5H2BA

Structure of a novel antibody g196
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
216
structure length
216
Chain Sequence
b'QVKLQESGAELVKPGASVKLSCKASGYTFTNYWMHWVKLRPGQGFEWIGEINPSNGGSNYNEKFKRKATLTVDKSSSTAYMQLSSLTSEDSAVFYCSIWDSYFDYWGQGTTLTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPWPSETVTCNVAHPASSTKVDKKIVPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords G196 antibody Heavy chain
molecule tags Immune system
publication title G196 epitope tag system: a novel monoclonal antibody, G196, recognizes the small, soluble peptide DLVPR with high affinity.
pubmed doi rcsb
total genus 39
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2016-10-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5h2bA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5h2bA02
3GO1H 1VFBB 3L6FB 5KVFL 5EO9B 1H5BA 1UB5B 4OD2B 5JIHA 4O02L 3NH7L 4HULB 5KG9B 4XMLH 2OJEA 1H3GA 1FG2B 3MOBL 3QFJD 1T5XA 5MI0B 2BSTA 3PQYE 5ADOH 1ZLWK 1SYSB 2DN7A 5I17A 4P2QE 4KK5D 3FONA 5F6IC 5F96L 4R2GB 3QIUA 3V4PH 1OP5H 3RY5A 1JTTA 3RVXD 3A67L 5IMKA 4JFQA 2VTFA 3A67H 1N4XH 4IRZH 2F5AL 2GJ6A 3T0BA 2YKLH 4LHUD 3D39D 4LSTL 5BXFA 3P9LA 1CL7H 4NQEE 5D2LE 3O81A 3KPNA 3QT2A 3N50A 1TJGH 1RZIA 4R7DA 5J1AA 3FFCD 3IDXH 1IL1A 3MGOB 5D93B 4GRWF 4FFWD 5H2BA 4JCMA 4LRNL 1PKOA 4O2FA 5DJ0B 2P8PA 3REWA 4ELME 3QDGE 1FGNH 4LRNH 4ZMAT 2NLJB 1EXUB 3SBWA 3GHBL 1CLYL 3TP4A 4YHPA 3WUWB 4KAQL 3SE3C 1ZEAL 3MRPB 5ENWB 4NIKB 4WW2B 4G6AD 3WN5C 1GRWA 4D3CL 4U7SA 4GQ9L 3TCLA 4MAYD 3LCYA 4O5LH 4U7MA 1PZ5A 4YXKL 3CUPA 1VADA 5EU3B 3SDYH 4K3JH 4PLKD 1KEML 5JOFB 4I3RH 4RWHA 1CI5A 1A6TA 2VLRD 3C5SB 4OQTA 2VISB 3O9WA 1M7IB 3ZSTA 1INEL 1ZT4A 3BQUB 3SQBA 4QTHB 1G1YA 3V6FA 3LQZB 5DHXB 5EC2B 5C0AD 4P2QB 3ISWA 1UWGL 3I6LD 4G8EB 2QHRH 5I1JH 1TQCB 1GGCH 2F9BT 4DVRH 1BOYA 3O6LL 2Z31A 4HUUA 4XPHL 4J3TA 4TNWF 1T7ZA 1S5HA 4IJ3C 1OAZL 4FQXA 3SDCC 4EOWL 3EHBC 4OFYA 2QSCL 3TBWA 3HFMH 3FFDB 2ADJB 3BYTA 3F7RA 3PGFL 5DUBB 5ESQB 4G43B 5FM4A 2IFGA 3PGFH 4O02H 3UYOD 4H25A 1IILE 2GJJA 2PKDA 3MOBH 2QR0B 2FJFB 1MOEA 3MA9H 1JGUH 5EIQA 1JPGA 1KJ2L 1U3HA 1NEZA 1IFHH 1MY5A 5HHQA 1R3KA 5CIPH 4TSCH 1HINL 4AT6B 4J3VA 4WI8A 5C0AE 4GKNB 1IFHL 1MJUH 3GGWB 4X6EB 5DSCB 1WC7A 4WEMB 1XGQA 3H7LA 3P9WB 5JHDE 1X3DA 5HYJB 3BGAA 1UJTA 3SE8H 1JI1A 2NY6D 1QRND 2LU7A 5DC4B 1M7DA 3SE8L 1GPOH 4G42B 4LAJH 5D7LA 5E2TH 1BBDH 3BWAB 3BVNB 2VSDA 1HH9A 3CFDA 2PCPA 3PWLA 2VDKL 2C3XA 1LO4H 1MAKA 3HUJE 3NN8A 1LDPL 4M62L 5HGGS 3V8OA 4OF0A 1CDCA 1HILB 3U4AA 1I1AA 4OJFL 1UYWL 1J5OL 1KPUA 3LVEA 4EN3B 5D8JL 5EWIL 5HI3C 3QCUH 3KJ6H 3VXUB 4XRCB 4I48B 3EIFA 3DMMC 2H6PA 5EWIH 4YHZH 4ZTOL 1UA6H 3G5YB 3I84A 3UJTH 5KVGL 2XZAH 3OXRB 1JI2A 3AAZB 2XA8L 4PJIA 2QEJA 4V1DA 2VDML 5HVHC 4QRPB 3S36X 2AK1L 4HGWA 3OR6B 1MFDL 4E9LA 5H8DA 2AK1H 1U3HD 1Y18A 1NLBH 2ICCA 4CGTA 3SDYL 1I9RH 1T03L 4M1GH 2BNRD 2JJSA 1ZMYA 4U6VL 1S9VA 3FHAA 2ZOLA 2VLKA 3G5ZB 4Y19D 5B4MC 2IPTL 3OG6B 4XP4H 3RHWK 5EUOF 1I8KB 3CXHK 2PETA 3TPKA 3QUYD 2WBJD 1PYWB 5T3ZL 2J8UF 4DEPB 1J10A 2NZIA 5DO2D 2D4FA 4ENEC 1VHPA 4OF7A 3EJYD 2XNAA 4S1RH 2R29L 2VWEC 3T77B 5DJAA 5DT1H 5BW7C 5DQ9A 1DL7L 2FHBA 5GZND 4RSVA 2HJKA 1FZKB 3QQ9D 1A9EA 5EZLA 1FZOA 9CGTA 1GH7A 1IGCH 1UH4A 3HUJB 5DQ9B 1UADC 4HW6A 3V7AE 4D8PA 5FXCH 1JGUL 5C08E 3BWAA 2GJ6B 4NQEA 4HIXL 3SGEH 4Y5YB 5FO7A 3ORJA 3P2TA 4YGVA 5CJBA 5H94A 1RFDL 4M1CD 4KTEH 1S5IH 4QRUA 4RNRB 1DE4B 4GMSL 4YXHH 4JZJC 3T0XA 1RV6X 4LFHD 5GGRA 4U31A 1K4CB 1B4RA 1KCSH 5D5ME 1I7ZB 4YFLI 1IQDB 4M9OA 4OZHB 4RMWA 4WFGD 5CP3A 5LJYH 5I16A 2O5YH 4YC2C 3LAFA 4M7KH 1G9EA 3GKZA 4JANA 5HVFB 2Q8BL 3HE6C 3SDXF 3X17A 1LP9F 3VDAA 2OL3H 2VC2L 4OCLC 4WW1A 4MXQC 4OIIH 5I2IA 1AQDA 3EOAB 4WV1B 1KBGL 5I1GL 1QLFA 1FNSH 4CADB 3ULSB 5JMRA 1CFNB 2CIIA 2XZZA 4C56E 4OLZL 3ZTJG 3L3OA 3PQYD 3WNMA 3WIFA 2P5EA 1AJ7L 5F1KC 1F2XK 2DDQL 2YOCA 3LQZA 2Q6WB 4L5FH 4ZUUB 3UBXB 1JZ8A 3MV9A 2P44B 4OD3H 5HYJD 3BPCB 1E4KC 4NQCD 5CZXC 5DEGA 1OARL 4AY0A 4OD3L 1F4YL 3AS1A 3D3VB 5JZ7D 4DKFL 2DLIA 2PTUA 4ODUB 1UGNA 3BH9A 4X7SL 1X5LA 4UBDC 4CMMB 1JP5A 4XP9L 1NDGA 3MUZ1 5E6IA 1DQDL 2VLLB 3BP5A 5BV7H 4I0CC 1TVBA 4GBXC 5IMLA 1BQUA 3H0TB 4K7PY 4L3CB 4X7TA 3S98A 4Z78B 3WV0A 4U1NB 3GK8H 4C4KT 3QUKB 4LLVA 4LP4A 4NUJB 1NC2A 3FB6A 5DGQA 1W0YT 5EOQH 1N6VA 1B2WH 1N0XH 3ZDZF 3BZ4B 3WS3B 2OLDA 4X4ZA 5FM8A 4P9HL 1G0YR 15C8H 4PYGA 2YMXL 4YPGB 2YA1A 1CDHA 1F3JA 3BZEA 4ONOA 1A4KA 3W5NA 4P5TB 2ATKB 5C2UB 1ZLSL 1HHGA 5IB4A 4E0RB 2CQVA 4EIGB 5L8KB 4BQ9A 3HRZB 3TCLB 4CU6A 1RZJH 2ADGA 2GEEA 5D4QA 4AL8H 1MCRA 3N1QC 2XIDA 4RAHA 1GCFA 1VACA 2AS5M 3RTQD 2XPGB 4M1DL 1UB5A 1J1PH 3LKSA 3OAZK 4WI6A 4AK1A 1IGTB 4HEME 4P2OB 2LFGA 2NXYB 3S8WA 3FFDA 1TZHB 5INCA 3RZCC 4KRLB 1JMZA 3NCCB 3H7BA 2BVUA 2XQBL 1GZPB 1QO3A 5LWYH 4LMQE 3EDEA 5GS1A 4K7PL 2OSLB 4WJ5A 5FDWB 3AXLA 5LWYL 5B21A 3P4NB 1CLCA 2BDNH 3B8SA 3BI9X 1BVKA 1NCWH 3DXAA 3MYJA 35C8H 4TPRL 4L29B 4FFYH 2GAZB 5IGXL 4OLYH 3GI9L 4DOHE 2FZ3A 3PHQA 4I3SL 2SEBA 5CJOL 3MRKA 4WUUD 4NT6A 3QCVH 4F57H 3OKEA 2AJVL 1N2RB 1DBJL 2N1KA 2BNQB 4AH2B 4LU5L 3ZLQC 3D9AL 3IJHB 4HIJA 5E4EC 1YPZE 3T3MF 3LEXB 3PP3K 3EZJB 2YZ8A 2ICEB 3WO4C 5IEKA 5DA4A 4AM0A 1T80A 1ZKAA 1H8OA 2YPVL 1NMCB 4ZOAA 4HG4K 1GGIH 4U3HA 1JGLL 3FTGA 4Y4FC 4WGVB 4PJXE 4OZGB 1MY7A 3S3PA 3SKOB 1G6VK 4KXZI 3QUXD 1UZ6F 3Q6GL 4TUJA 3P30H 1FLRH 1OCWH 2H45A 3C6LB 1PG7L 4J1UA 4KWUA 1AGFA 1RURL 1MRCH 5L6YH 2DQIL 5C0FA 5KZCB 5DI8B 2OK0H 1X5ZA 4K94H 5E99L 5IJVA 4JKWA 1NUFA 5LQBL 2FRGP 3LDBB 1XF1A 1F3JB 1MI5E 3B9KD 4KHXH 2A77H 2V17L 5M94B 1A1OB 3RGHA 1ZT7A 3LKNB 3EGSB 2L0DA 2QSQA 1ETZA 2QSTA 4NZDA 4QYOA 4YHNA 5CLWA 4S2SB 4ZUUA 4QRPA 5D70L 2A2QT 5HDOA 3VH8A 1DP0A 5TFSL 4ZD3H 5SWQA 3FOMA 3QEQE 5B8CB 2DI9A 1D5IL 5FYLL 4OM1H 1G0DA 2A38A 3BIAX 3CXDL 4G9DA 4BKLA 1CE6B 4NKQB 4XCNB 3M07A 3STZA 3HZMA 1EIBA 1YY8A 4U1HB 5SV3A 1J0IA 4K3DL 1JYNA 4BSVB 2BCKA 1DQML 5KSVB 5CKGA 2DM2A 1V7NH 4LKXB 1CFQB 5IMLB 1TJGL 4F2MA 4Z6AT 2NPLX 1MHHA 1WF5A 4M48H 3HE7B 4WTZA 3ARUA 5ACZA 4JZJB 3O2WL 4ZNCD 4PGJA 3F12B 1UWXH 1PZUB 3CFJB 1SQ2N 5IKCB 4TPRH 1FYTE 2APBA 1MRDL 1A1NB 4I3SH 4OI9A 5CJOH 3NPZB 5HHQB 3FO2A 2V2XA 2FIKA 3LPFA 2GKIA 4UIMB 4YHKL 1KCUH 1S3KH 5L88H 1AD0B 1XR9B 4NQEB 4JFYB 5TH2B 1I85C 3LMJL 3BMVA 5BRZD 4JZNB 1RIHL 4QOKD 5IK3B 1BFTA 1JGEA 3D1MC 2ITCB 1F00I 1J1OL 1PQZB 1T1YB 1EBAA 1OT2A 5CAYB 4C57C 4P57A 4JCLA 1RZKC 4NGHH 1WWBX 2DQJL 4JRXA 4M8QB 1UXSA 2V5MA 4ZPVB 4DCQB 2GJZB 3V5KB 2VABB 3GMPA 5EU6D 3TIEA 4YEEA 1IGTA 5EC2A 1CD1B 3Q3GA 4MNQE 3SE3A 1KIPB 2NMSA 3TWCL 1MHPH 2XFXA 3CGTA 3C60D 4RBPK 4MAUH 2ZUYA 4FA8A 3BKML 4G7YH 3WHE1 3MRBB 5ECJE 2V17H 3RWGB 4U1KA 4RA0C 3KAAA 4APQD 3MUGB 2ED7A 1B0GB 1WFNA 1BFOB 1L7TH 4IS6B 2D0FA 3C2AL 3GSRB 4MD4A 3V0WL 1S9VB 2HT3C 4HPOH 4XP5H 3FMGH 2HFFA 4ZAKB 5F89A 4FQHA 3IFNH 4LKCA 3IKCB 5I1AB 3TN0C 5L2KE 4QGYA 2HRPH 3HR5A 3SDDA 3CMGA 5A3IC 4YE4L 4EN3C 4NO3A 5GGTA 1NMBL 5GGQL 2H26A 5EUKA 2DJSA 2VOTA 1MJJB 3RUGB 4S1SH 1BM3H 3QDMA 3ZKQD 1FBIL 1CICC 1BM3L 2LE9A 1MIMH 4F9LA 2EDQA 3B9AA 4QRQB 3T3ME 3HAEG 4BA8A 2A9ML 4D9RE 1QYGL 4F15B 5BZWA 1W0WA 4ZFZA 2PCPB 3PWLB 3SGDH 5BXFB 2DM4A 3PWUA 1JK8B 2HFEB 3DETC 4KJPC 3BJLA 2BVPA 3QDJA 5DZNA 2IF7A 1SJHA 4OCXH 2YD5A 4IRSD 2EKSA 2DS4A 5I74C 1RIVL 3C2SA 1BX2A 2WUBL 4F80A 2EEAA 1IBGL 4YGVB 3EJJX 5IFHH 5L0QC 1NAKH 5EDXA 1EUUA 4NN5B 4HXBL 5JA9A 3JUZA 5CEXA 5E9DD 2BX5A 2MSPA 1C5CL 3MJ7A 3QB7C 1I9IL 5MEPB 1S9KC 2FB4L 3SDCB 3SY0A 2NW2B 4KRPC 4P57B 5FGRA 3WD5L 5CP3H 4ONHB 1MQ8A 3AB0C 1FL3B 4JRYD 4Z7VA 3IJSB 2FX9L 4Z9KB 1Y0LB 3FB8B 3LQAC 5FB8B 1U0QA 5ESVB 3T0EE 5C86A 1A2YA 1ONQA 5KJRL 5BS0D 2F19L 1G7IB 2P5ED 3TWCH 4OCNC 3QQNA 1BHGA 4JVPA 1UWGH 1CGUA 3KPLB 4JFED 4QTHA 2DYPB 3BHBA 1U8MA 4HZLB 2GSGA 1F8TL 3HN3A 3UMTA 3O6LH 3GDBA 1PG7X 3WIHH 2QKIB 1A6ZB 2JIXD 3CVHL 4HQQH 4KKLC 4QHUA 2UZXB 1LO2L 2BC4A 4EEEA 5IT2H 1CF8L 3L5WB 4PJGF 4P9ML 1R3KB 5DK2A 3VXNB 1QEWA 4PFEA 2E7BA 4XH2B 4Y4HC 2FECI 1KCVH 5CEYA 4YFDB 4PJ7A 3OKOA 1QNZH 2VUOA 2I26N 5GRVK 2X9XA 1G9ML 3H3PH 1VKXB 1CD0A 3VD3A 3PQYB 5DTFB 5LGHH 5BRZA 3K3QA 1WZ1H 4AYFA 3QNZA 1H3PH 3GRWL 1J0JA 4Z7VF 1FZOB 5CIPB 3TA3C 1V7MH 4Q7DA 3VXRB 1JF1A 4MA8L 3RDTB 3E2HB 1D5MB 1HSAB 1QYGH 1IL1B 4L8BA 3ARFA 3F6IA 4X8JB 4JAMA 1DUYA 1XGUA 5EOTA 3E6HB 3SKJL 1KLUA 3RVVC 4ETQB 1C16B 5GGTL 3MLRL 3TJEL 5F6IB 5MERB 3TJEH 2WUBH 4G9FE 4L3EB 3K7UA 4I0PC 4G6FB 5HYSA 2JB5L 3MRLB 5JOEA 2HFGL 5D7JC 3LKOA 5K9QI 1U95B 4MD5A 1TCRB 1U8JB 2VDMH 3IXTB 1X5KA 3W11D 2CMRL 1ITBB 2ZG3A 1DBMH 5B38G 4ZYKB 1F97A 2VLME 5T1MA 1NC2D 2GJ6E 2YA0A 1CFBA 3WLBB 3TBWB 3LSOA 1YY8B 1ES0A 1BEYL 1FO0B 4JHAH 4WU7B 5I1LB 4HWBA 2EDLA 1BLNB 4JJ5A 1WAAE 1A8JH 5HSFA 3LOWA 4Z5RB 4M7LT 1E6OH 3Q1SL 1QLEH 3BH9B 5E6ID 1QFOA 1CQYA 4LCCC 2HJLA 3KNBA 5DFWH 1Q94A 4JN2A 1DQDH 1U3JA 5ICZB 5FDYA 5JW5B 4X9IA 3TBSA 3U9UB 3FRUA 1F3DH 3OKNA 5GJTH 5HHOD 5J13B 1I1AD 4K8RD 2HYMA 1L0XA 2W0FA 5ESAB 1FVDA 2R0ZL 5JIIA 3DURB 1DSFH 3ZYJA 5ACZB 1UKSA 5D1QC 3E6FA 2OJZH 4ODVL 4F58L 2NY4C 1INDL 1A6PA 5FO8B 4G8GA 1NGZB 3PWJB 3DRTA 1RJZA 5ETUB 2AK4E 3QUMB 2FL5B 4FMKA 2NX5B 2FX7H 2HKFH 5CJXC 3VJ6B 4P49A 2B20A 2VJXA 3DX8B 5C07B 1FGVH 3DRTB 1UC6A 2XN9E 4OZGF 5K9KA 3QXWA 4WUUB 3OHXB 3SKUD 4XMPL 3ARGC 3MZGB 2BXYA 2ZNWA 3UTTE 3R4DA 4L9DA 5IMMB 4PB0L 4DZ8A 4QYOB 1ZE3C 1F11A 4AEIH 3QDGD 1ZHKA 1MCOL 3MOAH 4FQXD 2JCCF 3I3DA 4TNVK 1XR8B 3D18A 3MBEB 2GSGB 3GIVB 4HZLA 1U93A 4PG2A 5JLZA 1GOHA 5DK3A 5D7IE 3THMH 4P5KA 4TVPE 3RJDA 5I71C 4G7VL 3BDBA 3JTTA 3RDTC 2BSTB 3JWOC 2VUYA 1RJYB 5IVXF 1AR1D 4RGNC 3QI9C 1KB9J 4PUBH 1I1FB 4GRLA 3MTRA 3UTTA 3QZWA 4Q9RH 2BSSA 3NCEB 1R3IH 4WU7A 1X4XA 6FABL 2E7LC 1HYSD 1S7UA 3EYQD 4WVRA 4JQXA 1HKLH 2EDTA 4LSUH 1GGBL 4HJGA 4FZEH 3ULVD 1JNHB 1TXKA 3DO3A 4QNPE 4RDQG 2VZVA 3GSVB 3DTXB 3OJDB 4Q74A 2AJZB 2R1XB 4NFDA 4Z7UE 4ODUA 4UMGA 5E8PB 4RGNB 4PJAB 3MCLH 4NQCB 1UJ3B 4LCUA 3P9LB 4NJAL 3O0RH 4YHOH 2NY5H 3VFTA 4PJ5A 3O3DA 5D2LF 4RISH 1TLKA 3LZFH 4MA7H 3PGDB 1BQLH 1NMAH 5A2KH 1X7QB 5EUOB 5K9OB 4Y5XC 3O3AA 4XMKL 3V6BR 4UINL 2X4SB 5CHNB 3H8NA 1U8IB 2VQ1B 4LSPL 4R3SA 4Z7NF 3D39A 4ELMF 5JMOC 1S7QB 4U6HB 1SY6L 4WHTB 2VLMD 5TQ0L 4ZOEA 5MEQB 5JHDD 4QRSA 5C0GA 2PXYA 4FXGA 3L5IA 1AD9A 3FCTB 4PJEF 2C7UA 5F1NB 3SO5A 3L9RA 1N59A 4DOHB 4NN5C 1UM5L 3BO8B 4LBEB 5MEPA 4H1LA 4MNHB 1MNUH 4WTZG 5ITFA 1G9NC 5DYOA 1RU9L 4XCFL 3SJVA 2A73A 2NY4B 1F13A 5I74B 5IW1B 4MDJA 4LLQB 2I24N 5HHOB 1C5BH 1L0YA 4JFDD 2RAMA 5GRXG 3IETA 1M6OA 2PO6D 2LVEA 4GAYA 1LD9B 2X05A 4DUXA 3GIVA 3MRQA 3H9SD 3EOTH 1CDGA 1ERNA 2CLZB 2QR0A 4LSSH 3WIFB 5E8EA 1BJ1H 4IOFD 4LLDB 3NOIA 1SY6A 4JKMA 3CCHB 3SGKC 4QRQA 4EDXA 1P4IH 3QIWC 3HI1B 4P2RE 2ZUWA 1WV7T 4LASL 4U1SA 2IPKA 4F3FA 2APWA 3DYPA 1W2KT 4WO4B 3N85H 3TGXA 3DUSA 1S8DA 1QVOB 1N7ML 3WN5A 2E9WA 1T2QL 1EGJA 4HS8H 3LV3A 1U8OB 1AD0A 1QFWI 3QUMA 5KANI 1DLHA 4TOYL 4NQSB 4ZAKD 2YBRB 2I27N 1G7HA 4MX7A 4L8DB 4EIZC 4W6WB 4OZHA 4G9FD 3V7MA 1KJ2A 2J8HA 4RAVA 1I1YB 1OVZA 4HS3A 1AI1H 4O2EA 2EIZA 4PJAE 4UTBH 4OM0L 5D7JB 4YBLC 3HHRB 4KJWC 1QBLH 2P5EE 5KSUB 2FEDC 3UYRH 3U7YL 1I8IA 3OR6A 4DKFH 5JQHC 5HYQA 1RPQA 5J3HD 5DQDH 4XWOD 3SJVD 3UYRL 2C3VA 3WUWG 5JXAL 2L4OA 2C3HA 3J8F7 5EU7E 3RP1A 4TVPD 4ZXBD 3IJYA 5CMAB 2IMNA 5J1TC 4I48A 4PBWD 2VLKE 4BYHA 5HYSG 4Y2DB 3ULVH 1YMHB 4C55A 3DYOA 4PY7B 3BPOB 1OAXH 3BIKA 3UC0H 3WJJC 4M93B 3TA3B 4FQJH 1P7QD 4LSRH 4OZIF 4LFHG 4PJAF 4EXPX 3WJLC 4MNQB 4DN4L 3G08A 1BJ8A 1JWSB 1J0ZA 5GRZA 3V0AC 3EFDL 4LOUD 2OTPA 4JFQB 1PBYA 5HHPA 4XH2A 3EO1A 1M6OB 1G6RA 1V05A 1XGTB 5E8OB 3MRQB 1C1EL 1SYVA 4I18C 4KJYB 1I7RB 4F7MA 2I5YL 4RMQA 4X6EA 4CMHB 5KTEH 4JHZA 2EDKA 3T2OA 1MCWM 1CL7I 3MR9A 2J8UE 2QQNH 4Q0XL 3MA7B 4KKCC 1XIWD 3QUZC 1BBJA 5TE7H 3GKWL 1HQ4B 3BN3B 2WP3O 5FKPB 4KROD 4U1MA 4L9LC 4BZ2L 2FDBP 3ARXA 3IDNB 4X6DA 2WIMA 1I75A 2IMMA 4L9LA 4X6CE 4JDTL 2ZCLL 3RGVD 3BE1L 4LHUG 1D3CA 1MUJB 2NZ9D 3FO9A 3QJHB 2VXSL 1YPZA 4R3SB 2OQJB 5C09B 2EXYD 4G8IA 5BW7A 1DBAL 2A1WL 3VGFA 2BNQE 3SE4A 2AKRA 3ARDC 2JF1A 4XNXL 2ZUXA 4XC3L 5F44A 2I9TA 3IXAB 4BFIA 5EU7C 5F3BA 1OSZB 4KUZL 4FTVA 3WBDA 1N8ZB 1H0DB 2C1PA 5FF6A 4Y5VA 1ZHKB 2ZJSL 4NFBA 3WIIH 3ZE0E 1ETZB 1TVHB 3IF1B 1Z3GL 2CO6B 3VXQB 5L0QB 2A73B 2VR5A 1PZ5B 4WWKA 2EYTB 4QTIL 1X5IA 5D2LB 5EU3A 3ZTNH 5DI8A 2GCYA 3MZTA 4HWBH 5KN5B 3I3EA 3VXOB 1CICD 1BFVH 1HOCB 4JRXD 2IJ0C 1DQQB 3OB0H 4HLZG 3LY6A 5TGBA 2B8OT 1JGDB 5KAQF 4JR9L 4FQ2H 3GI8L 4U6YB 4AMKH 4GRWH 2VDOL 1NMCC 4F15C 3RA7L 2HH0H 1DTUA 5C0CB 1D9KB 1XGPA 2JB6B 5E4EB 3TZVC 1X9QA 1WZLA 2C9AA 2X89A 4JGMA 4HUUB 4G9DB 8CGTA 1AFVL 1SBSL 1A7NL 1N2RA 4FQHB 3BEVB 1BBJB 4ZG1A 3L95A 5JA8B 1JPSL 3ZKNC 5KOMC 5GJSL 1YECL 1ZHBA 3RU8L 1REIA 2X4RA 3QIUB 1AC0A 1CFTB 4ZAKC 3O3DB 4KJQD 4R2GD 4XXDB 2I5YH 5BCAA 2R0KH 4UI2A 3GJEA 3J7HA 3G6JE 4N8VG 1DQTA 1F6FB 2IAND 2P5WB 3P0YL 4JG0H 4JZJA 4AT6A 4TN9A 4OFVA 4LVNC 2X4OA 4QRRD 2R1WB 2AJUH 5EOCL 4JN1H 4LSVH 2NXYC 2Z93A 5IR1A 2CRZA 4P2OC 4I9WD 4F37K 1QSED 1AP2A 4ONGL 3RI5F 2FHCA 2P8PB 3REWB 3CU7A 1T3FB 4OZHE 4IOFC 3G6AA 1W72B 5IV2A 5IB3A 3NFNB 4HKBA 2Z92B 1D5BB 4EQ3A 2E7HA 3HZVA 4HC1L 4IMLA 4U1LA 4JY5H 1FN4B 3BRGC 3MSPA 5FECB 4L1HA 3B9KA 2FO4A 3IDIA 2NYYD 4JVUA 1U8PB 4LCCA 4JM4H 2FYYA 3I75B 3MV8A 2KH2B 1AGDB 4GW4B 1O5DT 5FYJU 2Q6WA 1T83C 4NKMB 3SCMD 3Q1SH 3RL1B 1U8PA 5I18H 4JKKA 4BELD 2CIIB 5ICZA 4OIAA 4K07A 3O11A 2FJHA 3WXWL 3OKDB 1Q9KA 1FH5L 3DXAE 2Z35A 1JUFB 1OY3B 3EO0B 1ULVA 2XI9A 1TZHA 2RQ8A 4MSWA 4RGOL 1KEMH 4PJCF 2D31B 3CIQA 4R9HA 2DF3A 4GBXA 5IT2L 4QKXB 1MJ8H 3ARPA 5F97E 3S4SG 2RJMA 4X4XB 1MJ8L 2EDXA 3L5XH 4JPIB 2VDNL 4M7JL 5GGSA 5C0CE 5TDPB 1XF5B 3B8YA 4M7JH 2Y5EA 2C1OB 5E7FA 5A1AA 2X4OB 1KJ3H 4PJHA 4PJEB 4PTTB 3QO0A 3SDXE 1XR9A 3MRKB 2FX7L 2HKFL 4TSBL 2CDGA 4XXDA 3VI3E 5J6HB 5IBUG 4DK6A 4DQOH 3RAJH 5BVPL 4FHBD 4HMCA 5CEZD 4XZUA 3QUXA 1A3RH 3TYFA 2NY6B 3ROOB 4F7PA 3WS6A 1PW3A 4NQVB 3VFMA 4XMLL 4OCWH 5C09A 1JF6A 5GGTH 3UPRB 1ZGLM 3ILPA 3V4VL 4HGMA 4JO4L 4OCWL 3B3IA 1KJ2H 1LEIA 5F7HA 3SKOA 4Q97A 3G5VB 5DVKA 3MGTB 3HE6B 2HWZH 3V4PL 3ESUF 1FBIH 3VWJA 2YN5A 1I4FA 1U2HA 4CBPA 1X5HA 4DN3L 1G7MB 5C0JB 1KCLA 2HFGH 4OCMC 3BRFA 2PXYB 3HC4L 1LNUB 4ZS6D 3EOBB 1T5WA 1FORH 3LKOB 3FOLA 1GGTA 4U1IB 4Q9RL 1JNJA 3WSQL 4FOMA 1URLA 6FABH 2D03H 2DQTL 2MPAL 2W92A 4CVUA 4H8WL 5A43C 1XGTA 4Y5YC 1E4XH 4FQLL 2FX8L 2CKBH 4KAQH 1UYWH 4PG2C 4YDLB 4HF5L 5FHAH 2FX8H 1IBGH 5IWLC 1FL5B 2FO1A 2X70A 1U42A 5CJQH 3FQUA 4Z76B 2R1YB 1RZFH 3QHTC 4P2YA 4W4OA 3TO2A 1UVQB 1SJEB 4QXGH 4L4VE 1XGPB 2WBJB 4D8PB 1QO3B 3A6CH 3QRFM 2HJLB 5IJKC 5SWSA 3N0PB 4YXKH 4C59B 2CDFB 2NY4D 5EU5B 1CXFA 5MHSE 3GIZH 5IP4A 1YUHA 3G6JB 1E4XI 5ETUA 4IOIB 3QBTB 3TIDB 3GIZL 5E6IB 5JPNB 4Y1AB 1NL0L 3FB7A 1FP5A 1MF2H 4P46A 2O5XH 4X99B 3HKFA 2QSVA 3KPSE 3KJ4B 5E9DA 2P5WA 1ZLUK 5HYJA 3LEXA 3MRNA 3VXME 5IW3A 1SEBB 1YEEH 1ZS8A 3HG1B 3NTCH 1I7UB 3KPRE 4MDIB 1F4AA 2W0PA 5JIKA 3GSWB 3HFML 5IB4B 1T0MA 3PV6A 2BVPB 2WUCH 3QDJB 1NFIA 4Z7UF 5KSAB 2EKSB 4P9MH 1IGIH 4RGMB 1UQSB 4XBPA 3SKMA 4ZFGL 3IXAA 3PWNB 3UCRA 4WUKL 5IM7A 1JRHL 2W65A 4KQ4H 2A74A 3O9WC 4LPVA 3VGBA 1W8OA 4O00A 5FKAA 3UDWC 1I85A 1NDMB 2AJ3B 1CD8A 1UENA 3MA9L 1NPUA 1IKNA 1UWXK 3KLAB 4MNGB 2P24A 1F3DJ 3G5XA 5E8NA 2VDPL 1Y6NR 3F7VA 3V6ZB 2VDPH 2XV6B 1L6XA 4PJ7E 2G2RA 1BVLA 3S36L 1G7QA 3F62A 4QRRA 1OAUH 1F6AA 1ND0A 1HH6A 5D7JD 4NWUH 4BQ8A 3P4LA 4HD9A 2R2BB 2ED9A 1BBDL 1D5XB 1F42A 1IQWL 1NBVL 5GSRA 3SDDD 4PJ9B 3DHJA 1QFUL 3W2DL 1P7KB 5ERWB 1XH3A 1MCHA 4JHBA 4Y8DC 1A6UL 1B0GA 4M43L 3MR9B 4GAYB 3DARA 4HS6A 4OJFH 1XF4B 4M43H 4NQDA 4X9HA 1AIFA 4H26A 5F7DA 1KNOB 1CR9H 4GKNA 5JOPE 1P1ZA 3H9SE 1A02N 1XGQB 3BYYA 3UJTL 5FFLA 3KPSB 4YUEH 4HS6B 3DVIA 3IDMB 3SKNA 2AXJA 3SOBL 3OX8B 4OKDA 5DMIL 4W6YB 3NA4A 4L8BB 3VGAB 4D9LL 3NBNA 1MFDH 5GIRB 1KCRL 5EU6A 1AGCB 2AKRB 4XNQB 1T7VA 4Z7WB 5D1XD 1DVFD 2PR4H 3ARSA 5J57B 5DVLA 5M7QA 4J8RA 5HHOE 1PQZA 3SDAB 1J1XL 3EO9H 1KPUB 4EN3A 1A5FL 2PW2A 3HPJB 1M7XA 3M45A 3VXSB 2EDHA 3QUYA 3IFPB 5CGYD 3IDYC 3HUJF 3NAAH 4K8RL 1T1WB 1E28A 4X7SH 3BVNA 2A74B 3IU4H 4JFYA 1IGYB 4WWKB 4ZS7H 2N56A 3FQXB 3AMLA 1I1RA 1UG9A 2L7UA 1ZLVK 1T0MB 1Y6MR 1T1XA 2Y36L 3FAWA 3PP3H 1TDQA 2DKSA 2P46B 5E5MB 4D9QE 4FQPA 3S34L 1BECA 4UU9B 1AXSA 1A6AB 4ZFOL 3JV5A 4XI5D 2BHYA 1N0LA 1BZ9A 3MRRB 4RA3A 3O6KH 1CD1A 1YQVH 3Q3GB 2GY5A 3IDUA 3RHWF 3EFDH 5ERWA 2BVEA 1FJ1A 4XGZA 1CN4A 3SO3C 2WMPA 4MJ5B 4JFOA 1S7TA 3LN5B 4JDZB 2ESVD 1CDUA 3T2PA 5D7IA 5IVZB 3MNWA 5C0BD 4QNPF 3IFOA 2BHZA 1MREH 3CDFA 3JBG7 5D93C 2QV2A 1OAUL 3CLEL 3HI1A 5HD8D 2OR8A 1OW0A 1JNLL 2F54B 1MFEH 1RJYA 4OGXH 5BJTA 2EE6A 4POYA 5FUOL 4M7KL 1MCKA 1FRGH 4AH2A 3IKCA 1RUPH 5C3TA 2CD0A 5E8EB 4AL8L 1RZIB 5F6HI 2X70B 4JHWH 3HG1D 3RVWD 3B4NA 4QRPE 4GRMA 3C5ZA 4HFUH 1IAKA 1FCCA 2PO6B 3V4UH 1LO5A 4KJPD 4KMTH 2D7NA 2GT9A 1U3HC 3DI3B 3H42H 3BE1H 1BVKB 3MOAL 1MFAL 3H42L 5GRUL 3MRFA 3OBAA 4WI2A 4QRUB 3H6JA 3MRNB 4OZFH 1AKJD 5GGRY 4NUGH 1MAMH 2R1XA 1E4JA 1EZVY 1I7UA 2GT9B 3LEYL 3CFJA 4P23D 3QEQB 4HDIA 4OGAD 5GGSY 3INUL 3D5OF 4L5FL 4TUJB 4PRID 1JIBA 3ECBA 1TTFA 4PUBL 5D1ZA 4ZUSA 2H6PB 5ELIA 4JRXB 4EN3D 4FP8L 2NTFB 4WDIA 1CTNA 3MGTA 1WEJH 5F1NA 4N90D 4FABH 4RWYL 1FZMB 4ZS6C 1IC7H 2XKSA 1IZJA 3LEVL 1FO0L 1GC1H 3F58H 4NHUA 1CVSC 4Y2DA 2HT3D 1T1YA 1DBKL 4Y4KB 2XWBB 4XWGL 3P3YA 1FV1A 3QO1B 2DL9A 1EJOL 3FB5B 3MODL 4NKDB 5DS8B 1KN2H 3WFDH 3FOMB 2ATKA 3NZHH 2NY2B 1MLCB 3GSNH 5DRWB 4HG4J 5HHXH 5GSVB 3NIDF 1BFOA 2VR4A 3MCLL 4UAOB 5E5UB 3C5SA 5HGHB 3EBAA 2EDYA 2VISA 3B9KB 2XN9D 1HHHB 1AQKL 4NNXB 3HC3L 2YD7A 3C8KA 1BJ1J 4F9PC 4M7LL 1RY7B 2HTLD 2OSLA 4MZ2A 1FLRL 3BGMB 3OR7A 3P30L 3IAGC 3MPCA 4XVTL 3QR2A 4YHIB 1MHHB 5GJSH 4PD4K 2UZYB 5D96B 3BUYB 2NW3A 5IUSA 2YEZA 5KSBE 2XZQH 4X9FA 4N68A 2FHFA 2CGRH 1CXEA 2Z31D 4JLRA 3RWEB 3S4SB 1JVKA 1P4LA 1JNLH 1S7UB 3TESA 4NQDE 3D2UA 5I19L 2ICEA 3OWEA 5HPMB 3K4DA 4O4YL 4M6NH 4NFCA 1R0AH 5DJDB 5JTWA 4ODTL 4LCWE 2R69L 1IM3B 2A6IA 4G8GE 5DD0L 4GMTH 3M1BB 12E8H 1VEOA 2BVOB 4DUVA 1YN7A 5TH2A 4IIQB 1BPVA 1EFQA 1CFTA 3JWDL 3KYMA 2YSSA 1C5BL 2UY7A 1HQRB 3G9VA 4MAYC 3UZVB 5D2NE 4NQCA 4XCYB 5KSAA 4OT1L 3TFKC 3R0NA 4W4NA 5EZOH 3MV8D 4OT1H 1JCKA 3OGCB 4TTDC 4NNPL 3HZVB 4DZ8B 2PYEE 1CXIA 1T6WA 2UUDH 3P0VL 4UDTA 3DX7B 4FXKA 2X09A 2APVA 3PWPB 2NYYC 3MRPA 5ENWA 3L3JA 4PG9A 3RY6A 3DX8A 5JHDA 4R26L 1T04A 1QFWL 1WICA 1W72A 5D96C 2OTWB 1OAQL 4P2OA 3HS0B 5E2VH 4YX2L 3N85L 1F2QA 4KHTH 4WHTA 4PGCB 2IPUK 5FGCE 3RX8A 2B1AH 4N8CH 1P53A 4P23B 2DLFL 4EBQL 1F4XH 4DFIA 1Q1JH 5HJ3A 1YNLH 4JPKL 4UT7H 3MACH 4I4WA 4Z0BH 2BMKA 5I73B 1KN2L 2EYTA 2OZ4A 4PRPE 5ISZE 3HR6A 1YEHL 2WP3T 3B9KC 1H9VA 4KK5C 5LGKA 4L3ED 2IANA 4NN7B 5C9JA 2K1MA 1G7LA 2DQUH 4FN0A 1ROWA 4EQ2A 3ZDYF 1DQJA 3U1SH 2YPLE 2GAZA 3S97C 1LD9A 2AAVA 1MFCL 5F9JA 3ZL4H 4WW2F 5IF0A 3CH1A 4R2GC 2DI8A 1CG9B 1OTUC 2X4TB 2J3SA 1T5XB 4K23H 3WHXB 3H2WA 4PD4J 1T6VN 2BVYA 3BEWA 1WBXA 3BKMH 4F7EB 4UV7L 1GL4B 4WI4A 2VDLH 4F2MB 3G6DL 2AEWA 4K9EL 3W9DA 4KHXL 5AUMB 3GBNH 1UB6B 3MLXH 2VLLA 4KVCH 2ITDA 1YJDH 3Q5YA 5EPMB 5EU5A 1XT5A 3PWPE 5GPRA 1D5IH 3RZCA 4HUWB 1MHEA 1MCIA 4NQVA 1VEPA 3D39B 5L7XL 5TFSH 3NH7H 1OSPH 3H9ZA 3ES6B 4G6JH 4OZFB 1S9YB 1U9KA 3M17B 5DHYB 1QSZA 1VGEH 1WTLA 1T1XB 4K3DH 1SJHB 4X6CB 1DE4A 1EGJL 1U8HA 3NGBC 3DXAD 1PJ9A 5FYKL 3U6RB 1KLUB 3GFUA 2DQGH 4JG1H 1RMFH 1QPXA 2H2PD 4V2CB 1CXLA 3BT2H 2EDJA 4GXUN 4LVEA 4IMKC 3EJZD 3QWRA 1D5BA 1TQBB 4OKVA 1LVEA 2YPKB 5IOPA 3UTQA 3TVMD 3KPMA 2W07A 4OD2A 3RVWC 5L9DH 5D7IB 5IVZA 4NNYA 2BP3A 1GIGL 1P9MA 3CZJA 3UJJL 3VFPB 3QIBA 1FL3A 3RGVA 4X4YB 3VRLE 4MCYA 5IFHL 1S3KL 5HTSA 2QQQA 5L88L 3S37H 4NDMA 5H37G 5T1MB 5CWSA 3PXHA 2BOCA 3GUTB 3RGVC 1F4WL 1KN4L 5T3XE 1ACYL 4OLUH 4HK3N 2E6QA 3CVIH 4E42A 5IESL 4HBQA 3JV4B 3FQWA 4ODXA 4ORZC 2BNQA 2DQJH 5BVJB 3WIIL 4HMEA 5B38A 2BC4B 4XI5C 3ARVA 4M4PA 3DX9A 2HTKC 5DJXB 1KJMA 3K1DA 5DK0A 3FT2B 4WCYH 1BQHA 4OZGE 3T0WA 3W5MA 1ADQL 1J8HD 3MYJB 3O3UN 4IRSA 1N6UA 3HLAA 2IQ9H 1NC4B 3KXFB 3BZ4A 4W4OC 4U7KA 5HPMA 4OLXH 4LOUC 2WAHA 5DJDA 1KG0B 1LK3L 4XPHH 3OV6A 2ZWLT 3CVHH 4ZFOB 1NCUA 1TJIH 3VGAC 1FNEB 4HPOL 3QULB 4FQIL 1IC5H 3GO1L 3MFFA 4JANB 4UT9L 4JZOA 2EH8L 2F53D 3ARTA 3V52H 5CSBA 5D7LB 2H2SD 5A16B 1DVFA 5CMAA 4P5MA 5CSZA 5BV7B 1QG3A 3DROA 4PLNC 4MD5B 2WM0A 2JCCB 2WBWB 3L3GA 4YE4H 1M7IA 3V4VH 4M00A 4GRWB 5GGQH 5C7XH 3ZO0A 3X14B 4G80A 3RU8H 4UUJA 3ARYA 1IM9D 3PHOB 5HGHA 3MRBA 3MLYL 3UBXG 3CUPB 3OF6D 2NNAA 5K59E 4NRZA 2QJDA 1U8MB 4WFFD 3VFVB 3QXVA 5CD3B 5DS8A 3S7GA 1KCKA 4HK3J 3OKLB 1WT5C 4PJCE 1XZ0A 1HHJA 1A6UH 1QSFB 2FNBA 1Q9LA 5DJZB 2AJUL 3WKNA 2IALB 4JDVA 1ZLWH 1PAMA 4P99A 3MLTA 4ZXBB 3JTSA 1NGPH 3UJJH 2H26B 4WEBH 3VFWB 2RFXB 4AEFA 4YHZL 1GJIA 3N1MC 4CJ0A 3QDMB 3HI6L 4JJ5B 4J7RA 1P2CB 1YJDC 3MLTB 2UYLA 5I75C 2J1KA 1S7WA 5DMIH 5FK9B 5DTFA 2X7LB 2XZAL 3RPIA 2CMRH 2FB4H 5D6DA 3B6SA 5IBLD 3ZKXC 3CLFH 3B9DA 4I3GA 1BIIB 1C5CH 3VFTB 4I3RL 3QHZH 5DMJB 5IMKB 2D9CA 2BXZA 4OFDA 3GMRB 5BVJA 1JWUA 2FBJH 4JM2B 4S1DD 1CLOL 3O9WD 1WWCA 1J11A 2FBJL 4YZFE 5HVWA 3L7EB 4MJIB 3VI4F 2PO6A 4X0KB 4EDWH 1CTOA 3VE0A 3MREA 4UNTA 3BD3A 3V0VB 1IGFL 4PLJC 5KJRH 3MRCB 3H9YA 4FTVB 2PO6C 4Y1AA 2VLJD 3PWUB 4ZS7L 4KK9C 4S1RL 1HCFX 3MXVH 3F6LA 4JRYA 3TJHC 4HQQL 1UZ8A 3IT8D 4E41E 3LPWA 1MHCA 3P73A 1CF8H 5EO1A 4C4KO 2PW2B 3V95A 4G6KL 3RKPA 5JIPA 5HI4D 4MMXC 2WBJC 4JFXA 4Z7VB 4OKVB 2IQAA 2W1NA 1CZ8H 1NANI 2VQ1A 4NBXB 2P24B 2ADIA 3QUYC 2VYRE 4KQ3L 5HYIA 1MHCB 1EVUA 2C4XA 2R0ZH 4HUVB 1IGCL 1DZBA 3D0VB 1JGDA 4LPWA 1IAOA 4U2YA 5B4MD 4MVBC 2P47B 1HWGB 2DQDH 2PNDA 1T0PB 3SO3B 1A1MA 5L2KB 1FFNA 3MQIA 3U30C 2L7JA 5GZOD 5T1LD 4PJFA 3PP4L 1MJUL 3QDJD 1G7LB 4KTEL 3T3PF 5AAWA 3RTQB 3WFHA 4GMSH 4MA8H 4EUPA 5JDSB 3L3HB 1ZANL 1KYOJ 3SJVB 4OGXL 4PJHE 5ADPH 2JJSC 1KLFA 1RUPL 5J12B 5BS0E 3F65A 4XMPH 1VFBA 1P84K 3B6SB 5EBMA 1P7QA 4WWKC 1BD2A 3IU3A 1JFQL 3DV4A 3K2MC 1S8DB 3V2AR 4MMZC 4F7CA 2Q8BH 1EAPB 3SE9L 4P59H 5GRUH 3G6JA 4JFHD 4GOSA 1S7RB 3ZTJH 4AM0B 4DN3H 4EDXB 5I8OH 4OLEA 3SDAC 5E4IA 2NY6C 1CG9A 3T3PE 4HFWA 3UO1L 3O41B 3ARDA 1B88A 4FFVD 3TT3L 4NYLB 2DQTH 2MPAH 1CLOH 2VZTA 1R3IL 3VFSA 4LCUB 3U9PH 2Z91B 1E4XL 4FQLH 2OZ4L 3GMQB 4Y16D 2YXFA 2WWKO 3VXTB 1DANT 3DGGA 1UACL 3ARRA 4L8DA 1ORQB 4MJIE 5E9DB 5JORA 4G80B 3QNXA 5KS9A 3T0EB 3P77B 1QKZL 4BUGA 1F6LL 1MRFL 1HNGA 1ZXQA 1GAFL 3EHBD 5T3ZD 4L8SA 4PJBE 2QTEA 1N5AB 5CZKA 2AK4B 1EDQA 5DUML 4GS7B 2KZ1B 3SPVA 3WKMH 5IB2A 2R0LL 1UEYA 4HLZH 5K9KB 3LD8C 1HEZB 2NY3D 2VXVL 3AREB 2Q7YB 4PRPD 4G6KH 3TA3A 3DECA 2AI0L 4QRSB 2AXGA 5JHDB 3S34H 1CZ8L 5BS0B 3OKKA 4DGVL 1JZ7A 5ANMA 2H3NA 3O2VL 1IC4L 3RNQA 2H32B 5F3HA 5SWSE 3QRGL 4ZXBA 1U8JA 3IXTA 1C5DB 1Q9KB 1YQVL 3OKDA 1YEFL 2ZSWB 5KS9E 3V6FB 3KPPB 1WTGT 4YHNB 3MJ6A 5TDOA 1U93B 5ABDE 4P2QA 2DB8A 1FG9C 3T2NH 3P11H 3RL1A 4MJID 4OB5L 3W0WA 1AHWB 1WAAF 4RGMC 1MIEH 2ZUQB 3AFLA 2ERJC 4IS6A 4OB5H 2YK1L 1UM4L 5FV1L 2XWJB 5KSAC 2CUHA 1R5VA 2C1OA 1ZLSH 4L4VB 5ICXB 4AENA 4ZNEE 3MLWL 3M1BA 2CXGA 4D0DA 3C09C 3VGGA 3FB7B 3CDYA 1KT2B 2A9NL 5EPMA 4NQSA 4YZFF 4J6RL 3RUGF 1MCSA 1PX3A 5GISL 4C56D 4FFWC 1RK1B 1NCTA 2EDWA 3WNPA 3S88L 2BSRA 1JHLH 4JGUA 1D9KD 5IR1B 3KDMA 1T89C 5E6IC 5D1ZB 4KY1L 1VKXA 4X7TB 3OPZL 5F7KC 1WBYB 4N1EA 5DJ6A 1UH2A 2Q1EA 5A2JH 3WNKA 3MGOA 3CMOH 1DBBH 1XGRB 5DJCB 3U83A 2VQUA 2EEDA 4U0RC 3RVXC 2X4QB 3UP1A 3NFPA 4I2XA 3QISA 2X42A 5LGJA 5IM7B 1SMAA 3ZDXE 3VI3F 1OAQH 3VA6A 2W60B 1K5NB 4JRYE 3WE6B 3IDIB 3EGSA 5FYLE 4E41A 1C16A 2EE3A 1FO0H 1GC1L 3F58L 3GI9H 1JWMB 4X6CA 4FABL 3U7AA 5E7BA 2VH5H 3FOLB 2WINA 3MV9D 1PKQE 3AGVA 4PRHB 5CCKH 4XPFH 2ORBH 3G9AB 3T04D 5C0FB 5D1QA 5IFAL 3L6FA 1N26A 3LN4A 4Y4KA 1HI6A 4U0RB 1JGLH 3GMOB 5I2IB 4J3SA 2R56H 4Q6IC 1GGIL 1J12A 3GK8L 1Q72L 2PXYD 1IGML 5EZIL 3VXMB 4Y0GA 2NW3B 1IM9B 3CFCL 4TULH 3ZL4L 1FDLL 1H8NA 3UTTD 4NKOB 1IMHC 3QRGH 3CJJA 5IMOB 3VFOB 4YBQD 3K1KC 3TA3D 3K0WA 5ICXA 5CBEA 1JPTH 1K85A 4CMMA 1I9EA 2LVCA 3BEWB 4P9HH 2PYEB 3W9EA 1WGOA 4PRPB 3ARWA 5DEGB 4M6AA 1G6RB 4ORGA 2F8OA 1OTSC 3IDGA 5DD1H 2DAVA 2BRRH 3CSBA 2R2HB 3NIFE 4RBPH 1S78C 3L95B 1OHQA 2ZUQC 2Z8SA 5EZJA 1FSKB 5DD3H 5FGCB 3FRUB 4UV4H 3U79A 1BZ7B 3K8KA 4OM1L 3F5WA 3B2UD 1GSMA 1FC1A 1UM5H 5HYEA 3HUJA 3N1PC 4GRLC 3LS4L 3D69A 2O26U 3OGOE 5DQDL 4XCFH 1WISA 1SEQH 4CW1A 1L7IL 3OKMB 3BXNA 3QIBC 4L9LB 25C8H 1FAIH 4XNQA 1NGQH 5J6GB 1JYXA 1LE5B 3MNZA 3QUZB 3D0LB 2ZZUT 1RZ7H 3BKJH 5SX4H 3TPUB 1J18A 2K7PA 2NZ9C 3S96B 2Z93B 2EH7L 4LEXH 1EAJA 4WNQB 1RD6A 1VFMA 3MO1A 1K4DA 3U36B 4CMHC 1VACB 5GGVH 1DFBH 4OLWH 1HOCA 3BPNB 3T0EA 2F53A 2VAAA 2A6DB 3T0EC 4U1KB 1I8KA 4OLYL 2E9BA 3HMWH 5JDSA 1VPOH 4HKJA 2G75B 4LL9A 1HIMH 1M71B 2XOTA 3TO4D 1YNTB 4GW5A 3IVKB 3HMWL 3CFIC 1E6JL 3MACL 2AGJL 1IAOB 1DBAH 2A1WH 5BZDB 4PJCB 1RIHH 2ICWA 2APFA 4OTXL 3RZWA 5IW6B 3UX9B 4JN2B 1A2YB 4S1QL 1QRKA 4HKZA 3VXSE 1N6QL 5F9DC 1EEUA 4NZUL 1MJJA 4NGHL 1J1OH 4OSUH 3RBSA 3RUGA 5AD0B 5L2JA 4LGRB 3BH8A 1JN6B 4HWUA 5LAXB 3MLZH 1Z3GH 1EH9A 4GKOA 1IC7L 2B1HL 5TPWL 4N8PA 3QFDA 4QXTB 3UJIL 1KFAL 2VXQL 5HY9A 1BD2B 2GYSA 2R4RL 4L3AA 3KPTA 4G7YL 4GW1A 3VXNA 3VRLF 2Y07L 4EI5B 3H3BC 3DV6B 3UBXI 2HJFB 1FIGH 4KU1A 4HIEA 1VGKB 4KZEL 1J8HE 1KJ2B 2X4RB 4KMQA 4XWOC 4LLAA 2JJWA 2EIZB 2BZDA 1RUMH 3IFNL 3GSNB 5D9SA 4M7LH 4P5MB 5ID0A 4JEGB 1Q0YL 3BESR 3U30B 1G7HB 4MX7B 1FYTB 1NAMA 4Z95H 4E5XB 3QDJE 4M8QA 1A6VL 2P8MB 4IMLB 2OQJA 3AAZA 4Z95L 4KZDH 4X8JA 2APTA 4WO4C 5JNYB 3BZFA 1AQDB 1FAIL 5E2WL 1EZVX 4YR6A 4I2XE 3UROR 3WNNA 3EDKA 2YPKA 4OCRH 5FHBL 3QIWA 3F7VB 3V6ZA 2OR7A 3QPQC 1CIDA 1DQQA 1JNNL 3P0YH 4KUCD 4QHMA 5TE7L 1MWAA 2AK4A 5T33H 3HZYA 1EHXA 12E8L 3ZHLA 3EYOB 5AZEL 1WFUA 1QP1A 4N90E 4DTGL 3MV9E 4WEBL 1QSEE 1EHLL 2XN9A 4H20H 5D6DC 3U2SA 4NC0B 1INQB 2NY0C 1EEZA 3NCFB 2J6EA 2BOBB 3UXFA 5HDQL 3MJ8A 3GSVA 3C5ZB 2WNGA 1G84A 4NJ9L 3O6FB 3TN0A 4NKOA 3ZKXB 2BOCB 1B3JA 5IHZB 3K2UH 4K3HA 2GQHA 1H3VA 5DUBA 5ESQA 3U48A 1N5YH 5C0IB 1F5WA 2HG5B 5D7SL 5H2BB 5IHUH 5ILTL 3VXRA 1OP9A 1WBZB 2Q7NA 2DWDA 4XVUC 5IBTH 2WBJA 4X4ME 1ADQH 1CXHA 4P5TD 4CW1B 5JDJA 5EORH 5DMKB 4QTIH 4PREA 1X7QA 4D9RD 5ID0B 1I3GH 3ZTNL 5H35A 1U8IA 3EDFA 3LKRB 4Y19A 1AKJA 3MV8E 4UNUA 4AMKL 5E2UL 1A1NA 1UJ3C 5IIEB 4X7DC 4MB3A 3VE0B 4X5WB 4XAKD 4NQXA 4CN1A 1KLGA 3C2AH 3E3QE 5E8DH 2X6MA 2XYCA 1K6QH 3FMGL 3X3GH 1RZGB 1WJ3A 4I18B 1NJ9A 1TETL 4G5ZH 1ZS8B 3HG1A 1KJVB 1CBVL 4JY6A 1A7NH 4PJFF 4Y88A 3X3FL 4KGLA 5F3BB 1MCQA 1E28B 2I9LB 3PG2A 4WHDA 1KGCE 5BV7C 1BVLB 1G7IA 4U0QB 3QCTH 5CJ5A 4R0LC 1Z0MA 1T04B 3DJ9A 4ISVB 5C0BA 3VXMA 1JE6A 1CE6A 2WSKA 4X7FC 1OF2B 4GKZA 4U4BA 2DLGA 4PR5A 4FQXB 3RAJL 3IFOB 2AJ3A 5BVPH 2MQCA 4ONHA 3FO1B 4EVNB 2IAMA 4MNQD 5KVFH 1KPVA 5E08H 4LLDA 3EYQC 3JWOL 4GXVL 4BJLA 4S2SA 2D0HA 4R4ND 5CZVL 2XWJA 1RJLA 4GXVH 3TO2B 4G6JL 5IF0B 5SWQB 1CWVA 2H9GA 2RCSH 4RFOH 5EOCH 1NAML 5F96H 4B50A 4ORGB 4H1LG 2SEBB 1TZGL 3BSZL 1Q9OA 2Q86B 1XF3B 3ZYZA 1TZGH 3BSZH 2AERT 2AQ3A 5JW4N 2XY1A 1IM3A 2A6IB 4JM2A 1C12A 4WWID 5HDQH 4JY5L 2GK0B 3UEZA 1DLHB 2WIIB 4TNWK 1RQ5A 2ZKHL 1QFWM 1NLBL 4XPGH 3C6LD 5J89A 3QQ4A 5DDHB 1MHEB 5C0NC 4PRNB 2V7NB 3WIHA 4YNYB 5AYUH 5TE6H 2VR9A 3ARGD 1GIGH 5AYUL 5TE6L 3V8CA 3QQ4B 4HF5H 1FVEA 5DDHA 4TQEH 5FHAL 3W9DB 3ZT5A 3TNNB 1I1AB 1TVDA 4QOKA 2JELL 2AJXL 3FQRA 3GRWA 3B3IB 2ENYA 5CS7A 5KOVC 3MGAA 4RGNE 3I6KB 3MXVL 2ADFL 4P3WA 4E0RA 2YR3A 3MRLA 2R29H 4HCRH 3HRZA 4J4PD 4APQA 4DZBA 1HHIB 4WFEE 2FYYB 3MV8B 2H1PH 5IBUB 3ESVF 5MEOB 2B2XH 1UWEH 4IHOA 4DK3A 1BF2A 4U1IA 5D1ZD 5HHOA 1I1AC 3U0PB 2JJTC 4L4TA 4PJ8A 5EO9A 5FYJH 3PUCA 3QEGH 3L9RB 4P3CH 1VCAA 2XFXB 1HK6A 2DM3A 2AXGB 7FABH 2G60H 4PV8B 1T21A 3OKKB 1Z9LA 5J1SC 4H8WC 1OAZH 4G43A 2BCKB 5KSVA 3GMOA 2G2RB 4CKVX 2UWEF 1JHKL 4J2XA 4O51B 1IGIL 1A22B 5CEYB 3UZEA 4OQTL 4BKLB 2Z8RA 4JO4H 1JRHH 1T4KA 4GBXD 1QR4A 5TE4L 4JO3H 4CU7A 3ILQD 5MHSD 4N0RA 4KKBD 2PTTB 5TE4H 4NRYB 4JY4A 3IAPA 5LBSL 1FIEA 2PUQT 3JZ7A 2FIKB 1MCOH 3U9UA 5KW9L 1W0VB 5I1GH 2A6JA 3FN0H 3CMOL 1N4XL 2H41A 1ZHBB 4XNYL 4NC1C 5F7WC 4PY8I 4HV8A 3V5DB 4LSTH 1XGUB 3FT3A 1NBZB 2I60H 4LGSB 4NN7C 2EDBA 1T83A 3TT1L 4OZFA 1IQWH 3EYFB 3A6BL 4LAQH 3O41A 2KZWA 3AU1B 5JPMB 4R0LB 4LLVB 4FQCL 3RVVD 3KDMB 4Z7NE 2Z92A 2ID5A 3NFSH 5KZCD 3ZT7A 1JF1B 4JFPB 3FZUC 3DUUA 2F5BL 3B9EA 4M4RA 3ZT6A 4HPYH 4BFGA 4ZTOH 1HE7A 1RZFL 4YUEL 5K93A 4Y4HB 4ZUSB 2ESVE 1NCCL 4EI6A 1ADQA 5CEZE 2YWZA 5IFAH 1AXSB 4ZYKA 3KPRB 1MFNA 1JJUA 2Q76A 2R56L 3VCLA 2AJYH 2EXWD 4JM2F 4P5TA 4NJAH 3VRJA 5J9PB 1A21A 3O0RL 1B4JL 5GJTL 3KS0J 5I71B 1JWMA 4YK4C 1X4ZA 3MBEC 2X40A 1YEKL 3WFBL 3T0VA 3K46A 5CUSL 2OL3B 1KULA 5IFJB 3WS6C 1A1MB 2BK8A 2J6EH 1OM3H 2JIXA 2DJ4A 5IB5A 3P40A 5T3ZH 1YEEL 2P8LA 3VWKA 2XTJB 1EV2E 15C8L 3AB0B 4NM4H 4Z7UB 1T0NB 3DVFA 3DTXA 3Q2CA 4NM4L 3VGEA 4IMKA 1FFOB 1TVBB 2IEPA 2DQCH 3PJSA 5FKPA 4ZFGH 4CDHA 2DQCL 1BD2E 2V7NA 4OQTH 4NC1E 1X6NA 1XCQA 4PTUA 5FYJE 4MXWH 4YDJB 3CX5K 3LS4H 5GS3A 5ITBH 3R1GH 3E1F1 3MXWL 2DQDL 4N8VA 4XTRC 3KR3L 1AGEA 1YMMA 3R06B 1I1YA 4TSCL 1WCBA 3GMRA 5F6HJ 3FJTA 1NCBH 2KBGA 3DV6A 2FR4A 4QF1B 4LSSL 1RUQL 3CPLB 1J88A 2M1KA 4FTVE 4YHML 1MFEL 2W60A 1RUQH 2CDEA 1H0DA 1QFUH 4Y16C 4UAOC 1PEWA 3A6BH 1V3KA 3HZKA 5E5RB 4BZ1L 4ZPVA 3PDDA 3IDJB 3VGDA 1CICB 1LDSA 4YIQA 3SQOL 1U8NB 1UT9A 2FBOJ 3RWFB 3ZZ1A 3ABZA 3CDCA 3TO4A 3RWJA 1MVUA 1HKLL 4Z7VE 2CUIA 4RCAA 5FOBA 4RFEB 1R5IB 3BZFB 5TGBB 2AGJH 3SDAD 1FJ1B 2BHUA 1MAML 5B3JF 4OTXH 2RIKA 1CE1L 2OYPA 1NFDB 1B0RB 4NO2B 3P4MA 1A3QA 3KG5A 2HT4C 4P46D 1OGTA 3GJFH 1AJ7H 4UU9A 5CD5C 4LKCB 3OAYH 5GRJH 3HMXH 2VZ3A 4X80L 2D7QA 5EZIH 1XF4A 2QLVB 2J8OA 3MLZL 4DJMA 4CJ1A 1U91A 4KJYA 5IW1A 5EULV 4TULL 4IDJL 1MPAL 4PRAA 5JHLL 2XN9B 4BZYA 4I0PB 1YNKH 3LEVH 1UEMA 32C2A 2DYPA 3BHBB 4XX1E 1G9NH 1NBYB 2YA2A 1U3HB 1A47A 1IKFH 4NM8H 5H37H 2DOCA 4GW1B 4XNUH 1XH3B 4LLYA 3BOVA 1X5GA 3HNTL 3ZHKA 3CSYA 5MP6L 3U0WH 5E99H 4U33A 5GZOC 1KENL 4LNVA 3KNBB 4TUOB 1I9JL 1PGRB 2YS4A 4GH7B 3C60C 4H5SB 5DC0A 5EA0L 2ICWI 4EZMA 3E2HC 2IFFH 4JRXE 3V6OC 3RQ3A 4WO4A 1HH9B 1OD9A 3NPSB 3V6OA 1EEYB 1OQXA 4XVUD 4MQXD 3QDMD 3BKYH 3OX8A 3L7FB 5EU4B 3SDCD 5EZJB 1VEMA 2YUZA 3HZKB 1I7ZA 3NCYS 4YBHA 4ZODA 3RVTC 5BMFL 4X0KA 1R3JA 2X1QA 1KJVA 4JPWL 3T4YA 5SX5K 1FNLA 3ARBA 5C0DB 5KTEL 4TVPL 2C5DC 3BQUD 3EOTL 4RNRA 5E5MA 1ZSDB 4KH2A 1BREA 4Q0XH 2A6DA 4O4YH 2V2WB 4LBEA 1MWAB 2KDGA 5C09D 1K3IA 4UILH 5A16A 3HZYB 3TPUA 4OLWL 2B0SL 3ELAT 5F1OB 3TBVA 4DWHA 3VWKD 1YQ2A 4QGTA 4KMTL 4UDUA 4LASH 3QIBB 3GZKA 4GUPB 3LB6D 4M1DH 3IDYB 3L1OH 4NZTL 2ADIB 4LGPB 4XVSL 4KI5D 4XPAL 1OPGL 4NUGL 1I1FA 4GRLB 3U4BL 3EOAA 2F8XC 1J9CT 2P1YA 1JZ6A 4XBEL 1GYAA 1Z0NA 5HYFA 4XC3H 1QPPA 1IRAY 5F9WC 3BP6B 3INUH 3CCHA 1EPFA 2E5EA 3K2UL 1EO7A 3BFOA 3MLVL 2GTWB 5IFJA 4NPYA 1R3HB 2IH1A 2R23B 1K3ZA 4RWYH 5DK0B 5DJXA 5C9JB 4OM0H 1P4BL 1QBLL 3RX5A 2AEQL 4WI7A 1ZVSA 3ZHDA 3U7YH 2ICES 4HIEB 4HWBL 3OAUL 4Y89A 5C0RH 5LKNA 2PYEA 1QSFD 4Q9QH 4P46B 4Z0BL 3NZHL 1YEDA 4QXTA 3V7AG 1EK3A 4ZQKB 1NANH 1PG7W 5HY9B 1A4JA 4JFDA 4YHPB 4N0YL 2ZNXA 1JBJA 2HH0L 1CFVH 4E41D 4ELMB 3D0LA 2XWTB 1V3LA 2Y72A 5F72S 4LEOA 1L7TL 2EYRA 3CZFB 3KPOA 2YN3A 3RA7H 3QWOA 1ZVHA 1CBVH 3AMKA 3E6FB 4LDOB 4LSRL 4G6FD 4Z7WA 1ZVYA 2YUWA 4ODSH 4MS8C 2NR6C 2UY6A 2JLLA 3IJYB 1JPSH 4F9LC 4DW2L 1WIUA 5DR5L 4GG6B 4AQ1B 3WJLA 4JRWA 5DZOA 2IH3A 3O9WB 1OB1B 3QXDB 5LQBH 5F21B 2A77L 1NKRA 5GGVY 5KSUA 1K2DB 1RVFH 4I5BB 1RUAH 1K5NA 4MDJB 1IEBB 3LIZH 2JJUA 2VZOA 5JOFA 1NH6A 2V6HA 1MCWW 5DD0H 3X14A 3GM8A 3KPRA 2DL2A 4RMRA 2FGZA 4RRPG 3BO8A 3KJ4C 3HAEA 4XPTL 1WIPA 3KLHC 4U3XA 3QDHA 1OQOA 4BUHA 1FFOA 1P2CA 1RIVH 1P7HL 1OPGH 3U4BH 3HCVA 1G7QB 4AIZB 3VFPA 3C09B 4CRPA 4XBEH 5IVXB 1GHFH 3OZ9H 4HHAA 1TTUA 4PV8A 3HNSL 4UB0H 3RZCD 1JV5A 3WYRA 4OBRA 2IC2A 2NY7H 2YUXA 2Y06H 5ISZB 4PGDB 3VWKB 4PJXF 2IWGA 3MROA 3FQTA 4Z0XA 2KQNA 3UTSE 1BQHG 3HLAB 1WITA 3FRPA 4K7PH 3FO2B 3FO0H 4GRLD 3PGCA 1N5YL 4MXVE 3BX7C 3B9VA 2HN7B 4ZUTA 4B0MM 2CK2A 2LU4A 2H2PC 2N4IA 5C0RL 4YDLC 2RB8A 5C07D 2AJVH 4MAYA 4M7ZB 3M17A 5HPOA 3MX0A 5E8PA 2R8SL 1TZIA 1OTSD 2F8VA 1U3ZA 3O8XC 2N7BA 5D6CB 2YD3A 3OL2A 4FQQA 5IB3B 3C6LA 4RGOH 3WIHL 2ITDB 3FHQA 4WNQA 5FGSA 3CVIL 3UTSA 8FABB 4K3JL 4ELMA 4KV5E 5IVOA 3E0GA 2NY1C 2W59A 2UVEA 4PJ8C 4OD1H 4DCQA 5FO9A 1FNEA 3EYUH 2E9JA 3STLA 4NP4L 4PJBB 3DSFH 3RKDC 3VXOA 3KPMB 1NCDH 1QNZL 3QNXB 2VXQH 1MHPL 4I18A 5GS0H 4M6ML 3VH8B 3HC0B 1VFAA 4MAUL 1RURH 4LHUA 1MRCL 5L6YL 4LF3B 2XRAL 4E41B 43CAA 5B8CC 1NSNH 4LPUA 5F1IB 4PIRF 4HKXA 4RDQF 1KYOK 3G6DH 4MS8D 3U82B 4TSBH 4N0FA 2VMFA 2FO4B 5JR1L 1ZT7B 2ZUTA 3LIZL 3W0WB 2MTPA 4JJHA 3SCMA 3VFNB 3V52L 5F9OH 2R4SL 1PLGL 3LDBC 1R5WA 4EUPH 2G5BA 3MRIB 2XXMB 3ROLB 4OI7A 3SE4C 1LEKB 3GMMB 2VKWA 4L3CA 4C83B 3DX6B 1KTRL 3UAJC 4PRNA 4HH9B 1CQKA 3BD5A 1JGVH 4WFHD 3WLWD 2J2ZA 5EBMB 3O6FA 2ZUVA 3UZQA 2ZCHH 4LPYA 1MELA 2NY1B 1BFSA 1XGYH 1C12B 4HDIB 5F7LB 4NT6B 3O3AB 4IRJC 3KPNB 3MLUL 4X5WA 4M7ZC 1BEYH 1AY1L 3GHBH 4J3OC 1S7SA 4H8WH 1F58H 2A6JB 2VDRL 5I1KH 4ZSOB 2DLEA 5ACLA 4L4TD 1BOGA 1IGYA 4GG6A 1JK8A 1NKOA 2HFEA 1A3LH 2AJXH 2CDGB 4XP1H 2R39A 3ULUH 4XAWH 1KN4H 1E27A 4PJGB 5KVGH 5CSGA 4XP1L 3TFKD 3D48R 3IRPX 3PWPD 4OLVH 5IJVB 2MCG1 5HYJE 4Y1AD 4D3CH 2MNUA 3WXWH 1KIQA 1RHFA 3FB5A 5DUPH 3UTPE 1F4WH 3HC0A 3EUUA 1I9IH 2VLJB 5HHME 3E8UH 5GGUA 3VFUA 5HXMA 3VWKC 2ZG2A 3RL2A 3EOBA 5DC9B 1MEXL 5IV2B 2HRLA 3DOSA 1FZMA 2J7LA 2CXKA 3EDJA 5IHUL 2W91A 1BVZA 1ES0B 3NCJL 3IB4A 3DLQR 5DD5L 3QQ9C 2F54D 5B22A 3I02B 4JQXC 1UCTA 4ZAKA 1TCRA 2EC8A 3MLSL 5F89B 3O11B 5FOJA 4UOW0 4NRZB 1GC1C 3O4LB 4P3CL 3MJ8B 3ARGA 3U0PA 4L8CB 4R7NB 3K8LA 3RUGE 5I1JL 4NZRL 3T1FA 4ENED 1AIFB 3ZE0F 4CVXA 4UT6L 5AZ2H 1EBPA 2PW1B 3W81A 4MQXC 3S5LG 5GS1C 1RUKH 2HTLC 4DKDC 5T1DL 1RUKL 5I75B 2BNRE 2VZ1A 3I2CH 3I50H 1KCVL 3FFCE 3VD5A 5DF0A 3MXWH 5EBGA 1A7OL 2DI7A 5C0EB 2FATL 4TSAH 3BH8B 5LAXA 1J8HA 4OZFG 5SV4A 5HHVH 2DQHH 1T7WA 4V1DD 2AEPL 3H9SA 3FB6B 4FRWA 4WI5A 5LBSH 2HWZL 5EUKB 5A40E 4U1SB 3TNNA 2AEPH 1P4LB 4S1SL 4MCZB 1OGAE 1V7ML 3ECBB 2NX5A 3QUMH 3H0TA 1KPRA 3LRHA 4PJGA 5EFIA 3TT1H 5C08A 1IQDA 5CLTA 4JREB 4NO0D 1YN6A 3SKJH 4UDTB 1G9MC 4KC3B 5DZLA 1LMKA 2D03L 4LLWB 2HT4D 4P46C 1S7SB 4O2CA 4F7TA 1B90A 1TVHA 3QXAA 3HPLA 1YEGH 2F53B 1SEBA 4PJDA 1YEGL 1Y18B 2E8ZA 2IBGA 1T1WA 3W82A 3S96A 5I15H 2XA8H 4FG6D 5EC1A 1IGJA 4PJGE 3E8UL 2AJYL 3BMWA 3PHSA 4RFEA 3MNWB 2P48B 2WQRA 5EN2A 1TQCC 3IJSA 5J8OA 1YMHA 3BAEH 2RGSA 3C9NA 2D7OA 4H1LH 4ISVA 5C0BB 5TF1L 1UACH 5TF1H 5DJAB 4WENB 4UINH 2GW5A 1IGFH 1UFUA 5C92A 3KYOA 4YPJA 1ZHLA 1NFDE 4HUMB 1SM3H 1WAAA 4PJ7B 4NCC1 1EEZB 3SKNB 3NACL 2NY5C 4YC2B 5B3JE 1BQHB 4QOKE 3TJHD 1PX4A 4X5XA 2BOBA 3FQNA 3KLDA 4UNVA 1T1ZB 2AI0H 4PJAA 2D2OA 2NX5D 4PRDB 3L5WA 4DKAA 3QP3A 1QRNE 1ORSA 5HGDA 3BKYL 3TVMA 4X99A 4WW2C 4PRHE 3QXTA 2X7LA 5EFIB 5D2NA 4KKNA 4OUUB 4S1DC 5FYJL 3T0DA 4PLKC 3PP4H 2EDOA 3QULA 4NQDD 1MH5A 1QVOA 2P42B 2YPLA 1OL0A 2WWMD 4WW2A 4JFPA 1WLHA 2BFVL 2I25N 2DJUA 4AG4L 2FJGA 2HKHL 2EO9A 2BFVH 5JNYA 5CGYC 5EU6B 4J3UA 3EYVA 2VB5A 4MLSA 1ZANH 5FA4B 4OFYD 4UILL 4LLUB 1D6EB 3SDCA 5C1MB 3LS5H 2X4SA 3CK0H 4JB9L 3SQOH 2OTUB 2PYFB 3NGBB 5IWLA 2EXWC 5A2FA 2WK2A 2HT2D 4J6RH 3HPLB 1MI5B 2ZOKB 5C71A 3IKKA 2ZOLB 3G5ZA 3RWGA 3R0MA 4PJDB 1FNSL 1VADB 4M61A 5IEHA 3O4LA 4A6YL 3U2SB 1QFHA 2CJUL 2Q76B 3KVQA 4HGWB 4D0BB 3FZUD 1I3RB 4OLZH 2VNCA 4X83A 4Y4KD 4K3GA 1KCRH 2P7TA 2MHAB 4KKAC 5HHMD 5F7MC 3T0AA 1WZKA 3S37X 5HVHB 2UYLB 2VN7A 3UPAA 3S9DB 3DX6A 3HAEB 3SDDC 2UWEB 3O3EA 1U8QA 2F5BH 3QA3B 1WEJL 2Z31B 2OZ4H 3OQ3B 2CIKB 2VL5B 4FZEL 1TPXB 2H2SC 5SWSB 4Q9CA 2MOVA 4JKLA 1S5HB 3R8QA 4XCNA 4PLOB 3JTSB 3G6JF 4Q9QL 3UTTB 3OJVC 1ZHNA 3DYMA 4NM8L 4PRIB 1VDGA 3WFDL 4OCSH 5I6XC 4D2NA 3F5WB 3ILQC 3GJFA 4NBZB 4Z7QF 2V2XB 1M7DB 3OJ2C 1MJ7L 2YSSB 5SWSD 2E6PA 4PP2A 4DGVH 1QSVA 2IFFL 4ODWA 4A6YA 3IDGB 3RKDD 3GJFB 2MCPL 4WU5B 3TF7C 4FFZH 1FCGA 4PB9H 5I73C 1FDLH 1G0XA 2X4QA 3MRJB 1MVFA 5GRVL 4QRPD 4O2CB 1L9NA 3D85A 3BP7A 3H9HA 4PJHB 4Z77B 3VG9B 4PJ8D 5KVEH 3LRSB 5IHLB 3SBWC 1YEFH 5KVEL 3HI5H 3U36A 4AJ0A 4F58H 1ZAGA 1DCLA 5DJ6B 1AD9B 3FCTA 3IFLH 4B5EA 4PJXA 3WCYA 4OZ4B 2YRZA 3VMOA 4XC1H 3VJ6A 4R4BA 2JK5B 1KGCD 3B5HA 3D39E 3G5XB 4L4TB 5I9QC 2R69H 1JMXA 3PL6D 4JVWA 4PJBF 3N1FC 3LS5L 3I85A 4A2MA 5JW4R 2B0SH 4JHWL 2Z4QA 3JTTB 4J4PC 5JOPD 3ET9F 5FA3B 1K2DA 2D9QB 4IHOB 2R0WL 2HFFB 1AE6H 2CLZA 4IIQC 4XPAH 4HJ0C 1LO3L 3QHFH 43CAB 4L4VD 1DN0B 5I76A 2W9DH 4H26B 1YMME 2J88H 2OI9C 1TCMA 3VG0L 5HBBA 4PRPA 1DR9A 1ZHNB 1FZJA 3CFEA 3VFGL 3TYGL 5GQBA 1A6WL 4JPIA 4LARH 1NC4D 1NCWL 3KXFD 1XCQB 4FP8H 4LARL 5GSRB 5CWSB 4FFYL 2Q87A 3S5LA 4DFHA 5IVXA 2OBGA 3WN5B 1RK1A 2XY2A 2XTLA 3BUYA 1A4JB 1FNGA 2BSRB 4QXUL 1J0YA 5E0QA 3EDDA 2VH5L 1YNLL 1LEKA 4QHNB 4O2FB 5DJ0A 1S9XA 4HS8L 3WHXA 1BFVL 4AENB 2E9IA 3TZVA 4JPKH 3B5GA 3MUHL 2YPVH 3LMJH 2A83B 3RWHA 4HK0B 3QUXB 3SHSA 2ZCKH 1N6QH 1WIOA 1E27B 4ZUTB 4EI5D 3F7PC 1HHKB 5MENB 1NGWA 5T3ZE 2NY2C 2YRPA 1N8ZA 1OT1A 3OKYA 3HC3H 4PJ5B 1IGMH 2K3TA 2PYFA 4C54A 4DZBB 1MPAH 2XKNB 3UTZA 3WL9B 1U6AH 1OCWL 5D5MB 1JPTL 5HGAB 4KVNH 4JAMB 5GS0L 1NMAL 1SBSH 2DKMA 1VFAB 1TPXC 4XNUL 1DLFL 4DW2H 3DNKA 5MI0C 2JJTA 5MP6H 4P23A 3FB8A 5B3NA 1K8DA 2YMXH 4HWNA 2OK0L 4OZ4A 4YWGH 2B4CH 3EW3B 1A14H 3WLBA 5IROA 1IC1A 2ATPA 1FC2D 3L5JA 2X4PA 4ZUWA 4U6YA 3HE6A 5C6WH 5C3LD 2RBLA 4WGWB 4OAWB 3BDYL 3QZWB 4U1GB 2AEIT 1FZJB 5D2LA 3O4LE 5E2JA 1X5AA 2E27H 5IVNA 3T2QA 4ZUVA 2E27L 4RQQA 3CFKA 1J1PL 5DHVA 3X13A 1Q9OB 3K4AA 5DK2B 4XB7A 5IQ9A 3ETBF 25C8L 4IRJA 2VZUA 1RJLB 4PJDF 1LO5B 1MCFA 4RFNC 2Y06L 4KI5C 3IDXL 3SCMC 1AXTL 1CGTA 1RMFL 4POUB 5ICYA 4R96A 4LSDA 4PGDA 2BJML 1QQDB 4LVOC 1AY1H 1F58L 3WHE0 1MQKH 2HP4A 3KPOB 2XZCL 5L9DL 4HX1A 2ZCLH 4XVSH 4YLQT 5C0IA 1MQKL 3QH3A 3S37L 1WUNT 3QCVL 2ZSVA 4JRYB 1G7PA 3RWIA 5T5FL 1HQ4A 4WDIB 4JO2H 5KVDH 4YHKH 4L1DA 2NY0D 3IAQA 4OLVL 5TF0A 2KQMA 4JO2L 1R3LA 5DUPL 1KCUL 5AEAA 1PKQB 4HCRA 4YEFA 5FYKD 4WIQA 3WXVL 4BQCA 3RVTD 2NXYD 2Y5TB 3MRHB 1QSEA 3P9MA 3VXQA 1HSBB 5I1IH 3MLPA 3VXUE 4JFFB 3O2DL 4XZUB 4N1HB 1UH3A 3T4YB 3MYZA 4NQXB 3NCJH 1OOAA 5FM5O 4D9QD 2CR6A 2OMNA 3CDGB 1KFAH 1OSZA 2BY2A 3JVGC 5CSZB 5TPWH 3FN3A 1KEGL 2HLAB 4LQ1A 4K23L 4YDIH 1P69B 2OTUA 4QY8B 4N0UA 4RIRA 3DSNA 1HH6B 4HJJL 1UXSB 4BH8B 3REVB 1IT9L 2XRAH 4PJIB 5INDA 1S7XA 4HUVA 4JR9H 5L2KD 1DDHA 4RX4D 1CGWA 3O4OC 2YD2A 5DGRA 5BOPA 4Z7UA 1Y0LA 2QQKH 5FB8A 5BS0A 1U8QB 1CFSB 2OXGA 4OGYL 4Q6YA 4XP5L 3REVA 3WUZA 2BNUB 1OAXL 2IADA 3IU3B 3FRPG 3VXUD 4NO3B 5F7NC 4TVSa 1PLGH 3GSUB 4PJCA 1CCZA 2P5WD 4QHKI 4X6CF 3CSYB 5C6PB 1EMTH 4M5YL 4YH6A 1Q0YH 1JRHI 3BD4A 3CAFA 3DHMA 4Y2DD 5TJWK 1ORSB 2O5ZH 3MA7A 1HN1A 4N0UE 2WIIA 5HHVL 2FSEB 3ULUF 4WEUD 2AV7A 2DKUA 3U7WL 1PDKA 2X1XR 4Z18A 1SYVB 1P5UA 3ZE2E 3V6OE 3QSKB 4JREC 3FQNB 4MD0B 4PJ9C 2VIRA 3VI4E 1NQBA 2FJFA 1YA5A 4NYLA 3RPIB 5C08B 3MNVB 1LILA 5CJXA 4NSKB 3GHEH 1YN6B 2DIJA 4LCWD 4GG8B 1O7VA 3O2WH 1ZA3A 2Q3AA 5AZEH 3GHEL 2BJMH 3MJ9L 2XXCB 2DWDB 4RAUA 5T33L 2HMID 1EHLH 2IPUG 4JN1L 5FA4A 4PV9B 2EC9T 4G8FB 3FT4B 5D8JH 2XZCH 3TBTA 1N3NB 4HKBB 4WFED 1JTOA 3D69B 4RAUB 2XWTA 1A3LL 3ULUE 2EIDA 4HXBH 4ZOBA 5AWNH 2EXYC 1H3UA 3VA2C 5EUOA 3NN8B 1NDMA 1KIRB 2IGFL 1NCAL 4LRIC 4RIRB 4TTGA 1NFIB 4JGJA 5HGBA 3FAXA 1ZK9A 1MEXH 3T09A 2FEEL 4KKCD 2VQTA 5BOZG 5E6ZA 4R7NA 3IF1A 4JFFE 3ARBC 1GXEA 3KWWA 1II4E 2E7CA 5ALBL 3L3IA 3QZWG 2GIYA 4R90L 5F8RC 1P7KA 5ALBH 1A6ZA 1ITCA 4KROB 1X5XA 3CU1A 4MZ3A 5EORL 5L2KA 5D7IF 5CILL 5AYQA 5E2UH 4POZC 2CKBA 4H0IA 4CU8A 4N5ED 4OIBA 3SGKA 3DVGA 1BZQK 1QBML 3C9NB 4OD1L 5C8JA 1NUGA 1CLZL 1QBMH 2IALA 1J8HB 4JDVB 4KQ3H 4HKZB 2B2XL 3VD9A 4WFFE 4PP1D 3STZB 43C9B 2V5RA 1KTDB 4OQ1A 5EBWB 4DVBB 4HIJB 1YEIL 4YFLF 1TETH 1ZA3B 4UOW1 1DVFC 4AEHH 1EEQA 1FQ9C 5D1XC 3B2VH 3QQ3B 4YDVB 3LRGA 1H3PL 3MJ9A 3B2VL 4OF6A 3IGAB 4NRYA 1T22B 1VFOA 3VMNA 4RAVB 5EG6C 2XT1B 2X9YA 3U4EA 1EFXA 1WC7B 2A9MH 3EAKA 4LIQE 1V5JA 5L8LB 3FL7A 3LN9A 1KC5L 4LDLB 5F9OL 2PXYC 4N9GA 4JB9H 2M26A 1LO4L 2RCSL 3PL6A 4RRPA 1V3JA 4KI5E 3P4OB 3RFZC 1P84J 2C3GA 4JO3L 4WY7L 5C0JA 1CR9L 3MFFB 3NIDE 3NIGE 3UTSB 4GQPH 3SE9H 1KBGH 2ATPB 4MWFA 1LHZA 4BQ6A 5I8OL 3UTQB 1EO5A 4PY7A 3LN4B 2LAGB 4YQXL 2VERN 2CJUH 1ZV5A 2YKLL 1KIQB 1S7QA 4U6HA 1LEIB 3CVHB 3JV0A 4P5KB 3KXFE 2Y25A 1J7VR 4MJ2A 4KKBC 4LAQL 2W65B 1DBML 2CRIA 3QHZL 3WSQH 1C08A 4XPGL 2HLAA 2GY7B 5JUEH 4JHAL 4U6VH 3QIWD 3CFBB 3LH2H 5J11C 3Q5OA 3I75A 3NVQA 5ANME 5F1IA 2G75A 2VDRH 5DWUL 3TLRA 3AM8C 1IJ9A 2JELH 5DWUH 1KNOA 1ZTXH 3P4NA 2F19H 3ULUL 2YC1A 3O6FD 2FD6L 1CGYA 4L8CA 4Y7MA 4ZUVB 1H5BB 4YAQA 3G08B 3BPNC 4AIZA 1MJ7H 1S9XB 4O51A 3MRGA 4HCRL 2CLRB 2XTJD 5BZWB 4Z78A 4R8WH 1FVCB 4R8WL 2EKJA 2HVKB 2EE9A 3VFRB 3BP4A 2ZG1A 3VD4A 4R4FL 3MRGB 5KSAD 4NBYB 4FZ8H 5F70A 1YEIH 1H3XA 5DD5H 1L4IA 2YXMA 4FZ8L 1IEAA 3GB7B 5K9OA 3HI5L 1G9MH 3H3PL 2JCCE 1ZWIB 3OGCA 4ZO7A 3HE7D 3IFLL 1OAYL 1KJ3L 5J11B 1U8LB 1VENA 2ARJQ 1U8HB 3QPXL 5ALCL 2ILLA 2YK1H 4UIMA 3AS0A 2FR4B 1MIEL 1T20A 1VFUA 3QXUA 5FECA 1PY9A 1KUMA 3CK0L 3ULSA 3T4AB 5ANMB 1A9BA 5GISH 3G6AB 3WJJA 5J4MA 5JW4Q 1O7SA 5EH1A 5EUOE 5SX4I 4L8SC 2A9NH 1BGXH 3C6LC 4Y4HA 3QDGA 1OGAD 3LSOB 3O8XA 1EVTC 5DJ2B 4KUCF 2UZIL 4MWFB 2P7TB 5F88B 3CC5A 5I8CA 4BSWB 3BGMA 3OR7B 2WLYA 1JHTA 1KXVC 1YEJL 2CLVB 4FXLA 1T0NA 4YHIA 1D6VL 5IOPB 3MRIA 1A6WH 1GPOL 3THML 1BQSA 4HUKB 2I60L 2MFNA 2DMCA 4YAQB 5F9JB 2X5PA 1UVQA 4QRRE 3EZ8A 3O45A 4LIQH 4FS0A 3LH2L 3ULUC 2OL3A 1EJ6A 1ZT1B 4L29A 4LIQL 4PGZA 1FNAA 3KHOA 4JQIH 5I8EB 1AR1C 3OKNB 4RGND 5IGXH 2IANB 4JQIL 2DBLL 1DN2A 1GGBH 1QLEL 3MRMA 2BY0A 4X6DF 3VXMD 1F02I 4X5LA 3N9GL 4Y5VC 4OV5A 3TZVB 1SYSA 3QO0B 2H32H 4OCSL 5ID1B 1K8IA 1NC2B 1J05A 4ZPTA 4PRIA 3CSGA 3GSNL 4YDKL 4X4XA 4LEOB 3OJDA 4O58L 4HWZA 4WWKD 3FT4A 4G8FA 1FPTH 1WZMA 3D2UB 3QWOB 1Z9MA 4B7LA 3VFRA 1QLRB 5BQ7B 8FABA 2UUDK 1BQLL 4IDJH 3LKQB 4C58B 5EOQL 3CFCH 2J6E