3SDDD 3QUXD 1F13A 1XIWB 3AS1A 4JPIB 4P2OB 2J7LA 3CFKB 4JQIH 4Z7OF 4J6RH 4LKXB 2OXGA 4JFFA 3MXVH 4G8IB 1JWMB 1V8HA 3AB0B 1PD6A 4HJGA 4M1GL 1JYVA 2Y06H 4TSBH 1KLGB 4I0PC 4XMKH 3ILPA 4R7NA 5K9KB 5JLZA 1ADQL 5JPMB 1QSFE 1YQVH 3D39B 3GRWH 4P9HC 3C5SB 4MHHG 3VGAB 4APQA 2OZ4L 1A7OL 4RNRB 1ZT7A 4L3EB 5JHDD 2ESVB 1JPFA 1G7MB 4ZPTB 2BY0A 5J3HC 1RUQH 3T1WA 1OHQA 3MNZB 2V2TB 1WBXB 2JKXA 4G6AD 4JQIL 1U0QA 1NGWA 4KQ3H 3N1PC 4J6RL 3MXVL 4KJQC 3IDJB 3W2DH 3RNKA 2CKBA 5HYSB 3WNLA 3RY4A 5C0NC 3AC0A 1T2QH 2N7AA 5DMYA 4XMKL 4NWTH 1U95A 1RU9L 1JTTA 2XTJB 4ZS6C 3ZSSA 4YHPB 3FT4B 5CUSH 1YNTA 1NLBH 3GRWL 5KZCD 4HZLA 1IM9D 1MWAH 1U8IA 2HLAB 3T8XB 1DUYA 4Z7NE 1BFOB 5DMGD 1UGNA 5CS7A 1S7RA 1A6ZA 5GGUA 4XWOC 5AUMB 3BO8A 4UNTA 1KT2B 2R2BA 3RIFF 2PTTA 2DI9A 2W65B 3MA7A 4Z7QE 3T4YB 1RUQL 1DL7H 2OTPA 1T66C 2IG2H 2X4OA 4KQ3L 3WHE0 1S7SA 3QT2A 3W9EA 3FQTA 5DQJA 5C0RH 5DJAA 2YD9A 1MI5A 3CSBA 4PGDB 2E9IA 1EAPB 3TBVA 4JVUA 1N59A 1PY9A 3WS6C 4U49A 5D1ZD 4AENA 5FYKU 1OP3K 1I8IA 3MNWB 5CUSL 1U8OA 2CUHA 3VFMB 1BJMA 4KJPC 1MWAL 1QRNB 3CK0L 4LPXA 4U6HA 1JGEB 1M7XA 5ICXA 1OM3H 4GW5B 4XNQB 2VZVA 2H3NA 3PGFH 2GJJA 3Q6GH 4PJIE 3MRLA 4OZFG 5HGHB 1FHGA 2VISB 4QRUA 3HC3L 1TZGL 5HVWA 2IG2L 3LDBC 1N6VA 2GK0A 3ARDD 2A83A 3NIGE 5C0RL 4LDEB 4ZUWA 4LCWD 4NKIH 4XNXL 1JUFB 3VDAA 5I71C 4K2UL 5FYJE 1FNFA 4YQXH 5E8EB 4WFFD 3NIFE 3RY6C 1WZKA 4KZDH 4IRSC 4D0BB 1EO8H 1YN6A 1UQSB 3C8HA 3DXAB 3BGMB 4X6DB 4M43H 4WW2B 1KB5A 5MEPA 4UQ2A 2ZUTA 1OM3L 5E9DE 43CAB 3O45A 4JPKH 5I1KL 3MRNA 3SDCB 2LVEA 1VKXA 3PUCA 5IBTH 1CFTB 1GSMA 2CGRH 3I9GH 4NJAH 5D1QA 2DLIA 5DI8A 2Q3AA 4PRAA 3Q5OA 3HZKB 1AE6L 2FNBA 4PJXF 1KCRL 5JMOC 2AK4A 1ZT1A 2QQNH 3UTQA 5CINH 4NKIL 3QDMA 3QSKB 5LQBH 4Y5YC 4WVRA 2DQIL 4JFEE 3MLUH 1SBSH 4YQXL 3O6FD 1UCTA 3D85D 4PD4J 1DLFH 4Z7UE 3QUYB 2NYYC 1JZ7A 2G2RB 4Z76A 5MENA 4QY8B 2HT2C 1T1ZB 1KTDB 1BZ7A 3T2PA 4PJCE 3AREB 1DVFA 5TDNA 3M17A 5IBTL 3QXDB 1S7XB 2CGRL 4LLVB 4JM2F 4NJAL 1IC5H 4R96B 1OB1A 1X6NA 3QCVH 2B1HH 1ORSA 3PHQB 4D9RE 4NBYB 5EU3A 4D9QD 1VSCA 2QQNL 1JV5B 4UQ3A 3MLUL 1SBSL 4CL7A 3SHSA 4PJGE 1FG2B 4YXHH 3QNXA 1DLFL 1SBBA 4D8PA 4P59L 2QQQA 3JWOC 2IC2A 5BCAA 4NQCB 4BH7A 4G9FD 1EAJA 3DURB 3QIUD 2HJLB 2HT3C 3DTXB 1KEMH 4HEPG 1NPUA 1P7KA 5CD5D 1I1AA 1I7TB 2IQ9H 3HZMA 5MHSE 2RFXB 4KK6C 3W11D 4HH9B 1BWMA 5FV2A 1IC5L 1HHIB 2DTMH 4U7MA 3CAFA 5BV7C 4N9OB 3L5WA 2PO6A 4N0CD 5DZLA 4BQ6A 3C8KB 4QRQA 2AP2A 1G84A 4MVBC 1A3QA 5IROC 1YMHB 5IEKA 1BQUA 2AJSH 4GW1B 4QO1A 5CSGA 4YXHL 2YPKB 5JHDB 3UDWA 3T04D 3V52H 4C55A 3SY0B 1LEIA 5E6YA 1KJ3H 4I5BA 2A73B 2FCBA 3WLWC 4P5MB 4HIIB 5IB4B 2WP3O 1FV1B 3O4LA 3HMWL 1U8LA 3JZ7A 3ZYOA 1HYSC 1FZKA 2BSRA 3X17A 3KG5A 2FSEA 4OLXL 5DK2B 1RULL 1WFTA 5GIRB 3ARRA 2JCCF 4RGOH 3AVEA 4LF3A 4U31A 4QT5B 5KZCB 1R24B 3CCHA 4M8QA 1MAMH 3PDGA 4G6KL 2WUBL 3UC0H 4KKBD 1IZKA 2AJSL 4LLAA 2F58L 5C08A 5C0DB 3MOQA 1JZ6A 4MQSB 5DURD 4WY7L 1ZGLB 1OAUH 1MSPA 1KJ3L 4N68A 2DF3A 1XR8A 1PVHA 4PJEE 4I0KA 1XGUB 1YA5A 3B43A 3QCUL 2BHZA 1U8NB 3IDMA 1S7UA 1K4DB 2IF7A 3KPPA 1HHKB 3HAEH 2GTWB 5F71A 4QCIB 5D1ZB 1OCWH 4BA8A 4UINH 3RWJB 4ZSOA 4MXWH 1CE6A 1SYVB 3IFOA 3TBTB 2ADIB 3QZWA 3HS0A 2R39A 4DEPC 3LRGA 4PBWD 2IFFH 4G43B 5I0ZA 4L29B 1HHHA 2XFXB 3UC0L 5BV7H 4Y8DC 1HQRB 1D5BA 1WISA 3PJSA 4YHNA 3ZE2F 5ISZE 1OAUL 1CF8H 4OBSA 3MYJB 5JW3H 4FFWD 5D96C 3S6CA 1E27B 4MA8L 3ARDB 4NRZA 4E5XB 4PY7A 5GJTH 4LCWB 3DVGA 1S9XA 3OJDB 4I77L 1IC4H 1UM4L 4UINL 4OCWH 5C0BD 2E7LA 4MXWL 4PLKD 1I8LA 3IGAA 4R97C 1KJVA 2AEIT 5ERWA 5J1TC 4PJ8D 3GI9L 1P2CA 5J89A 2IFFL 5FM4A 4J3VA 3ZE1F 5BV7L 3NIDE 4J12A 2EDLA 3I2CL 3QUKB 4F7CB 1Z3GH 1NMCB 1CF8L 2FJHB 2D4DA 1WK0A 1Q72H 1G6RA 3P4MB 4JZOB 1NC4A 1VFMA 4YHKL 1FYTE 2EE3A 4F2MB 1CLZL 5CHNA 3IVKA 1IGJA 5FOBB 3R1GH 4EKXA 4MAYA 1ITCA 3RI5F 4J7RA 3O6FB 2BNQA 5KN5B 3D85B 4OCWL 2NY3C 2M26A 3QNYA 1MUJA 3PABA 5I18H 2BOBA 3SCMD 3O6KL 4R2GD 3V6ZB 2B8OT 1U91B 1Z3GL 3T08A 4J4PD 4PBXA 1WWCA 5JIPA 1GZPB 5GZOC 1UH2A 4KPHH 1Q72L 2V17H 2WBJA 3TCLA 1RZIA 5ESQA 1I7UA 3MRJA 4WUKH 2CD0A 1N64H 4IRJD 1WBZA 5E7FA 4YUEH 3WNOA 1T5XB 2Y72A 5ESVA 2HJKA 3R1GL 1ETZA 3TIEA 2DYPA 1FORH 4Q2ZA 1TVDA 3CXHJ 3FFDA 1ZANH 4DVBA 2VDNH 5I18L 3MRRA 2RCSH 4FQ2L 4CBPA 3MOAH 1T20B 3QIUB 5FK9B 1YN7B 1RZJC 2X9WA 1J11A 1K3IA 3F62A 4OM0H 1CBVH 5CJ5A 4Y1AA 4K3HA 3ZKQD 5LJYH 1R5WB 4J3SA 4GQPH 3UTSA 4UIMA 5FGCB 5FYJU 4WUKL 1GH7A 1AHWC 5ID1B 2AW2A 1A7QL 2YEZB 2W0LA 1SM3H 4YUEL 3KJ6H 5IB1B 1DR9A 4PB0L 3OXSA 5D1XA 2P47B 4BK4A 1FORL 5ADPH 2DBLH 4Q7DA 1HNGA 1U8JB 2VZ3A 3VXOA 1G7JA 2VDNL 4N0FB 1JI2A 2R29H 2RCSL 4GKZA 3RVVD 4HUXA 3BWUC 4MWFB 4K71C 5FHAH 1Q0YH 3VXRE 1GZQA 2E8ZA 4PJXA 4YDJB 1F90L 5I8CA 4YFDB 3FQXA 2VB5A 5GRJL 3MV7D 4OM0L 1CBVL 5EC2B 4Y2DC 4WU5B 1J1PH 2EH8H 4JGUA 5EBLB 4HKXA 1FSKB 4QF1B 5EPMB 7CGTA 2VDMH 3NVQA 5GJSL 4ZDHB 2P1YA 5E5RB 3CVHB 3MJ7B 4UT7H 1SM3L 3AU1A 5D93B 1S78D 3KJ6L 5DR5H 5E8PA 3QPXH 2VYRE 5SWSD 3C6SA 2FEEI 4UDUB 5ADPL 3O6LH 1T89A 2DBLL 2YD1A 4LCCC 4WNQB 1OP3H 5C6PB 1F58H 4DKAA 5DURB 3HE6D 3NGBB 2V9RA 1N3NA 3K1KC 4KKCD 1CYGA 4GKNB 3MROB 2R29L 25C8H 5J6GA 1JF6A 5FHAL 1Q0YL 3WIIL 1PDKA 5CJXC 3EKCA 3O9WA 4PJ9D 4IMKC 4OIBA 1J1PL 2EH8L 3FB5A 4YIQB 1FC1A 2EC8A 4KTYA 2E7BA 2NW3B 4DQOL 1RZJH 2B7DT 2NZ9D 3E3QE 3MBEA 3KYAA 4YHML 1OW0A 2VDML 1JNNH 5INCB 4HX1B 3CPLA 3U0PB 2OL3H 3ZLQC 3J8F7 4D94A 1J05A 4X6FB 5C0AE 5DR5L 3QPXL 4L8SA 5D2NE 4NKMB 3T1FB 2MQ0A 2X4NA 4QHNB 4TSAH 4X9IA 4KXZH 4QKXB 5D72L 3PWUB 3ARFA 1F58L 1ACYH 1ZLWH 1OQOA 1K8DB 3GSQB 5GQBA 4YEFA 3KLDA 4PGJA 1KN4H 1W72H 4TNVF 25C8L 1ZAGA 5L2KD 3MR9B 1UWEH 3STZB 3NZ8A 3VXMB 4CMHC 1YEKH 4ACPA 3T2NH 3LD8C 2OXHA 2YN5A 3CU1A 5DHYB 1DANU 4WFGD 5I1HH 5IB3A 3WLBA 4QLRA 4JFFE 2ENYA 3GI8L 1Y18B 1Q9WB 4Y4KA 3TYGH 2P5WD 3CFEB 1JNNL 4CVZB 4UOW0 3WKNA 5C0BB 3MFFA 1BZQK 2YR3A 2X2YA 4IHOB 1A3LH 4P5KB 1MVFA 1NFIB 4JQXC 4PJ8B 1EGJA 2QQLH 1T1WB 1DN0A 4UZGA 4TSAL 4ZNEA 3QXTA 2W07A 1N8ZA 1CGVA 1ACYL 1VFBA 1CIDA 2XY1A 2BOCA 4IDLA 4X9FA 1RY7B 1KN4L 1W72L 2XZCH 1EHXA 2VDKL 3DGGA 5C0GB 1MVUA 1QBMH 4LLWA 1UWEL 4TULH 1KB9K 2Z35A 1YEKL 3T2NL 1BOGA 1CXKA 1E4JA 4ZO7A 1YEFH 4YHLH 1FVCA 2JCCA 2VLME 1AXTH 4RWYH 2ARJA 4CN4A 5EZOH 1KOAA 1QHPA 5T3XE 1N5YH 4K9EC 5B22A 5CMAB 5HJ3B 1A3LL 3QEHB 2YD6A 3GSNH 3KS0J 3SCMB 5HYQB 4U1IA 1XGPA 3FT2B 5KVMC 1FO0A 2QQLL 4R2GB 3P73B 1RQ5A 2CRMA 3S36X 2BJMH 3H8NA 2WAHA 3EO0B 3QIBC 1EZVY 5DS8B 1OAZH 3LKRA 3CLFH 2G5RA 4HGWA 3WSQL 4FG6C 2XZCL 2Q76B 3OB0K 4NM4H 4TULL 2P48B 4ODUA 4FNLH 4YHOH 4ZS6D 5F96L 5FKPB 4G8GA 5ECJE 1YEFL 1FFOB 4YHLL 1LO5A 1JGUH 4RAHA 1GC1L 1VPOH 3IDXL 3GMMB 1AXTL 4RWYL 3GKWH 3MUGB 3DUSA 2GITA 3S35X 4PTTA 1G6VK 1MI5E 3MZTA 4RWHA 3QEQD 1PGRB 1Q0XH 3RIAF 3GSNL 2BVYA 4C54A 3DJ9A 1WTGT 3HFML 3RJDA 1Z9OA 5FYLL 1S9VB 2Z8WC 4URTB 3TT3H 4LEXH 4P57A 3QR2A 5JW5A 3EZ8A 1OAZL 3LOWA 3CLFL 5KSAC 2XKNA 5ESAB 4NFBA 1WCBB 4HUUB 3SPVB 2A74A 3RX7A 5DD6A 4ELKB 4YHOL 4FNLL 4H0GA 4P3DA 1WZLA 1D5XA 1TJIH 1JGUL 4L4TD 1P5VA 4JREB 4LGPB 1EXUB 2R23B 3G5YA 4NC1E 1U3HD 3V4VH 3VXTB 3GKWL 5EZLB 5EU4B 4RIRB 1Q0XL 3EYOA 4P5TA 4NBXB 3NCFB 1F6AA 1FPTH 2DOCA 3BPOC 1RZ7H 4K9EH 3DBXB 1J0YA 3CMOH 4OBRA 5GGVY 4UAOB 1A1OA 3OKEB 3MV7B 2KPNA 1ZHLA 2GJ6A 4HCRH 2RBLA 4JDTH 3RUGB 3IFNH 1LEKB 2XKUA 3LRSA 3T0VA 5DSCB 5ITBL 5H37H 5LBSH 3TNMA 4DW2H 1B0WA 2B20A 2FJGB 3FHAA 3BEWB 1K3ZA 5CP3H 4MD0A 2AK4E 2CQVA 4NQVB 5SWSB 1LE9A 1MIMH 5KVDH 4KK5D 5E94B 5KVFH 3HE6B 3QDME 2P5ED 2DQUH 1CR9H 3MV9A 5C0FB 1RZ7L 5E8NA 4PR5A 2B2XH 4K9EL 3QXVA 4R4BA 1G1YA 4O9HH 4HKJB 5D70H 4PJ9B 5SV4A 1BVLB 2XNAB 3VWKA 5MENE 4XCEB 1MCLA 4L8DA 5DRWA 4HCRL 4JDTL 3FN3A 3IFNL 1CDYA 4FFVC 4N9GB 4WI5A 4P2RD 4NRYB 1K85A 4YHIB 5LBSL 1T3FB 5F7DB 4FHBD 4OIIH 5LGJA 5F89A 4NC1C 4PRHA 1C1EL 1KJMA 1T1XA 1K5NA 1RAMA 1F3DJ 4JVWA 3TBSB 3U6RA 4A6YH 5KVFL 4X8JB 1HWHB 2DL2A 2D7NA 1T03H 1QVOA 1A7RH 1CGSL 2DN7A 5IKCB 2A6JB 5L2KB 2DQUL 3L3OB 4MSWB 1MWAB 2B2XL 2XACC 2AAVA 3BFOA 4LSPH 1J8KA 5D70L 4FFYH 2ZUYA 4M00A 5KVGH 1ZHKA 3CC5B 4KQ4L 3EZJB 2PNDA 2P5WB 4NO2A 4K7PY 2FYYB 3OJVC 1S9YA 4OIIL 2BVUA 3W5MA 4UT9L 3UPCA 6CGTA 4NNXA 5IK3A 2BVPA 3EDFA 3QNZA 4XVUC 1AGFB 4QRTB 4JFYB 4XVTH 4WO4D 1KV3A 4HQQH 2RAMA 2NY0C 5JUEH 2DWEA 1CGTA 3KS0H 1HHJA 1T03L 5E2WH 4PV9B 4LSDA 2D0HA 3G5VA 4WUUB 1NCNA 4FFYL 1IEBB 1WLHA 3EOAA 4PRPA 2E8YA 3RWCA 3GMLB 4NZTH 1BEYH 4I4WA 1DEEB 4V1DA 4MVBD 1AKJA 4O2CB 3O4LE 3PHOA 2VE6B 2BFVH 1FAIH 2F74B 2AJVL 5GRWA 4PJDB 1ZSDA 4M1CD 1GOHA 4NNPL 2Q1EA 2JJUA 5F7LB 4XVTL 4DK3A 4ORZC 4HQQL 1OP5K 4MB3A 1EMTH 1EPFA 1YPZA 4OZHF 5I1CH 3EDDA 5C08E 5DVLA 4JG1L 2R0WL 3QRGH 5DUMH 1KCVL 5L2JA 1FYHB 1UKQA 3CDGB 2HYMA 4FQXA 4R0LA 5H2BA 3HZVB 3BQUD 1CTOA 3W82A 5LG1A 4WW1B 4NZTL 1BEYL 1Q94A 5HI4C 4P2YA 5DVNA 2Z9TA 4NO3B 2P8MA 2WBWB 4HIHA 4F7TB 2EE9A 1CDIA 2BFVL 4C83B 35C8H 3VXQA 4ZO6A 3NFSH 2PO6C 1IILE 3T3PF 4UOJA 4ZSOE 4X6CB 4MCZA 5F7KC 1U41A 2R1WB 2X4RA 4MZ3A 1VADB 1VA9A 2E5EA 4GAJL 3AS2A 3RWHA 3V6OC 1W0WB 5GGVH 4LDOB 2O61A 1SY6H 1RZ8B 2VQ1B 1INQA 2FECL 1WITA 1CCZA 4PV8B 1NUGA 4PUBH 4HIEA 2DJUA 2C4XA 4Z6AT 2FL5B 4AEHH 3BD4A 5EOTB 3LKSB 3KXFD 2NTSP 4XZUA 1U3HB 4KMLB 2D3VA 4FABH 1CDGA 35C8L 3BPNC 3BDYH 5MI0C 3L95A 3E6HA 3NFSL 2WANA 4R90H 1FL6B 1HILB 4JR9H 3N0PB 3OKMA 2VLJA 1IM3A 3LDBB 4K94C 1WV7T 5GGVL 4KRMB 3UTTA 2EYTA 2D9CA 5DJ6A 5GGQL 4PUBL 1CXLA 2GK2A 4U2ZA 2IALB 3RP1A 1EJ6A 4HJ0D 3FO2B 2CLVA 4X6DF 3GJFK 4AEHL 4WW2F 3TVMA 5BVJB 3UTPE 4UTAL 4NT6A 5D7IA 3D3VA 3FT3B 1UZ8B 2XT1B 1PZ5A 4FABL 4JDZA 3NN8B 4LL9A 4Y8AA 3VFRB 3C2AL 2GAZA 5ITFA 4K55A 1AGBB 2BNQE 1BD2D 1IAII 5CEYA 2P5EB 2R0LL 1JHKL 2X4SA 4MQXC 1XCQA 5B39B 4L5FH 2FGWL 4P4KA 4WWKD 1NC2D 5IG7B 2DBJA 3EJYC 3LPFA 2E7HA 3QUMH 1DQJA 3ROOA 4BSJA 4PRDA 4NO5A 1H3WM 2Q6WB 2DKUA 2F5BH 4P2RB 3BP7A 4W68A 3SE3C 1ED3A 4JKWA 3MLYH 4X4YB 2BHYA 2F53A 5IV2A 1PQZB 3R0MA 5FYKL 5HHOD 4RRPA 2GSIB 4UBDD 3BW9B 4YDKL 3CSGA 1L9NA 1A1MA 4CUCA 3DUUA 1YEHL 5E8DH 1E6OH 1FLRH 2E7LC 1U8PB 4S0SD 3TZVD 3W0WA 4RZCA 5F3BB 1XGQB 3IJHB 4FQJL 1JFQL 1WEJH 1D5ZA 3VGDA 4L5FL 2VQTA 4ZAKD 4KRPC 1DLHA 2NXZD 3QXAB 4IRZL 5E6ID 3E2HC 3O8XC 4BH8A 3RWFA 3CDCA 2I9LA 1OARL 4GKSB 3NOIA 1MRCH 1O7SA 1GGIH 2F5BL 4K94H 2W0FB 1EIBA 2WINA 4Y1AE 4RA3A 5FHBH 3MLYL 2IWGA 5TQ0H 5IT2H 1IGTA 5F9OH 3UTSE 1XGYH 1SMAA 1GXEA 1CN4A 4X80L 4WO4B 2WWMC 4RMWA 3DRQB 5CLTA 5D5MB 3HPLB 4MQTB 3S34H 1Z0MA 5JORA 4GW4B 3L5IA 1J5OH 2GTZB 3CZFB 5E8DL 1FLRL 1MCOL 4WCYH 5KSUB 4ZUSB 2P24A 1E4XI 4Z78B 1TENA 2BVEA 1KF9B 4KV5F 1NGPH 4NSKB 2F5AH 1WEJL 2K7PA 5BV7B 4F37F 1I9EA 4I0CC 5CEXA 3PIQB 5KJRH 3O2WL 2CDEB 2X89A 2BCKA 2CUIA 4RFNB 1MRCL 2CJUH 4PJXE 2HN7A 4CN6A 4K3DH 3NABH 1NL0L 5FHBL 5H35A 3DV4B 5TQ0L 2AXFA 5IT2L 4QRSA 2Q8AH 5F9OL 1XGYL 2VXUH 3QYCA 5T1MA 3OHXA 3KPQA 4YO0B 1CGYA 2VTFA 3F5WB 2F9BT 1ULVA 4M93C 5CZVH 2NY6C 1ZLVK 1J5OL 4LARL 4N0YH 4EUPA 4Y2DD 3GSWA 4F8TA 1JP5A 4NKOA 1ZA3A 1MELA 2IMNA 5A2IH 1NGPL 3HR5B 3OPZL 3WO3B 2F5AL 3EOBA 4IIQC 2WK2A 4QXTA 1ZWIA 4ZQKA 1V3LA 2C1PA 4HKBB 3TYFB 5KJRL 3BQUB 1BVKA 4ZTPH 2CJUL 5JTWA 4K3DL 3VXSD 3DMMD 3CX5K 2LU3A 3RPIA 1P5UA 5JOPE 5BRZD 5FA3B 4YJZL 4XC3L 4X7TA 3FZUC 2VRAA 2X4TA 1UB6B 2XPGB 4OIAA 3VH8A