5H2BA

Structure of a novel antibody g196
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
216
structure length
216
Chain Sequence
QVKLQESGAELVKPGASVKLSCKASGYTFTNYWMHWVKLRPGQGFEWIGEINPSNGGSNYNEKFKRKATLTVDKSSSTAYMQLSSLTSEDSAVFYCSIWDSYFDYWGQGTTLTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords G196 antibody Heavy chain
publication title G196 epitope tag system: a novel monoclonal antibody, G196, recognizes the small, soluble peptide DLVPR with high affinity.
pubmed doi rcsb
total genus 39
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2016-10-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5h2bA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5h2bA02
4LCYA 4DN3H 1R3HB 3PWPA 1Y0LB 3I6KA 4JHZA 2FX8H 5T3ZD 1UZ8A 2G75A 2CKBA 1UKSA 3OG6B 4P23D 5ALBL 5DJYB 4J4PA 1SJXA 3G9AB 3ROLA 2CRIA 1W72H 4KFZC 2OTUA 3C9NB 4ZUSB 3QO0B 4AZ8A 2H32H 4EKXA 1DANT 2EE3A 1AD9B 3FB6A 1Q1JH 4NZDA 3ULUH 1MJ7H 3IS1X 2BC4B 1UM5H 3O81A 4GRWB 3SPVB 3Q3GA 2ZUQB 4JRXA 2IAMC 3C2AH 4GLRH 4HUWB 3P9MA 2PR4L 5DJ2A 1OM3H 5JW4Q 2IANA 3K46A 2VAAA 3LRHA 4Y16D 1FBIL 5E4EC 5C6PB 3JV5A 5DURD 1D9KA 1QQDB 2CIKA 3AY4C 2HWZH 4N5UA 4WRLA 4U6XA 4F9LC 3DMMB 1FL6B 4P5TC 1M05B 4X99B 1K4DA 5IESL 3NZ8B 3HZMA 4LDOB 4MD0B 1OGAB 5FUOH 3RVVC 5AEAA 4GW4A 4ZTPH 4R2GD 4XH2A 2VSCA 5C0FA 2W0FA 3TT1L 1IGYA 3DV4B 3K7UA 4UOJA 1MHEA 4KUZH 1U8MA 5F1IB 5AZEH 4ZUUA 1RZ8B 5C0BD 4UNUA 1X5GA 5C08A 1AXTH 3BKJH 5TPWH 1U8IB 3RQ3A 4F7MB 2YWYA 5EZLB 5EBWA 3SE9L 1CCZA 3QCUH 2GJ6B 2BHYA 3EYSH 3IDGB 5I1JL 3Q1SL 3H42H 3FQUB 3QI9B 4MA1B 5M94B 3DYPA 1WSST 2AABL 3ARGA 5HHXH 4UV4L 3PQYA 4NQDA 1AO7A 3MR9A 1NC2A 3FO0H 4FFWD 4EBQL 1NSNL 3BKCH 5TQ0L 1CS6A 3RA7L 4Z76A 2DLHA 3QQ9D 1IGFH 1MFCL 4LEOB 4OZFB 3QG6B 1RIUH 3SJVB 1INQA 5DSCB 1BJ8A 2GUOA 4A6YB 1P7HL 1ORQA 2QSCL 1OT2A 3C6LB 1AY1L 1GZPB 3TIEA 4U1MA 5DQJB 2VUYA 5C0IB 2UY6A 1BD2B 4XBPB 1I3RA 4PJ9A 3V95A 1FVEA 4YR6A 3HUJF 4NFBA 4JPIA 4ODVL 5D1QA 3GJEA 2P8LA 2VDMH 4OFYD 4M7JL 4BFBD 2OR8A 1AP2B 3S96A 4LSUL 3OX8A 4L5FL 1WWAX 1BM3L 1KIQB 1KJMA 3G9VA 2ZJSL 1H3PH 4N9OB 2WBJD 3VMOA 5A3ID 3SHSA 2X4RB 5D2NA 5DMKA 4L4TE 1KIRA 3D9AH 5K59E 3ZTNH 1DBMH 5C0CB 5FGSA 5H2BA 2DQUH 3RZCA 3VFPA 1YNTB 3VI3E 5E94B 3BZFA 3RNQA 2XN9D 4LDEB 5GISL 5IVZA 1NCDH 2Z31D 2CK0H 3QDJB 2VDQH 4X98A 3TESA 2JELH 1OWWA 3O3BB 1ZAGA 4HGWA 4HPOH 4WWKA 3UTZA 1U41A 3GKWL 1F8TL 1UXSA 2OJEA 5I73B 4W81A 2QR0B 4HBQA 4UI2A 1OB1B 3BP7B 4X6CA 3IXTB 4P4KB 1RMFH 4HZLB 5I15H 1MNUL 1NDMA 1S9XA 4PD4J 3SKNA 3SDCD 4MX7A 3UTTA 5DVLA 1S7VA 2PXYD 3C8HA 4Z7WB 2FO4B 4PY8I 3VD3A 4UTAH 5E8PA 3W0WE 1CG9B 4BH7A 5E8EA 1CGSL 1ZVSA 3T0EE 4PLJC 3NPSC 4PJHB 4K7FB 1JNLL 2R2BB 1CZ8H 2XWBA 4JFPA 1IAIL 4XC3L 4KK5C 1AQKH 1RHFA 2V5TA 1MFAL 1QSEB 3ARFB 3UC0L 3BKYL 1F2QA 3UTQB 3HZKA 4KC3B 4G8EB 4XWGL 1OP9A 1K4CB 4CUCA 5IB5A 4N8VB 5C0NC 4Q6YA 1FLRH 2VH5L 3KLDA 2XTJD 3ILPB 3MV8A 1CICD 4QGTA 1WEJH 2QKIB 3FB7A 3OMZA 3L95A 5JUEH 1CDIA 3V0VB 2QQLH 5DA0B 3QEQE 1JGVH 1DANU 3QJFA 1QHOA 3SGJA 1OCWL 1N8ZA 1HYSC 2XXMB 3FT2B 1AFVH 1J5OL 4WI8A 2ADIB 2ATKB 4XCNB 4Q9QL 5DJAB 2XPGB 3TH2T 4HS6A 1G6RA 3PL6A 5FK9B 2F58L 5IBTH 1RUQL 1A47A 5TQ2H 4RAVB 1JYNA 4PRHA 3DXAA 3ZE2F 2JJVA 1ORSB 1SEQH 4Y5XC 2AJZA 4OM0H 2NYYD 3MRIA 2Q8BH 3WS6C 5D7IF 1ZA3A 2COQA 5HHOD 5GRZA 1CQYA 4CU6A 1IAKB 2OJZH 2EIZA 3G5ZB 4J3XA 4FQ1H 3HZVA 3TZVC 1RI8A 5DZOA 1MCJA 5KSBA 4WI2A 4YHZL 1GGBL 1GHFH 1WBXA 2J8HA 3LZFL 4OKVA 5IT2H 1NGWA 4KQ4H 2GITA 4JHWL 1RFDL 4XVSL 1YQ2A 4UIMB 4TUJA 1IZJA 4X5XB 5C3LD 4OZFG 1EAPA 2CDGB 2HRPL 2J2ZA 5ID1A 5E6ID 1PY9A 2AQ2A 2C3GA 3NACH 3DVGB 3GBML 4GS7B 4WEMB 2FJFA 5ICYA 1QR1A 3F58L 3OB0K 4PUBL 4R26L 5ICXA 4Y19B 1LP9F 1CVSC 2JJUA 4DVRH 4JFDA 1CE1H 4N0UB 2WUBL 5HPMB 4YXHL 1D5IL 4CKVX 4Z78A 4X7TB 2FJHB 5DUMH 5E9DE 2JJTA 3RTQC 4WTWA 3HMWH 2HLFD 5DUBB 4U05A 5C07A 2ZKHH 1NFIA 4NC0B 4QHMA 1B4JH 3QBTB 5E00A 4MQSB 2HTLD 1T03H 1KJ2A 1AGDA 5DRZB 1ACZA 1TJGL 5CLWA 1ZOXA 2AK1H 2APFA 1HQRB 4RFEB 5DI8A 4GLRI 1JMZA 1MI5E 1F4WH 3V7MA 1FLTX 3KYMB 4OLZL 2GJJA 3MFFA 4JRYE 4AT6B 3A6CL 3U2SA 3L6FA 1YMHA 1IT9H 3AAZB 4HBCH 4NM4H 2VXVL 1ADQA 1I3UA 1UB5A 1JL8A 3RWHB 1LK3H 3BD3A 2IGFH 4U0RB 5E6ZA 5JHDB 1L4IA 5B39A 1WCBB 1XEDA 3HG1E 4X8XA 1R5IA 2YBRB 4EUPH 1DEDA 3U4AA 1QPXA 1T5WB 5HGHB 5HDBF 1GIGL 4I2XE 5F88B 4QRRB 4MAYA 4NGHH 2NXZD 2X40A 4TN9A 3RWEB 5EORH 3LQZB 4N5EC 1OPGL 5BZWA 3BE1H 1GGCL 4IRSD 2KBGA 1OQXA 5A2IH 3FOLA 3KJ4C 3BAEL 4B7LA 2UZIH 1QTYT 5I19L 4DZ8B 2P5EA 4PB9H 4ZFZB 3NAAH 3VGAB 1CD1A 4APQC 1JZ8A 3DMMA 3KPNB 1FL6A 4ODSL 4X4YA 4PRIE 5TDNB 1M05A 4X99A 3TN0D 3NZ8A 4MA3B 1WK0A 4JJ5B 3DSFL 4GG6F 2NTSP 1ZT7B 1HILB 1HI6A 3MLSH 3DETD 1JGDB 4RFNB 1URLA 4EI5D 4J4PD 2EDFA 4NBZB 3ZDZF 4AEIL 1U8IA 4QHKJ 1N2RB 4HLZG 4Y0GA 5FYLH 2VQTA 1GOGA 4NP4L 4QRTB 3ZKMC 4G6AC 3IDGA 4KAQH 1UCBL 4OZIE 1A3RL 1C5BL 3QI9A 3BSZH 3HI1B 4N8VG 4PJ5E 4HDIB 2YPVH 1I8KA 5HI5C 2DTSA 4KZDL 1Z3GL 3O45B 5FGCB 1MREH 4JRXD 1Q0XL 2P8PA 4OZFA 1BJ1H 4HMDA 4I0KA 4RISL 4PJIE 2IAND 3SJVA 2HJKB 4HJGA 5DSCA 2P5WE 4NN6C 4A6YA 4MHHG 5IG7B 3C6LA 4JANA 4F80A 1GZPA 5HVHC 3JZ7A 1NL0H 5HHPA 3L5XL 3KLHD 1C12A 1QSFE 2VERN 2CMRL 5DQJA 4XTRD 4F8TA 5D93C 3ZO0A 5D7SL 1BD2A 1ZANL 1DQLH 2HLAB 4NHUB 3MJ9A 1T7ZA 2Y07H 4ZD3H 5HYQB 2CJUL 3N85L 3WNNA 4UV7H 2R15A 5KN5A 4IOFD 5DD1H 2GY5A 4JM2C 3SDAA 5JXEA 1TTGA 4ONFH 2DQGL 1U8HB 2IADA 4OF6A 1HSBA 3OHXA 5CP7B 3V9FA 43C9A 2J8OA 4AEEA 1AP2A 1YZZA 5B38B 4K2UL 1KIQA 1JF5A 4LLQB 3ARGD 4L8SB 4G80A 2MWCA 1S9WB 3DLQR 3PQYD 4NQDD 1AO7D 4O00A 5IJVA 4LPUA 1OY3B 4NQTA 4O4YH 2PN5A 1E27B 1KLFA 1V7NL 4LHQB 3AS0A 5C3TA 1EMTL 4OIAA 3MRDA 2DN7A 1WICA 5C0CA 1CFNB 5TDOB 1BF8A 2G60H 3HI6H 1D5XB 2W9DL 5JR1H 4O02H 4DGVL 5JOPE 5C2BL 4QHUA 3V0WH 4JFHE 4JKLA 5LXGL 3LPFA 1NPUA 4QF1B 1FC2D 4DK3A 4PJ9D 4Z77A 4XHJD 1P7KA 2I24N 2L7UA 2Q87A 2IC2A 4JO2L 4LIQL 3UBXG 1A3LH 4OD2B 2FHFA 3UYPA 1CFSB 4U2YA 1B90A 4HUUA 4QHNB 4HSQA 3T3MF 4ONOA 3IFPB 2YK1L 1DDHB 1B88A 2DYPB 5FFLA 1MCFA 1YEKH 4NYLA 4Z7WA 3WNKA 1BZ7B 5IKCA 3T0VA 4L3AA 1K85A 3VJ6A 1DN0B 3CCHB 4NRYA 4HULB 4GRLA 4K7FA 5TDPB 1NGYB 3PV6A 4RRPG 2Q8AH 1CLOH 3TCLA 1MAMH 1ZEAL 3NGBC 3R1GL 2NY5L 2E7CA 4U49A 2WV3A 3CIQA 5JOEA 3RZCD 5HVFB 3D18A 1TVBB 3KXFE 3EFDL 2NY0B 1DQDL 3ES6A 4RA0C 1QSEA 3EBAA 3KHQA 1D7FA 4Z7NF 1FYTE 3UTQA 1J87A 2GSGB 4WTXA 4WWKD 3THML 2EE9A 4WUUA 3QISA 3LN5B 3CXDL 3LOWA 1ZHBB 4EDWH 1XF4B 5F97E 3MJGX 1IGCH 5JQ6L 3T65B 3IGAA 1KIUA 2D7PA 3UTSE 4YZFE 2Q3ZA 1R3JB 4P9MH 1V3MA 1AR1C 4NN7B 4GXVL 3V0VA 4OLYL 5FYKL 5HHMD 1WAAE 3P9LB 1TFHA 1U8OB 1ZHKB 2VKWA 4WNQA 3FT2A 1KB9K 4F8QA 1T83A 4OGYL 2ATKA 3ZTJG 5DJAA 2AJUH 1U9KA 2XPGA 4FABL 4NN5B 3AS2A 3QPQC 3VU2A 4G6KH 1TCRA 3MLZL 3PGFH 3QDMD 4FFYL 1IGJA 4R4BB 3WFDL 1FZOB 1AGEA 1UEYA 3B9AA 5E8DH 5L9DH 2DIAA 4HKBB 4FQXA 2VN7A 2YHGA 2R39A 4LSVL 4S1SL 1DUYA 4MYWB 2DLTA 5HDQH 3ARBA 4G7VL 3MOAL 4LKXB 4M5YL 3MV8D 4JHBA 5D2LF 2UWEA 5CCKH 4D9RD 1E4WL 2RFXA 1A7OL 2DQIL 3VDAA 2CDGA 2VLKA 4FMFA 2MMXA 3IJHB 4LF3A 2MSPA 4EN3A 2VDOH 2LU3A 5DHVH 4Y19A 4JRYB 2ZSWB 5EO0A 1H3VA 3HS0B 1I8IB 2EXWD 4JLRB 3G5VB 4N0UA 3AM8A 3O9WB 4O58L 3UBXA 3MNVA 4GAYB 1PKQA 4HKZB 4P3DB 5IBUG 4F58L 5HHVL 1E6JL 3DXAD 4FQJL 2V17H 1C1EH 4PG9A 3HG1B 2VAJA 4EDXA 4JVWA 4I2XB 1MCLA 2BNQB 3UPAA 3VXPB 4NKOB 4DZBA 1K3IA 2IEPA 4AEHH 5B38G 4RFEA 4JN2B 1V8HA 3LS5H 3QIUC 2EDOA 2WSKA 1VADB 1DSFH 5JDJA 3F12B 3KYMA 2H2PD 2B5IB 1GPOL 2D7QA 4OKDA 4AT6A 3I50H 4KKLC 3FN0L 4NZTL 4RRPA 2BJML 4WDIA 4V1DD 2FRGP 5FCUH 2VITB 2F53B 5IK3B 3AAZA 1RURL 1RULH 3CNKA 1C5CH 4YXKL 4ZPTA 5DC0A 3WFEH 3C60A 3RWHA 1CBVH 3TBYB 1EEUA 5CHNB 4J6RL 5JHDA 4JQXC 4JFDD 1WCBA 1PJ9A 1Q9WB 3QNXB 4R9HA 3MA9H 4UIKH 5HGHA 5F88A 4QRRA 3CH1B 2N7BA 4PS4H 3OPZL 3RWEA 3NFPB 5C07D 4OF7A 4LBEB 3V79C 3CFIC 3OKKB 5DK2A 2AGJH 3AREC 5C0DA 5L2KE 4KU1A 4YQXL 3MV11 4KY1L 1SM3H 4ORZC 3D2UB 4JVUA 4PGBB 1E6OL 4OTXL 4DZ8A 1WTLA 1DE4B 4TSAH 1WQVT 5LGHH 3SO3B 2PTUA 4S1DC 1WT5A 5HJ3A 3KPNA 2X9WA 5DLMH 5TDNA 4KK8D 3KPTA 5DDHB 4P0DA 4MA3A 4OZ4A 4EOWL 2P5WB 2QEJA 3LEYL 3T3PE 4ZXBB 1JGDA 5FM8A 1D5ZB 1MJ8H 2XICA 2HVJB 1NFDB 5JW3H 4U6TA 4RQQA 4L9DA 4PJXE 3QIWB 2LAGB 5MI0B 4Z7OE 3G04B 5M95B 2KZWA 4ELKB 4AMKL 1U3HB 3P30H 4QRTA 4X9HA 3DIFB 1K5NA 1OW0C 4FQIL 4MAYD 1X5ZA 3V0AC 4KROB 3AVEA 3HC4H 1G7QB 1LEGB 1BVLA 4DKDC 5F1NB 3ULVD 1CL7H 4K55A 3DJ9A 3WN5C 1T5XB 2A2QT 3A6OA 2J8UE 4LLUA 5JW5B 4PJDB 1NBZB 4LSRL 5I16B 3WS3B 1MWAA 5GSVA 3MBXL 4OIIL 4AG4L 35C8L 4OCRL 2C7UB 3DMMD 2BVTA 5KTEL 3UMTA 3KPLB 3FRUA 3WLWC 2BVEA 2N4IA 1KCSH 1OGAD 3IXAB 1ZTXL 4MXQD 5F1KC 3DRQB 2DL9A 4NHUA 2F8XC 5HYQA 3FJTA 4FXGB 4OV6F 3GM0A 3TT3L 1F4AA 5CEZE 4KUCF 2R1WB 2ADGB 5EC1B 5FM5M 3CPLA 4I3RL 4P99A 1U8HA 4P5MB 3KDMA 1LO3H 4Z9KB 5SWSE 5E2TL 3MLUL 5HHQB 2GJ6D 3AS1A 1UEMA 5B38A 4MMZC 3UYRL 5GRUL 1QLRB 3QI9D 3W39B 3PP4H 2XIDA 4LLQA 5I1DB 1M7IB 5F9DC 3F8UB 1Z9OA 3D39A 1DL7H 4JHAH 4OI8A 1E27A 1Z5LB 1KTKE 1AIFB 4HUNB 5BZDA 5JNYB 4XP6L 4P2RB 5EDXA 4YX2L 3KPRA 3SJVD 3ULUF 4OZHF 4KI5D 3CSPA 4HIHB 3VI4E 5IW1A 3P0YL 3C6LD 4PY7A 5IB2B 5GRYA 1CFNA 3SEPA 1PZ5B 1D5XA 1U8JA 4LQFL 4KGLA 5E08L 4AK1A 4JAMB 3RI5F 1BD2D 8CGTA 2XZCL 4QF1A 2GT9A 1CFTB 1BBJA 1VGKB 3S36L 4UILL 3DX6B 4OD2A 3KXFB 4NKMA 2FSEA 3VGGA 3WCYA 5JXED 2ATPA 3N1FC 1FH5L 4GH7B 2BHUA 3WHXB 1XR8A 3CSBA 4ERSL 2VZSA 1JGEB 5C7XH 4NNXA 5CJOH 4KJWD 3M1BA 2DYPA 4NO0B 4E42B 5TFSH 2WLYA 1NDGB 1MPAL 2NTFB 4KQ3L 4LDLB 5TH2B 3ZKXB 3BHBA 2F19L 4K23L 2EYRB 1DN0A 3CCHA 2DQDL 3KVQA 5TDPA 1MEXL 1EHAA 1MCCA 3E6HB 1NGYA 4UB0L 1WC7B 3U82B 3EO0A 4M1GH 4Y4HB 5C0CD 3HZYA 1DLFL 1RIHH 1TVBA 1KENH 1MFDH 4FHBD 4M61B 3GSQB 2BSRA 1I3GH 2OZ4H 1MFEH 3QDJD 4I0PA 3G6JF 3WIHA 4LOUD 4UOW0 5JXAL 3O6LH 4HJJH 5GIRA 5FHBL 2QHLA 4ZOBA 1IEBA 3HFML 1AXSB 5DRXB 4U1GB 5SWZE 3T65A 5EBMB 3S7GA 5ISZB 4IRJB 2BCKB 4MXVE 4DQOL 5KANI 1U91A 3BQUC 3W9EB 3TVMB 2E27L 4P4KD 3VMNA 5ITBL 2W59A 5DHYB 1UA6H 1FNEA 1UXWB 2CXKA 4KVNL 2HT3C 3DRTB 3WL9B 1FE8H 3DUSA 3H7BB 3D87B 3WO3B 4GRLD 2AJXL 1T04A 1T1WA 1G7MB 2B20A 3ZYOA 4QT5B 3B9DA 5F3BB 4JQIH 3BH9B 4PPTA 5DVMA 2FH8A 5F21B 3U7WL 3KYNB 1QSED 3ARFD 4LVNB 4PJFB 1BIHA 5HVGB 1A14L 3I6LD 1XIWB 2Y06L 2OYPA 4H0GA 4HKBA 4WUUD 4JPVH 2I9TA 4MNGB 1EO7A 3BVNB 2R0WL 2XZQL 3QULB 4XHQA 3DUHA 3S97C 3CFEB 4GAGH 4KKNA 5HYSG 2F5AH 3X11B 5D1XC 5CD3B 4RA3A 3GNMH 3V6OC 2J88H 1HXMB 2F74B 4RWYH 3SQOL 3MJ6A 3VGFA 3VDBA 4QYOA 3GHEH 4O2FB 4OCSH 4JGJA 3EYFB 4JLRA 4DW2H 2PO6B 4PRPB 1U6AH 2ADJA 2GQHA 5LVEA 3VGHA 3MLPA 5BJTB 1UZ6E 4XCCL 4K71B 4OCXL 3OG4B 1IRAY 1JPGB 3GMPA 4MWFA 3G6AB 5HVWA 2QQKL 5GJTL 3VFWB 4JREC 5IBLC 2B2XL 4XPAH 5H94B 2RIKA 3NH7L 4PJBE 4LAQL 3ROOA 1EEYB 4XGZB 4OCYH 2O5YH 1FL5A 4Y2DA 5EZOH 2OL3H 4JN2A 3ARBD 1P5VA 1VADA 2VE6B 2CLRA 5FYJD 5CEYB 4HLJA 5DJZB 1AQDA 3GI8H 4G8FB 1B2WL 5IB3B 2FB4H 3RVWD 3CLFL 2F53A 1FRGH 4NRZA 4EN3D 1I7TB 4YPGB 1LHZA 5K59F 4Y19D 4URTB 5SX5H 1MHHA 5CHNA 43CAA 5HYJB 2CD0A 3MLRL 4PLOB 3SQBA 3VI3F 1CN4A 2YXMA 3EZJB 4YHKH 4XWOC 1GZQB 3VWKC 15C8H 3EYUL 4KK9C 12E8H 4G8IB 1A21A 1MF2H 2JB6B 4JKWA 25C8L 1U2CA 1S7QA 1TPXB 1NAML 3BD4A 4JEGB 1MIMH 3L3JB 3WDJA 2ZNXA 1U36A 4WGVB 1U8PB 2J8UB 3DUUB 3KYKL 2VR9A 4MLSA 4LAJH 1DEEB 4ZS7H 1T1YB 4DK6A 5TGBB 5F96H 5E8OB 2ARJB 1I1FA 5CFHA 1D5ZA 4X9GA 4G8GE 1U8NA 5JHDD 1NFDA 3QUZA 4UBDD 4FZ8L 4X8JB 3G04A 4M6ML 5DD3H 4ELKA 1U3HA 4XPFL 3VWJC 2DM3A 5ALBH 4Q74A 4QRRD 4UOW1 1I8LC 4XX1E 4JFOA 1RZ7L 4M8QB 4ZFOB 4NSKB 1VB9A 1G7QA 2ESVA 3D48R 1I85C 5I9QC 1L7IL 3BEVB 5HYSA 4G6FB 1RJZB 3GO1L 3RY5A 5H35A 4PTUB 5D7IA 1A4KA 5E4IA 4ZUVB 2APVA 1UT9A 4MQ7B 1NBZA 5I16A 1BHGA 1OTSC 3EO1A 5T1LB 5ESQA 3H9SA 4WVRA 4LCIL 3RKDC 6FABL 2E7LC 2NY1C 3U9UA 2PR4H 1FVDB 5ID0B 4G3YL 3QXTA 4IIQA 3GMLA 4POZC 1JIBA 3IXAA 3SGKA 5GS1C 2GAZA 5DK0A 3BIBX 5DHXB 5DZLA 5IESH 4OGAD 1AGFB 3PF2A 2R1WA 5FKAB 4Q9RL 2EYTB 4JZNB 1E4JA 4X9BA 1HQ4B 1LP9A 1JNNL 5INDB 2AK4E 3TT1H 3RVXC 3FOMA 4UINL 1IEAB 3IDJA 4AQOA 1SY6L 1HSAB 1QLRA 2OSLA 3GIZL 4ZODA 5I1DA 1UB6B 4HWEL 3TNMA 1U92B 4KRLB 4JFXA 3SE9H 2ZSVB 2BY1A 1U8LB 4P23C 5FA3B 1Z5LA 4KHXL 1NUFA 3ESUF 4OUUB 2X4TB 5GS2D 5I1JH 3Q1SH 5DD6B 5JNYA 2RJMA 2VOTA 5DJXB 2H9GA 4NBYB 4UV4H 4EBQH 4YHNB 1NSNH 4M8VA 5TQ0H 1I7UB 3RA7H 1FFOA 3O6FB 5IB2A 2ZCKL 1ZHNB 1MFCH 2BOCB 4FQPA 4CRPA 4N1HB 1VACA 2ED9A 4LEXL 3PABB 2EDDA 2V5MA 3BRFA 2QSCH 5FOJA 2PKDA 1UYWL 3L3GA 1VGKA 4YDIL 3ZT7A 2HJLA 3DX6A 4Y16C 3D69A 4F2MB 5EZJA 3WHXA 2VLLB 4L9LC 3PWUB 2L4OA 4LCCB 4ODVH 3RIFK 3GSNH 3AC0A 2EYSA 1ZGLM 4R2GC 2BMKA 3UZVB 5EUOB 1NDGA 4M7JH 3TYFA 4DN4L 5TH2A 3ZHDA 1KC5H 4JG0H 4LSUH 2YPLA 1U8KB 3ZKND 4L5FH 1BM3H 4NT6A 5EIQA 2ZJSH 4GUPB 3KPRD 3SE3C 1NBQA 2ICWI 1UWEL 1Z0MA 1WC7A 3QDGA 4NJ9L 1NCCL 4TOYL 5HGBA 1X5AA 3GSXB 3R06B 4QRPA 3GSWB 4H5SB 3RBSA 4ZSOA 4M61A 3GSQA 4FFWC 5DJCB 4GBXA 3QQ9C 4JFFE 1X5LA 1ITBB 4D9QD 1WIPA 2YPKA 4FQHB 3FFCE 4I3SH 3K1KC 4YDVB 1AXSA 5GISH 4EI6B 3GMMB 4P2QB 4U1LB 5EBMA 4Z95L 3UTPD 2BCKA 4X0KA 2V2XB 5JA9A 3ALXA 3I75A 2VNCA 3RX7A 4HFWB 3GKWH 3PJSB 4DOHB 1F8TH 5L88H 4ONGL 2DYPD 3TJHD 1HHIB 3WL9A 1FAIL 4LCUB 5E7BA 2ZG2A 2APTA 3P11L 2G9HB 1FZMB 2FECL 1F6FB 2EDBA 3QUXB 3UDWC 4H25B 2YD5A 5A2JH 4H1LG 1A6ZB 3WXWL 2PYEA 3LKPB 4YEFA 1A7QL 4FQ2L 1VFOA 1IC1A 2XKUA 4RFOL 1CGSH 2NY0D 1EV2E 1JNLH 3QFJB 3QYCA 4YHLL 2WBJC 1GGYA 1SYSB 3KYNA 4DCQA 4PJFA 4PG2C 2BERA 5IMLB 1IAIH 4XC3H 2A77L 5BXFB 5CIPB 5A40E 3QWRA 5L7XL 1MFAH 3PGDB 4HC1L 3K4ZA 4QXTA 3OAUL 3UC0H 4KK6D 3VRIB 5EA0L 3BKYH 4NQEB 1F3DJ 1JZ7A 3SGEH 4NQXB 4WU7A 1E4KC 4OZIF 3CFEA 4XVUC 4XWGH 3QQNA 3X11A 4PJBB 5EUKB 5CD3A 3N9GL 1ETZA 4RIRB 2Z31C 4ORGB 1I7RA 2VH5H 4XAWL 4OFVA 1KXTB 1RUPL 1QRKA 1B6UA 4PJIF 1W8NA 2E3VA 3HE7B 1JRHL 4O2FA 2D7OA 1NQBA 4YO0B 4OLUL 3EYFA 5GZOD 4QXWA 3MNZA 3B2UD 4W4OA 1OCWH 1YEDB 4NQUA 5D1ZA 3X13A 4PRPA 1EGJL 5I1AB 2JB5L 4R8WL 1J5OH 2EDXA 4DEPC 2W38A 3LKQA 4ZFGL 3SDCC 4JM2B 4DFHA 1JPGA 4OF5A 2F58H 2Y5EA 3G6AA 4JB9H 5DRWB 1RUQH 3QAZB 4HUVB 4RGNB 3CLEL 1ES0A 4TSCL 1FQ9C 1EEYA 5J13C 2JCCF 1HN1A 2K3TA 2O5ZL 3GDBA 1OP5K 4C56E 2VE6A 1ZLWK 3ZDXE 3CFJB 4YHZH 3LZFH 1CD8A 1QFHA 4P4RB 1RFDH 1G6RL 1T66D 4XVSH 5D5ME 2I26N 1N4XH 5GGTL 1FZJA 2HRPH 2WIMA 2XTJC 1YEHL 1CICC 2D31A 5C0JA 1ZT4A 3O9WD 3F58H 3ZLQC 4PUBH 4R26H 4BK5A 2QSQA 5AYUL 1MRDL 1GZQA 4FQQA 3BT2L 4YWGL 2WUBH 3U0WL 4YXHH 1D5IH 3WV0A 1YNLL 5I17A 2BRRL 2BNQD 5D7LB 4MJ6A 1QACA 1A6AB 4PRDB 5I1HL 3C5JB 2P43B 3O2DL 5I1GL 3OAZK 4Y8DC 3I3EA 4MDIB 5IB1B 4NNYA 5FUCC 1U8PA 2JK5A 2HFFB 1TJGH 4YE4L 5B8CA 3T1FA 2NYYC 4WFHE 4H1LA 1DEEA 4JQVA 1T1YA 5C0AE 1BBDL 2F53D 1PQZB 5TGBA 5E8OA 4OLZH 1OLLA 1MCQA 2E9BA 1ACYL 1F4YL 2JF1A 4AYFA 3A6CH 4MJIE 2V9TA 1SEBB 1R5VA 2VXVH 5DFTA 4TPRL 1V5JA 2WBWB 4Z7VE 4KTDL 5E6IC 4NSKA 4U7MA 4XNZB 2YRLA 2FIKB 2AK4B 4PTUA 2AI0L 3D2UD 1S7TB 3BUYA 5C09B 4PGZA 4YZFF 3V8OA 4MB5A 1OPGH 4OT1L 4MQ7A 5F1SA 3KWWB 5E1HB 4R6UA 2VXQL 4PJCE 5HHNB 3L3DB 3IKCA 3BAEH 1WAAF 2HLFC 4Y5VB 3V4VL 1ZGLP 2AEWA 2JJSC 3P4OA 1ND0B 1G7IA 3C08L 2P5WD 5AUMB 2ZOKB 2HTLC 2VO5A 3D5OF 4ODSH 4R0LA 4ZXBD 3VXRE 4NO5B 3FHAA 4HG4K 4B5EA 4ESKA 2EYTA 4YGVA 4JZNA 3DSFH 1HQ4A 1KN2L 1JWSB 3DYOA 3QIWD 5CBAB 1G0YR 1N3NA 3ULVL 1U3HD 5SV4A 1QEWB 4TNVF 4AEIH 1NC4B 3OKEB 2R0ZL 4KROD 5I1KH 2EKJA 5D9SB 1YMMB 4Z7UF 3Q0HA 4LSDA 1U92A 4NHCL 3M8OL 4NP4H 2ZSVA 1ZVHA 1LO5A 2HMID 4LVHB 4OUUA 1UCBH 1P2CA 4MZ2A 2YD3A 4LIQE 4ELMB 2A1WL 4KJQD 1I7UA 1Z3GH 2LAAA 5IOPB 4ETYA 2WM0A 2BOCA 1Q0XH 1CLYL 2NXZC 1EO8H 1R5WA 1RJYA 4RISH 3OJ2C 1RK0B 3RIAF 4IRSC 3S37L 4PJGE 4D8PA 2NX5A 5FOBB 2J1KA 2Y1VA 5E99L 3T0XA 1E28A 2CMRH 3L5IA 3ZE1E 5FA4A 1ZANH 3ZYIA 1CR9L 3VFMA 3VXMA 3X14B 1DVFB 2M2DA 2VLLA 1MCWW 2CJUH 3N85H 3OKDA 3TN0C 3PWUA 4PRAA 4K7PX 3FFCB 1RZJL 1I4FB 4LCCA 3V6OE 5IMMB 3MV9B 4X4MA 3HMXA 2DQGH 1G7LB 3DETC 1QSVA 5EUOA 4Q0XL 5EIIB 4EI5C 4J4PC 4Q58C 4K2UH 2G5BA 4PV9B 5K9KB 5KVMC 2D4DA 4P2RD 1H5BC 3FO9A 4WHTB 5I1LA 3NCEB 4KPHL 3RNKB 4HHAB 3BPNC 1ED3A 1V7NH 3BISA 1KXQE 4Y89A 4ODXA 3MJ9L 4H5SA 3MBEB 1EMTH 1RV6X 5MEOB 1G1CA 4X6DB 1WFNA 3UJIL 3LPWA 1S7XB 4LVOB 3V6BR 1VERA 3WDIA 2H26B 5L6YL 4DGVH 3BRDA 5C2BH 4YDVA 1FO0A 5LXGH 2GY7B 2VZ1A 5CWSA 1F4HA 4P2QA 5HD8D 3LQAC 5T3XD 4BQBA 4JO2H 1SJHA 3ARVA 4LIQH 4RGMC 4XTRC 2FR4A 5C0GA 3SGEI 1T1ZA 3LDBC 3PJSA 1A3QA 1RZGB 2XY2A 3KPPB 4FRWA 1HHIA 2YK1H 4JPWL 4LCUA 4Z0XB 4M1CD 2ILLA 2B1HL 1BZ9B 4JFYA 5JIHA 4JDTL 4QHKI 1AC6A 3JBG7 5ITFA 5J57B 1OGTA 3QQ4B 3QDGD 1RUKL 4Y4HD 1VFMA 1NUNB 4M48L 1ZSDA 1CF8L 1MCHA 3D3VA 3ARGC 2VLJE 3QFJA 3T3PF 3HR5B 4GBXD 4KH2A 5EU7C 1ZEAH 3R1GH 2NY5H 5IR1B 1MLBB 5IMLA 5BXFA 3EFDH 2ZUVA 5CIPA 3TWCL 1LO4L 4NKIL 4PJXF 1DQDH 4Z7OF 3ARDB 4QGYA 3VRIA 5ESVB 2H8PB 2OR9L 5ISZD 3LB6D 1C5DB 2C3WA 4NQVB 3THMH 1X5KA 3CXDH 3TVMD 2BNRA 1S7WA 3K2UL 5JQ6H 4YBLB 4RIRA 4IMLB 4XHJC 3VMPA 1J1OL 4U7SA 1MLCB 4IJ3C 2VXUL 4EUPB 4I1NB 3PDGA 2R1YB 1ZHLA 4GXVH 1W72A 1KUMA 4OLYH 5FYKH 3H6JA 1IEHA 2H32A 1YEDA 4Y4FA 4DN3L 2MQ3A 4OGYH 3IDYC 4OZHA 3SY0A 4GAJL 4FABH 3MYJB 3C8KB 2CR6A 2VDNL 3QIBA 4ZUTA 1OAYL 1OAUL 3MLZH 1PZUB 5LGKA 1LE9B 2XWJB 1RZFH 4JR9H 4FFYH 4U1KB 3K3QA 3MRFB 3O4LA 1YY8B 4HUVA 3ETBF 3WFDH 3QWRD 3MRKB 4JY6B 4J3SA 4X83A 1DBKL 2C1PB 2IPUG 3C09C 3RZCC 2OS7A 4LSVH 4QRSB 4S1SH 1BIIB 1Q1JL 5EFIA 5J6HB 3UXFA 3G5XA 4F33B 3MOAH 1UACL 3MRRA 4M5YH 1RJLA 4WWKC 2X4PB 2IALB 3QXAA 1E4WH 2PUQT 4MNHB 1JNHB 6CGTA 2EDHA 1A7OH 1XGTA 2DQIH 3CXHJ 2HWZL 1DP0A 2R0LL 5D71L 5DJ8B 1X4XA 4PRPD 1FFNB 2C4FT 3EOTL 4PJAE 4NKQB 1FNAA 3ZE0F 3BP5B 3Q6FA 5T3ZE 3JUYA 3GSUA 4O58H 1V3LA 2QJDA 1CDYA 4F58H 2BDNL 2QLVB 5HHVH 1E6JH 1LQSR 1QVOB 3N1MC 4FQJH 5D7LA 3G6JA 4W6YB 2D7TL 2DLEA 4LHUB 3C5JA 3DI2B 4HCRL 1OLZA 1WIOA 3QCUL 4Y4KA 3B83A 3LD8B 1VHPA 5IB1A 1H0DB 3H42L 5IVXE 5EOCL 4LARL 2NY7L 1ZLWH 2YWZA 4Q2ZB 5DD5L 5HGAB 1ZXQA 1IGFL 3IDMB 2ERJC 1GPOH 1QLFA 1IARB 1CIDA 5A16B 3FN0H 4NZTH 2BJMH 4DKFL 5HYJD 1SEBA 1RURH 5ERWB 3MRCB 1GYAA 2C3VB 4WY7L 4HS3B 4YXKH 4JZJB 4Q6IA 4J6RH 2X4NA 4WW1B 2PW1B 4XVTL 1D6EB 1JWMA 4D3CL 2X44D 5E0QA 1K2DB 3CC5A 1UJ3A 4WW2B 4JKKA 5C0BE 5C09A 3RY6A 5J9PA 5JPNA 1P4LB 5CZKA 4UUJB 5MENB 2Q6WB 2ZUTA 4YQXH 2XQYG 4XMKL 4KY1H 1QHPA 2GK2A 4PGCA 2XXCB 1E6OH 4OTXH 4QOKA 4Y5VA 5ILTL 3MRJA 3W11D 3WJLA 4NZRH 1H3PL 3OAZH 5DR5L 1FN4A 5AUMA 1EDQA 3GMOA 3Q6GL 3ULSB 3V52L 1Q9OA 5T3ZH 3B5GA 2OQJB 4PFEA 1N59A 1P84K 4RSVA 1DBJL 3QP3A 4EOWH 1B9ZA 1X5YA 2AKRB 2ED8A 3HN3A 1ONQB 3LEYH 2DQUL 3T0BA 2GFBB 1QUNA 1I75A 4ONHA 4HWZB 1OD9A 2VXTL 2XA8L 3OKYA 1NC4A 3C5ZB 3B2VL 5KSUA 4CMHB 5JW4N 2DM4A 2BX5A 5I71C 3TPKA 1VGEH 1ZGLA 4G6FD 4AMKH 1MCBA 4ISVA 1KJVB 1CD9B 4FQIH 2AV1A 1KCRL 5ETUA 1HH6B 4POYA 1GCFA 3JUZA 3SO5A 4XNUL 2A74B 5IOPA 1RMFL 3TF7C 1L6XA 4EUPG 4GO6B 4LSRH 4I18B 5FOBA 3S37X 5F9WC 3MBXH 4OIIH 4J8RA 4AG4H 2X4UB 35C8H 3GBNH 4L3CB 4JFZH 4OCRH 4RDQG 5KTEH 4QCIB 5F7EL 3HRPA 2RR3A 4U1NA 4ZOAA 3FN3A 3OJVC 2A6DA 3RHWK 1KLGB 2XKNB 4L4TA 1XF5B 4NPYB 3P40A 1UZ6F 1VSCA 3I2CL 4BELD 2XN9E 3TT3H 1WFOA 5E5UB 3G5YB 2AW2A 4YK4B 3JVGC 5IMMA 5MP6L 4BSJA 1RK1A 4I3RH 1G7LA 2AJVL 4NM8L 2MCG1 1MVUB 1UWGL 4XPGL 4DVBB 3MLUH 1BJMA 4HPYL 4E5XB 3UYRH 5GRUH 5F89B 2UYLA 1H3XA 1L0XA 3VG9B 3KPMB 1FLRL 4POUB 2PTTA 3LN9A 3RNKA 4XXDA 2QSTA 1IAMA 3O6FD 2MKWA 2GTWA 4D0DB 1A0QL 1W2KT 2V9QA 3TYGL 2GJZA 3O2WL 4M4PA 1NEZA 4XP6H 5FO8B 4YX2H 4JM4H 5MEOA 3ULVC 4X6DA 3X12B 3H0TB 4UU9A 3P0YH 4K8RD 3X17A 2ZUQC 4WV1B 2LVCA 5FHAL 2H26A 4LQFH 5LQBL 2YUZA 5D70L 5E08H 1OQOA 3FO2A 2VLJB 2XZCH 2V5YA 3BN9C 4HUKB 3QHTC 3FONB 4U6HA 3VXMD 1X5JA 3DMMC 3S36H 4UILH 1ZLVH 3PIQB 5KSAB 3PP3H 1QLEL 4MXQC 1FH5H 2Q7YA 1OAQL 3P4NA 4GKNB 4OM0L 2G2RB 1J0KA 4YHOL 3OGOE 4ERSH 5F6IB 2NXYB 4OLXL 2NW3A 1EBPA 1G7HB 4WI4A 4Y2OA 2GK0B 4ODTL 4HH8A 1BZ9A 4HUXB 1M1SA 2XTJE 1GHFL 2JE8A 2FBOJ 4BUHA 3QUKB 1MPAH 3QQ4A 1TQCB 3GRWH 2F19H 4K23H 5IMKA 5KAQG 1M7DB 4MA1C 3QI9C 2FDBP 2DQDH 4JO4H 1QFOA 3UPRA 3QEQA 4UB0H 5BV7L 1RZJC 3B6SA 4YHIB 5IR1A 1DLFH 1MLBA 3C2SA 1QSZA 1OD7A 2AXFA 4JVPA 1BAFL 1IC5L 2B1AH 3C6LC 4P2QD 1JK8B 1S7UB 1C5DA 2YD7A 5FUCE 3TH4T 3JTTB 5FHBH 3HFMH 3LKNB 4KKBD 4IMLA 5F93C 4DQOH 4KGJA 3MCLL 4HIIA 2E27H 2VISA 3REVB 2EIDA 4EUPA 2EKSA 5JXEC 1S7RA 2E6PA 3V7AG 4OLEA 4RMTA 4OZGE 3EOBA 2DKMA 2EDJA 4KVNH 2OM5A 3HHRB 2IMNA 2EZ0D 4PP1D 5HGDA 4CDHA 2X1XR 2FD6L 2Q3AA 4KJWC 4FTVA 4LLMB 2AJXH 2AQ3A 4LPVA 4CVUA 3QFJD 4RX4A 5LCVL 4YEEA 5HPOA 3MRGA 1YY8A 3MLXL 5JZ7C 2ICEA 4OV5B 1AD0A 1QRNA 5HYEA 3U7WH 2I9LB 1Y6NR 4NQED 1A14H 2WINA 4KUCD 4LLWA 5CJ5A 2Y06H 1QBBA 4KMQA 4H88L 4D94A 5E9DA 4EVNA 1LEKB 2XZQH 5J6HA 4F33A 4NRXA 4LOUC 3WIIL 3BZ4A 1HZHL 1OT1A 2X4PA 4NJAL 2IALA 2FZ3B 2IJ0C 3LRSB 3HE7D 4ZQKB 1A2YA 1TZHA 5I73C 2X9YA 3RKPA 4XNXL 4DUWA 3ZYJA 2FEEL 1MI5A 1WWWX 2X7LA 5DJ8A 3SQOH 4P4KC 3FB5B 3K80A 3CVHB 3PGCA 2DAVA 1LO0L 2R1XA 2CUMA 3GJFK 3WIFB 4NFDA 3L3IA 5ICZA 4LP4A 3NVQA 3MLSL 3SKOA 2X41A 5TE4H 4RGND 4XCCH 4ALAL 2KQMA 4OCXH 3PWLA 4FFVD 2B7DT 1T1XB 5CGYD 2QQKH 4PRNB 4KTYA 1WGOA 4P59L 5J1AB 2B2XH 2CDFB 4QRQA 1QNZL 3EJZD 2PCPA 5CD5D 1FFPB 1H0DA 4LAQH 1RQ5A 4HEPG 1K9TA 4ZO6A 1OP3K 2EXYD 3ARFC 3TFKD 5CSGA 5CJXA 4X6EA 4HV8B 4JKMA 2C9AA 1G9EA 5DMYA 1SQ2N 5B4MD 1BWMA 5BS0B 4WJ5B 4NWTL 2AJ3B 1CXIA 1B2WH 1A02N 3W2DL 3CLFH 4I13B 5ERWA 2P24B 2C3VA 3L5WB 1J0JA 4JZJA 5KANG 4WW1A 2BVPA 4PRIA 4CW1B 3REWB 2FL5A 3MLRH 2A73B 1NUDA 4LGRB 3QUYB 4YC2B 2XA3A 1D6EA 1ZK9A 3QCTH 1J05A 1K2DA 3WNMA 3RL1A 5DD1L 5D7LD 3EYUH 4BQCA 3NPZB 4WO4B 3WNPA 5MENA 2Q6WA 3GUTA 1MFNA 5EB9A 25C8H 4P3WA 4F7TB 4OZIA 3T77B 1NAMH 4PJ5A 4GMSL 4JRXE 4HT1L 3O8XA 5C6WH 3CFBB 4QY8B 2IANE 1JNJA 3KYKH 2FLRT 2OQJA 1JZ2A 2ID5A 3O6MH 4O51A 2XOTA 1JYWA 5JR1L 4O02L 3OR6A 5FKPA 1QSFA 1EFXB 4GKSA 3RVWC 3C5ZA 5DQ9A 4FZ8H 4GS7C 1QA9B 3L7EA 5DEGB 4MCYB 4GW5A 2ZOLB 5LAXB 2AK4D 3N0PB 1RZ7H 3RDTB 1RZKC 4ODBD 5C09D 5DTFB 1LO2L 2B39A 1LE5B 3HNSH 2HKHL 2Z35B 5LBSL 1L7TL 2JCCA 3DX8B 4CVZB 3GO1H 4XCEB 3HPLA 3BGMA 4TSBL 3PQYE 4NQDE 1AO7E 4QOKD 5F9OL 1YEKL 3P4MB 1JF1B 5EU7E 2ZCHL 4LCIH 2VL5B 2HFEB 2X4UA 3WEXB 3QXWA 3RWCA 4CN6A 3KLAB 2Z8VC 5F70A 4J2XA 4G3YH 3SCMA 2PXYB 1KLGA 5JDSA 3F5WA 1CLOL 4M93B 5I76B 2ICES 4CADA 5F8QC 4Q9RH 2CO6B 1NC4D 4R4ND 2BHZA 4N1EA 1YMMD 4BZ1L 2WAHA 2HTKD 1JNNH 4DVBA 1JHKL 4YHYB 2Z8SA 1HHGA 4UINH 4U0RC 4E5XA 4YAQB 1SY6H 5F89A 4P2OB 1IGCL 32C2B 4OQ1A 5F8RC 3KPMA 3GIZH 4U6YA 1EX0A 4HWEH 1XZ0B 2B4CL 1FIEA 5DEZA 3ZDXF 4KHXH 1KLUB 3VDCA 1JUFB 5D72H 3NABL 1H15B 2AS5M 5FO8A 3STZB 1N0XL 3X12A 3EOAA 3W9DB 2ZUYA 3DV6B 3OKNB 3TBWA 5D5MF 1CDCA 2ZCKH 1KEML 1KBGH 2GI7A 3BP6B 4LEXH 3FFDA 4F7EA 3VGAC 4Y5YB 4XZUA 3HI5L 4ZAKB 3FONA 5DXWA 1MH5A 5KSAA 3GMQB 5FEBA 1OAKL 4XXCC 3MV9D 4G9FA 4R90L 3NBNA 4GKNA 1OOAA 4S1QL 2G2RA 5DHVA 2DQTL 4MQXD 3EZ8A 4RFNC 1S78D 4K7PH 4LNVA 4OGAC 2A6IA 1I7ZB 3BP4A 2OR7A 4HUXA 5AAMA 5EN2A 4X6CE 2FX9L 3UTSA 1D5BB 4DN4H 5GGRB 5ACZA 4HAGA 2DICA 4L8DA 2HVKB 3O2VL 1IZKA 2IBBA 1M7DA 5HHME 3T0DA 3MLTA 3MBED 1Q72L 1XH3B 3QXDB 1UWEH 4NJ9H 1NCCH 4TOYH 4FQLL 2VQ1A 4YHIA 1CXFA 5DC4B 3RPIA 1IMHC 4M3KB 4YJZL 4J3WA 3DVNA 1A7NL 3QDME 1I3VA 1JK8A 3MROA 3WFCL 2L0DA 5ACLA 3T1WA 4Z7VF 2VDKL 2V7NA 3HCVA 1KXVC 4YBHA 1HHKB 4AH2A 2YEZA 4NIKB 1P53A 3EYVA 4G5ZL 3SDDB 1WV7T 2IAMA 2KQNA 4Z7UA 3REVA 5JHLL 1KT2B 4PJEE 5CILL 2YXFA 4YDJA 3RWDB 2B8OT 2W60B 4X7FC 4ONGH 3MV8E 4PJCF 2N56A 1CDGA 1DSFL 3QQ3B 3AY4A 4D9RE 4I77H 2R23A 1FAIH 4KJPD 4P5TA 3TBSA 4LLMA 4L8SC 5JPMB 3LN4B 5AZ2L 1K8IB 1GJIA 3WXWH 2Y5TB 1A7QH 4FQ2H 5C8JB 3ZKNC 4RFOH 3V2AR 3QXVA 1J1XL 5F72S 2OMNA 4YHLH 2BNUA 4MVBD 3ARDD 2K7PA 2FHBA 2VTFA 4UIKL 5SX4H 2A77H 4PRHE 3DXAE 4S0SD 1FSKB 3PWNB 1A6VL 1KNOB 1S5HB 3QUMB 5L7XH 3RJDA 2MPAL 4A2MA 3OAUH 5EA0H 1C08B 2VYRE 3RL2A 3SOBL 1ZLUH 5FXCH 1VCAA 1KPVA 1NUGA 3EAKA 3LRSA 3MRMB 1MJUH 1YDPB 3CUPB 3N9GH 1T0NB 3MV7B 4K3DL 1RUPH 5IFAL 3BZEA 1MHCB 3RI5K 3GGWB 5I0ZA 2BY3A 2XT1B 5AAWA 1MCDA 5HI4D 3FB5A 5MEPA 3CVHA 3R0MA 1JRHH 2YN3A 3F7VA 4PJGF 4V1DE 3WIFA 4OLUH 4FTVD 1VKXA 4R4FL 2DTML 3QA3A 2GW5A 4LCYB 2JB5H 4R8WH 4R96A 3TLRA 3PWPB 3I6KB 3ZE1F 4ZFGH 4JFDE 1NGZA 1MIEL 2VDPL 1QRND 1YYML 4PRNA 1UZ8B 1SVCP 1HHHA 2G75B 2CKBB 2BY2A 4YBQD 1HEZA 3CLEH 2NY0C 2NY3B 5C07E 5E2VH 2O5ZH 1MUJB 2OTUB 3LKSA 1H3GA 5EU3B 4HV8A 5L2KA 1EO5A 3TA3B 5I1IL 1UKTA 3FB6B 2AJ3A 4KK6C 5FYLD 4PRBA 5A2FA 4LLYA 3KPSB 3DROB 3Q3GB 2ZWLT 4Z6AT 2P24A 1G6RH 3K2MC 3L5WA 4NN7C 4RMSA 3GEWB 2Q86B 1KCUL 2VAAB 3FN9A 5IQ9A 5GGTH 4TTGA 4CW1A 3REWA 1D9KB 3IDNA 1YEHH 2A73A 2CIKB 4U6XB 4UTBL 5C2UB 5F71A 3CAFA 1EIBA 3HZMB 5AYUH 1MRDH 1S3KL 5GZOC 4NN5C 3BT2H 4YWGH 4IM8A 3U0WH 2R29L 1TZGL 3OL2A 4LHUD 2W0FB 1GSMA 3D0LB 4PJXA 4KRNA 1YNLH 1TQBB 1IGYB 2BRRH 1MHEB 5LG1A 4ZUUB 5C08B 3ULVE 4KJYA 5I1HH 4F7TA 4GRWE 4QWWD 1UKQA 3T77A 5EBWB 3O2DH 5I1GH 1DL7L 5JMRA 4M03A 4FXKB 2Z9TA 3LEXB 5DEFB 3BKML 4QY8A 2HT4C 4YE4H 5I0DA 1LK2A 4NQDB 1AO7B 3BH8A 3MR9B 1NC2B 4Z76B 1BBDH 2EDRA 3U0PA 2IFGA 2IG2L 1ACYH 4X80L 1F4YH 1OGAE 4QKXB 4EZMA 2A38A 2GUOB 4CNIA 4NCDA 3CX5K 2IH1A 2XRAL 1T66C 5DEGA 4U1MB 4TPRH 2MQ0A 1KPRA 4KTDH 3RDTA 5DJDA 4XP4L 4M6OL 5C0RL 4PJ9B 3O9WC 2F54B 1FVEB 1MRFL 4JO1L 1LE5A 2GJ6E 3CD4A 3DWTA 4YR6B 3RWGA 5MEND 4C83A 3DX8A 2D3VA 5SWSA 4JPIB 2AI0H 4XCEA 4D9LH 4HJ0D 5D1QB 1CQKA 3GJEB 2OZ4A 4OT1H 2P8LB 5BMFL 1JF1A 4HWBL 5C70A 3GMRA 2DQEL 2VMFA 3S96B 2VXQH 3OJDA 3OX8B 2HFEA 1X4YA 5SWQA 2IPUK 3SJVE 2AXGB 4KI5E 1KJMB 3KLAA 3V4VH 5ADOL 3CU7A 4JKPL 1OTTD 5CEZL 3C08H 4ZFOL 3QPXL 4WGWB 2IH3A 4DUXA 5I76A 2J6EA 1BWWA 2B5IC 5D2NB 4N9GA 3CMGA 5DMKB 1BD2E 4L4VB 1KIRB 1M6OA 3C5ZD 1U93A 1KN2H 3WS6A 4AJ0A 2ICWA 1IGTA 3VFPB 2FLBT 4TUOB 3ULVH 5FYKU 3RNQB 3STLA 1ZA6A 1F6AB 2DS4A 4X7CC 3TZVA 3DO7A 4P2OA 2R0ZH 4XB7A 3L7FA 5HSFA 3NCYP 1XZ0A 3HLAA 1CXLA 3M8OH 4NHCH 1G7PA 3BIKB 3LHPL 3F7PC 5EWIL 1R24A 1IGML 3MJ8A 2A1WH 2OJEB 5KVGL 1YY9D 2VLRA 2ZUUA 3W9DA 3QXUA 3DV6A 3KYAA 3OKNA 1UA6L 1KN4L 1CWVA 1NDMB 1S9XB 3QHFL 5L8LB 3SKNB 3BP6A 3UTTB 3SCMD 3S37H 4PJAF 2XI9A 2BSSB 5C0CE 2Z0BA 3VA2C 3SO3C 4K3JL 1J8HB 3AMKA 4JQIL 5E99H 5E8PB 5E8EB 1LDSA 1RPQA 2VR5A 5LGJA 3QDJE 2R2HA 4KVCL 1CR9H 2ZG3A 3FQWB 3ELAT 5T33L 1EHLL 3W5NA 4CBPA 1BQLL 4JFPB 4ZXBC 1HNFA 1IC7L 4XPTH 1P1ZB 3K81A 5E6YA 3IU4L 1RZJH 4XI5D 5T5NG 1XFPA 4OZFH 2ITDA 3QIWC 2BVUA 5MI0C 5SWZA 2I27N 1U3HC 4Q0XH 5IVXF 5GGRA 4A6YH 5IB5B 1XCQA 1IM9B 4JFEA 4KROC 4XPHL 2EE6A 3QXDA 4KPHH 5T1KB 4Z7WE 2HMIC 5CJQL 3FB7B 5KBNC 1SMAA 3L95B 3MJ9H 4PJHE 2OL3A 4OCSL 2HAZA 4F15B 1PG7X 3VGBA 2QTEA 2P44B 3QJFB 1EPFA 2VLJD 4KJQC 3SE8L 4M1DH 4H20L 1N8ZB 3UJIH 1X5IA 4XMPL 3UAJC 2XTLA 1HWGB 2IFFH 3G6DL 3TIDB 5L6YH 4J1UB 2B4CC 4P46B 5SX4I 4UT6H 5KSAD 1QSEE 3ECBA 3PL6B 3SGKC 3CX2A 3I6LE 4WUUE 4PRHB 2NXYD 2CXGA 3LMJL 3HPJB 1Q9KA 2YC1A 3U9PL 3RWDA 5EZOL 3M45A 2D0HA 3UTOA 2XV6B 1ZA3B 3GKZA 3QQ3A 1N5AA 2GTZB 2VC2H 1IQWL 4JPWH 4APQA 5T5FL 3HZVB 2B1HH 1YUHA 4W6WB 2ZZUT 3GI8L 4JDTH 7CGTA 5KSBB 1WBXB 1JRHI 4FFZL 4GQPH 1RUKH 5F7WC 2WANA 1C16B 2Y5TA 4TUJB 4M48H 5CMAB 4OF8A 4ZYKB 1CF8H 2OTWB 1EAPB 3V6FA 4LFHG 1MAKA 2SEBB 3CFKB 1D6VL 2BSED 4Q7DA 2FJFB 1QR1B 4L8CA 4MB4A 1AGBA 5KJRL 1CVRA 3U4EB 1UC6A 3TWCH 1LO4H 3DGCR 1S5HA 4NKIH 3RUGB 1EXUA 1H8OA 4RAUA 2OR9H 5TJWK 4Z78B 1DJSA 4IOIA 3VD9A 2R2EA 4TULL 1K3ZA 3CUPA 3K2UH 5C07B 1NFIB 5HD8C 5ALCL 4QHMB 1Y6MR 5FYJE 4CU8A 1J1OH 2LE9A 3F65A 5E00B 5EO9A 4NUJB 1KJ2B 1AGDB 3MUJA 4XNYL 3WKNA 2V7HB 5DI8B 5I2IA 4ZS7L 2EEBA 1VPOL 1IVLA 1BQHB 3P2TA 3DECA 2BOBA 3ZKXC 4M1CC 4Y19E 3MFFB 1BQSA 4DFIA 4X5WB 3U2SB 3L6FB 4GAJH 1WZLA 4GFTB 1YMHB 4G42A 4N0UE 3LKOA 2MOVA 2VDNH 3JWOC 1OAYH 1OAUH 5BVJA 1PKQE 1UB5B 4Y4HC 4Y7MA 5DD3L 5EU6A 4MNQA 2EH8L 2H1PL 5IEKA 5B39B 1R5IB 2MHAA 3JV0A 4GBXC 1DBKH 2YMXL 5EBGA 1MUJA 3U4BL 4YFLI 5EU3A 4P57A 3F7RA 4MAYB 3FMGL 3TA3A 2R56L 3VXOB 4OAWA 5BZWB 4U1GC 3VE0A 4IRJC 1UACH 3KPSA 3LB6C 3DROA 4LCWB 3FOLB 3TVMC 3BD5A 2Q86A 2P5EB 1EJ6A 3QHZH 4Z7QE 3JV4B 2J12B 4HMCA 5D71H 1XGPA 2R0LH 1CD1B 3ARSA 1QYGL 3EOTH 4X4YB 5JHDE 3ZSSA 5E1AB 4HF5L 1KIPA 4G8GA 3X3FH 5CLTA 1HI6B 4L1DA 1RUMH 3D0LA 4QRRE 4MD5A 2BDNH 1T89C 4XRCA 5IFJA 5FYJH 3CZFA 2D7TH 4LVNC 1N6UA 2YZ8A 4HCRH 1FNLA 1XIWC 4FXKA 3LEXA 2IBZY 5DEFA 3VFSA 5BS0D 3TNNA 5EOCH 3MGOA 4LARH 1NEUA 2NY7H 2F9BT 4FQCH 1I8KB 4K07A 5DD5H 2UVFA 4LASL 2NMSA 4U1SA 5CP3H 5IMOB 2P8PB 4G7YL 1TJHL 1BFOA 4LHJB 5IEHB 1F4XL 1ITCA 4HJGB 4DKFH 4OI9A 4P48A 3O11A 4JANB 2WWKO 3QUYD 4WY7H 5HHPB 1C12B 1X5FA 1FIGL 3D0VA 4TUKL 3O6KL 3PXJA 4EQ3A 4WO4D 2PO6C 4XVTH 2F54A 4Y1AA 4D3CH 2Z93A 4G6JL 4RBPK 4WHYH 5KN5B 3WBDA 4K71C 3SDAB 3MFGB 3GSNL 3N1QC 2IADB 4LRNL 4TVPD 1HSBB 3OHXB 4PBVC 5FGCE 3EDDA 1QKZL 43C9B 4XMKH 1KC5L 4JG0L 4Q97A 2RB8A 4OZGF 1NMBL 2AXGA 5ILTH 1VA9A 4G80B 3BGAA 5IJVB 3L9RA 4NO3A 5DR5H 3DX9A 4DAGL 5GHWL 3T4AA 3Q6GH 3V52H 3WUWA 1KPUB 5JIPA 4KK5D 1NLBL 4KTEL 5BRZB 3NCBB 4ACPA 5IFHL 4L4VA 3MRDB 1CK0L 1DBJH 1EFXD 2DKUA 2ZPKL 1CGXA 1NGPL 3U36A 2DJUA 3K8MA 5I1CL 1FNFA 4TUOA 1F3JA 4I3SL 2YOCA 4QHUB 1F6AA 2QQNL 2VXTH 3G08A 2XA8H 3VXUB 2O61B 3RDTD 3B2VH 1IM3A 3WDHA 3BIAX 4Z77B 1P7KB 3L3KB 1JTOA 3Q5TA 4DKEL 2BK8A 1UVQA 2YS4A 1BOGA 1UWXH 2JIXB 2X89A 3BIKA 3GSVA 1KCRH 1X9QA 3ZTJH 4HUUB 5L88L 4BM7A 2CIIA 5EOTA 2W9LA 1Y6KR 4XNUH 2KH2B 1DQML 3CK0H 5GGSB 2YRZA 1CXEA 3KPRE 1TPXC 2VZVA 3ARXA 3OR7B 4NYLB 5KS9B 2BSSA 5IKCB 2APWA 1B0GA 1J8HA 1CD0A 3T2OA 1BQHG 3VJ6B 4OQTL 4PP2B 4NRYB 4LQ1A 5C9JB 3DHJA 3W11C 4GRLB 1WBYA 3NMEA 5F7EH 5AYQA 3QFDA 4UDUB 3PV6B 1SMOA 1CLZL 1T6WA 2NW2A 3TCLB 4D9QE 3FQWA 1U58B 4XB8A 3I2CH 3D18B 1T7VA 4LLVA 1P1ZA 1Q9LA 4M7LT 5CZVL 3AROA 3ES6B 5MP6H 3TZVD 4P2OD 3UTPE 2AJVH 1PG7W 5B39G 4NM8H 3QIUA 1H8NA 1YEFH 1T21B 4XPGH 1UWGH 1GOHA 1MCWM 4M4RA 4WUUB 4HPYH 1IM9A 1U3YA 2ZUWA 3IGAB 2E9IA 3RRQA 5T1KA 4NKDA 2GSIA 4JCLA 3ZT5A 1A0QH 3QWOA 3TYGH 1KYOK 4FG6D 3O2WH 4OLVL 2NPLX 3MRPA 1QBLL 5EU4A 4WNQB 3ILQD 2YUVA 4RMRA 4ZAKD 5FHAH 3TIDA 5LQBH 4J1UA 4P46A 5D70H 4D0CA 3HAEB 1TCRB 4GKZA 1QO3A 4JB9L 2X1OA 3AREA 1IGJB 3V5HA 4R0LC 4X7DC 1FV1A 3LAFA 1MY5A 3R0NA 3HPJA 4K3GA 1AGEB 1QLEH 4WTZG 1OAQH 2LTQB 4YHOH 4OFIA 1HINL 4X6FB 2GTZA 4FQXB 1MSPA 4OLXH 4ODHL 1A7RL 2FATL 4ODTH 1DUYB 1NCUA 4JFED 3ARBB 3ARYA 2CK2A 2UWEB 1C16A 2RFXB 5CMAA 3PHSA 2NLJA 4ZYKA 1N4XL 2OTWA 4OI7A 2VLKB 3IYLW 3WYRA 2SEBA 4TNVK 3CFKA 2VN4A 5BV7H 3U48A 4LF3B 2XG4A 3NIGE 3O6FC 1H9VA 4EN3B 3B3IA 3U4EA 1DTUA 5EO0B 2DIJA 3RUGA 1BAFH 1IC5H 3DVIA 4N5ED 1XAUA 3UBXB 3WLBB 3MNVB 3BOVA 5FUZL 3BRGC 5FV2A 1PKQB 3WN5A 3OKMB 2GHWB 3SDDD 3RHWF 3MCG1 4PG9B 1I8MA 3RIAK 1KEGL 2CLVA 4EDXB 5CKGA 4O2EA 3D85A 3MCLH 4NUJA 2A0LD 3EIFA 4F3FA 1W8OA 1X6NA 4LCCC 4DZBB 3MLWL 1IBGL 2V7HA 5L0QB 5C9KA 5CJBA 1BQHA 4U6VL 2J4WL 1PAMA 3RWIB 1JGUL 3DI3B 1NCTA 2FD6H 4X5WA 2Y4SA 4WDIB 1T7YA 3ALPA 2ZUXA 4G43B 3VXSA 5LCVH 5CBEA 2F15A 3M17B 4ZPTB 3C60B 3MLXH 1PX3A 2WLZA 4MA7L 2AEQL 3V8CA 2BNQE 2OX5A 3BPCA 4H88H 1UCTA 4XAKD 3VXOA 1NMAL 3D25A 3MV7D 5DK2B 3IETA 4KMTL 5C0DB 3WIIH 4LCWA 4RZCA 1HZHH 4NJAH 4HQQL 4L29A 3AGVA 5D96B 1QD0A 3IF1B 4UMGA 2F53E 3JV4A 4XNXH 9CGTA 1G9NL 5E95B 5HJ3B 3NCYS 4WEBL 1YNKH 1LO0H 3PWPD 5E1AA 4H8WC 4K7PY 4OZ4B 3QUXC 3HNTL 4CN1A 3T08A 2Y23A 3PWVA 4WI6A 1J10A 1Y18B 2EZ0C 4PP1C 5EU6D 4MNQD 5HY9B 4OD3L 2D7MA 4ALAH 2NY3D 4WTZA 4XBEL 2NNAB 3NCCB 5I1KL 4RQQB 4YHPA 4N0FB 3MGTA 4P59H 1K5NB 1QNZH 3TA3D 2W91A 4NZUL 4X6CF 1YEGL 1BVLB 5JTWA 3KPSD 4MS8D 5IMOA 4LLUB 1EO8L 4PJCA 4HXAL 4NWTH 5IEHA 2JKXA 5KVFL 2VZOA 1D9KD 1MWAB 5GSVB 3W2DH 2XQBH 4U1IB 1P7QB 2DI9A 2IBGA 5EC2A 1JPSL 2RCSL 3HE7C 1NFDE 2WK2A 1EHNA 3FRUB 3V5DA 4M3JA 3VXRA 7FABL 1BLNB 5ECJE 4N0YL 5EH1A 3NTCL 5IBUB 3NN8A 3JXAA 3BDBA 3LH2L 3HAEG 2M1KA 4PREA 3BQUA 5SV3A 1W0YT 3S34L 2Y7QB 4XPBL 1LNUA 1YPZF 3CPLB 5GSRA 1BMGA 5C08D 3KDMB 2O5XH 2IPTL 1V7ML 3QO1A 5KSVA 2BVYA 3QAZC 4S2SA 1DQJB 4HWNA 4P2CG 1MQ8A 4PJEF 4RGNC 3VFOA 5D7IE 4C55A 4S1RL 5CGYC 4FFVC 5D8JH 4PJDE 3H9SE 2YD1A 1NC2D 3D39B 4GMSH 2DWDA 3KJ6H 4HT1H 3EJZC 4TTDD 5BZDB 5CD5C 1KPUA 3KPRB 2EXYC 3IRPX 5BRZA 3TFKC 4J3OC 5IW1B 4PY7B 2J5LB 4HXBL 5IGXL 4LSPL 5BVPH 4I8DA 1U8JB 1I1YA 1VFBA 1JHTA 4PJ7F 3VXUA 3UROR 3QSKB 2O61A 2GT9B 3NIDF 1BBJB 1U8QA 2F54D 4Y1AD 3L3KA 2JIXA 5JLZA 1LGVA 4NKMB 2FSEB 3KYOA 2LABA 5D1QD 2ATPB 3FB8A 4CDGC 3HC0A 1LO2H 4RBPH 3KPOA 1LEIA 1XR8B 2HKHH 5LBSH 1CLCA 1L7TH 2HFGL 3SDXF 2UVEA 1IQDB 5GGSA 4P2RE 4TSBH 4NNXB 3I02A 3M1BB 4YFLF 5F9OH 3OR7A 5IQ7L 5KS9A 5IV2A 2ZCHH 3MO1A 3BHBB 1T80A 1JJUA 1JWUB 5I8EA 3OTTA 4PP2A 4RWHA 5C9JA 4JGMA 2FHCA 2UUDH 3DURA 4L4VD 1AGCA 1HXYA 2I25N 1MCKA 4UDUA 2X1WL 4WCYL 3EO0B 5IB4B 4NUGL 2R4SH 1U58A 5J12B 3HZYB 4F9PC 1PVHA 1OTUD 4CVXB 2X4SA 1LMKA 2BSRB 1XGQA 5T3XE 3OB8A 1IFHL 4HUMB 4BZ1H 4I0PB 1QPPA 1T21A 1JHKH 5GIRB 1FC1A 2X89D 1IEBB 3ARTA 3E8UL 3CFCL 3U1SL 4XNZC 2X70A 4F57L 2B4CH 1U91B 4IHOB 2YPLE 1OARL 5DYOA 2W65B 3NABH 4GRMA 1N0XH 3UTTD 3QDGE 2APBA 1FNEB 1J8HD 1KEMH 1A1MB 3DUSB 5IVOA 4ZSOE 4Y5VC 3MRHA 2FJGB 3WJLC 4B41A 3QCVL 4KDTC 1T04B 1M7XA 1T1WB 3OAYH 4XMLL 2NCMA 3HAEA 3BYTA 3MJ7A 1PSKL 3HI5H 2CLZA 1RZFL 4JR9L 2EO9A 2C1OA 1S7SA 4FP8L 1OAKH 2Q7NA 4ZUWA 4LGPB 4R90H 5ISZE 3NZHL 4S1QH 3BPOB 2DQTH 3IFOA 4LSQL 1FHGA 4X6FA 3VG0L 3P0GB 3ULVF 2I9TB 4GRWF 1Z2KA 1IM9D 1O0VA 4RMQA 4R4NC 3HUJB 3MUHL 1REIA 5T1KD 2HTKC 3MXWL 2FX9H 3EYOB 3MZTA 3EKCA 3O2VH 4LVHC 5J56B 4N68A 4ZNEA 4IDLA 4MSWB 5ANMA 1Q72H 4L3EB 3HRZA 4L8BA 1P6AB 5SX5K 3LCYA 3NFNA 3VW3L 1Z0NA 4FQLH 4ETQA 4CGTA 4QYOB 5IWLC 3VWJA 1PG7H 2BFVL 2PETA 4P46D 5JORB 4BFGA 4PJFE 2OP4L 3PL6D 1A7NH 4PV8A 3C87A 2ADJB 3WFCH 3WLBA 3ARED 3FQTA 1ZE3C 3OKMA 2VDKH 3L1OL 4MCZA 4PRHD 4MNGE 1A5FH 4EJ1C 3GMPB 4MWFB 3WO4B 4M02A 1DVFC 3LRGA 5I66B 4MAUL 2E7LA 4G5ZH 2V2WA 3ROOB 1DZBA 5JHLH 5CILH 2KKQA 5I75B 1FL5B 4Y2DB 2FH6A 1FL3A 3WE6B 3ET9F 2MJWA 4MQXC 2A6KA 2CLRB 2ARWA 1S78C 5GS1A 1T2QL 5ENWA 3RWIA 1WZ1L 2DJ4A 2DQJL 4K9EL 4NC1C 1AQDB 2FEEI 1P9MC 1P6FA 2C4XA 5FGBA 1B6DA 4G43A 4PRPE 5AZ2H 2ICCA 4NRZB 3M17A 5HYIA 4PD4K 4PJAA 3BMVA 43CAB 1J1XH 1MHHB 3MBEC 2PTVA 3MLVL 5D7JB 2P1YA 2ORBL 4LVOC 1CTNA 1JF6A 3WNLA 3IU3A 2W0KA 2BRQA 1A6VH 3VFRA 4JZOA 2MPAH 1Z6JT 1JI2A 3S4SG 2VZ3A 1RD6A 3SOBH 1UM6L 3QH3B 1NAKL 1MFBL 1KTRL 1S7QB 3IF1A 2AJSL 4NZRL 5IVXA 4K3DH 1YJDL 5IFAH 5E24E 2VB5A 1YEIL 3OXSB 3PHOA 5T3ZL 5L8JB 5HYJE 3RY4A 4Y16A 4R4FH 2DTMH 4GSDL 3P4LA 3VXSD 4NWUL 1I1FB 1Y18A 4KJPC 1K6QL 5HY9A 3WFZA 1U8NB 4ZDHA 1MIEH 2VDPH 2NNAA 3QUZB 1YYMH 1U95B 1BQUA 1NJ9B 1VGEL 4N0FA 3MRBA 4Z7NE 1W0WA 1A9BB 4JFOB 1INDL 3BDYL 3CDGB 4HAFA 5FCSH 1KB5L 1F02I 2AP2A 4MVBC 5I8KL 3ARDC 2XACC 2ESVB 3CVHL 1XMWA 1UG9A 3T2NH 5HYSB 4LCWD 5H35B 2FWOA 5I74B 3WKMH 2DBJA 2FCBA 3B9KB 5I1IH 5D7IB 1A4KB 3FZUD 3DTXB 3VFUA 4Z7WF 4YBLC 2P5ED 1JE6A 5AD0B 3EO1B 1V3KA 5J3HD 5ESQB 3H9SB 4PJHF 4U1IA 1P7QA 3ZDYE 3GBNL 3VFGL 3OKLA 1P4IL 4JFZL 1S8DB 3U9UB 4X6BA 1KCUH 4IIQB 1BLNA 3GMLB 3GI9H 3HR6A 1HDMB 4GJTB 5FV1L 4UTBH 2GAZB 3T8XA 5DK0B 5HI4C 5DQDL 3VRJB 5FF6A 1YA5A 4LPCA 2Y7QA 1S3KH 4E41B 4PR5A 1LP9B 2R29H 1TZGH 2YD4A 2Z8WC 1S9YB 3E1F1 4QNPE 1DQJA 3NA9H 3FOMB 1KFAL 3IDJB 5EBLA 1G9NC 2A9ML 4HEME 2OSLB 3LV3A 5E8NB 3TNMB 3DX7A 1UJTA 4JFXB 4HIXL 4YBQC 3BKMH 2H3NB 1F13A 2H9GB 4JM4L 2A6JA 2HH0L 1RZIA 1PBYA 1FFOB 3OQ3B 4PG2A 1TIUA 2IG2H 4X80H 1SJEA 1VACB 1JI1A 1W0VA 3K4AA 2XRAH 1TENA 4CAGA 4TVPL 1GOFA 3L3GB 1EH9A 2IF7A 3IVKB 2HJLB 1JPTL 1VEOA 4N90D 2XN9A 2GYSA 3D69B 3SDAD 4XP4H 4M6OH 3S4SA 5IIEA 5C0RH 5EZJB 1XF2A 4WI7A 1F5WA 1MRFH 4JO1H 3TCXA 3LY6A 1IQDA 5DFWH 4YLQT 4U1HA 1NANH 2EYSB 4YDKL 1HCVA 4R97B 5BMFH 1R3LA 2BMKB 3H9HA 4HWBH 5K9QI 2DQEH 3TYFB 1J12A 5CINL 2R2CA 3GRWL 2YPLB 3LD8C 1JWUA 4U3CA 4NT6B 1PX4A 3CDFA 1MCEA 4JO4L 4QWWC 2Y72A 5BRZD 5ADOH 4XP9L 5F3HA 4JKPH 3QDGB 5HGBB 2O26U 5CEZH 1X4ZA 3QPXH 5IB4A 3HTLX 4Y88A 4QRPB 3U0TA 4F37F 4CVXA 3BGFB 4Z5RB 4ZSOB 5LWYL 3VXUD 2B1AL 5KVDL 4ODUA 4GBXB 3VXME 4QTHA 4KHTL 4RNRA 4PGDA 1HHJB 2YPKB 4JZJC 4GG6B 2JIXD 4X4ME 5JIIA 3A0OA 5EUOE 1JZ5A 4X0KB 1A6WL 4IHOA 5H8DA 1C7TA 3I75B 2DWEB 3LHPH 4WW2C 4MA8L 5EWIH 1Q0YL 1EEZB 5JO5B 1IGMH 2W65A 1OVZA 2A83A 2AV7A 5KVGH 5CSZB 5TE6L 2HA1A 1WIUA 3QT2A 3UYOD 1DLHA 1KN4H 4HJ0C 1A1MA 1F97A 1MRCL 3QHFH 4Z7QF 4LSTL 2LVEA 2FJGA 1UGNA 1PEZA 1AE6L 1WISA 4K3JH 2PYEB 2ZNWA 5IP4A 1J0ZA 5GPRA 5FYKD 5INCA 4IDJH 4P2QE 3EUUA 4BKLB 4KVCH 4DCQB 5T33H 1CXHA 3TV3L 3WXVL 4DWHA 1EHLH 1H8SA 1BQLH 3QZWA 1IC7H 1FG2A 4XVJH 5FDWB 3IU4H 4IRZL 4DOHE 4QXTB 3C5ZC 3HUJA 3RVUD 4CMHC 3BO8A 2DLIA 4WU7B 5HHOA 4YNYA 1FCGA 3EYOA 4MMXC 3H3PL 3KAAA 1J1PL 1R0AH 1ETZB 4XPHH 3BPLB 1I7RB 3HNVL 4I4WA 4MSWA 4BSWB 4L3EA 4PIRF 3PNWB 4OZGA 5AG9A 5CJQH 1N6QL 4IS6A 4NNPL 2H2SD 3DNKA 1YEJL 1WFUA 2YD9A 3QFJE 3CVIL 5JORA 3L3OB 1YY9C 2CUHA 5E6IA 3MNZB 1VDGA 3SE8H 5DO2D 4I18C 5D1ZB 4H20H 3X13B 4LLDA 4XMPH 1A1NA 2HT2D 4TYUA 2Z8RA 4P3CL 5DMIL 5TE4L 5BOZG 3G6DH 3LKQB 1KOAA 3SCMC 4PBXA 4FA8A 2EC8A 4NQEE 3FT4A 5D4QA 1SBSL 2YKLL 5J1TC 5GGVY 2X4QB 2X9XA 4FQXD 5I66A 1ES0B 1CFBA 1V05A 3LMJH 4YK4C 1BX2A 3MOQA 3U9PH 5E2JA 2CRMA 5LJYH 1XR9B 3GJFB 2JJSA 3WE6A 5IW6A 3CMOL 4MDJA 5DRNA 2WWKT 1IQWH 2IPKA 1E4XL 3TJEL 5T5FH 4XI5C 3VG9C 2VLKD 4ZPVA 3PWJA 4FFZH 3V4UH 1CDBA 5HTSA 3RWFA 5L2JA 4YDLB 4XCYA 2DRUA 4K3EH 2OTPA 1RUAL 1NAMA 5DGRA 1FZJB 4JE4B 3FO1B 1D6VH 5D7JA 2D31B 5C0JB 3PDDA 1ZT4B 1MY7A 4MJ2A 5F7KC 3QCTL 3O4LE 4RGNE 4WV1C 5C71A 5KJRH 3EDKA 1TMCB 4OD1L 2OK0L 1TDQA 4YUEL 2Q76A 3BESR 4FQQB 3BDXA 5BQ7B 2WUCH 3O3AA 4H8WH 5I17B 3QEHB 4XNQA 3QH3A 2LU7A 4TULH 5KSAC 2V2TA 4MJ6B 3FQXA 5JW4R 2C3HA 4BFIA 5ALCH 4MZ3A 3DBXA 2IQAB 1DFBL 3MCKA 5F6IC 2NXYC 4NNYB 1X7QA 3OXSA 2JK5B 5AWNL 4XNYH 5B8CB 2DQHL 3DYMA 5FO9A 3T1FB 2Y36L 1B0RB 3O6ML 4H1LB 4AM0A 4OGXL 1VPOH 3QUML 3VXNA 1TQCC 2XNAA 2OBGA 3C60D 3BFOA 3TN0A 3RVXD 4OF3A 2K7QA 5KG9B 1R5VB 1RJCA 1U95A 1NJ9A 4JDVB 3IJSB 2WWMD 2EH8H 4O5LL 3KNBA 2H1PH 3NCJL 5D7LE 3G6JE 1A9BA 1NLDL 4EI5A 2P7TA 3CDGA 4OFKA 1MVFA 1R3IL 1NKOA 1H5BA 2P45B 2YMXH 1MCNA 4OUOA 4K9EC 3U4BH 4HGMA 3HNSL 1YN6A 2ICWJ 1G0DA 5D6CA 3B9KA 3FMGH 2R56H 1CFVL 3BUYB 3DTXA 4RGOL 2M8XA 5AD0A 2GCYA 4AIOA 5J89A 1WVZA 2WQ8A 4WI9A 5K9OA 1SY6A 2E7HA 2VJXA 3IKCB 4HKXB 4JFQA 1S8DA 3U83A 2FYYA 2CKBL 3P4OB 3SKMA 5D2LB 3QEGL 1FJ1A 1G7IB 4P9HL 3O0RL 3GSOB 2PF6A 1HDMA 5MHSE 1JP5A 1QYGH 2EC9T 4R0LB 3PHQA 3VRJA 2VIRB 1P5UA 1QP1A 4HF5H 4E41A 4YGVB 4LL9A 2OLDA 5KOMC 3O3EA 1S9YA 1V3JA 4NQCB 1N3NB 2FGWL 1YJDC 1PGRB 2UY7A 5C09E 5D6DC 1EEQA 5GGUA 3MC0A 3SBWA 1UQSB 2EE2A 2YN5A 5E8NA 5CEXA 1KTDA 5ESAA 1NANI 1IAOB 4JO3H 3U6RB 3LEVL 1LO5B 5C92A 5B3JE 3KR3L 3LQAL 1P2CB 1TXKA 2H3NA 1KB9J 4QOKE 4XNMA 5D72L 4OCNC 5DUPH 1OAZL 1MCRA 3U7YL 4LASH 3INUL 1P7QD 3MODL 1KBGL 1R5WB 4G7YH 1RJYB 2FIRT 1TJHH 1ZKAA 3VFNA 5IJKC 3EW3B 1F4XH 3NIGF 4D8PB 4Q9BA 4GXUM 2NX5B 3DHMA 2VLMD 4M7LL 4HKJA 3V6ZB 4AIZA 3IVKA 1E28B 1FIGH 4TUKH 5KZCB 3BW9A 3O6KH 5FA4B 1YMME 4R3SB 3VFMB 3VXMB 2G5RA 4G6JH 1Q94B 2X10A 3OKDB 1N64L 4K7PL 4HK0A 5MEQB 1LDPL 4PRAB 4Z0BL 5IM7A 4PLKD 4ELME 1BVKA 4EIGB 4LRNH 4QLRA 4O9HL 1QKZH 3D39D 1F11A 1J88A 1FNSL 2VABB 3BWAA 2AJYL 2G5BB 1NMBH 5EO1A 4PJ8B 2PW2A 4V2CB 3FO9B 4E9LA 5I1LB 3C5SA 1ED3B 5D7KD 2IBZX 4DAGH 5GHWH 4GW1B 1JTPA 5K93A 4ODXB 2R69L 1A8JH 3ARRA 5J0BA 4KTEH 1NLBH 3E6FB 1A6TA 4S11A 4Z5RA 4J3VA 1GVIA 5IFHH 1DQTA 1CK0H 1JHLL 2I60L 2ZPKH 2YA2A 1NGPH 3S35L 2RGSA 3PE9A 3VFTB 3SKJL 1HHJA 3S88L 4GG6A 4TNWF 3B8YA 2FGZA 2QQNH 1FO0B 3MQIA 3MV9E 4XVUD 5CWSB 5C1MB 3R8QA 3QUYC 4YC2C 1A4JB 1SJHB 1O7VA 4DKEH 2FR4B 4NC1E 2DWEA 5C0GB 1T1ZB 1NH6A 1EEZA 5JO5A 3FT3A 4WO4C 2NZ9D 5CSZA 1JYXA 4I48B 4I77L 3C6SA 3ZL4L 1DQMH 4HC1A 1KGCD 5BO1H 4JFYB 2P46B 4X6DE 5ITFB 1A1OA 1OGTB 1I1AB 5CGTA 1G6VK 4JDZB 1SYVB 2UZXB 1UH4A 4OQTH 2DMBA 5F9JA 1ZSDB 3RX5A 1CE6A 3D3VB 1YN7A 5I18L 4O2CB 3VFVA 1CLZH 1HYRC 4BKLA 5A3IC 3HB3D 1A9EA 4I0PD 3QDMA 1FORL 1XCTA 4W4NA 2V5SA 5CZVH 5FDWA 4LSSL 1G9ML 1EGJA 3R4DA 3AFLA 1BGXL 4BH8A 1F00I 1YPZA 5CS7A 2BNRB 1MJUL 1S7WB 3RDTC 2DOCA 5C86A 4BSWA 4GG8A 4PJEA 4U7KA 3PNWA 1ZHLB 1W72B 1KCLA 4OLVH 5J4MA 3RGVB 1NCWH 3L3OA 1QBLH 3CU1A 3PDOB 2H32B 1LD9A 1PFCA 1NFDF 1XF3A 4Y4FB 4OZHB 1DUZA 5EPMA 3SY0B 1A7BA 4Q9CA 2PXYC 3QIBB 4ZUTB 3TO4B 3T09A 4M93C 1ZT1B 4PJ7A 3O4LB 5GGTA 2X4QA 3HC3L 2ITCB 2OMBA 1UM4H 2EC9U 4MXWL 5E2VL 5EU5B 3RVTD 1FZKB 1F45A 1QOKA 1XR9A 3GJFA 3LKRA 1HINH 4PJDF 4YHYC 4ODHH 1A7RH 2FATH 4AENB 1I9JL 4P2OC 4UDTB 5C0EA 5EFIB 3SDXA 4L3ED 3G5XB 3MRRB 2X09A 3EDFA 1AXIB 1RJLB 2DJSA 3QXAB 3B43A 2D9QB 2I07A 1XGTB 4FTVE 4A2LA 4TQEH 3UPCA 3O2DA 4M7KL 4V1DA 3FO1A 4NFCA 3EYQD 1SVZA 4XBGA 1T0MA 1RVFL 2PNDA 4FG6C 4HIJA 2Z91A 1QRNE 3Q6FB 5BQ7A 3GSUB 3O4OB 3ILQC 4Y5YC 1WFTA 5FUZH 4ZAKC 1MCOL 2Y6SD 3QEHA 5IHZA 3G6JB 3T0AA 4I0CC 2P49B 4Y2DD 2RQ8A 3WHE0 2IQAA 3E2HB 1KEGH 4Y4KB 1JPFA 3MREA 2NY4B 1U42A 5FYLE 3MLWH 1TZIA 1IBGH 3UZQA 4IEFB 3ISWA 2EO1A 1B0RA 5F7FA 4U6VH 2J4WH 1K8DA 1ZWIB 1QLFB 5B22A 3TEUA 1R3HA 1JGUH 1Y0LA 2XY1A 5KG9A 3JVGA 5D7JD 4M5ZL 4JDVA 4ZOCA 2QQQA 3IJSA 4LGSB 2NY2B 4Q6IB 2X4NB 2IQ9L 2LQRA 5DJYA 3NA4A 1KJ2L 1QFWL 1OL0A 4MA7H 3S5LB 1JWMB 2AEQH 3CC5B 3MZGB 3C9NA 5F1OB 1UJ3B 4ZUSA 1BFTA 2ZP0T 3QO0A 4R7NB 3OBAA 4D9LL 1NMAH 1AD9A 5J9PB 5JPNB 3BXNB 4KMTH 2BC4A 3SPVA 3Q48A 4HQQH 4HKXA 2FX7L 3SDDC 4HUWA 1ADQL 4PGCB 4QOKB 1L9MA 3MRJB 5D2LA 3D6GA 4DGIL 4N0CD 1FN4B 1G9NH 1QQDA 3GSOA 3GMOB 2A0LC 3I6GB 1Q9OB 4WEBH 2VIRA 3MA7B 1ZLSL 1N59B 4MD0A 1OGAA 3HNTH 3QUZD 2F5BL 4OBRA 4EQ2A 4NQCA 4ONHB 3DV4A 4OD3H 4XBEH 5F1IA 5FECB 5KSUB 1RZ8A 1UQSA 5MENE 2AEPL 2ESVD 4CJ0A 4F7MA 4S0TD 1ZGLB 1IAOA 4ISVB 5EZLA 3U6RA 4OLWL 2GJ6A 3V7AE 2JTDA 1FSKC 4MLIA 3B9KD 2AV1B 4NZUH 4X7EC 1J9CT 1P69B 3FQUA 5ETUB 1G1YA 1YEGH 1L6ZA 3H9SD 1DCLA 3FAWA 4WFED 3QR2A 4LEOA 3QG6A 4HXAH 4KRPB 1MAJA 1RY7B 1KCKA 5KVFH 3BUTA 1VFAB 2EDWA 4J8