5H2BA

Structure of a novel antibody g196
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
216
structure length
216
Chain Sequence
b'QVKLQESGAELVKPGASVKLSCKASGYTFTNYWMHWVKLRPGQGFEWIGEINPSNGGSNYNEKFKRKATLTVDKSSSTAYMQLSSLTSEDSAVFYCSIWDSYFDYWGQGTTLTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPWPSETVTCNVAHPASSTKVDKKIVPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords G196 antibody Heavy chain
publication title G196 epitope tag system: a novel monoclonal antibody, G196, recognizes the small, soluble peptide DLVPR with high affinity.
pubmed doi rcsb
molecule tags Immune system
total genus 39
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2016-10-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5h2bA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5h2bA02
3PWJA 4NNPH 1J8HE 3ARBB 4C56A 4OSUL 5DD3L 3DMMD 2XXMB 2F8OA 3SKUD 2VLKA 2WM0A 4CADB 4N8PA 4WI2A 4JG1H 2HRPL 2VLJB 4X6CE 5LWYL 4PRIB 3FFCD 4DTGH 5ACLA 1EAPA 4PJ7B 1QNZL 1T0MA 5IKCB 4Z18A 3MV7B 1FV1B 1IEBB 3QZWB 4UDUA 3RX8A 5I1KH 4ODUA 4U4BA 1NGZB 1D5BB 4BH7B 2EE6A 1R3JA 3E1F1 2VKXA 1XGUA 2IMNA 1H8NA 1JI1A 1GGBL 4FABH 4ZPVA 1AR2A 2C3VA 3G6AA 4O02H 4UT9H 5DK0A 4G6AC 4O2EB 1IVLA 4EQ3A 2L4OA 3SKOB 4YLQT 5F70A 2AABL 5ANMA 4HDIA 5GGTL 1NFDF 1N5AB 4GQ9L 4JDTH 2VR9A 2V5TA 3NTCH 1OPGH 3H7BB 3HMXA 5IMLB 4RMTA 3SE3C 1KEGL 4HKZA 4P4KA 3F58L 1CGSH 5F9OH 3WEXB 1TVHB 1M6OA 2A6IA 3L5HA 1YUHB 3UTSA 4AM0B 1ULVA 3VD3A 2JELH 5JPNA 1EO5A 2O5ZH 4OLZH 1ETZA 4FP8L 4M5YL 1N5YH 4XXCC 5HYQA 1UFUA 1I1RA 1UKSA 4IRSD 1T7VA 1UZ8B 5DR5L 4KROC 5DJXB 1AH1A 4LVHC 5D93B 1HWGB 1KCSL 3MUHL 2XWJA 4PRAA 5DEFA 1JZ5A 2YMXL 4R8WH 4LSTL 2UY7A 4MMZC 4TULH 1RUAH 1EFXA 4UINL 5CSGA 4FFVD 1MVUA 2ZCLH 2KBGA 1QBMH 2EO1A 5JA9A 5CD3A 3OQ3B 5CGYD 4MX7A 5EFIB 1G9NC 1BFVL 4AIZA 3LMJH 2P44B 5CSZB 2DQTH 5GGVH 4G8EA 4XVTL 4K3JL 2YPKA 1JHLL 1QKZH 32C2B 5E1AB 3BW9A 1I9IL 4Y16C 3V5KA 3L1OH 4KTDL 5TQ0H 4OF3A 3P4OB 4OI8A 1WLHA 5EC1A 2ESVA 4XPTL 1ZK9A 1PG7W 3MCG1 1KN2H 1OWWA 2H6PB 2A73A 1F58L 3QDHA 4G9DA 1DQJA 4GOSA 4U1SA 3QDMA 3F62A 4LCCC 4JRXE 4JFQA 4OZHB 4JFEE 2HFEB 2VISB 4POZC 4PB9L 5DF0A 1GHFL 4FQ1L 1Z9LA 4P2QA 4NKDA 2FEEL 5GISH 3OHXB 4NRYA 1VEPA 1FO0L 1UB6A 3WXVL 3T1FB 4YHKL 3MRQA 3MV9E 4FQJH 2HJKB 4BK4A 4Q6IA 2XWBB 2Y9RT 3WFHA 5H8DA 5EU4B 2FX7L 4HD9A 1OGAB 3RGVB 2AEQL 5HXMA 4FXGB 3MV11 1CFVH 5F7FA 3ES6A 5FUZL 2W9EH 3FB6B 5I6XC 3QH3A 1I7RA 1ZEAL 3GMPB 3KPOB 4WV1A 2AEIT 2R0WH 4X7SH 2FR4A 2BVTA 4MXQC 3BT2L 3MZGB 1F2XK 2D7TH 3KS0J 3MROB 4KZEL 3ARWA 4X98B 4XVUC 3C08H 3MTRA 3IAQA 4Y19D 1RD6A 3KYKL 4QRRA 1INQA 5K9JL 1XH3A 2B2XL 5AYQA 3FFCE 4AJ0A 2SEBA 2ZPKH 3CFDA 1PKQE 4P2OC 4LSVL 1OP5H 1U92A 4XXDA 1F4HA 4LLYA 3G6DL 4UT7L 1URLA 3EYSH 4PJXE 4K55A 1NC2D 4TUJA 1GJIA 1KPUB 2P5WA 3OKKA 3GRWH 1P69B 2XA8L 2OZ4L 3FT4A 4GRWH 5TPWL 5CEZD 5AAMA 2O61B 3WLBA 4PY8I 4QRTA 3CFBB 4E42B 5CCKH 1F00I 2OI9C 3STZA 1V7NH 4OGXL 1MUJB 1J0HA 3MLZL 5KS9E 1JZ3A 1FDLL 3TNNB 5KVDL 4GBXC 1AFVL 2P5EA 4PJDF 1Q72H 4UIMB 4S0SD 3DETD 1AP2A 4UT6L 1P9MC 5DQJB 4GKSA 5GGUB 4NFBA 1CLOL 2E9WA 2R23A 3UYOD 1OAKL 1T1YA 1WCBA 3BHBB 3MBXL 2LE9A 1P7KA 1U58B 3NCBB 3GUTB 1Q9LB 1KPRB 1NC4D 1XGYL 4X8JA 3MRFA 5EPMB 4I4WA 5MI0B 3O3BB 4GXVH 5HGHB 1XCQB 3RZCA 2IAMA 4DN4H 2VDOH 5HHOA 4KGJA 4OZGF 4PRPB 4HIXH 2F5AL 1VPOL 3QR2A 5ISZB 1EO7A 1BAFL 3MRHA 4JLRB 2Y5TB 5FUCE 3FQRB 4Z7WB 3O6ML 1MAML 4RGMB 5C92A 1HCFX 1FZOA 3O2WL 5KSBA 1GC1C 3DROB 2NZIA 2D3VA 1ZHKA 1A0QH 5EZJA 3IU4L 3T08A 1KLUB 4QHLA 3VGEA 2XTJD 1CDHA 4PD4J 4AMKH 4LHQB 4Z76B 1U6AH 2H26B 4FQLL 3F8UB 1FFPA 5HHVL 4OQTL 5KBNC 2BXZA 3E6HA 5L0QB 5KOMC 3RWEB 3X11A 1CXIA 3HFMH 4KH2A 1G0XA 3S35L 4L29A 3NPSB 4YBQD 1GRWA 3Q5OA 3OAZK 1PZUB 3P0YH 4Z5RA 4MA1B 1CG9B 1R5WA 4WW2F 4BK5A 4TUOA 5F44A 4U1JA 1UCBH 2IADA 3WIIH 2IAND 4Z7UA 5B39A 2BX5A 5AZEL 1Q9KA 1S78C 3IB4A 4P2RD 1HXYB 7FABH 3QCUL 3BZEB 4APQA 4UBDD 1ZT7A 4IIQC 3O8XA 3E0GA 3BOVA 1CXLA 5BMFH 4JHAH 3L5WB 3T2NH 1FLRH 4HCRL 3C5JA 3JV0A 2DWDA 1G7MB 3TN0C 2LVCA 5F6IC 3MUZ1 1E28B 4QRPE 5JW3H 2D2OA 5ESQA 1JI2A 2ICWB 3RDTD 4S11A 4FQXA 4X4XA 2GCYA 4Y19E 3EO0A 3TFKD 5SV4A 2Q1EA 1MAKA 2MFNA 3WCYA 3ZE2E 1VGKB 3DUSA 1OD7A 4LCIL 4FZ8H 4NN6C 3U7YL 4IS6B 4OGAD 5CINH 1JGUL 1TFHA 2UWEF 4XWOD 3IXTA 5C0EB 1WF5A 4UQ2A 1SY6H 5FB8A 25C8H 3IXAA 1CTNA 1WC7B 4R0LA 5DEGA 2Y07L 5CEZE 4M62H 2GSIB 3R0MA 4KRPD 4UOW0 3WXWL 2CIIB 2R0ZH 1QSFA 4K2UL 4Z95H 1MNUL 1ZLUH 3U83A 3WKNA 1AQDB 3DBXB 3OGCA 4KJPC 3T0ED 1I7TA 3QDJA 4QF1A 4U2YA 1QRNB 2EDEA 4H1LB 2EC9T 3FB8A 4HV8B 1J11A 5EZLB 3B9VA 4M1DL 1AQKL 4OIAA 1J86A 2UYLA 5JZ7D 4ZFOL 1GZQA 3NGBC 1VFUA 4JDZB 4UTBH 3MLWL 3P4NB 2PCPB 3TCLA 1KEMH 3EOAA 4RIRA 1KTRL 1G84A 4QRSA 5HHPB 2BSSB 3WFEH 1XF5A 3DX6B 3VXNB 2FEDC 1YNLL 5EBMA 1ORQB 4ISVB 2XKSA 2FBJH 3HAEA 5H37G 4XBPA 2NW3A 1D9KA 2EDFA 2W60A 2Q20A 4JPKL 3BSZH 4OJFL 2VNCA 4LDLB 1NGPL 3BZ4A 3S35X 2ICWI 3TBTA 3U4EB 4KTYA 2XQBL 5B8CA 2CH8A 3ZT5A 3L7FB 5JHDD 4MQ7B 3VFVB 1QKZL 3FO2B 4F33A 3DJ9A 1Y18A 1RIHL 4LSRL 1JPSL 1D5MA 5ERWB 3S96A 5DHVB 4PGCB 5D2LE 4F37K 1LK2A 1WT5C 5C07D 3MRCA 4G7YH 2KDGA 4KUZH 2PYFA 3TJEL 1SJEB 3OAUL 3JSSA 4Y2DD 15C8H 5TE6L 1FYHB 4QGYA 5FYJH 3BEVA 1KIPA 2AXGB 3UBXG 5KJRH 3SQOH 3QIWA 1Z0NA 1BLNB 1KG0B 2VUOA 3S5LB 3FT2A 3PL6C 1KIRA 4M7KH 4I2XE 1ZT4B 4OZIB 3MXWL 4HJGA 1CXHA 5C9KA 5EU3B 2DD8L 3SJVB 4NWTH 3LDBC 4JN2A 2ICEB 5K9KB 3ZDXF 1BVZA 1ZHLA 4HWBL 4CMMB 4M5ZH 2Z31B 1JYVA 3RY4A 2EECA 5EIIB 5I30L 2X4SB 3X13A 4M43H 3U7WH 4PJGE 4NN5B 1XGQA 4WW2A 1MWAL 4PP1D 2OR7A 3VH8A 5KSAA 4ODWB 3RA7H 2OR9L 4LVNB 5T3XD 1UZ6E 4XPHH 3UPCA 3VI4F 3WN5B 1K4CB 3EDDA 2JB5H 5DRWB 1NBVH 4L3ED 4XWGH 4HT1L 4JFFB 3SDCC 4WTZG 1JGLL 1XT5A 5FDWB 1DBKL 5EO9A 5GRJL 3WIHL 4LAQL 1CL7I 1FG2A 4MDIB 5DMYA 3N50A 3RNQA 4OUUA 4V2BA 5EOQH 1ZT1A 3HE7C 4J8RA 4LQFH 4OLXL 2AJ3B 2H1PH 5B3JE 4ZFGH 2H41A 1MQKL 1JHKH 3H3BC 4LKXA 4P3WA 1AIFA 2CSPA 4P3DA 5F3HA 4M8QA 5FCUL 5E8DL 1YZZA 3ULUC 1KCRH 3I9GL 5JQ6H 3KLHC 3MRGB 3SOBL 3BP6A 2NTSP 4ODBD 1UWGH 5I1DB 4L8SA 1KT2A 1OM3L 1NAKL 1GGYA 3DGGA 3T0EE 5E6IB 3OXRB 4I0PD 2EDWA 3RL1A 5L88L 4FFZL 4LLUB 1E4WH 4Y2OA 4XAKE 3D39B 3QUXC 4NZTH 1SMOA 3RWDB 3ARUA 4OI9A 4XCNA 3BI9X 1DCLA 3LN5A 5JNYB 2XFXB 1KENL 4YDLC 4JN1L 3C6LB 3KPSD 3BP4A 2X1PA 3M1BA 3PGCB 2FRGP 3FTGB 5FYKH 4N0FB 1UB5B 1KPVA 3Q0HA 3MV8B 4NO2A 2JK5A 4CVUA 5ADOH 4UQ3A 5HTSA 3RJQB 3MZTA 2ZOKB 2A9NH 1HHJB 1QTYT 1E6JH 4GRMA 3K46A 4MS8D 4XTRD 2DLTA 4L4TD 3OWEA 5C9JB 1J1OL 4YAQB 1CU4H 2W0PA 4P5TB 4YWGL 4DN4L 3D3VA 3L3DB 1HHKB 3BYYA 1L7TH 4HIXL 1I3VA 3GMLB 4IMKA 2EDYA 5J1SC 5EORL 2MSPA 3DECA 5CKAA 5KG9A 3W39B 3BD5A 3IT8D 1DBBL 1T80A 3KYAA 4LSQL 3VXSD 1AKJD 4F9LC 4YHZH 2F53D 5JHDE 3P9MB 3PHQA 3PP4L 5D72L 3TA3B 4NHCL 1U8IA 1LILA 1NMBH 3ZDYE 1ORSA 2HYMA 3QI9B 4NQCE 4Y7MA 1VKXB 4L3AA 5KVFH 3I6KA 4ZAKB 3BE1H 43C9B 4ODHH 4OKVB 2V17L 4YXHL 4FQQA 4LHUG 3RPIB 5C07E 4GRLA 1MFEH 4PV9B 2IALB 2BRRL 5BXFB 3HRPA 2VLLB 5HDBF 1XF2A 5GGRA 4CN6A 4YDVA 1IGFL 3EJYC 3CDGB 3O3AB 4GW4B 3ZHLA 1T7WA 4G42B 1IEAB 4LKCB 5K59E 4GRWF 2DQFB 3T8XB 4R6UA 5GRUH 4PJHA 4MNHB 5DS8A 3OJVC 1EZVX 5D7JD 1BBJB 1JIBA 3DYPA 4WU5B 1I85A 5GS1B 7FABL 4QHUB 1NKOA 3EBAA 4G6KL 2AJUH 2XZQH 4FG6C 3QIBD 3WO4C 4OF5A 5EZIH 3B9KA 3ZSTA 1OAZH 1KV3A 1J0JA 4H88H 3VFRA 4QY8A 2YPLD 4NBZB 1IZKA 1JHTA 4X4ZA 2A77L 5I16B 4J1UA 3CIQA 5I0DA 1WZLA 2WLYA 2QADD 3FQUA 3WLWC 5DUMH 4XT1C 4YXKH 3QHZH 1I1AD 3P4MB 2DBLL 1KN4L 4F57H 5BJTA 3S37H 5EU6B 4L3EE 1KXTB 3UYRH 4G5ZL 4N8VB 4O2CA 3ILQC 4EDXA 1XF3B 1F90L 3WNPA 4WJ5B 3QSKB 1OOAA 1LE5B 4Z7VB 3T77B 1T5WB 2M26A 2VB5A 4XNMA 3HR5B 4Y1AB 5LQBH 1DQQB 2BSTA 4ALAH 3KYNB 1EEUA 2OJEA 2AK4D 1FNAA 1RJZB 2XI9A 4R90L 1A6VL 3MJ8A 1T1WB 3RVVC 2J88H 3ARBD 2BNUA 3O4LD 5C2UB 1P7QD 4NQDD 1DBAL 5BVJA 1YEHH 3BDYL 1L0QA 1CBVH 2J8UB 2R1WA 1MHPL 2HN7A 2E8ZA 5C1MB 2VXQL 2VLJD 4ZOCA 2J4WL 3VD4A 1YEDB 4GAGH 2CJUL 3C6SB 2LVEA 4GG8B 4QTHB 4PUBH 3TM6A 1FL5A 4Z77A 5IQ7H 3SDXF 3WS3A 3MV7D 3N0PB 2DI8A 4PJAB 4BA8A 1U93B 1VHPA 2Q3ZA 4PJBA 2IGFL 5F96H 2Q8BL 4OFYA 4EI6A 3PDOA 5F93C 3GSVA 4ZXBA 2R2EB 3F7VA 4YK4C 2NLJB 3CC5B 4L8BA 2B7DT 2NY5H 1RMFL 2VIRB 3LV3A 4L4JA 3UTZB 4U1IA 3JV5A 3GMOA 1YEJH 2BP3A 3QPQD 4L4TE 4X9HA 1FZJA 3NFNB 4WEUD 1G9EA 1KB9J 1BD2E 2ZUUA 4I13B 1NLBH 5AZ2L 1FGNH 4JKKA 5D1QB 4HKXB 4EBQH 1WUNT 3CNKA 3VW3H 3VXSE 2VQ1B 4EVNA 5ICXB 3LSOA 5F97E 4O51B 2H32A 2F53E 1WQVT 4NUGL 3VU2A 4JFDD 2YRPA 3NCJH 2EE9A 4GKNA 1DTUA 3AC0A 3DXAA 1I8IB 1TTUA 1AGFB 4FN0A 5F3BB 3H9SB 2NY3C 3NN8A 1XZ0B 3GMRA 2C4FT 4M3JA 5FECB 1X5ZA 2EDBA 3U30C 1FYTA 4NSKA 5DYOA 2AJXH 1BZ9A 1HHHB 4K71B 3O2DA 3PQYE 4WI7A 4HUWA 3D0VB 1CR9H 3TEUA 2OXGA 4GH7B 3BPCB 3TIEA 5J9PA 1NUNB 1VGEH 5EU7C 4X99B 3RWIA 5HVGB 2OR8A 2C3HA 3KPQB 3ZYOA 4IEFB 5IEHA 5MENE 3VFUB 4U1KA 4NNYA 3L5XL 5EUOE 5IB2B 4EIGB 1B0WA 4JE4B 1CFQA 1ZLWK 1XFPA 1NL0H 1JL8A 3GMQB 2WIMA 3ZL4L 4ETQA 1YPZA 4U1LB 5MERB 2VR5A 1R3KB 2YPLE 1BREA 2VQUA 4XHJD 3ROOB 4ELMA 3BKCH 3D85B 4K9EH 5GZOC 3TP4A 3MRMA 5TDNB 2EDHA 4NOFA 2IG2L 5B38B 2IBBA 4NNXB 1K6QL 1X5YA 4X80L 3T04D 1DVFC 1H8OA 4KHTH 5F6HJ 2W0FA 2JB5L 1LO0L 2XTLA 3IDMB 1RHFA 1X5HA 3VXUB 1NBVL 2X2YA 1KLGB 1ED3A 4TTDC 1U3HA 3CXHJ 2D7QA 3HE6C 2X4QA 5SX4H 1Z3GL 3MV01 3HG1B 3ZLQC 5AWNL 5EIVA 3I75B 3RGVD 2V2TA 4XNQA 1AGEB 4IBLT 3T3PF 4LFHG 3ZTJG 3C9NA 4HJJH 2YD5A 5JUEH 4XH2A 2HTLD 3GSWB 1WBXB 2CDGB 2ADIB 1IGTB 5KAQF 5DD1L 1A3RL 3BJ91 2V2WA 3MA9L 4PJ8A 1ND0B 4PJGF 2GJ6B 2QBWA 4L8DA 3VDAA 3GSNL 5FHAH 4KROB 1UM4H 1KTLA 4LVHB 4YIQA 5DTFA 2VLJE 3IJSA 4PRIE 4PJ7E 1Z0MA 2BSRB 4RWHA 4OD2A 1Q0XH 3MV7E 4X6FB 4Q9CA 5E70A 3N1PC 3SE4A 1AJ7H 2P8MA 2C7UB 3PWPA 3HKFA 4X9IA 4KKLC 3N9GL 4HWEL 2VWEE 4XPFL 3ORJA 1NAML 1IGMH 4HS8H 5KW9H 3ZE0E 4KQ3H 2AEWA 1T21A 4XP9L 1EIBA 2ITCB 2BNQA 4EUPB 2PW2B 4RSVA 3SEPA 2M8XA 3OPZL 1RZ7H 4ZS6C 3C09C 3P30L 4LCCB 3UPRA 3MNVB 3L3GB 1MFAH 1BBDH 5HYSG 1UH4A 3KNBA 2QSVA 5FO8B 1JPFA 4MZ3A 2RBLA 1PQZA 4JCLA 3BFOA 3WNKA 1P4LB 5JXEA 3NCCB 2R1YB 3C8HA 4LPYA 5C0AB 1FAIH 1A7BA 4XC3L 2FO1A 3PDGA 1YN7B 2MQCA 2Y72A 4MDJA 4MAYA 5ISZD 2AEPH 3EDEA 2X4PA 5ENWA 1OF2B 3W9DA 2A0LC 3FB7A 5I6XB 1FAKT 2IPTH 3HS0A 4HWZB 2J5LC 4CU7A 3V0VB 4QXGH 4KDWA 3WS6A 1SVCP 4UILH 1ZSDB 3LVEA 2OCFD 4KHXL 1F13A 1HOCA 4ZUVA 3BUYA 2NQCA 3GI8L 4D0DB 3B6SA 4PREA 2HLAB 3QIUA 3TIDA 2WUCH 4HUVB 1LE9A 3GJFA 4JM4H 3GSXB 4PG2C 1Q38A 4P2OB 3RKPA 1FFQA 5L2KB 3QIWC 4W81A 3IRPX 4S2SB 4ZO8A 2D9CA 4CAGA 5GRZA 3PJSA 4OZHE 4U6XB 5HY9B 2WWKO 2EDTA 1A6ZB 5DSCB 4K3EH 4XZUA 1JZ7A 1YY8B 2N1KA 3M17B 2ORBL 1IE5A 3QHZL 1FE8L 1JWUA 3QT2A 2RCSL 3QEQA 1QVOB 1U0QA 3S37L 2OI9B 1AXSB 3O6LH 1DLHB 3ZTNL 2WK2A 2VDLL 5CEXB 4POYA 3TBVB 5I2IB 5GS2D 1KLFA 1P84J 4GBXB 5HHXL 1AE6L 1OGAE 2CDFA 3MNWA 4WW2C 1NCAL 2DI9A 2VRAA 3NIGF 4PTTB 3NZHL 3W5MA 4WY7L 1U8PA 3CZFA 1IGCH 4PRBB 4QHKJ 4QCIB 2CO7B 1YYML 3H3KA 5GGSY 4XRCB 3Q5YA 5DO2C 4JZOB 3SGKA 5EA0H 3VFGL 3LRSB 1I1YA 3JWOC 4JR9L 4ZUSA 5FHBL 4JB9L 1X5XA 3VGAC 4I3SH 5E94B 4P59L 1PEWA 4WUUB 2NNAB 2PYEB 1IILE 3PHSA 1AD0A 4NRXB 2DAVA 4KAQL 1KJ2L 4FNLH 2VUYA 5E95B 5L2JB 2VQTA 2IBGA 4OZFH 4PRNA 3QUMH 1QQDB 4H25A 1C7TA 3BXNA 4KI5F 3RWCB 1OAYL 3NFPA 2P49B 1D5IH 3CJJA 1U3ZA 2OTUA 5IP4A 3LY6A 3PGDB 2HFFB 5TH2B 4GS7C 4QNPE 1CDGA 5FF6A 5HGDA 3AGVA 4RZCA 4N90D 2B1HH 4HUKB 1W72B 1T89A 1KJVA 2PETA 1H9VA 5E2TH 1G7LA 3FZUC 2VERN 1T20A 5DGQA 2BERA 1I9RH 4NKQB 4ODTL 4ZS7H 3W9EA 2C1PB 3UO1H 4H5SB 4QTIL 4KUCD 3LKQA 2Z8WC 3GBLA 3CVHH 3ARYA 4DGVH 5HJ3B 2W0LA 1NFIA 4M03A 4HC1L 4IIQB 1BM3L 1R3LA 2V5MA 3ARFC 2YEZA 3CUPB 1CFTA 1GL4B 1R6VA 1LVEA 4PRPE 1MRCH 5ISZE 4RFOL 1ACYH 1EDQA 4IRJA 1GCFA 4Z7WE 5D70H 3FQWB 2P45B 5GRVK 5IB4A 5DJCA 3L6FA 3TGXA 3TN0B 1RHHA 3VFWB 2XZCL 5F6IB 2ITDA 4H0IA 1BF2A 5EZOH 3WHXA 5JOPD 2MCG1 2VDMH 3E6FA 3S37X 4TSCH 1ZS8A 3W11D 1DANU 1EO8L 3GIVB 5T1KA 3TWCL 4HPOH 3QCTL 5C08B 1H5BC 1NBYB 1S9VB 4W70A 2P5ED 5EBWA 2EH7L 2WBWB 4PJEA 5DK3A 4NN6B 2PW1A 2W9DH 5DJAA 1BIHA 4U6VL 2R2HA 1N6UA 1S9XA 1ZHBA 2P8LA 4ERSH 4M6AA 3DHMA 4HJ0C 2GT9A 3UJJH 4A6YA 1LEGA 5EU5A 3WO3B 1GOHA 5KZCB 4YO0B 1IEHA 3PF2A 1R5VA 2NX5B 2FL5B 5JO5A 3B9KC 1TENA 2DLFL 1FJ1B 3B3IA 2D03L 1LEKB 4JRYB 3TPUB 4FFWD 1NSNL 2I9LA 2CRZA 5HHOD 4X6DA 4JKPL 8FABA 1C5CH 4QRQB 5CGTA 5KSUA 4PGDA 2NCMA 3NGBB 5FAAA 3UBXA 2EIBA 2FH6A 1OSZA 3MRLA 3V5HB 2P42B 1Y6MR 1S5HB 2VXVL 3TT1L 5DQDH 1S7VA 2WWKT 3MODL 3EYOA 4JFPB 3QA3B 2ATPB 1K8DB 2OL3A 1LK3H 1U8HB 4KV5E 3RVUD 3OZ9H 1IQDB 4OM1L 1UXWB 4JFFD 1TPXC 2VSCA 4ORZC 2DWEA 5MEQA 1QLRA 4MNGA 1SHMA 5IW1A 1I1FB 3PWLB 4KTEH 1BOGB 3QRGH 4EDWH 4YE4L 3HI6L 3I3BA 3LZFH 1FZMA 3EJZD 3U0WL 4WWKC 4M48H 3WNLA 4WTZA 4JM2A 1IGML 3HNTL 1F3JA 3F5WA 4M6MH 5HHNA 2MPAH 1M7IA 4UB0H 4JZNB 3CXDL 1HN1A 2FECI 1T2QL 1BQHB 4OD3H 2YK1H 5E6ID 1QRNE 3TO4C 1T6VN 4JO2L 4X5WB 3D39D 4WFFE 4R7DA 1JCKA 4N90E 2MHAA 3C6LD 5F7DA 5HD8D 1MFAL 1INEL 1BGXH 1BBDL 4FS0A 4LDEB 1DQML 4FQIH 2HWZH 5GSRA 4XGZB 4PG9B 4HPYL 3HPLA 4U1MA 3MV8D 4Z0BL 2I07A 2HH0H 4NHUB 1EEYA 4Q9QH 3AMLA 3PL6B 3IDXL 5DJYB 5C7XL 2JIXA 3V6ZA 3BEWA 1EUUA 3BX7C 3PWVA 4KVCH 1NBZA 4UU9A 2YZ1A 1G6RA 3DO3A 1OT1A 3LDBB 1MCKA 4P5TD 1V3MA 2L7UA 3GSQB 3DUUB 4QT5A 2CLRB 1Q0YL 1A1MA 5I15H 3KLDA 4TNWF 2BNRA 4BFEA 4KKBD 3RUGB 1MRDH 2IPTL 2O5XL 1CFSA 4JY6A 1ZGLB 3NBNA 1RUKL 1L7IH 4LPVA 3TA3D 5LVEA 4OT1H 4R9HA 1IRAY 4M00A 5F89A 4P9HH 5D8JH 3IDUA 3N06B 1UXSB 3QI9D 1G7PA 3RWGB 4AYFA 1A6UH 1QSFD 4KKAC 2I5YL 4ZAKD 3V4PL 3V6OE 3W2DH 3VFTB 3SDCB 4NRZA 2K7PA 4Y4KC 3T1WA 3K4ZA 4LRNL 1YN6B 3PWJB 4NC0B 3X12A 1QACA 3K1DA 4QOKA 3HE7B 3ARDD 5F7EL 4EN3C 5JXAL 3MRDB 2OQJB 1X5FA 3SGJA 2GJJA 5INCB 4XX1E 2DQHH 4X7TA 4XBGA 4LEOB 2BJMH 2F8VA 3QUZC 2R1XA 3BD4A 1MRFL 4OB5L 3MLXH 1H3TA 3ISWA 3NACH 2ZUWA 5D71L 2B4CL 2QQKH 4LHUA 4M7LH 2HVKA 1FBIL 1S7TA 1DBML 3WDHA 4OZIE 3H3PL 3SJVE 2AXJA 1WVZA 3D0LA 2GEEA 5EO1B 3QUXB 4TOYH 5C6TH 1UVQB 4KFZC 4HKBA 4YDLB 2C3VB 3ZHKA 1IGCL 2IBZY 5FO7A 1FIGL 2F54A 2C1OB 3NMEA 3QXDA 3ZHDA 1V7ML 5DJ2B 4LF3A 5INDB 3KXFB 2ZSWA 4OLEA 4RA3A 4LSSL 5I8OH 3HI5L 3SBWC 4LLWA 5EU6D 5TJWK 4KMQA 4MJIA 3REVA 3TV3H 1LDPH 3JWDH 4JFFE 1M7DB 1BVLA 2A6IB 1MIMH 1LP9A 4YHYB 1LO5A 2E7CA 5FO9B 2GTZA 4N0UB 3UC0L 4ZYKA 3K81A 4K8RH 2BVQA 4DCQB 2KQMA 5EOCL 4UV4H 4OF7A 2AJZB 3VXQA 3OF6A 1KCVH 4ZFZA 1RJCA 2XWJB 5DEFB 2VL4A 5HYJA 4JCMA 4MMXC 5CEZH 5D2NA 4YFDB 3PXHA 5DFVD 4M4RA 1MVUB 3HPJA 3G08A 3WFZA 2DQEH 5CD3B 5CP7A 3GBMH 5I19H 1X7QA 5CJOL 2Z35B 5T3ZH 2QR0A 3SE4C 4AIZB 1I4FB 2ZP0T 1GGCH 3D39E 2FSEB 4PJCA 2XYCA 2L0DA 2YPKB 1HNGA 1CYGA 1KB5B 2NY4C 4BUGA 1BEYL 1B4JH 3BW9B 3U9UB 4J6RH 2BC4B 2AAVA 5GGTA 5JIPA 3T65A 4HIJB 1XIWA 5CZVH 3U48A 1RZGB 5IMKA 3MV8E 1HWHB 1OCWH 1P4BH 5DJZA 1I9RL 5D9SA 4J3OC 4FQCH 2WINA 3UJIL 1ADQL 5AUMB 2LQRA 3ULSB 1T4KA 2PTTB 3CVHL 4DGVL 3TLRA 3WO4B 1HZHL 3EO9L 4RAVB 1OP3H 1SEBA 5ICYB 4IOFC 5D1QD 4P99A 2I27N 4H8WL 4NJAH 5JXEC 3BKYL 5IGXL 2ZOLA 5KTEH 2VLRB 4KK9D 1A3LH 4J3UA 3QNXA 5GHWH 4HFWA 3SE9H 1F8TH 5DJ8A 4TSCL 2CRIA 3QPXL 3LQMA 3H9SD 4Y89A 3NCMA 5IHZA 2VDQH 4FZEL 1TJIH 3UTOA 3U9PH 5B4MD 1EJOL 3H9YA 1IARB 3OAYH 3WIFA 3MMEA 1INQB 1A5FH 1XH3B 1QFUL 1RZ8B 3NCEB 5BRZD 3B2UC 3ZKQD 1YECH 4NFDA 1DQTA 4PY8J 4XXDB 1FGVL 3P77B 1FO0A 2PR4L 1F4XL 1F6AB 2EC9U 4JZJC 1S5IH 4NZUH 1X5JA 1EFQA 3OKKB 1DJSA 5LXGL 2A6DB 2VXSH 5IVXF 4G6JL 4Y5XA 3LPWA 3IKCB 4PB0H 4RDQG 3STZB 3D2UB 3D85D 3EKCA 2LABA 1W0YT 3VA2C 4YK4B 2EYTA 1G0DA 3VGFA 2P1YA 2DQGL 4G6AD 4FTVB 4TRPH 1FH5L 1NCBH 4ZO9A 3B43A 3N1MC 4JO1H 3VXUD 3M07A 5EU6E 5HGGS 4BH8B 4IHOB 1A7QL 2Z8SA 4OTXL 3MLUL 4C58B 3HG1D 2R23B 1MHCB 4YHLL 4Z7VE 4WO4A 4LLVB 4OLUL 3IJHA 1OGTA 3BVNA 4Y1AE 1LO4L 3IDJB 3JV6A 1MVFA 5JDSA 1NFDB 2PO6A 3MRFB 4F7CA 3CCHA 3NAAH 1ZA3A 5IB3B 3QNZA 2ATKB 4LAJH 4JQXA 3MRKA 1HYSD 1VADA 4E41A 2J8UE 3SDDA 1WFNA 3FN0H 1S7QA 2GJ6D 3O9WC 1CL7L 1A7OL 4OD3L 2NY3B 2E8YA 1NQBA 4KQ4H 2OZ4A 3LIZL 5A2FA 2B39A 3EOTH 3U30B 3SCMA 4XPBL 3B9EA 5IIEB 1C12A 1EHNA 4MJ6A 4QHLB 1NCCH 1UA6L 1JF1B 3K3QA 1S7XA 1T1ZA 4PJAE 3GDBA 4YPJA 1N64H 1HILB 4B7LA 4BUHA 4RBPK 1BWWA 3QUKB 2YD9A 3T3ME 3H42H 4JQIH 1HSBB 3GIZH 1TETL 1MEXH 3FRUA 4DUWA 5SWSB 1INDL 3PV7A 3G6JA 3ULVE 3IDGB 5D7LB 3VJ6A 3CSPA 2X70A 5CS7A 1CGVA 1FZKB 1FN4A 1ZAGA 5FKAA 4DUXA 2CK0L 3DX8B 2RQ8A 3C60A 2ZSVA 5A3IC 4TUOB 1TDQA 4G9FA 2VDRH 2NY0C 2A83A 1DVFB 3HC3L 3TZVA 2B5IC 2EDRA 5EOCJ 5C86A 2CXGA 3MCKA 1U8LA 5J1AA 1SBBA 1D6EB 3VWKA 3U1SH 3MRPB 4TVPD 4FQHA 5C09A 2IPKA 3HC0A 5CIPH 3HE6B 3QXUA 2EXYC 1T66C 3H9SE 1P6FA 3D69B 6FABL 2DWDB 3CLEH 5IHLB 2X4RB 4WU7A 3QXAB 4WFED 2VH5L 5ESQB 1J8HA 1R5IA 4NZRH 1S7UA 4OQTA 3T4AA 4MXQD 2Q3AA 4NO5B 1TNNA 2G5BB 4MXWH 1JMXA 4X6CA 1Q8MA 4O58L 4XVUD 5I76B 1P7HL 1IKNA 4ODSH 3ZKSD 5I1IL 2HT4C 2W38A 1OB1A 3O0RH 1IAII 3CLFH 4P2OD 5BQ7B 3ARXA 3BWAB 4D9RE 5C6PB 3THML 2M2DA 3HHRB 2UUDK 3MXVL 4L4VD 3QUMA 4XP1L 5CJQL 1TJHL 1JMZA 1IFHL 4NZJA 1ZTXH 2X4OA 1SQ2N 4PS4L 5IBLC 2YKLH 5T3XH 1B2WH 3CFJB 5E6YA 2EC8A 2UYLB 4XBEH 4TN9A 4HCRA 1ROWA 3OR7B 4J3SA 5I8OL 3VXUE 2X9XA 1FVDB 2NXYC 5SX5K 3UPAA 1P1ZA 3HG1E 3WMSA 5GJSH 2G60H 3C09B 5DMIL 1ZHNB 3ZDZF 1EHLH 4ONGH 2HFGL 3BPOC 2E7LA 1ZGLM 3CMOL 3QFJB 5HI5D 1A1OB 5GGSA 2FYYB 4PJDB 1IGJA 1AC0A 3P0GB 3P73B 2RIKA 4XBPB 1BJMA 1G7HB 1D5XB 1G6VK 4YGVA 2GJ6E 1NEZG 3S4SG 2H2SC 4I48B 3VRLE 4ZUTA 5MEOA 4IMLB 1GGIL 2VAJA 2C4XA 1I7UA 1B4JL 3T2PA 1UM5H 5IQ9A 5IT2L 4WUUD 2AI0L 2EDXA 4KMTL 2PYED 3VWJA 5IROC 3KLSA 4X6BA 4NZDA 5DI8B 2C3WA 3SDYL 5ALBL 2J5LB 4F7PA 4MAUL 1D5MB 3IF1A 1JPTH 2OM5A 3SPVB 4ZFOA 3A6BH 1RZKH 3RTQA 3LHPL 1AY1H 1CFBA 3DVNA 5ACZA 3WUZA 4G80A 3EHBD 3ILPA 3QQ4A 1I7ZA 1LO2L 4JRXA 4OCYL 4R96B 1I8KB 2D31A 3LKRA 4KI5C 4YFLF 5GS0L 3FT2B 1N4XL 3TO2B 1VA9A 2CRMA 4HBCL 4NJAL 4LL9A 3MOBH 4NDMB 3HNVL 4HJGB 4PJ9C 2E6QA 2J2ZA 1S8DB 3CK0L 5I66B 4YDIH 5I8KH 2BVOB 5C0IA 3VFSA 1NMAH 1LO3H 3VFOA 3ARRA 3LKSB 4AG4L 4TVPE 4GJTB 4WGVB 2X9WA 5H35B 3SE8H 5C0AE 1S78D 1U2CA 5F88A 1OW0A 1N59B 2RHEA 4WW2B 1S7SA 4XP4H 1IGYA 4ZOBA 2WUBH 4WFEE 3O41B 3QZWG 4FMKA 1IC5H 1FNSL 1TJGH 4K7PL 1C5DB 4U7KA 4K3DL 3DMMA 2CUMA 1P2CB 2Z8VC 4LLQB 5DFWH 2Y6SD 1WFUA 5ALCH 4S1QH 5I8CA 1N6QH 4D3CL 4XCCL 1FG2B 5C0RH 1LEIB 1QLEL 5CBAA 4DJMA 4J8RB 3FFCA 3TBWB 5T5NG 1PKQA 1BX2A 5HVWA 3MR9A 3FOLB 3FQTA 4YZFE 8CGTA 2IJ0C 3WYRA 3VGAB 4LKXB 2VR4A 5C08D 3WHE0 2FX8H 3VI3F 4PJXA 5L2KE 3WFBH 5E2WL 4YUEH 4JQVA 1TZGH 4PB0L 4DZBB 5TF1H 4UTAL 4NQVB 3MLTA 4HWBA 1N2RB 5KZCD 4WTXA 5KS9A 5E00A 4ZDHB 5DT1H 3KYMA 1MSPA 2NX5D 1WBYB 5C0BB 3PWNB 5JQHC 5E8OA 1MWAA 4PGEB 5C2BH 3BP4B 5IEKB 4DKAA 5DDHB 2FGWH 2NY5C 4GS7B 2AQ3A 3J7HA 2CKBH 2ILLA 5TE4L 4DKFL 1QSEB 1HDMB 4MAYD 4UQ3B 5KVEH 3ULVL 2DOCA 5E8NA 2X05A 3WIHA 3NAAL 5ICZA 3DURB 5T1LB 4BFBD 4IRSA 2XKNA 4HLJA 4Z7QF 4CU6A 3CX5J 5IFJB 1KIQA 4WFHE 5HVFB 1RZFH 4J3VA 1HEZA 2XN9B 3HZVA 4PJIF 3LEVH 1EVUA 5KG9B 3V6FB 3CPLB 4P23C 3I2CH 3ARFB 5D5MF 2I60L 3PHQB 3GGWA 1Q1JH 3WFDL 3ESUF 2VXTL 1U8IB 4WUUE 5FCSH 2PYEE 1OWRM 1N64L 4PJ5B 2EEBA 3RNKA 1SBSL 3HZMA 2X4UB 4L1HA 3UTTB 1CLYH 3DRTA 3FAXA 3JTSA 5KVGH 3AUVA 3F7QA 1WICA 3ZO0A 4OD1H 4G43B 1GAFH 2YD3A 1EEZA 1IAKA 5K33A 1EUTA 1Y6NR 3KDMA 3AB0C 3U46A 3MYZA 4X0KB 4CW1B 1GVIA 1H5BB 3IFNH 3T4YB 5DK2A 4UNVA 5I1JH 1B6UA 4GMSH 1HINH 3C5SB 3SDAC 1MI5B 1QR1A 1QEWB 2X89D 2V5SA 4QEGA 1U3JA 4GXUM 4MJ5B 3GKWH 1TMCB 3IDNA 5EUKB 3CSYA 3DX7B 1B3JA 1KCUH 3B9KB 4K9EC 4OKDA 4AL8L 4UOJA 3HUJF 1IJ9A 4HIEA 4U3XA 1WK0A 2VC2H 1ZXQA 4OFKA 1OTUC 3GKZA 5BZDB 3QDGB 4MCZB 2X4NA 4OCMC 1T03L 5TDOB 3W5NA 5C8JA 3ULVF 1XR8B 4KVNL 2BY2A 2XNAB 3ESVF 5LKNA 1EK3A 2VITB 1NUDA 3O81A 3UJTL 1HIML 4Y19A 5GS3A 5A2LH 3BP7A 4D0BB 3A0OA 4UUJB 1J0KA 2BSTB 3G5XA 5F21B 2R2CA 2OJEB 2ZG2A 3QQ3A 3O45A 1TPXB 4NGHL 4NJ9H 3SDCD 1F4AA 3P11L 5F9WC 2UZIL 5C08E 3GSUB 1QYGL 4S1RH 1N7ML 2WIIA 3HE7D 5BVJB 2OTPA 4XAWL 3TT3L 2R15A 1NJ9B 2HN7B 5HSFA 2BHUA 3P3YA 3EFFA 3I6GA 1FNLA 1IBGL 1ZTXL 2BY0A 3MACH 3ULUD 3MA7B 4WWKB 1TZIB 1DEDA 3KLHD 1MFBL 2CR3A 4M9PA 2NX5E 1XEDA 3WS3B 1G9NL 3FL7A 3V4VL 2VYRE 3HZYB 2FATH 4JRYE 3TO4B 3NFSH 1DLFH 3D48R 3QUXD 5F1SA 1S9YA 1HXMA 4H0HB 4QRUB 5F9JA 2HKFH 4ONGL 1CGWA 1RIUH 1U2HA 2K1MA 4GAYA 1BQLL 4U1IB 1M71B 4U05A 1JF6A 4H26B 4KZDH 2GK0A 3CH1B 2V7NB 1K3IA 4KK5C 3UMTA 3KXFD 3GSRA 2DQCH 4LNVA 3A67H 1QFHA 3MLRH 4WO4C 1DQDH 1NPUA 1I3RA 1CGYA 5EH1A 1P4IH 2A38A 1CZ8L 3Q6FA 4DKEH 3LEYH 4LNRB 2NY7H 4K7FA 3KYOA 1YEEL 3HB3C 4TVPL 3MLSL 3REWA 2P7TA 1QFWH 3KJ4C 1KJ3L 5GRVL 4DGIH 1B0GB 3SDDC 5IWLC 5D7SL 4HIHA 1I75A 3VDCA 5LAXA 4TSAL 4WNQB 3GMRB 3STLB 1C1EL 1S7WA 5D2LA 5BVPH 3L3KB 5FK9B 2E27H 4KJYB 3L7EA 3B5TA 5ADPL 1HHIA 4Y4KB 3TJHC 5M7QA 3TIEB 2HA1A 3TBYB 4ENED 2R4RH 4EN3B 2FJGB 3KLAA 1RURH 5D7IF 3GMMA 1N0XH 1HHGA 3FHQA 4I5BA 3N85L 1ZGLP 4NNYB 3QUZB 1A9BA 3FO1A 3V5DA 3D87B 4KDTA 1L9NA 1QO3A 4BZ1H 4P2RA 2YXMA 1OLLA 2GAZB 5F1NA 4PP2A 3AMKA 4Y4FC 3C60C 5DJDB 5IG7B 4GKZA 4LRIC 4GRWB 3P9LB 3WJLA 1RY7B 1QHPA 3IETA 5SWZD 3TZVC 2WUBL 1QBLH 3CD4A 4BKLB 2NW2A 1IZJA 2FIRT 3JBG7 1MY5A 4OGYH 1TJGL 1A4KA 4OIIH 2VXUL 3UCRA 4Q9RL 3RUGE 3ZYJA 1PKOA 3RDTA 2QL1A 2VLRD 1YNTA 2HMIC 2YUXA 3MNZA 3WLWD 4F7MA 1OAXL 3QEGH 5JOEA 4CNIB 2A1WH 3BH8A 4JM2D 1JGEA 1CF8L 4LCWB 1FVEB 5DRZB 5IHBA 4N8CH 3RIAF 3EYFB 4QWWC 2GUOB 4H1LG 1K2DA 2W0KA 4H20L 3ILQD 1UJ3C 1XAUA 1XGRB 1G0YR 4LIQH 3R06B 3HMXH 1JUFB 4R26H 1XCTA 3GNMH 4NOBA 5GSVA 1SJVA 5CILL 4L8DB 1JF5A 1KTLB 5IESH 3RVVD 3QXTA 5IMOB 2V9RA 4S1SH 4YHOL 3ULUE 5CD5C 3W0WB 3T0EA 1B90A 2BFVH 4M6OH 2JIXD 4HX1A 1U91A 2QQLL 2VAAA 2GJZB 4JFOA 1MJ8L 1RVFH 5L6YH 1GC1L 5GS2H 1R3IL 1D3CA 4WHYG 2NY4B 4OUOA 2G75A 1G7QA 1QFPA 4O2FA 1YJDH 5BCAA 3LS5L 2FB4H 2DYPA 3D2UD 2AJSH 3KXFE 3SDXB 2VZTA 4PRHB 5DHXB 3OKEB 1MIEL 1FNHA 1W72L 2F58H 1OT2A 5I1EH 4FTVD 1JPST 5MHSD 1E6OH 4ZQKB 3TBSA 2E7LC 5E8PA 1Z6JT 1KELH 4MXVF 3KNBB 5DUPH 4AENA 2H3NA 3IU3B 4HLZG 2P46B 4HS6A 4HUUB 3TYGL 1FFOA 4FA8A 3QFDA 2VDPH 3S34H 5J6GA 5J89A 3LPGA 4MD4B 4N0UE 5DRXA 5JHDA 1R24A 2BOBB 3IVKA 4FXKA 4XX1G 4EI5C 2DJSA 1XGTB 2E3VA 1KC5H 4NQCA 3VRIA 3L9RB 3PIQA 5EIQA 1T3FB 1UQSB 3I50H 4UIKL 4XVSH 3ROLA 3S5LG 4LASH 5CBEA 4OQ1A 5HYEA 5C07A 3MUY1 2X1WL 1CLCA 4Z8FH 3HS0B 2NY3D 4Y2DA 1NAMA 2J8HA 4OFVA 4HXAH 1U8QA 5A2JH 3CFEA 1IAOB 3RTQC 4M7JH 1HQ4A 5J13C 1E0OB 3U0PB 5IJKC 3MRNB 4HK3J 3U6RB 4JO4H 3VXRB 1MCNA 4N5UA 3PV6B 3AAZB 2DQJH 4XMLH 4W4OC 5D1XC 4S0TD 3EO1B 1TCRA 3TIDB 3L3JB 5C0FA 1LE9B 2FECL 3C8KA 2FD6L 1KB9K 5JW5A 3OKLB 3SY0B 5J12C 5SWSD 2ADFL 5DJ0B 4G8FA 3VCLA 5I1HL 1DEEA 5D7LD 5FM8A 4JZJB 1OP5K 4MGXA 4G8GB 4XHQA 3GB7A 1XGPB 1O0VA 1SM3H 3MJ9L 3PNWA 5E2VL 4WHCA 4NQXB 4MA7H 1EGJL 2WBJD 4YR6A 3QEQB 4QXTA 3RVWC 2I9TB 3DTXB 4JVUA 1I9EA 3G5ZB 5IVZB 5C0NC 5GZOD 2VLRE 3FCTA 1VFAA 4WI4A 3OF6D 1EXUA 1NCUA 4LCYA 4XNUH 5DJ6B 1IKFL 3BAEL 1DVFD 4L3EA 2EICA 5HYJD 1AHWA 5CHNB 2YRLA 3INUH 3ZE1F 3DVGB 4TQEL 5DZLA 2R4SL 2OYPA 2VZUA 4NJ9L 3HE6D 2G9HB 2OP4L 1ITBB 4PJFF 4U1NB 2AV1A 3SN6N 4S1RL 4HLZH 5IVNA 3L3IB 1IQWH 1FC2D 1HQRA 3R1GH 4NM8L 3QHFH 4M9OA 4Z7OE 3QISA 1CT8A 1XIWD 1I1YB 4EXPX 2BVPA 5FOBB 3VXTA 2Y23A 4R2GC 3RWHB 1E27A 4QKXB 4BQCA 3AVEA 3G5YA 2FZ3B 4D9QE 3O9WB 2YBRA 1NGWB 3F12B 4JQVC 3MGAA 2R2BB 5IF0B 3VXOA 4KY1H 4LLMA 5IM7A 4NWUL 3RL2B 3HI1A 4HGWA 3DIFA 3NFSL 4U7SA 1QHOA 4NC1C 4CVZA 3D18A 3EOYG 4M7LT 4F58H 5IFAL 1H0DA 1SYSA 1YEKL 3AREC 3HLAA 3P40A 4H25B 3U2SB 4WEMB 3ZYIA 2VE6A 5HI3D 1NDGA 1BJ1H 2YXFA 3NFPB 3PGFL 4HK0B 3CXHK 4ZTPL 5AYUH 5H2BA 4NQEB 3LKOA 1NDMB 3BH9A 3OJMB 4JG0L 4DVRL 1NKRA 3VE0A 2AQ1A 4L4TA 4CJ1A 4FTVE 5MHSE 5FF6B 3QG6A 5ILTL 3FMGH 1EMTL 4HF5L 1BD2A 1IAIH 4YC2C 5BW7C 1KJVB 5EBLA 1T5XB 2R0KH 5ETUA 3GJEA 4LPXA 2NY7L 4YX2L 3VXSA 1AKJA 4ZS6D 1RU9H 1R0AH 1KBGL 2F53A 3Q1SH 4R4NC 2BOCA 3LD8C 3LQAH 5DVMA 5HI4D 5FFLA 1YYLL 3B8SA 5C71A 1NFDE 4O9HL 2FGZA 4HS3B 2NY0B 4Q0XL 2B5IB 1VFBB 4NP4L 1MCQA 4WW1A 1UG9A 1DE4B 5IBTH 5I17B 2E27L 1QFOA 1KJ2A 1F4YL 1CGTA 4GG6F 3A6OA 5IB5B 3LH2L 1DBJH 4NKOB 4JY5L 4P9HC 4U6TA 2VMFA 1EHXA 5DJCB 1Z5LA 5E5MA 4MQTB 5J57B 4OCSH 4ONFL 4GT7A 4L8CA 4NCC1 2HT2C 2A0LD 1A6AA 3P9WB 3VFNB 4D8PA 3QO1A 4Q9BA 5MENA 2DQIH 4LLDA 5EU7E 5T1KB 1NEZA 3MO1B 2Q76B 3S4SA 5F7HA 2XY2A 5D7JA 1II4E 2K9UA 1MCSA 5E0QA 4JJ5B 4Y8AA 5EUOA 1JN6B 3HZKA 5SWSE 3QJFB 3QIBA 5LCVH 1WTLA 2YC1A 5D7LE 1J12A 2VL5B 5BZWB 1QLFB 1I3UA 3QEUA 3ULUL 4QHKI 4N8VG 3WFCH 4B0MM 1T0NA 1ZANH 2YPLA 1NGXB 3CFKA 4OLYH 2KZWA 2EIZB 1R5VB 2O5YH 4HC1A 4F7TA 5BOPA 4K7PY 1I1AA 3O6KH 5F9AC 3OKMA 5TDPB 3A6CL 1RZIA 4X6DB 1ZLUK 5IJVA 1HH9B 4MJ2A 4QXWA 4KGLA 3S88L 1U8KA 1RJYB 2QKIA 3NZ8A 3BKML 4UAOC 2NXYB 3S9DB 1JFQL 5FYLD 1YMMD 4MD5B 2AK4A 4KJWC 1MLBB 3D6GA 4MCYA 3SCMD 3MUJA 3JWDC 2WQRA 5LGHL 2FCBA 3BPOB 3ARBA 3QWRD 5CSBA 1P7QA 3OKNB 3TYFB 3RU8H 1BF8A 4GW1B 5DO2D 1CE1L 3G5VB 4CADA 1U8NB 4K8RC 1RK1B 2GQHA 2VLJA 5IB1B 3DVIA 4PJ7A 1I3GH 5DMGC 5IKCA 2QQNH 3MV7A 1FV1A 3GHEH 3QZWA 1LNUB 1UYWL 3JVGA 4FFYH 3HAEH 3OJDB 4BH7A 1FZMB 4HMDA 4Q2ZB 5EBGA 2P4AB 4RGND 1WEJH 1Z2KA 1GPOL 2R9HC 1JNHB 3BIKA 4O2EA 4B50A 4GMTL 4LHJB 1KB5L 1P84K 1VDGA 3VRJB 4C54A 2IFFL 2BY3A 4Z7NF 1A4JB 2MHAB 3CVIH 3AU1A 5F7DB 5T33H 4ZSOB 4I3RH 1TTFA 2D9QB 5IMLA 5DUPL 1TCMA 5E2JA 1UWEH 2HJLB 4U1MB 5I8EB 3UZQA 2I07B 3ARGC 3WEXA 1CICC 5ID0B 1NLDH 1YUHA 2QSTA 4EEEA 4ZD3H 1BWMA 3QFJE 4WDIB 4PJ9B 4QXUL 1NBZB 3UBXI 1MCPL 4UU9B 1PG7H 4PJDE 4G6ML 2D4DA 4UOW1 1DQLH 1UZ8A 5DJXA 4QT5B 2DQDH 2FLBT 3MGOB 5CLWA 3ZZ1A 5HHMB 2BNRB 5LBSH 3MREB 1I1CA 3QCVH 1CFSB 1NCWL 1MAJA 4JGUA 2XTJC 4JY6B 1UWXK 4HH8A 1ES0B 3KPMB 5EFIA 1J1XL 1I9JL 4XVJH 2XXCB 3GBNH 5ELIA 1AR1D 5CSZA 3Q6GH 4PJ5D 2DI7A 32C2A 4HUNB 4U1GC 1EJ6A 4K23H 3UTTD 2GW5A 4LSUL 4B41A 1FRGH 5B38G 4AIXA 3P4OA 1A14H 5FYJU 5L9DL 3MJGX 2ZJSL 2H6PA 3I84A 4YBQC 5FIEA 4V1DD 2ARWA 4BYHA 3G04B 4WI9A 4XBGB 4OZHA 2HFEA 3BYTA 2VISA 3VXMB 3EW3B 3SGDI 5BO1H 4FQ2L 4N1CA 4KDTC 3OHXA 1TITA 1MI5D 4UBDC 2AW2A 3T1FA 1P53A 2F19H 2EEDA 3WUWB 3MLVL 5JR1H 2R56L 4HJ0D 1ZLVH 2HJKA 2Q7YA 2XWBA 5AD0B 3GFUA 3INUL 3RJDA 4TUKL 4RGOH 5EU4A 5IVOA 3RGVA 3IGAB 1CFNB 1MPAH 2F54B 2P48B 2VZ3A 4QHNB 4FXGA 5A40E 3OMZA 3QWOA 2MKLC 3MLYL 5FYLE 3BN9C 4EOWH 1ZE3C 3QDGD 5DFTA 3FB6A 2APBA 3BKJL 3KPOA 1BZ7B 1ZVSB 4Y5VC 2B0SL 3VWJD 1ZLSL 3MJ7B 3B2VL 1IM9D 1CDUA 3REVB 1OAQH 4X98A 3X3FL 2LV4A 5CFHA 4DN3L 2EEAA 1VB9A 4LU5L 1GYAA 1YEFH 1U95B 2N56A 1YQVH 1KACB 1N0LA 1H3XA 4WEBL 1RAMA 4P23B 4EUPG 4JRXD 4BZ2H 2AV7B 2GIYA 2A74B 4JFED 4F3FB 4ZFZB 5J6HB 1VEMA 5TQ2H 3SO5A 2YA1A 1V05A 4RGNE 3QUYD 2DM4A 2BK8A 1ZVHA 4XB7A 2O61A 4F2MB 1X7QB 3GHBL 1PSKH 3MV9D 1E4KC 3CFBA 1PY4A 4CVXB 1MUJA 5E2UL 3TNNA 5C0BE 1A7PH 1J0IA 1JNLL 1IAIL 1JTTA 5IV2B 4LSPH 5HBBA 4O4YH 2YPVH 1XF1A 4JPVH 3AB0B 4UIMA 2R0KL 4EQ2A 12E8H 1FG9C 3TO4D 4Z78B 2YA2A 2PXYC 1BHGA 5DQJA 1RU9L 5GGUA 5D9SB 5T5FH 2V2XA 1QSEE 3SDAB 5JHLH 3BHBA 1XR9B 1U58A 1S7RB 3GUTA 1Q9LA 3QWQB 1IGIL 1S3KH 1GZPB 4J12A 5EPMA 4JFZL 3FO0H 4ZTOH 4LP4A 4RAHA 1XCQA 4ZOAA 5HGHA 43CAB 5HPOA 1MFCH 2Q8AL 1JV5A 4W6YB 2XN9E 2XV6B 3AFLA 3ALXA 3LOWA 4L5FL 3V0WH 4PPTA 1NCDL 5ISZA 2ZOLB 5ABDE 3LN4B 2W65B 4JLRA 1YNKH 2Z92B 3IYLW 3FQRA 4Z7WA 3DSNA 2WMPA 3EGSB 3N1GC 2X1XR 3DROA 5DVOA 5MEPB 4PJ5E 3ZSSA 4O00A 4P46B 1RUQH 1HKLL 1KLUA 3KHQA 1WFOA 3UTTE 3GK8H 2FWOB 2LU7A 3RX7A 1FNGA 4Z76A 2H26A 3MCLL 4PGBA 4YHPB 3RPKA 4KKAD 1I8MA 1YQ2A 4V1DE 1FPTH 1ZA6B 1BPVA 3RWEA 4Y4KD 3V8CA 3WFCL 3WIFB 2ZNXA 5F9WB 1KXVC 1ADQA 1A7NL 4G3YH 4XPGH 3EYQC 2IMMA 3QG7H 5I9QC 1MI5E 3CFCL 5DEZA 4JANB 3DGCR 4HXBH 4OCXL 5KSBF 4NQTA 5CWSB 3QUZD 1DSFL 1C7SA 3LQZB 1XMWA 3V52H 4DZ8B 3K7UA 1HI6B 1RIVH 4UDTB 3T0DA 3DO7B 3ZKND 2VLMD 4JHWL 3QDGE 2EYTB 4XMKL 4F7EB 4EZMA 3KVQA 3IFLL 4N0YL 5E08L 2AS5M 4OI7A 1IL1B 1HK6A 1AHWC 1RULH 1CWVA 1G7MA 3HC4L 3WJJA 4NKIH 1U8MB 3HNSH 1E28A 3RU8L 4NCDA 1A7RL 4U6YA 2ICWA 4MQXC 3ZDXE 3JXAA 4XNYH 5K9OB 4MD0B 4NO3B 1H3VA 4ODVL 3R0NA 4WO4B 3C5ZC 5T1MB 1JK8B 1OGTB 4Z7UF 3EYUL 4R4FL 4XCFH 4LCWD 5SX4I 3FT3B 4F7CB 2GFBA 1VGKA 1ZA3B 3WD5H 4IS6A 3QNZB 2E6PA 1UM6H 3VI4E 3ECBB 3MOAH 3G9VA 3MRKB 4XP5H 5C0EA 1FL6B 2Y5EA 3KJ4B 4I0PC 1OY3B 2H9GA 2R8SH 1S7QB 4F15C 5IFHL 1BQSA 2Q7NA 2H32H 2QHRL 2ZCHL 5TE7H 2GSIA 4OLWL 2CIIA 3GO1H 5FXCH 2UVEA 4I9WD 3W0WD 1AQDA 3DBXA 3V95A 1UKTA 1SJHB 2NTFB 4H1LA 4JO3H 1JP5A 4HV8A 5I1GH 5EZLA 1EH9A 5D6DA 4URTB 1RZKC 1JYNA 2OMNA 3ARTA 3DSFL 4JDZA 3P4NA 2IH3B 2NY4D 2PCPA 3O2DH 1NBQA 4LEXL 2Z93B 4QRPD 4JY4B 4U6HA 3MFGB 1IC7H 3VJ6B 5HHPA 2BSSA 2XZAH 4GAJL 3DX6A 4PRHD 1AI1L 4HAFA 3VXNA 4K07A 3EFDL 4R7NB 4AEEA 5C0DB 4RAUA 1ORQA 5FKAB 4ISVA 4Y4FB 3C60B 2D0GA 3MRBB 4LARL 3GMNA 3X3GL 3RHWF 4M6NL 5C70A 4PLKD 5A16B 4AEIL 4XC1H 3U4EA 4RFNC 3L7FA 4MQ7A 3VFVA 2IQAB 1Q9OA 1LDSA 2GYSA 3MQIA 3N1FC 5FYLL 3HA0A 5C09B 2D7NA 5E56A 4F8QA 3JV4B 3P0VL 4Q6YA 3SKJL 2DDQL 2GITB 5LGJB 3AY4C 3IRZA 3ABZA 2X7LB 4Z0XB 5DHVA 4PGCA 5DRNB 2ZCKL 1T1XA 1A6PA 1JGVL 1SJEA 1L4IA 4KK8C 5HGAB 1H15A 1UJ3B 1MJUH 2HT3D 1JPGA 5L7XH 3HMWL 4KJQD 3JWOL 2AXGA 5FGRA 1B88A 1VACA 1OQXA 2B1AL 1KG0A 4TPRL 4IDJL 4WENB 5JPMB 1NMCB 3O2VH 1ZT4A 2R69H 5HDBE 4YHML 1HH6A 5EU3A 5CJXA 1RFDH 1A22B 2X10A 5DD0H 4U2ZA 5LG1A 2ICEA 1S9WB 2APVA 5K9KA 4M1GH 5JOFB 1X5KA 4OZFB 3QUMB 2Z31A 4AEHH 1RUMH 3C87A 4GRWE 5HPMB 2VLME 5T1DL 4JKLA 2X4SA 4P5MB 1RZJH 4G7VH 3FO9B 4RWYH 1CD8A 4ODWA 4NT6B 2VDKH 5DGRA 2AVGA 3IS1X 1WWBX 1K4CA 2AP2A 3WN5A 1FNFA 5J06A 1P1ZB 2ZZUT 5DRWA 3VGHA 4DGYL 3NCYP 4ORGA 4JFFA 5IVXB 5FDWA 3U0TB 2NR6D 4DW2L 2DM7A 4JDVB 1MJ7H 4LPTA 3KPNB 1JBJA 4MDIA 4LCWE 1BQHG 5DLMH 2DMBA 2AJ3A 4C83B 3MRIB 3OXSB 4IRZL 2OJZH 1PLGL 1RUPH 1OSPH 2F74A 1VCAA 4IOIA 1WISA 5D1ZC 3ALWA 2WV3A 4JKWA 4Y5YC 3CVHB 2DIJA 4YGVB 3LS4H 4EI5B 3NABL 3NA9L 2CGRH 3MRGA 4M8VA 1FL3B 1PYWB 4DWHA 4OBSA 2NXZC 2F5BH 4I9WE 3W0WE 5E6IA 3OXRA 3JZ7A 3P4LA 1GGTA 2ARJB 3RWFB 1T83A 1CK0L 3O9WD 3D39A 3SQBA 3GI9H 3LEXB 2F15A 4JPVL 4X6BB 3RWDA 1AD9B 4OCRH 5JNYA 2XFXA 1FFNB 4OCWL 3C6LA 2Z91A 4G6FB 5FA3B 1J5OL 4FMFA 1FVCA 4WCYL 1K5NB 3RTQB 3FTGA 3MBEC 5J13B 4N0FA 1UB5A 2BDNH 4NNPL 3MV8A 2AGJH 3DVNB 2CMRH 4G80B 5D1XB 3ILPB 4X6EA 3RAJH 4NQED 2ZOKA 3SDXE 4JG1L 1HHJA 4PRHE 2GI7A 2EYSB 5C9JA 5J12B 4YAQA 4DTGL 4P5TA 3STBA 1ITCA 1HHKA 3L3DA 1PX3A 3V0WL 3GMLA 5I1KL 3QQNA 3W39A 1YNKL 3GJFH 4KXZH 2WWMC 1GIGH 3L5JA 4FABL 5A3ID 3P9MA 4PLJD 1X4YA 1WIOA 4H0GA 4O02L 3TA3A 3GSOB 4UT9L 2C5DC 4ODXB 5I18H 4F9PA 4NQUA 1PZ5A 4R4BB 3QI9A 1VKXA 2NY0D 2VN7A 4ZAKA 43C9A 4RMVA 2WZPD 5J56B 1IGYB 4JDTL 4OKVA 1OARH 5GIRB 4XAKD 3NTCL 3RPIA 1OPGL 3QEHB 4JFHD 3O6FD 1RI8A 2IALA 3ARDA 4PV9A 5BXFA 1KCLA 2VLLA 5E9DB 4LVOC 3ARVA 2EXYD 1T66D 2RB8A 1CGSL 1X4ZA 5F9OL 3UTQB 2ZUYA 1B9ZA 2CIKB 3CDGA 3O3AA 1KCKA 2XKUA 4G42A 2JELL 4LKCA 3VXRE 5F8QC 2O5ZL 4OLZL 4IJ3C 2DQFA 3T8XA 1N5YL 2DYPD 2BVYA 4MNHA 3KPPB 4R2GB 2VDNH 1OP9A 1BQUA 4MJ4A 2ADGB 2Y36H 1AO7B 1BBJA 4WU5A 5GS1A 5E24E 4QHUA 2EH8H 3J8F7 4R8WL 4OM0H 4JFXB 4TULL 1RUAL 5HVHC 2HT4D 1DL7H 3KPTA 2ZCLL 3S3JA 1QBML 2AJYH 2E9JA 4Y4HB 3F6LA 4G8GE 4PGJA 5I16A 3X14B 3LMJL 3AREB 2DQTL 5GGVL 2DQUH 4D0CA 3QEQE 3HNSL 1WITA 1MREH 3L1OL 3V0AC 4XNXH 3P4MA 5TQ0L 4NQCD 1F3DH 3M8OH 2JJSA 1TZHB 5EU6A 3CSGA 4PJHF 5FYKD 1W0VB 4N8VA 1KN2L 3WL9B 3FONB 4WJ5A 5GJTH 1LE5A 4YC2B 4Z7VA 3T77A 5DZOA 1T5WA 2NXYD 5E8NB 3HR5A 4Y1AA 3WD5L 1DQQA 4P0DA 5FGBA 2E7HA 3KYNA 4NIKB 1RJZA 2AKRB 2XKNB 1YEGH 2YRZA 1KXQE 3LD8B 5GISL 1T1WA 2R8SL 1JYXA 2RFXA 2YA0A 5TE7L 2J8UA 5HDQH 1G9MH 4M61B 4FQJL 3T3PE 3GO1L 2J6EH 4XPAH 5BV7H 2FIKB 2ADJA 2QV2A 3UTPD 1JJUA 3F65A 1YEDA 3F7PC 3C6SA 3V6BR 4D2NA 4GG8A 4QTHA 1CFVL 4AH2B 3U4BH 5A2IH 4UV7H 2BSED 5I1LA 2NY1C 4I18C 4N9GB 4PJAA 2NY2D 2W9EL 1U93A 5JIKA 2R0WL 4S10A 4X7SL 1LD9A 2QQQA 2D7TL 2R2EA 2NLJA 2KH2B 2QSCH 3IDIB 3CC5A 5GGQH 2VIRA 3U46B 3C08L 6CGTA 5HHQB 3BP5A 4NQEE 3BQUD 1V3LA 3UTZA 3DX9B 4NO0B 3NFNA 5DHYB 1IAMA 5FYJE 2ZPKL 4K3GA 1Q94B 1A64A 3TH4T 3K2UH 5H37H 4OZ4A 2MOVA 1WBZA 5I1CH 4P57A 1UEMA 4HKXA 5D1QA 1FCCA 1QPPA 4XC1L 2VQ1A 3EYSL 3B9DA 5ICXA 4J4PD 4PBXA 4O51A 3IDNB 4F8TA 1RK0B 4PJBF 3ZKXC 2R0LH 3GRWL 1CLZH 1NGQH 3KJ6H 5DMKB 1SYVA 3TVMD 5CCKL 4A6YH 2BY1A 1V7NL 5MP6H 1I8IA 4YDKH 1AGFA 5F3BA 2JCCF 3H9SA 4X4YB 3UZVB 5HHMD 2IQ9H 4RX4D 4UAOB 1Q72L 4JFHE 1PBYA 5KSVB 1HHHA 5I1AB 2HKHH 4U33A 3D0VA 2FJFB 3BPCA 4BSWB 5EWIH 4NCC2 4X99A 4D9LH 5BRZA 1MH5B 3PDDA 3PUCA 4BSVB 1E4XH 3O45B 3EIFA 3ELAT 4P4KC 4GXVL 3VFUA 3OBAA 4RISH 5DD0L 2OL3H 1JWSB 5IB2A 3BDXA 2VDOL 4GSDH 1NC2B 1BD2D 3VG0H 3ARZA 3GMQA 4HMEA 5LJYH 1RUML 3T09A 1LHZA 3E3QC 3I6GB 4U1LA 1K85A 5MERA 4MNQB 1C5BH 1R3KA 2PTVA 2EXWD 3VXMD 1ZWIB 3D85A 2DICA 4WFGD 5TDNA 1A0QL 3FB5B 4NNXA 4NYLB 1JNNH 1WWCA 4LOUC 1IT9H 2YUVA 3GZKA 3IDMA 1JWMB 3VXUA 3W82A 2X4TB 3BGMA 1A8JH 2VTFA 4AMKL 1U6AL 1YJDC 5F9JB 5FYKE 3HG1A 1O5DT 3I75A 3DV4B 4ZUWA 5C0CB 1REIA 1AGEA 2I25N 5DLML 3K4DA 3SGDH 3OSKA 3HFML 3SE3A 1K8IB 3PQYD 2OJZL 1NC4B 3ARGB 1CICB 1YPZF 3MJ6A 1WBXA 4YFLI 5FM5M 5HGBB 2CDGA 2ADIA 1IGTA 3P0YL 4ELMF 2YN3A 5BOZG 1ND0A 4WUKH 4XXCA 1UCBL 5MEND 2DTMH 3WIIL 2GJ6A 2R29H 3NIGE 4AZ8A 1NCNA 1CD9B 2GTWA 3UTPE 3KYOB 4XMPH 3SKNB 1KGCD 3GI9L 5B21A 1G1CA 3H9ZA 2BSRA 5BMFL 1G6RH 4JHAL 1M05B 1NANI 2XTJB 4X6FA 3T0AA 1GGUA 2OSLA 2EZ0C 3T2NL 1FLRL 4PY7B 4PJIB 2XACC 2YUWA 4Q6IC 1S7WB 4BFIB 4ZNEE 3V4UH 2ZKHH 2C7UA 1TVBB 2CMRL 4LGPB 4U7MA 5JW3L 4U1GB 5GRXG 1J0ZA 5D5MB 4HH9B 2V7HB 1AGCB 5SX5H 1J0YA 2DIAA 2KQNA 3E8UH 5E99H 5FA4B 2Q86B 3GM8A 1ZV5A 2ITCA 1W0WB 4PR5B 3KS0H 4HQQH 4EUPA 4WV1C 5TGBB 4YFEA 3AXLB 3KLAB 1A6WH 1KTKE 5TFSH 1JVKA 3NOIA 4ZSOE 3WE6B 3QJHB 3OX8B 4FZ8L 4LCCA 4I5BB 5CEYB 5CINL 3MNVA 1MCHA 3L3GA 1KYOK 4PRDB 2IANB 4KI5E 2CK2A 5FO8A 3CX5K 1SY6L 4P2RB 3SDAD 25C8L 1F45A 1MJJB 1KNOA 1KJMA 5KANI 4M62L 2JE8A 1B0RB 4HIIA 3QQ9C 3KHOA 1P4LA 2R0ZL 2EO9A 4O5LH 4Z95L 2Q6WA 1JYWA 2EYRB 1IC4H 3EDFA 4PRID 1UH2A 1OAUH 2NW2B 4BQ9A 3OG4B 5JLZB 2F9BT 3IFOB 1A4KB 5HHME 2BNRE 1YN7A 2WAHA 4AK1A 3CGTA 2OK0H 1OTUD 3S8WA 1QZ1A 4UTBL 1OF2A 3MNZB 4HWZA 4U1HB 1KEML 3W11C 3HUJB 4P3CH 4Y5VB 1FIEA 3VFMA 4OLVH 4TSBH 3C2AH 4JPWH 1ZSDA 4P46D 2XOTA 1T2JA 5DA0B 1UGNA 2JCCA 3WFEL 1JZ8A 1K2DB 4KPHH 1ODAA 1A3QA 1F02I 4D0DA 5DWUH 3WDIA 5E6ZA 4HUVA 4K94H 5IW6B 2FBJL 5CUSH 3GSXA 1XCTB 4P2OA 5GSVB 3DHJA 3BSZL 2CKNA 3LKNB 4OSUH 5DD3H 4S2SA 4PLNC 1B4RA 4L4VA 4U6XA 1TVDA 2DL2A 5HY9A 1A6ZA 3VXME 5E8EB 5DSCA 4WFGE 5DUBB 4DVBB 2HRPH 1YY8A 4X5XB 3M17A 5F71A 3RZCC 1QA9B 5LWYH 2IAMC 4WHTA 2YS4A 4W6WB 1R3HB 5SWQB 1QVOA 1QNZH 3L95B 4HBQA 1CD1B 5DC4B 5KN5B 4WGWB 1AXSA 2FDBP 5CEXA 4OAWB 3AM8A 1F6LL 3TBVA 5I2IA 2XQYK 2XA3A 4A2LA 3MX0A 4NN5C 4GBXA 4G7YL 3MRRB 3MRJB 4KUZL 2F54E 1QBAA 1GGBH 4LVNC 4P4RA 15C8L 2PXYB 4QCIA 1CDJA 3CU7A 4FOMA 4XRCA 5FYJL 4JZOA 4G8IB 5KJRL 1F42A 3SQOL 2AABH 5GGTH 3KWWA 4YHNB 2ED8A 5HDQL 4KK5D 4M7KL 3LRSA 1AGBB 4HUXB 4LSDA 3LQAC 3KPRB 4XPAL 1KEGH 4KU1A 3CDYA 4NWTL 1FFOB 3F58H 1MCRA 1T22B 3IJYB 1KGCE 2K3TA 1R24B 4M5ZL 1OP3K 2ICCA 3RY6A 1IM3A 4WUUA 2NNAA 4FP8H 2PYEA 4M5YH 4YNYB 4M43L 1A47A 3U7WL 4NRXA 1WFTA 2DLEA 9CGTA 5CIPB 5DR5H 1KULA 4ZUUB 4X7EC 5CBEB 5L2JA 3RA7L 4E5XB 4APQC 2PF6A 4PLOB 4XPHL 1T83C 1KCSH 5HYFA 3FN9A 2YMXH 1OTSC 2NMSA 3O8XC 4LSTH 2PNDA 4E0RB 3DV6A 4UINH 3RWCA 4XWGL 4MVBD 5HD8C 3QNYB 2HFFA 1OGAD 4MHHI 1BFVH 5EOQL 4LQFL 4XVTH 5GZND 4K3JH 1JHLH 2H1PL 4LGSB 1I9IH 1W72A 2V6HA 4NPYB 4ZFGL 4FQXC 4KTDH 1JHKL 3LKPB 3OAYK 5JW5B 1VESA 5I9QB 1KCRL 4XPTH 4P5TC 4KKNA 5JQ6L 1PW3A 1F58H 1WZKA 5D6CB 1UWGL 1EX0A 4L3CB 1XF4B 5KOVC 2C1PA 4YDKL 4H5SA 5EN2B 4KKBC 3PNWB 4MSWB 5D7IB 1WIPA 1E4WL 2IWGA 5HJ3A 5M94B 4PB9H 4IIQA 1GHFH 4FQ1H 1EERB 4NZTL 4Y4FD 1Q9WB 3CUPA 1FO0H 3FAWA 3WXVH 4R0LC 4F9PC 1K3ZA 1VFAB 1EXUB 1DR9A 4JREC 5FYKL 1MY7A 3FQWA 4TYUA 1AHWB 3FFDB 5ADOL 1JGDB 2FX7H 4Y16B 2AEQH 1EV2E 4EJ1C 4PV8A 3ARDC 3JTTB 2HMID 4KC3B 2A9NL 5FM4A 1E6JL 1AGDB 2NY6C 1BFOB 1HQRB 1U8JB 3GIVA 1CU4L 3C5ZB 5FUZH 3RVTC 4S1DD 5C08A 1L7TL 1NBYA 1S9VA 4LPWA 3BT2H 5CJ5A 2P24B 1CT8B 4QWWD 1G7IB 4KZEH 1C5BL 1QOKA 4HKJB 3OR6B 4YHZL 4I0PB 4LLAA 3KYKH 5K9JH 2B2XH 5EDXA 3QP3A 4MB4A 4F15B 1NMBL 4YO0A 3MJ9A 1D9KC 4LLMB 5IM7B 2NX5A 2FL5A 5KVFL 4LSVH 3HI1B 4HGWB 1YDPA 3BE1L 1FJ1A 1EGJA 4ODHL 3KPSB 1WGOA 1LEKA 3G6DH 3D18B 4UT7H 3TPUA 4CMHC 1RSFA 1L0YA 3H6JA 3HLAB 1WCQA 5B8CC 1MFEL 4PRPD 4QRQA 2GSGB 3ZTJH 3S3SA 2ERJC 1PVHA 2XA8H 2OZ4H 5TPWH 5C0GA 3BH9B 3PP3H 2NZ9C 3V5HA 4JAMB 3VE0B 4PJEF 1S5HA 1P6AB 1CE6A 4OGXH 3MLZH 1FDLH 3QG6B 2W1NA 5GRUL 1K4DB 4JFPA 3QA3A 4IM8A 2ATPA 1AFVH 3UAJC 5AAWA 1U8HA 3GJEB 4UT6H 2FJHB 5FGBC 5J3HC 1IQDA 1UXWA 1W8NA 1X5GA 1D6VH 1YMHB 2AJUL 2XZQL 5EZIL 5F7MC 2G2RA 1HSAB 1OAKH 3MBXH 3V9FA 1OAZL 4H88L 3RVXC 4X6DF 5DFVC 1BOYA 2DMCA 1XGYH 1A1NB 5ESVB 1I1FA 2EDNA 4TNVK 3PWLA 4RFNB 1WAAF 1BOGA 2FO4B 5DUML 4OV5B 4YXKL 1YC7A 4LGRB 4EI5D 2F5AH 4F57L 1VPOH 4JZNA 1BAFH 2Z0BA 1BQHA 3UYRL 3LCYA 3O6MH 1MAMH 2DKMA 3OTTA 1WT5A 1T7ZA 3BZFB 4X5WA 2AXFB 4YH6A 3O2WH 3MUGA 5C0JB 4RNRB 5KSAC 1PD6A 5LQBL 1CN4A 1W8OA 3PWUB 1T04B 5DD6B 4ALAL 3H7LA 4LLDB 3L3OA 2X89A 5CMAA 4BELD 4XGZA 2J88L 1N8ZB 4NHUA 1YEHL 5I71C 4FQLH 5HHVH 1CBVL 2XWTB 4OQTH 3PL6A 5D1XD 2YC1B 1T0NB 5J11C 4JM2F 3CSBA 3MGTB 1TXKA 3PHOB 4GAGL 2IH1B 4PUBL 5IQ7L 3DYMA 3KPLB 2CLRA 2G5RA 5EOTB 3IFPB 3EOBB 2E7BA 3RUGA 5F96L 1CS6A 4L8SC 5DC0A 5IJVB 1ZGLA 4X4ME 5AZEH 4TSBL 2YD8A 3RVWD 3QCUH 5C09E 2FNBA 2CKBB 2NY5L 5C0ND 2HG5A 1UXSA 4ZO6A 5B4MC 1YEJL 2IC2A 3VFTA 3SDCA 2AK4B 4Q58C 1QRND 4HCRH 1DUZB 1YN6A 4WFFD 3O4LB 1NLBL 1P7QB 4NQDB 3HE7A 4J3WA 4Z9KB 3T0BA 2APXA 1FGNL 5E9DD 4EBQL 3MRDA 3VW3L 5AG9A 5BS0B 3O3DB 2OQJA 3H9HB 3T0XA 5EG6C 5INCA 2YSSA 5D1ZB 1B6DA 4Y5YB 4LEOA 4DOHB 1DANT 1G7JA 2J6EA 3NCJL 4PJFB 5EO0B 4N0RA 5GGVY 1FORH 1M1SA 4IMKC 1J87A 4NKMB 2NXZB 2Z4QB 4R2GD 4LCIH 1AO7D 3U7YH 5EO1A 1JGUH 2XPGB 3K8MA 5IMMB 3QUXA 2ED9A 3RIAK 3NCYS 1WV7T 1UVQA 2OTWB 2AJXL 5ITFA 3BIKB 1CR9L 3BUTA 4Y4HD 2Y07H 2C1OA 1F6FB 1DN0B 3MBEB 3WXWH 4C4KO 5DJ2A 4K2UH 5C3LD 1MNUH 3ARED 1BIIB 1VGEL 5INDA 3KXFA 4YDJB 4BQ6A 4GRLC 3AU1B 4M1DH 1AQKH 1MHEB 1ONQB 3EAKA 4YBHA 4HEPG 4RQQA 4NBYB 3OKDB 5IVXE 1M7DA 5IOPB 3MLWH 1MLCB 1NL0L 4MA8H 4JFDB 1HYSC 5FO9A 4N0UA 1QRKA 2A6KB 2KPNA 1RJLB 4DCQA 3BKCL 4F9LA 3FQNB 4K9EL 3FOMB 4R4ND 5IBUB 1I85C 2AJZA 5JORB 1YNLH 2RGSA 4KHTL 3OB0H 3EYVB 3QULB 1EA9C 4CBPA 1F11B 4JPKH 3EDJA 4OJFH 2H2PC 2CLZA 4GO6B 3SJVD 1NGPH 4ELKB 1EZVY 2Z35A 4XI5C 1I4FA 2BVEA 1MCEA 2HP4A 2XQBH 3OV6A 2FSEA 1D5ZB 1KB5A 4HJJL 4LVOB 3U9UA 2Z31D 2BC4A 1WAAA 1LP9F 5JUEL 5IK3B 3HTLX 4GAFB 2K7QA 4HIJA 4HZLA 4GG6B 1RIHH 4LSRH 1JPSH 5CP3H 3DWTA 1RZGA 3HRZA 2HT2D 1U42A 3NIDF 4NQSB 2LAGB 3VXPB 1U8OB 4R3SB 3FQXB 4IJ3B 4P5KB 3DI2B 3WNNA 5EULV 3TJEH 2EDKA 5FHAL 3OAUH 1UM4L 4NO0D 5AUMA 2C9AA 3ULSA 5J1TC 2PTTA 5TE6H 2EKJA 1PJ9A 4RFEB 5SWZA 4RAVA 1NGYB 5HVHB 1Q0XL 5ICYA 4PJCF 2UV3A 1AJ7L 2H8PB 2GHWB 3MXWH 5E7FA 2Q7YB 2VLRA 3BO8B 2DD8H 3H0TB 2XIDA 1UCTA 4XCYB 2W92A 2BHZA 4HS8L 5KW9L 3QWOB 3VFPB 2D4FA 4KQ3L 4HWBH 2W59A 4LCUA 2ED7A 5I73C 2VN4A 5I30H 1P5VA 3RBSA 3DRQB 1RZ7L 1MWAH 4LBEB 4ZXBC 5ITBH 4M3KB 2OR9H 5E9DE 1MCOH 1LGVA 1SJXA 1KFAH 4KJWD 3PABB 1NUGA 3AS2A 3UEZA 1X5LA 5ESAB 1VENA 4HT1H 1JGLH 3B83A 1A2YB 1RZ8A 1DBKH 2XICA 5GRJH 3WIHH 1MFNA 4LAQH 1KTDB 3F7YB 2QHLA 3B5GA 4OLXH 4K8RD 3P77A 1FAIL 1AO7E 5F8RC 1H3WM 1MQKH 1F6AA 3Q3GB 4HG4J 5FCUH 5DMGD 5E8DH 3I9GH 2AEPL 2NY1B 4I18B 4NC1E 1SMAA 5FKPB 2A6DA 3SOBH 2DN7A 4MNQD 3IKCA 4M1CC 4QXGL 3D2UA 1OM3H 1NAKH 2O26U 3AM8C 4UILL 5L88H 2COQA 5T3ZD 1L6ZA 4FFZH 4RCAA 1E4JA 2R9HD 3VMNA 4FTVA 2WP3O 4KK6C 1KENH 5IR1B 4JN1H 5D96C 3O3EB 3U7AA 4BH8A 4IHOA 1D6VL 3BPLC 2WUCL 5CJBA 4P48A 5JIHA 5HI5C 4L1DA 4JM4L 2V2XB 1MHCA 3WHE1 5C0CD 4C56B 2BVUA 4LLVA 1DZBA 2FHFA 3IDJA 2L7JA 3TH3T 2VLKB 3ARGD 1NFDA 1CICD 3O4OC 4K3EL 5IB3A 2ATKA 3ZKXB 1J1OH 1JV5B 4YWGH 3DVFA 1EAPB 4C4KT 1T0MB 3DI3B 5EORH 4UDUB 3RY6C 3ZDZE 3O6LL 5GS0D 4ODUB 1DBBH 4LSQH 1R3JB 2IPUK 2APTA 1XGUB 3ARPA 4MA3A 3RIFF 4ZPVB 3PP4H 5D72H 5IIEA 3G6AB 5DK0B 4NHCH 1JF1A 1HILA 2BMKA 3EHBC 1QFWI 1U3HC 1FNGB 3QUKA 5ANMB 4HDIB 4PGBB 3KGRA 5EA0L 1HSBA 2V17H 4YXHH 4X8XA 1I8MB 5SWSA 2BRRH 4HKZB 4P4KB 3IDGA 5D7LA 3I6LD 4MWFA 4XP6H 1M6OB 4I3SL 1IGFH 1MQ8A 1NANH 3UTSB 1FZKA 5JPNB 4Y1AD 1ETZB 2WBJA 1WZ1H 4JPIA 3DX8A 4PJ8C 4N5EC 1M4KA 5HYQB 5EB9A 2CPCA 4FNLL 3QUML 2JJVA 4G6KH 1DVFA 4PRAB 4NUJA 1RV6X 1EFXB 1D6EA 2J1KA 3MRPA 1D5IL 1RZJC 1EBAA 3O11A 1MCLA 3HE6A 4MX7B 1VFOA 3LRGA 3G6JF 3OKYA 2A77H 3D69A 2Y6SC 4G8EB 2X4RA 5F1KC 3QXAA 2DIBA 2B1HL 5KAQG 4U6YB 3V5KB 1FSKC 4R97C 1A21A 3BN9D 4HEME 2DBLH 5E2TL 5IW3A 1KN4H 1DDHA 3ME0A 4JVWA 5EC1B 2ESVB 1L9MA 4NO5A 4G5ZH 4MLSA 1FORL 2G5BA 4Q74A 1F90H 2A73B 3I85A 4ZS7L 4G9DB 1DQJB 1CGUA 2GFBB 3QDMB 4U1SB 3UO1L 3NIFF 5I76A 4JFQB 3ULVD 1J05A 3NVQA 4JFYA 3S3PA 4P2QB 4NKDB 3L3HA 4R90H 1A6VH 4NRYB 1MRCL 2H9GB 1UB6B 4X7CC 5BQ7A 3BWAA 1DBAH 3BDYH 1ACYL 3ARQA 4MNQE 1MHPH 3MRQB 5D70L 4ZG1A 4Q6IB 1DUYA 3WFHB 3K1KC 3RI5F 2VXQH 5T3ZE 2J4WH 5EZOL 5E1HB 2CJUH 3CFJA 3VGBA 1VERA 2VDML 3OR7A 2Y06H 3ES6B 4MAYC 3VI3E 3WDJA 2JB6A 4X6CF 1FVDA 3ZKMD 3QH3B 1I7RB 4HPOL 4WV1B 2IGFH 5L8JB 2JKXA 2Q8BH 4MA8L 2FR4B 1QR4A 5C0CE 2J7LA 3WS6C 4YHIA 1ZHNA 4E9LA 4U6HB 2W9DL 5JA8B 2PXYD 1RMFH 3QFJA 4ERSL 1A1OA 4QRRB 3QIUC 2FYYA 3UJJL 4HMCA 4PJDA 4RAUB 2SEBB 3CFDB 3U36A 2V5YA 3P73A 3GMNB 1G7HA 1U92B 1D5XA 3VGGA 3UDWA 5AZ2H 3BISA 4AIOA 3KPRD 4LLYB 4I48A 3B9AA 2WP3T 4DUVA 4IMLA 1OTTC 3UXFA 2VO5A 4LVEA 3SKMA 4TUJB 1C5CL 4NUGH 2P5WB 1Q9OB 3F7RA 4GQPH 4D9RD 4Z7QE 3FT4B 2XTJE 3WLBB 1TLKA 4QRTB 5DI8A 3CDCA 4PJIE 2EDJA 4OZGA 5DQDL 3SPVA 3GEWB 3VDBA 5D5ME 2P5EB 1LK3L 1T1XB 3O3UN 1AP2B 1H15B 3OZ9L 3S7GA 3BPNC 3I6LE 4GKSB 5JDJA 1JPGB 1NH6A 4R96A 3SGKC 4PG2A 1I8KA 1T1YB 1WCBB 1VACB 1P7KB 1LWRA 2DLHA 3TO2A 4DQOH 5JMOC 5B3NA 4X8JB 3K2MC 4I4WB 4NDMA 1HH6B 4KTEL 2IANE 3QRGL 1S8D