5H2BA

Structure of a novel antibody g196
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
216
structure length
216
Chain Sequence
QVKLQESGAELVKPGASVKLSCKASGYTFTNYWMHWVKLRPGQGFEWIGEINPSNGGSNYNEKFKRKATLTVDKSSSTAYMQLSSLTSEDSAVFYCSIWDSYFDYWGQGTTLTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title G196 epitope tag system: a novel monoclonal antibody, G196, recognizes the small, soluble peptide DLVPR with high affinity.
pubmed doi rcsb
molecule tags Immune system
molecule keywords G196 antibody Heavy chain
total genus 39
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2016-10-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5h2bA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5h2bA02
2GIYA 1TJHH 4PJ7F 3JV4B 3BN9D 2VXQL 4OI8A 3SKOB 2HG5B 1EJ6A 2OSLA 5DJXA 4LSVL 1RZFH 3DGCR 3UAJC 1R5VB 3HPJB 4WJ5B 4HX1B 3GI9H 1B0GB 3M07A 4CJ1A 2X4UB 5E94A 4J3TA 5JO5A 4ZTPL 4JFPB 2J8OA 3IJYB 5C3TA 1KNOA 4BK4A 3VDAA 1U8LA 3DURA 3RWDB 3LKPA 3FT3B 2UVFA 3G6JF 4YDLC 4FXGA 5DJYB 3LS5H 3D39D 1RUAL 3FO9B 1SBSH 4HUXA 4RGNB 4XP5H 5D7LA 1RJLA 5I1AA 2E7MA 3SJVA 2M1KA 1J1OL 3D2UB 4WO4C 1DR9A 32C2A 1N5AB 3MRJA 5E8DH 4GLRI 3TIDB 5DRNB 4ZPVA 4MNHB 5EG6C 3H9SD 5B3JF 4PJFA 2HRPL 2I60H 4PJHE 4D9LL 2VXSL 3NTCL 1WQVT 1JF1A 4PJIA 4TVPH 4OLWL 4KC3B 3PXHA 1HILB 3DX8B 2X4RB 5I6XC 1CXKA 1I7UB 4Y16A 4M6AA 5F89B 2E6JA 5IFAL 4NQCB 4F7TB 1X5KA 2VUYA 1MREL 4R96B 4WW1A 3I75B 3DIFB 5E03A 2X9YA 25C8L 2DLFH 4U1GC 5T33H 1IL1A 3ET9F 4DJMA 2HMID 2Z92B 4OF0A 2AV1B 2VDPL 3SE9H 2AXGB 3QIUD 3F62A 2Q20A 5EIIB 3U6RB 1U92B 1FGNL 3MLVH 5MEPB 3C2AH 1MRDL 2GTZA 1WWCA 4X7CC 1HDMB 4OD1L 3FO1B 5INCA 2OMNA 5DC4B 1EEYB 1U8QA 1EBAA 1S7VB 2VR5A 3WNPA 3MRNA 1NGZB 2CKBB 2N7BA 4LSRL 3FZUC 4G7YL 1X7QB 2HT3C 1CZ8L 2X09A 4PV8B 5T1KA 2OZ4L 3ZTJH 1PGRB 1Q94A 1CDCA 5C86A 1FYTB 7CGTA 1KCKA 4Z0BH 5FIEA 4KUCF 2UYLB 2AK1H 5FGCB 1OF2B 1QP1A 1OARL 1I75A 3HI6H 1VACA 1RIVH 1J10A 3QI9C 1KUMA 2L7JA 3E8UL 4OCSL 4YIQA 3GSVA 3ZDXE 1U8NB 2R23A 4OF3A 4Z7VE 4L3AA 2XYCA 4M6MH 1A7PH 1CGVA 4LCWA 5IVZB 3SKMB 2L0DA 3CSYA 4R90H 2OQJA 3RVXD 4KDWA 1VADA 3MYJB 4NZUL 4S1RH 5DJCA 1KCRH 1KB9K 1DQDH 3F6IA 3SE8L 2GJ6D 2BY2A 2JB5L 2X1PA 3DI3B 2NY4D 3HE7D 1LEIB 2DBLH 2UY7A 5CINL 2AW2A 3C6SA 4OAWA 1S9WA 1YEHH 2H6PB 1MLBA 3GSUA 1QYGL 4LP5A 4R4FL 3T4YB 3RWIB 3JV5A 3V5KB 4MA3A 3QNXB 4HMEA 1KIUA 1RHHA 4Y4KA 5HYJA 4FOMA 4GRLA 5JPNA 4NQSA 3EOBA 1CG9B 5DGRA 2NCMA 5H8DA 3FQUA 4YHPA 1NFIB 5FK9A 5EZOL 4ZTOH 1M71A 3MV8D 4V2CB 3CFBA 3E3QC 4W6YB 1T6WA 2A9NL 5AWNH 3PWLB 3KAAA 1VGEH 3WIFA 3GSOB 4ENED 5IR1B 5DXWA 4HWBH 1UGNA 5GS2H 3MLSH 5IBLC 5C0RH 3HAEG 5A3IC 5IMOA 2EO1A 3PDOA 5FYJD 5GSVB 2GK0B 4TNVF 3ZKMD 3RWHA 4JO2L 2Z4QA 3QG6B 3QH3A 5J1AA 1J9CT 4DZ8B 4HT1L 2P5EB 3O6FC 3S36H 1MCCA 1OAYL 2YR3A 4HXAL 1J1XL 3U7YH 3T3PE 1AHWA 1B4JL 1FC2D 3BKCH 2F15A 4P5TB 3VG0H 2RQ8A 3CUPA 3CMGA 5D1QD 5EWIH 3VFPA 5AD0A 3EOBB 3G5XB 4RWHA 3MJ9H 2G60H 5C0IA 3HC4L 2X70B 3OX8A 1CIDA 2PW1B 4R26H 4GRWH 4JPIB 4F7CB 5AD0B 5IMMA 3FO0H 1AQDA 3LAFA 1LE9A 1JL8A 1CL7I 2BNQB 1BF2A 4FNLL 2NY0D 3ECBB 4FFVD 4K7PL 1P4IH 3BQUA 3P0YL 3BMVA 2YHGA 3SE4A 1G84A 1NCDL 4QRPB 1S5HB 1T22B 3O8XC 4EUPG 2KH2B 5KJRL 1ZXQA 4QTIH 5ABDE 1F4YL 3T0EA 2BVPB 1YNKH 4HKJA 2R0WH 5DF0A 3B3IB 1X4XA 5L2JA 2OQJB 4EUPB 4GSDH 1QBML 2GTWB 5D1XA 3LKOB 5E8EA 3DVGB 3GSVB 3MROB 5T3ZD 3DV4B 3KR3L 5C6TH 5CZXD 1FO0L 3MRCA 1CL7H 5JOPD 5E8OA 4L3CB 4AJ0A 4J8RA 2J88H 2VMFA 3GIVA 1A1MA 4WV1B 5F7UA 4BQBA 2IANE 3VH8G 5F3HA 4JPVH 1XIWC 1A14H 4OB5H 5CGMA 4H25A 1JIBA 5C0ND 1LK3H 2ARJA 5I73B 1JGUL 5GS1C 3VRJB 1CD1A 1EPFA 1ED3A 3WBDA 4OT1H 2PW2B 1K4DA 4XNMA 2H45A 1BOGB 5EC2B 5MEOA 4WTZG 1WITA 4Z5RA 4PJ9C 4NNXA 4YXKH 1BGXH 4O00A 1IAOB 3RHWF 4M7KL 4GG6E 3MLYH 1H3GA 1MFNA 2GK0A 1YNTA 1BVKB 4RA0C 1XMWA 5ESQA 3ZE0F 3U7AA 2UV3A 3LKNA 4FFWC 1ZLWH 3OXRB 4EVNA 5EBMA 1CGUA 2IAMB 3FRUA 1OF2A 3MV11 1ZLVK 3BISA 2FLRT 4HXAH 1EO7A 5GS0H 3QUZB 3VXUA 3SY0B 2NX5B 5IWLC 1ONQA 1CDYA 4YHPB 3BRFA 2Y1VA 1H8NA 4UTAL 3VI3E 4LPCA 3IJHA 3IF1A 3QEQA 3OKEB 1YEDA 1SYVA 1UXSA 4ONOA 2EIDA 3Q5OA 4P2RE 2CK2A 5DI8A 3MLZH 3R8BB 5IKCA 3NPZB 1U2HA 2OS7A 4HIIB 5EPMB 1HQ4B 2GT9B 2JJTC 1FNEA 2NPLX 3O6KL 5JDSA 1D5XA 3WNNA 1AGCB 4E41D 2UWEF 4QWWD 5JO5B 3S37H 1IM3A 4UV4H 1M6OB 4OUUA 2BVYA 2V2WB 1MF2L 4CW1A 3NH7H 3OKKB 5HGAB 2WIIA 5HD8C 2BRRH 2OL3L 4KQ3H 4HSQA 2VABA 3HG1E 5HPMB 4K9EH 4TYUA 5IB2A 1FZMB 2V7NA 3EW3B 1NAML 1BBDL 2XTJE 1GHFL 5IHUH 1OTUD 4ODSL 2IFFH 1GZQB 4LCYB 3CFDA 4ORZC 3P3YA 4MNHA 4NC2B 2X9XA 4QCIA 3GRWL 3NCBB 3HLAB 4MA7L 3SGEH 1NC4B 4Z8FH 3DHJA 4EKXA 3K46A 4F8QA 4XP1L 3V0AC 3P40A 4NWUL 2OJZH 1RJYA 3C60D 1UQSA 3ZT7A 3SPVA 1CXIA 5SWSD 1QSFD 2JJVA 3OAUH 1MCOH 1Q9OB 3T2NL 4PJGE 4BZ1H 5ALCL 1BAFH 3VFSB 1A7NH 3ARGD 2V5TA 1DVFC 4X8JB 3OGCB 5F7FA 3SO5A 3QFJA 3KPNB 5T1DL 1L0QA 1MFEL 4TQEH 2OSLB 2G9HB 4WFHD 4D8PA 1Q0YH 5L8LB 2NY4B 3VRLF 2AEPH 1PZUB 3ARSA 4P3CH 5D70H 5EUOF 1CDHA 5DMIH 4NJ9L 2PTTB 4AYFA 4S1SL 3QJHB 1WK0A 4PJHF 3RWJB 1HILA 1IKNA 2YPLD 4FXLA 4L3EE 4ZD3H 5T5FL 4LLUA 4QHMA 2JJUA 3LQAC 3H42H 2X1QA 1G7IA 1YEIL 3SEPA 1YEGH 1I85A 3HZMB 3UYOD 4S2SA 2B1AL 5DQDL 1LO2L 1LP9E 4RFOL 4ZPVB 3CFKB 5JORA 4G9FD 5I1EH 1CGWA 4L8DB 2BVOB 4QYOA 2YN3A 2AJYH 2GCYA 1X5HA 4I0PC 5FECB 2DKSA 1N4XH 4PYHA 5MHSD 4Z7NF 4ZAKB 1KF9B 4WHYG 5ANMB 4HBCL 4I13B 1TETH 4D3CH 5GJTL 3BEVB 5JA9A 3D18B 2VDRH 4MDJA 1FL6B 1I9RH 3QUYB 4B50A 3UC0L 3ARFD 3X3FL 3VFUA 1I3GL 5IEKB 2VXVH 3WFHA 4ALAL 2Q87A 3DARA 4U1LA 5C0AE 5BRZD 4YO0A 1I1RA 1FIEA 4XB7A 3EGSB 5C09D 3C6LB 4ETQB 4N0FB 5IB2B 5JXEA 1ETZA 4R8WH 2PR4H 3CXDL 5ETUB 2AQ2A 4HGMA 1IGMH 4OFYD 3RA7L 2IFFL 3L3OA 4I4WA 1NAKL 4FFYH 3UMTA 4M8QB 2NY0C 3IETA 4JKPH 4XCCL 1Q1JL 3HNSL 4PTTB 3VXSD 1E4XL 2VYRE 2QKIA 4QXWA 3CJJA 2BNUA 4MDJB 2YS4A 5E8DL 1KTRL 2O5XH 4KDVA 3LEVH 5FECA 3HI5L 3IRPX 5FOJA 2EO9A 4MDIA 1KELH 1CLOL 4M1DH 2QADB 4GW5B 1KEML 3FT2B 3NMEA 4IMLA 3AM8A 4XVTL 1H15B 5GGTA 3LSOB 2P49B 1ZEAH 3NCYS 1JE6A 2JELL 3RY6A 5DMJB 1PYWA 4Q74A 4PLKC 5D70L 3ZKSD 3DECA 4NQEA 4DKFH 4XP5L 3OQ3B 2VH5L 4Q9CA 4L9DA 1E28A 5D1ZC 5MENB 2VOTA 4KHTH 1XCQA 3OGOE 5SWZA 5FF6A 3HFMH 5EWIL 3MGTA 3AROA 2YUWA 1KULA 2FIKA 3LHPH 5CP7B 3LKRB 4NRXA 2NY7L 4U1SB 2WINB 3L7EA 2FZ3A 3D25B 4HCRH 5D7LD 4YFLI 4HDIA 4JKKA 3B2UD 3B8YA 3ARFC 2QR0B 4MJ6B 3UX9B 1I7RB 3QUMB 3OGCA 3SBWC 2DQDH 3Q1SL 4NC0B 4LHUD 4NZTL 4YHML 1LE5B 2X4TA 4EQ2A 3BPNB 3GSXB 3BPLB 4N0UB 3O2DH 5ALBL 1CXEA 1YY9D 4BELD 1F90H 3V4PH 1BQHG 2GYSA 3K8MA 5C0JA 5FUZL 3WUWB 3D69B 5B8CB 1S78C 1MY7A 5BJTB 1WFTA 5C9JB 3BVNA 3BH9A 1EHLH 4JFXB 4OLUH 1JK8A 2BZDA 5FO7A 3JV6B 3WJJC 4O4YL 3JWDH 1F2XK 3FQTA 4OCWL 5A3ID 2RAMA 1MJUH 1X5ZA 2FGWL 2O5YL 4N8VG 3U2SA 3JWDC 2B2XL 3MV7A 1T20B 5FXCH 4OIIH 2Y23A 3QHFL 4RSVA 3SBWA 43CAB 3B9VA 1U2CA 3UO1L 2XKUA 3O0RH 3Q0HA 5F88A 5C09A 4PG9A 2UZIH 4PRPE 3VFRA 3FO2A 2COQA 2Z91B 2DI7A 1BIIB 3RVUD 5EFIA 4LAQL 5GISL 4WFFD 4YNYB 3S8WA 4X98A 3ARFB 2WINA 2CIIB 5E5MA 4GBXA 4KDTA 2YPLA 3S97C 4XI5C 3ZDZF 4JHWL 1MCLA 1Y6KR 3SCMD 2C3WA 5TE4H 4JN1L 5DHVA 1WC7B 5D7IA 4K71B 1A3LL 4O2CA 2CUIA 3JZ7A 3H7LA 4R4BB 3NCFB 4YPJA 1VEPA 3M17B 1KYOK 4NJAH 5FYLE 3W0WB 1BQHB 5IOPA 1NPUA 1QBBA 1V3JA 1I8KA 1ODAA 1GZPB 2JJSC 5DRWB 1FZJA 1SEQH 3HE7B 5DYOB 4PJ5B 1UXSB 5BVJA 3MNVB 1YPZA 1FRGL 2CLVB 2ED7A 1MOEA 2EYTA 3MA9L 1V7ML 4KRMB 2M8XA 2WZPD 1DLFH 5KSUA 4ZO7A 5F9OL 4R4FH 4OV6F 4YHYB 2DOCA 1YC8A 4BKLA 3HFML 1E4XI 3V6OA 3SDAA 3J8F7 3QIWC 2BVQB 3SOBL 4EVNB 1MAML 4P4KC 1KCVL 4Q9BA 4PJFF 1OD7A 3UAJD 4JDZB 2IGFH 4KI5F 4OM1H 2HT3D 5DMGD 5GS3A 4NNPH 3ULVD 4OV5A 3KLDA 5HHOD 5E9DA 1BQLH 2SEBB 3O11B 3LN4A 4ZFZB 3QUKB 4NCC2 3WFZA 3FHAA 2YUXA 3STLB 2GFBB 1ADQL 2EECA 1ZGLB 5JA8B 2R2CA 4MJ2A 2CXKA 4HGWB 3LKQB 1BREA 4XNMB 2K3TA 4ELME 5CJBA 2EDHA 1F2QA 1ED3B 4L5FH 1FSKC 2QQLL 4NQSB 1LP9A 4PJFE 4UDTA 3OB0H 1K5NA 3L3JB 3SGDH 4G6ML 2AQ1A 5BJTA 4M8VA 1UZ8A 4NKIL 1ITCA 1KENL 1KJ2H 2DM4A 2KBGA 1WBXB 1OGAA 2H2SC 3O6LH 1A1MB 1NBYB 4QRQA 3GSNB 3QXWA 1DCLA 4JM2C 5E9DE 4LLVA 2N1KA 2DTMH 4Z7NE 1DE4B 2XWTB 4XBEH 3PWPE 2FX8H 4OKVA 1T1YB 5EZJA 5BV7B 1YN7A 1IEBA 1D6VH 2PKDA 2R1WB 4M6NH 2D3VA 4YDIL 1IQDA 1NUNB 4YEEA 1I9JL 2EZ0D 2EXWD 2JK5A 1GIGL 3KPRA 5I19L 1YMMD 1TVHA 3CDGA 3ARDA 3ZYOA 2QQNH 1OB1B 3QQ3A 2GQHA 1E28B 3PP4L 4UBDC 1ACYH 2CRZA 1ZT1B 3RTQC 4PYGA 4PJ9A 2DQTH 4UI2A 1WUNT 1CS6A 1BVZA 1IEAA 4DCQB 2AEPL 1LO3H 4I48A 2BERA 5I1DA 2YD4A 4HIXL 4WUUB 1IGIH 2BJML 3DXAE 3TBYA 4OF8A 3QQ4A 5D1ZA 4HAFA 1LWRA 3MGOB 4N5EC 2XNAA 2HFEB 1HI6B 1LQSR 1J1PL 4HFUL 2ZOKB 3Q3GB 2FHCA 4FFYL 1UCBL 5I74B 2QKIB 4GKZA 3L7FB 5T3XL 3QEHA 2VLJB 2V5MA 4KKLC 3E1F1 3QDAA 4QXTB 4X99A 4XT1C 4D9QE 2VKXA 3AAZA 4OZIB 4OB5L 4XCFH 1OGAD 3MGAA 4U6XB 1JYNA 1T5XA 4JO1L 3WFEL 1PKQA 1IAIL 3ARVA 4JRXD 1I8LA 1F6LL 5ICXB 1PX4A 3S35X 3AREC 5DJ6A 1OP5K 3MZTA 4GG8B 4Y5YA 2F54B 2ZUQB 4GS7B 3BP4B 1AI1H 3UJIH 25C8H 2PO6D 1FZOA 3AC0A 1UVQB 2NY1B 4W4NA 3I9GH 4F3FB 2AJSH 1D5ZB 3MRFB 5I8KH 1UXWA 1JWUB 4ZO6A 1A1NA 4XXDA 4M61A 4HG4K 1H0DB 5IIEB 3PGCA 5J9PA 5IMLB 2YMXH 4JPKL 1A6VL 1HQRA 1FO0A 4N0YL 3BJLA 5I30L 1N3NA 2HFFA 5ACZB 5MI0C 1RK1A 4MNQE 5EPMA 2BHYA 4UIMB 5KVDL 2FLBT 1NGYB 1FL5A 1A47A 3NAAH 2ZG1A 1MCHA 2XA3A 4MXQC 5F9WC 1R3LA 4WI2A 1CICB 1YEKH 1IGTA 1NMAL 4DK3A 5HYJE 3H9ZA 4R3SA 4B5EA 2D7NA 2XV6B 1M7XA 4LMQE 1K6QH 3NFPB 2OL3B 2ADGA 2HLAA 3QFDA 5LGHH 4TVSa 5EZIL 4FXKA 4HWUA 3DNKA 2HP4A 1L6XA 1MRCL 3FRUB 3K81A 4LLMA 2R8SL 3GB7B 1CE1L 4PJGF 1GGCL 4IJ3C 4P4RB 1QLRA 3WJLC 4D9RD 3VD3A 5IHZB 3PNWA 3LKSB 3S35H 1XR8B 5I9QC 3TT1H 4H0HB 3P73B 2BX5A 4E41A 3QCTH 1KTDB 3FQRA 1BD2E 1R3LB 1PLGL 1NMCC 1ERNA 2HJLA 3BW9A 4ZNEA 2R0KH 4DKEH 1ZLVH 3FN0H 5SWSB 2J6EL 2CDEA 2QSVA 3DETC 3VFVA 4ODXB 3VGFA 2WQ8A 4QRRB 2WBJB 3WKMH 1UCBH 4C55A 5C6PB 1EA9C 4JY5L 1VKXA 4HC1H 2R1XB 2AKRB 3RVUC 1IFHL 3JUYA 3ARXA 5GHWL 5F1NA 1FAIL 3PQYE 4JVWA 4JDTH 3CXHK 3HI1B 2Q3ZA 4PJCA 2CO7B 4WTXA 2V7NB 4ORGA 4XPTH 2W9EL 3OJ2C 3NTCH 3PHQB 4WU7A 4Z7QE 1CICC 1F4HA 5DJ6B 2R1YA 4ELKA 3DUHA 1R5WA 4X7SL 1T1ZA 5C0DA 4S1SH 4R3SB 3VCLB 1S8DA 5CBEB 5FKAA 4WY7L 3ZL4L 1S9VB 3V6FA 4FQHA 4K55A 3GBNH 3QULA 1N5AA 5ILTH 4ZD3L 1KFAH 3UPRA 4JRYD 1QHPA 5HI4D 3HNVH 3GUTA 3FMGL 4PRIB 1T0PB 1FL5B 4MS8D 4ZS6C 3AGVA 1N8ZB 1W0VB 2XTLA 3O0RL 2BNQA 1JPTH 1VERA 2IALA 2AABL 5IT2L 4ZAKD 4HXBH 4G6JL 1INDL 4G8GA 4QXGL 1JZ4A 3T1WA 1NLDL 1JNLL 2HVKB 2WNGA 2X10A 1CFTA 4LU5H 4NRZB 2W0LA 4FZ8H 2FHBA 2OTPA 1LP9B 5IB1B 3K1KC 1V8HA 3EYFA 2ZUQC 4GS7C 3VXRA 3UJJH 4PP2B 4WUUE 5BCAA 4P5TA 1IARB 4HGKC 6CGTA 3DMMD 1CLZH 1FN4B 1RUPL 1JGDB 4PRDA 2QQLH 5FEBA 4JG0L 4YC2B 1MCPL 5C3LD 4OV5B 1LP9F 1C12B 4BFEA 4OI9A 4OQTA 3MNZA 2NTFB 4PS4H 2V9TA 4L8SC 2E7LC 4AENA 3O4OC 1DQQA 1Z9MA 4ZOEA 5HVGB 4JM4L 4NRYB 1MCDA 5TFSH 3C5SA 4PJGA 4MXVE 1V05A 1KCSH 1S7XB 2O5ZL 1ACZA 3O3EA 4OLXL 3RRQA 4NN5C 3K4DA 4M7LL 4JPVL 4HWZA 5FHBL 4CDGC 2K1MA 4ODBD 4JREB 3I3EA 5FO9A 3U7WH 1QEWB 4F7MA 5E99H 4M9PA 5GRWA 1XF5B 4YBLC 1QA9B 3SE9L 3INUH 1UZ8B 1ZMYA 3IDGB 4KAQH 4NWTH 3DYOA 1OPGL 3WO4C 5IROA 1WAAF 1P7KB 4LNRB 2E9BA 3ARED 1DQLH 2IQAB 3OJDB 4F9PC 4JLRA 3HAEA 4JFEA 4YDJB 2YPKB 3IDMA 3FQXB 2UZXB 1RFDL 2O26U 2Y07H 3OF6D 5HI3D 1HSAB 1CGSH 3O2VL 3UJTL 4EDXB 2YKLL 5EU6D 3QCVH 3QYCA 1Z2KA 5I66B 1BEYH 1W0WA 4HKXA 4MAUL 1AO7A 5EC1A 3TZVA 4C54A 2VQ1B 3OAZH 1OCWL 4FQ2L 1KCUH 5FUCE 4UINH 3F7PC 3LQZA 2X2YA 3CC5B 3GSNA 2R9HD 3KYOA 3I6GA 4KJPD 5C0EA 2FATH 1S7UB 4BKLB 1H3XA 3QI9B 4KZEL 4M6ML 3BMWA 2Z0BA 3P77A 5E08H 3UDWC 4HS8H 5EO1B 1F3DJ 5DD6B 3SKNA 5IW3A 5SWZE 5DUPL 1T03L 3BN9C 3ZTNH 1CTOA 5HGBB 3BZDA 1VHPA 5I8KL 3TEUA 2EZ0C 3O4LD 4M7ZB 2EXWC 1FNFA 5FA3B 2VDNH 1QOKA 4X6EA 1MWAL 4HK0A 5DUBB 1NFDB 4O2FA 1RAMA 1EZVX 5I2IA 4Y89A 4G6KL 2E5EA 4FMKA 1LD9A 3QNZA 1J86A 1U91A 1LVEA 1SY6L 2D7MA 2GSGB 3P0GB 4ZUWB 5TE4L 1OTSD 2OYPA 3U0PB 5DD5H 4AEHH 3T0AA 4L4JA 4ODSH 1KGCD 4NGHH 3PQYB 3QQNA 5F88B 1TQCC 5T3XH 5I2IB 5IV2B 3I2CL 4HPOL 4RQQA 3TVMD 3DETD 2CPCA 4X4XB 5L88L 3QXDB 1FL3A 4BQ8A 4JHAL 3X13B 5FHBH 1A2YA 3IU3A 4RRPG 4K7PX 3V5DA 5ELIA 4KRNA 2RR3A 3EO9H 1D5IL 5BW7C 2VZOA 5CJ8A 2QADD 1DLHA 5CCKH 3C5JB 3MRQA 1P84J 1ZLUK 4IEFB 1E27A 3O3DA 2UWEB 4YHYC 1RURH 4JB9L 3N9GL 9CGTA 1LK2B 3BGFC 4WW2A 4O2EA 3IXTA 3C8KB 4GMTH 4GRWE 4EN3B 2YPLB 4MVBD 3RDTD 4PBWD 2B7DT 1L7TL 3SKOA 1NDMA 4HT1H 3TO4B 4F7EB 3U30C 1BIIA 3GMOA 4HLZG 4PJ8C 5D8JL 4CMMB 1JYWA 4U1SA 2AS5M 1BQSA 1E6OH 4K3HA 4LEOB 4YHOH 4YX2H 4LASL 3ARYA 2LQRA 3ARGB 3CNKA 2CJUH 3TESA 2LAGB 4YFDB 3EJJX 1ZHLA 2FJFB 1OP9A 5DJ2B 3E3QE 5MENE 2VXSH 4OGYH 2BRQA 3MOBL 3LZFL 3MRQB 4JFXA 2A9MH 3VG9B 4MJ4A 3UTQA 1TZIB 3BHBB 4YXKL 1IAMA 2Q7YB 2IEPA 3WFBH 3MCKB 3GSXA 4JN2A 2F8OA 4H1LA 4JPWH 1W72H 1R3HA 1U3HB 3PHOA 1KEGL 3NPSB 2DDQL 2NZ9C 4WEUD 1T1WA 1ZVHA 2GKIA 5JORB 4XHJC 1KPUB 4LSPH 5TPWH 5A2JH 3F7YB 5C0CE 1LK3L 3RHWK 4PR5A 3O8XA 4MA8L 4RDQG 2V17L 1I9EA 3GBLA 5IEHB 3IETB 4NT6B 2R69L 4M8QA 2F53B 3LN9A 2IPUG 4U3CA 2GSGA 3VMNA 1CD9B 4MCZB 1NCBH 5HGHB 5HI4C 1UYWL 4PGEA 3PE9A 4XAWH 4YHIB 5KTEL 4X6DE 3RKDC 5DFVD 3HZKA 4U05A 3SKJL 1LEGB 1RJCA 5DFWH 2PYFB 1UWXH 4EXPX 5DD0H 5I15H 2GSIB 4JZOA 2WBKA 4IOFD 1LILA 3HKFA 1J0YA 1KT2B 1D6EB 4RMSA 1F97A 3A6CH 3TBSA 4X80L 1PY4A 2IPKA 3V4VH 5IJKA 1OVZA 5D72H 3LN5B 4QHNA 1X5JA 4I18A 1JHKH 3I6KB 3S37L 1C08B 1J8HE 4PFEA 3P77B 1MCBA 3A67H 3UTSA 1MNUH 4PS4L 1MVFA 4ZG1A 4XMLH 3DROA 4K94H 3HC3H 2IPKB 5ESVA 3TBTB 1E4KC 4Q6IA 3V6FB 5ECJE 1X3DA 3RP1A 4LHQB 1W72A 3ETBF 5D5MA 1VGEL 3X3GH 1TDQA 1GGIH 3SGDI 3FCTA 4OJFH 4OTXH 5MERA 2IH3A 3LPGA 3OZ9L 3VFMB 4Q2ZB 3K80A 3SDCB 1CWVA 1I9IH 1VCAA 5JXED 2WIIB 3LB6C 3FQXA 1PX3A 4NBYB 1UZ6E 4HIEA 3S96A 2ZCHL 4P4KD 1KJVA 1RIUH 1EERB 2A74B 3WLBA 1PEZA 2G9HA 3UJIL 2XRAH 1BIHA 3W11D 5ID0B 1F90L 4MJ5A 5TGBA 4L4VE 3O81A 4HG4J 5T1LA 3GJEB 5FUZH 1VKXB 4HHAB 1RK0A 3PHOB 5GJSL 3VFSA 1IC7L 4HIIA 5IJVB 3MUZ1 1OT1A 1BFSA 1TZIA 3BHBA 4JFOB 4Z7WE 1J5OH 3MR9A 4KRLB 1G6RL 4H8WH 3TPKA 3V8OA 1UZ6F 1W0YT 3P0YH 4LHJB 4F7PA 2ZKHH 4XCNB 4HBCH 3CDFA 5EU4B 1TVDA 4XNXH 1ONQB 1TNNA 3GSRB 4N1EA 4NQCE 5IHZA 2I9TB 1R3KB 3BQUD 3BFOA 3QO1B 4OCXH 5GSRA 3GNML 1QO3A 1Q0YL 5ESQB 3IAPA 2ZPKL 4XH2A 4KTEH 2ZUXA 3IAQA 2HLAB 5E2UH 5GRVL 4CKVX 4X6DA 2X5PA 5HHVL 4DW2H 2W1NA 3SJVE 5IB1A 5MEQB 1MI5E 1YYLL 2FYYA 4XP6H 3F5WA 3RBSA 1YECH 3W0WD 3P30L 5D93B 1XH3A 4GT7A 3EDKA 4GO6B 1JI2A 3NABL 3DV6A 4Y4FC 3STBA 4ISVB 2IPTH 3HE6B 3MRMB 3JWOH 4PJ7B 2Y36H 1O0VA 4JRXA 4M43H 4H8WC 4EI6A 4UB0L 2DYPA 2DYPD 1H5BB 1DBAL 4PRIA 4GKNA 2YSSA 4IOFC 4OT1L 3O9WD 2D7TL 4QCIB 5IIEA 1I1CA 3LQAL 4KJYA 3QAZC 3RL2B 3PL6A 4GAYB 4CL7A 2CQVA 2R1YB 4ELKB 5K9QI 4GKSB 5BV7L 5K59F 3FOLA 3L5WB 5HPMA 3LEXA 4Z7UE 3MCG1 4LVHB 3ULUC 2DM2A 1MCQA 1OW0C 1DVFD 1PAMA 1INQB 3LDBB 3LH2H 3H9YA 4U1MA 1RPQA 15C8L 4GAYA 3IRZA 2ZP0T 3LHPL 3TPUB 3T0EB 2BSSB 2EIZA 4WV1C 2VLME 2V6HA 1KELL 3B9DA 5IB5A 5ID1A 1PEWA 1MEXH 4D3CL 1NQBA 2RB8A 1MCIA 5L2KD 2GT9A 5IMKB 4QRRE 4FABH 3ES6A 1BZ9B 4TSAH 4ODXA 2CR6A 3THMH 3REWA 3SDXF 3ZMRA 4HWEH 1BWWA 5DQ9A 4FP8H 4EIZC 2Y5EA 4JFQA 1YMMB 1ZVSA 4X6CA 3BT2L 4G3YL 3NZHH 3WHXA 1X9QA 2RGSA 3DOSA 1AR1C 3FFCD 5GS2D 5F7NC 1T2JA 5D6DA 1VFOA 4X7FC 1AY1H 5J8OA 5LBSL 2C9AA 1R0AH 1CLOH 3NIFE 3BSZL 3PGDB 4HS3A 3TH4T 3VI4E 5HPOA 2XT1B 5IB4A 4CNIA 5IMOB 2FHFA 2QEJA 2VC2L 2D0GA 4PY8J 2J4WH 4TUJB 3S37X 1OARH 2FB4L 3W9DB 5DR5L 4KI1A 4F37K 4Y88A 4NHCH 4KVCH 1XF1A 5F97E 4EDXA 5K9JL 1MI5B 2DJSA 4GAJH 1YEJL 4FFZL 5E2VH 3HCVA 3QDMD 1IJ9A 4P59L 1UACL 3ZHDA 1S7QA 1VA9A 1N59B 1MJJB 4C59B 2ADJB 5ICYB 1FVEB 1HHIA 3OR6A 4ELMB 1DBBL 3OHXA 5L8JB 4S1RL 3RUGE 2OJZL 5HJ3A 3D3VB 5IFJA 4H88L 5L0QB 3V7AE 1DUYB 2APVA 1VGKA 4IMKA 5DC9B 2Z31D 3EBAA 3LY6A 5I76B 5JIHA 3TO4C 1AFVH 2WIMA 1H3PL 3KNBA 2BNRB 3PGFH 1P84K 4L8SA 1K3IA 1J87A 5ESAB 1U8PA 1MAKA 2DICA 2BY3A 1FRGH 4NO3A 1BEYL 1FZOB 1RZIA 1S5IH 3NCJL 4K3GA 3DVNB 4G6FB 3LS4H 5KSAD 2QSCL 4OZGA 3BP4A 5DMIL 1Q72L 5E8EB 3CSYB 3R4DA 1OPGH 2FECI 4NC1E 1HK6A 4X0KB 4OM0L 3FHQA 3V2AR 1UB6A 2VKWA 2B2XH 3I02A 2EDRA 3W5MA 1WSST 3RGVA 5HVFB 3I9GL 4NOFA 1FCGA 1T2QL 5DEGB 5C8JB 4H26A 5FYKD 4QHKJ 3RWCA 1JGDA 1AO7E 4OLYH 1D5MA 4OCRH 4UTBH 4AY0A 4H0IA 2BFVH 4ZOAA 4WI8A 1QFWH 3MRKB 4WENB 1HZHH 3DBXB 3DUUA 2WLYA 4BK5A 3U48A 4PJIE 2UWEE 2ADIA 2VDRL 4YHNA 3REWB 3TZVC 5E1AB 4OLZH 3DRTB 1BJMA 4NQDD 1AXTH 1IEAB 4FQQA 4X6DF 1CIUA 1SJVA 1W2KT 3IU4L 2I27N 3HMWL 5HHNA 5C07D 3O9WA 1K3ZA 3QUMH 4QF1A 3HA0A 4U1JA 3G5VA 4YGAB 3SDDB 1GRWA 3MLTA 1Q0XH 3MJ6A 4QRTB 2NY2C 5F9JA 3R06A 2OZ4A 5GS0D 1UM5L 3MYJA 4I8DA 1BECA 4EI5B 2XKNB 4LKXA 4BH8A 2CKNA 5IW1A 3SKMA 1MIEL 4Y1AA 5CJXA 1JTTA 4LCWE 3PL6C 1TNMA 3O2DA 4D0BB 3OKDA 5C0FA 3X11A 5EZJB 4DEPC 4LSDA 2VXQH 4FTVB 2HVJA 3F65A 1QBMH 1E4WL 1G7MB 4R0LB 3FB6B 4MB3A 1EIBA 5EU5A 2DB8A 1GIGH 3Q6GH 2WBJD 3ZZ1A 4JANB 1U3HA 5LWYH 1YY8B 3ARUA 4YHLH 1LEKA 1CFQA 1BLNB 1NC4D 1VGKB 1RURL 2FEEI 2H6PA 5HGDB 5D7LB 4HPYH 4RGND 1JK8B 2A6KB 1I1AD 5CEZH 4GMTL 3RTQD 2RCSL 3HE6A 3S3SA 2C3XA 1R5IA 3BGFB 3C60A 1T6VN 6FABH 4MD5A 1QVOA 2X4TB 3HCVB 4QRPE 3QEUB 3IJSB 4UMGA 4WWKA 1CI5A 2V2XB 3NCJH 2PCPB 4PLJC 5CINH 3QZWA 2IF7A 4JAMB 4RWYL 2AJ3A 3VGAC 1X44A 1QLRB 2NQCA 5DJ0B 2E7CA 1SQ2N 3LRHA 4YIQB 4WO4B 3VD4A 4G43A 5C08E 1XGQB 3VFWB 3BPLC 3STZA 4JDVA 1IKFH 4KKCC 2MCPH 3SDAB 2IADA 2X4PA 1FC1A 4F2MA 1S9KC 5I16A 2NY5L 3QPXL 4LSQL 2PETA 1DL7H 1CZ8H 5I1KH 1QRKA 5KANG 1CT8A 4IHOA 2E6PA 4Z7WA 4RA3A 5T1KB 4NQEB 2NXZB 3OKOA 4NZTH 4YHMH 1AHWC 3J7HA 5D7KD 4KROB 5HYSA 1H15A 1LMKA 2DQHL 3O4LA 1CFNA 5DQJB 3QQ9D 4JFHD 3WSQH 2XQBH 1HHKA 2C1OA 4LRNL 4JPKH 4Z7OE 2ED8A 4X6BA 1DQML 5GGRB 1GVIA 1YPZF 3TCXA 5FGBC 5I75C 2OTUB 2Z93A 4OCWH 5D2NC 3VXUE 3VU2A 2BNUB 4U1NB 3DWTA 1BMGA 4PGZA 5ISZD 5BQ7A 1Y6NR 3VXPB 4M61B 3WMSA 1V3KA 1NH6A 2B1HH 3O2DL 1PDKA 4JFEE 2PF6A 3UTTB 4Y16D 3U0PA 2HG5A 3V4PL 3MLRH 3BDBA 5E8PA 2HKFL 3OPZL 4S1QL 4Y8DC 1KLGA 4LKCB 4R7NA 5EU7C 3DSFH 1MSPA 1I4FB 2ARWA 3H3KA 2J8UA 3C2SA 2GAZB 4Q97A 1FDLL 2R2HB 1P69B 2VLJD 2Q8BH 4KK8C 1UM4L 5L9DL 2VIRA 1BBDH 5CWSA 3TH3T 5HY9B 3HZYA 3N50A 1P7HL 2QHRH 5HGBA 3MV9A 3V5HA 5F6HJ 4Z7VB 4U6VL 5BV7H 2W65B 5E2TH 3JBG7 1DTUA 2KPNA 4MA7H 4L29B 2BHUA 2APTA 3AS1A 2MKWA 2RCSH 5DK2A 1ZAGA 3KR3H 3GZKA 4R97B 1DFBH 3MA9H 4WDIA 4G8EB 1IAIH 3KLAB 5H2BA 1R5VA 3HPJA 4A6YH 3RFZC 5FA4B 5LXGH 1KSRA 5F9AC 4Y2OA 1TZHA 4H5SB 5GGQH 2KKQA 1N6QL 2GSIA 3AS0A 2OXGA 3NFSH 3WEXA 5IHBA 1GPOH 3F12A 2G60L 5EOTA 4HK3N 1P1ZA 4IOSD 1DDHA 4MXQD 4KK5C 2BC4B 1MJ8H 2ATPA 2D9CA 2NY5H 1UEYA 2OTWA 1YMHB 4E42B 1M1SA 2ILLA 1V5JA 4OZGE 2VITB 5DRZB 3RAJL 4PG2C 3HG1B 4UNUA 3RX7A 4JFOA 1H3WM 3U4EB 5C0GA 2B1AH 1F4WL 5DHYA 4XP9L 3H9SE 3BXNB 3GBNL 3EFFB 4PJDE 1MHHB 4OIBA 2ICEB 1K9TA 5F7EL 4AEIL 1J05A 3EYUH 2PNDA 5HDQH 3KPQB 4P2OC 3EYSL 3TWCH 2VITA 1NLBL 2V5YA 3QDMA 1JGLL 4PGJA 2XZQH 1A6AB 3L6FB 3Q5TA 4XBPB 2E7HA 3MFFA 4BH7A 3RKPA 2FO4A 1CLYL 3G6JA 1DBBH 1YJDC 2R0WL 3GI8L 3HI6L 2BSTA 4QOKE 4WY7H 1DANU 2FSEB 5FDWB 1M7DB 1KENH 2DLTA 1OLZA 3MXVH 4C57C 4PRDB 2FO4B 1HXMB 5TE7L 2DWDB 4FTVD 4JG0H 2X4QB 4ZSOA 1FFOB 4Z6AT 5IEKA 3HHRB 2BCKA 2D03H 4OUOA 3ZSTA 4HQQH 2WWKO 1BGXL 3BKML 4U6VH 3FAWA 4KWUA 4AK1A 2YUZA 5C71A 5TFSL 2HFGH 5C0CB 4RAVA 5CEZE 1DQDL 1MFCL 1JYVA 2EICA 4G8GD 3RDTB 1FAIH 4JZJA 4PGCA 4QYOB 4RCAA 5IHUL 1I3UA 3OMZA 1BQHA 5IOPB 4L8BB 5D93C 3X12B 3T0EE 4WFGE 3OAYH 4GG6B 1G6RA 2J8UB 3QPQC 4ZXBB 3VI3F 4MA1C 5FUOL 3VW3H 3WFEH 1OAKH 4X7SH 3FQWB 4NZRL 3U4AA 5EOTB 4ZTOL 5I1HL 2ESVD 3WEXB 2C7UB 1CU4L 1F45A 5CILL 1WFOA 4XZUA 1XF2B 4Z7UA 1YNTB 4P5TC 2HN7B 2Y72A 4D8PB 2E27H 4JAMA 5JW5B 5HYIA 3S36L 5K33A 2AABH 1ZA3A 4OLVH 4X8JA 5D2NA 1NBVL 5JOFA 3S6CA 3DI2B 4O4YH 4PJEB 1T20A 2VZTA 5HI3C 3B6SB 5SX5K 5EO9A 5E6IB 3MCKA 4N0YH 3F7VB 1C5CL 1TMCB 2H3NA 4JJ5B 4F9LA 2HJLB 4RISH 1S9XB 5A1AA 2P5WE 1TLKA 5HGDA 3NAAL 2XFXB 3D69A 5B8CA 2W38A 3DTXB 3P73A 1NC4A 1YEKL 3PNWB 5E7BA 3HC0B 4AL8H 1RY7B 3UZVB 4LCYA 5F9WB 3BP5A 4JANA 3IXAB 5JHDA 4N90E 3LQZB 4X5WA 5FYJU 1NJ9A 1R3JB 5DTFA 2VQTA 5GRZA 3ARPA 4HDIB 5FM8A 2BNRE 3O6MH 2ORBL 5HYQA 5HGAA 5C70A 4LVNC 3U36B 3ALPA 2AI0H 3T8XA 2Q86B 2B20A 1I1FB 5CD5D 4U6HA 1HSAA 5EOCL 3GI9L 4FFWD 1YQVL 4NP4H 2BVPA 1QVOB 4NQUA 3WN5A 4DGYH 3A6CL 4LF3A 4ZS7L 1ULVA 5HHQB 1XGPA 5B4MD 5GGRA 3FRPA 5EUOE 2W0PA 3HRPA 3IDGA 5DJAB 4UUJB 3WDIA 3VRLE 1HNGA 5J89A 1J1OH 1CQYA 5F6HI 3RTQB 3WO4B 2PW1A 1ZANL 1AKJD 3RWGA 3QUZC 2P5WA 1I1AB 3D39A 1Q8MA 2X6MA 2DLHA 4P5TD 4TNWK 1XAUA 4FRWA 1J0ZA 1EX0A 3FB6A 1HYRC 1JTOA 2C5DC 3AM8C 1RVFH 3QDJD 3TN0D 5DMKB 2BVEA 4X4MA 3ZE2F 3S34H 3RJDA 4HH9A 4M93C 5DUPH 1T03H 4YLQT 5GGTL 5L2KA 4OFYA 5DS8B 1IC5L 3QXAA 1Q9KA 4KQ4H 4JDTL 5T3ZE 1Z9LA 3NVQA 3RL1B 5TF0A 1GXEA 3VD7A 2ADFL 3TBWB 1OSPL 4ODUB 4CVUA 2OMBA 1UH3A 1Z5LA 1GC1H 1KLUB 5D96C 2FATL 1NMBH 4JQIH 3QO0B 2A6DB 3IDXH 4YR6B 3I6LD 5IR1A 3SN6N 3VXNA 5I8OL 2IAND 3FOMB 3G5VB 4OZHF 4KUZL 4PUBH 4LCUA 3DVNA 4IDLA 3WIIH 1IT9H 1GOGA 1EEZA 3KS0J 4KUCD 5I75B 4LFHD 2ERJB 1G9MC 3TBVB 4Q9QL 2AVGA 2XA8L 4ODTH 5AZ2L 2XNAB 4LASH 3ARWA 3DUUB 3QIWD 4YGVA 4TOYH 3QQ4B 3D85D 3GMNA 3D85A 4U2ZA 5D1ZB 1SVZA 2HMIC 1P9MC 4GUPB 1MJ7H 4R8WL 4E0RB 1BLNA 1G6RH 3V6ZB 4TUOB 3BKYH 3UTZA 5A40E 5E24E 5CZXC 1CLCA 2OZ4H 1Q9LB 4TSBL 3SE3C 4J8RB 3SCMA 1D3CA 3WNMA 3H3PL 4MQXD 4LF3B 5ICYA 5JHDD 3QULB 1I8MB 4U49A 3TJHC 5CCKL 1HH9A 4O02H 3RGVB 1PJ9A 5ALBH 3ARDB 1RUPH 5CBEA 1R24B 3X11B 5EC1B 5DJ8A 1F4WH 1G7IB 1DZBA 1I1FA 2H32A 2LU4A 2DTML 1WWBX 5EORH 1SYSA 1A4JA 1NLDH 2JIXB 1CDGA 4PJCB 3G08B 1GHFH 4FZEH 1U8PB 3DO3A 3HI1A 1P7QA 3LIZL 4RMWA 35C8L 1JNNL 2HFTA 4L8SB 4K9EL 1C16A 3V6ZA 1RI8A 3ECBA 5SV4A 1CR9L 4J7RA 3BIBX 4MVBC 2VSDA 4NN6C 3TYGL 3LV3B 1X5YA 3DYPA 1AJ7L 3VWJD 1EMTL 1U8QB 4YH6A 4E41E 1TTUA 1B88A 3S98A 3GMPA 4ZDHB 2X7LA 4UT7L 3HNTL 3OKLA 1HDMA 2B5IB 4M6OL 4IRSA 3MV8A 5JIKA 5D71H 4PPTA 1IRAY 3PWPB 5EO9B 3WS6C 2I24N 3WHE0 4ZPTA 3RWCB 2AJZA 1B2WH 5GGTH 1CDIA 5I1IL 1QBLH 2WANA 5D9SA 2A6DA 3CCHA 4Z95H 4M1CC 4ERSH 2EDFA 2AK4E 1ORQA 1YC7A 2VQUA 4EBQL 5AUMA 2ESVB 2DI8A 3O8XD 5I8OH 1AP2B 4PBXA 1I85C 4D0CB 2JCCB 3AFLA 4ZXBA 1JF1B 5C2BH 5EBWB 2MJWA 3EYSH 4FQXD 1KIQA 1T0MB 1M6OA 4XAKE 4MQSB 2X1XR 5A2FA 2EEAA 1YMMA 5DRNA 5HVHB 4P23A 2B4CL 2F5AH 2IMMA 2FD6L 4RNRB 5C7XL 4OQTH 3ULUE 5DA4A 4HK3J 3KGRA 5I1GH 1D5BB 2V2TB 4BYHA 4LK4A 2BOBA 5I8CB 1PFCA 2VZUA 4WWID 2Y5TB 3O6FD 1EEQA 1T7WA 1WC7A 4OBSA 3RWDA 4P23B 5D7JD 4OFVA 3ZDZE 4P46D 3IF1B 1RU9H 3RBGA 1CICD 1FNLA 3GKWH 4G7VH 4HD9A 4KGJA 4L3ED 2DJUA 2XQBL 2J6EA 1IM9A 3NN8B 1FFNB 2NX5A 1KTLA 3H0TA 4F3FA 2JCCA 4WU7B 1KIRB 5DZOA 3RY6C 2MHAB 3ILQD 1J88A 1Y6MR 3FO2B 1QO3B 3F6LA 1QPXA 4G9FE 2NY3C 5JIIA 1HWGB 1UJ3C 2P8MA 3P9WB 1SHMA 3QO1A 5D1XC 1HYSC 1A6WH 2XZCL 2UYLA 1TCRA 1XF4B 2DQCH 3BO8B 5E2VL 3B9KB 1FIGH 3DGGA 1BHGA 2DLIA 1CE1H 2PXYD 3X14B 2VE6B 1NGZA 2CKBA 1EH9A 3ZDYF 4HZAA 2WLZA 4U31A 4P2CG 3LCYA 5J56B 1GOFA 2KQNA 4IRSB 4OLWH 3SE4C 3QUXC 4W4OC 3SDCC 1RD6A 2H1PL 5A16B 3MRMA 4AIZB 2XACC 4R97C 3F7VA 3GMPB 4ZDHA 5C0AD 4YDVB 3VJ6B 1ZWIB 3PP4H 1ROWA 2P46B 3AY4A 5KVEH 5MEPA 4WHTA 1RK0B 4LPXA 5FYLL 4FS0A 1WISA 3LPFA 5F3HB 2P1YA 5JMOC 4DFHA 3X14A 1AKJB 1G7QA 3LKSA 2JCCF 2BSSA 4MMZC 5KSAA 3T08A 4YE4H 4LARL 5T3ZH 2YA1A 1T04B 2QSCH 4Z95L 3G9AB 3VWKA 5E4EC 4LSTL 5GSRB 4P2RA 4Q6IC 4MCYB 2P8MB 1O7SA 4POYA 5LGJB 5F89A 2BNQE 1C7SA 2VXUH 5JXAH 1N6UA 3LQAH 3U4BL 1KYOJ 3QJFB 3FQWA 1T89C 4UNTA 1OSZA 2VDPH 3A0OA 2VZ3A 3LKOA 4EZMA 5FM5M 2PYEB 4NUJA 4DUWA 1CDJA 4Y5YC 3O2WH 3JWNC 5TQ2L 4IM8A 4Q6IB 4B7IA 4PGCB 4BSVA 2DWEA 4RBPK 1OQXA 3GSWB 1NGYA 3BYYA 4QRPA 4UIMA 5IJVA 1W8OA 3S3JA 3KPLA 3UTSB 4FXGB 5DJYA 1UWEL 5KW9L 3RVWC 4DW2L 4JFDE 3C08H 3DV6B 4JO3L 1AXTL 4OFKA 5J9PB 1BFVH 3THML 5DLML 3GI8H 3NCEB 1X5AA 2XKSA 1INDH 1RMFH 3KLHD 1QFHA 4Y4FB 4TSCH 1RULL 3SDAD 1D5ZA 4XWOD 4ZO8A 1BFOB 2EKSB 1KBGH 3STLA 1AH1A 2NXZC 5GGSB 2P5EA 3C60C 2V9QA 2EEDA 2D7TH 3VFNB 4HEME 5E5UB 3O9WC 5JHLL 1URLA 4LHUA 1T7XA 4U1LB 3ZT6A 4KJQC 4NO2A 1FIGL 1BJ1J 1NCTA 4HLZH 3MQIA 4NO0B 3R0MA 4FP8L 3AS3A 4UT6L 3OG6B 2J7LA 3TA3C 1OHQA 4LCIH 3T77A 2CH8A 4POZC 1K8DA 2FO1A 2PXYB 1T1WB 4LVHC 4AEFA 1NANI 4PRAB 3MRGB 5DD3H 1ZLSL 1MHHA 3PWVA 3AU1B 4IOIB 3RDTC 1KLFA 2P5WB 4NQVB 2EDTA 1NCCL 5H94B 2AP2A 4U3XA 3O3AA 5FGRA 3S3PA 3GSNL 1IGJB 2C1PB 2GJ6E 2XY2A 5HVWA 1AI1L 5CIPA 2XZAH 4F57L 4HMCA 5DEFB 3WLBB 2X4NB 4Z78A 3OJMB 5E99L 4O2CB 4R4BA 4IRZH 5D7JA 1SBSL 1LEGA 2P8PA 3R0NA 4Z0XB 1HKLL 1T4KB 4LRIC 4C56E 2EXYD 4YHIA 1JNHB 5TDOA 2IG2L 2EH7H 3V6BR 4U6HB 4LCCC 2I07B 3OV6A 4P2QA 4F2MB 5GS1B 1UKSA 4JRYB 1J1XH 2NX5E 5I1CH 1ZT7B 5IVOA 4P2OD 1OM3H 2EE2A 5IEHA 1ZE3C 5EFIB 5MI0B 3O8XB 2HH0H 1MFAL 3F8UB 4MQ7A 5FYLD 5B39B 3MOQA 5EU3B 5BMFH 3OR7B 1QLFA 4X5WB 1JPST 2PCPA 5EA0L 2V2XA 4KI5C 5BV7C 5IVXB 1UWXK 3PWJA 1MUJA 2X4OB 5TE6H 2N56A 3QNYB 4XHQA 5C08B 4DKDC 4FQXB 4PV8A 3GK8L 3OKNB 1QLEH 3U0TB 3DRQB 1X4YA 1F6FB 4EJ1C 1KPVA 4X9FA 3ZKQD 3QIWB 1C5BL 1JZ3A 4OCRL 1ES0B 1CF8L 2RJMA 1VEMA 1WVZA 5JPMA 1M7IA 1I9IL 4ZUUA 5C0JB 4KU1A 2FJFA 4WEBH 5I73C 1GCFA 3B5TA 4K7PY 4WCYL 5FGSA 1BFTA 1YNLH 3QUXA 4MLSA 2WUCH 5E1HB 1A9EA 1XIWB 2ORBH 5EU5B 3G6DL 5HXMA 4PRHA 2HN7A 4LKCA 3MLRL 4R7DA 4LAJH 3TO4A 2BXYA 4N1CA 4FQPA 1GGBL 1ZHNB 4I0KA 5IW1B 2EH8L 1ZOXA 1HZHL 3S5LB 5BQ7B 4NQXB 3N1FC 4H88H 1MIEH 4R2GD 4XNZB 1I9JH 2XWJB 5GRUH 5DUBA 5HHNB 3RZCB 1T7VA 3DUSA 4FQQB 3L5XH 1I1AA 3D39B 4O51B 4NBXB 4LVOC 2JLLA 1JVKA 5L6YL 3BPOB 4HUUA 1OP3H 4JZJB 5JOPE 4APQA 1CK0L 4RAVB 2ZPKH 1RZGB 5I6XB 4F57H 3X17A 4CUCA 5BS0B 1JPGA 4IHOB 5IV2A 1F42A 4I18C 4RBPH 1QYGH 4JFPA 2QBWA 4PTTA 5DEGA 1RUQH 4PJIF 1CFSA 3KDMB 5CLTA 5CP3A 2BY0A 2Z8WC 3MXWL 2F54E 4P2OA 2DWDA 3ZKXC 1GSMA 4G43B 3AY4C 2O61B 5E6YA 3TZVB 1G6VK 4LL9A 2J8HA 3F58H 3NZ8B 5DJ0A 1ETZB 2AJ3B 1A4KB 4HH8A 4N0FA 4Q9RH 4U6TA 1E4KA 3T4AB 4QTHB 5IW6A 4NFDA 3BP6B 2IAMD 3QZWB 1AR1D 5DHVH 5CS7A 2EC9T 3DXAD 1TPXC 2NY2B 4X6CF 5M7QA 4MD5B 5M94B 4UOJA 1FVDA 5DVKA 4FQLL 5FYJL 2ITCA 2Y07L 1NMBL 3O4OB 3QXTA 4WUKH 4Z78B 3QUYA 2DDQH 5KAQG 2AJSL 2VN4A 1U95B 3VXOA 4XPHH 4HJ0D 5DRXA 4BFGA 1KPVB 5TDNA 3WIIL 3HMWH 3KLHC 1QA9A 3V6OE 3GJFK 2G5BB 2WV3A 1CFQB 3JTTA 4Y7MA 3IDYC 1KCUL 3L3GA 3MV7D 3MBXH 3X13A 1YUHB 3PWJB 4BSVB 1K85A 4NM4L 2BVOA 4JRXE 3HC4H 4XCEA 3WCYA 1RZ7H 1N59A 2VNCA 1NCAH 2EE3A 5LBSH 4MQ7B 4JGJA 4Z8FL 4Q58C 1LO0L 1MI5A 3KYKH 4AZ8A 4AT6A 3C87A 3FFDA 4LLYA 1NCWL 5C0BE 4XTRC 1CGYA 5F7DA 4DZBB 1N0XH 2CLZA 3QDGE 2QTEA 5FDYA 4ZUTB 3M8OH 3KPRE 5F9JB 5MP6L 3EYVA 1T4KA 1A5FL 1D9KB 2ERJC 4JFEB 4YDJA 4NHCL 2PTTA 4QF1B 4U1JB 4LSSL 3HUJF 4X6FB 1WIOA 1MCNA 5TJWK 2P5EE 3B83A 2HA1A 4MNQD 4YUEL 4Z76B 3U0WH 4Y5XB 4PRBB 4Y19D 2CDFB 4OD2A 4I3GA 1NGQL 5HI5D 3VXRD 4YHNB 5IESH 1MPAH 1FPTL 3BSZH 3NIFF 3RPIA 4WU5A 2CGRL 5EDXA 4YDKH 1F02I 5DD6A 3SKNB 1PQZB 3DMMC 1Q9OA 3TT1L 3IKCB 3NACL 2NW3A 1XGYH 3KPLB 1EGJH 4WNQA 4DGIH 4Z7VA 3QI9A 4XNUL 3RVWD 1QQDA 5C8JA 2VDOH 1QSFE 2PUQT 1MLCA 3GMMB 3VGAB 1P6FA 1KPRB 1AJ7H 1MY5A 2NTFA 1QFOA 3L3OB 3P11H 3DGGB 4I4WB 5FUOH 5EOQL 4UIKL 3P4OB 1U8IB 2XQYK 3IDUA 2JF1A 4TVPL 5AYUL 4D9RE 1Q72H 1OY3B 4NFBA 1R3IL 2LV4A 4WFHE 3WL9A 4F58H 4YAQA 1KJMB 2QHRL 3MSPA 4G9DA 3KPPB 3JVGC 3VWJA 2DIJA 3MJ9A 3L3IA 2DD8H 2Z8VC 1BD2D 4C83A 2E27L 2VLRA 3VGEA 1IC7H 4PP2A 1NEZG 1NGWB 2R56H 3BAEH 4CJ0A 1MIML 1JI1A 5GRXG 1A7QL 1J5OL 4P9HC 1KBGL 3WYRA 1YN6B 3C2AL 1EUTA 1C8PA 3EFFA 2AQ3A 1HHJB 2GITB 2YK1L 2BOBB 5I8CA 1LDPL 1RU9L 5DHYB 1UM4H 5L9DH 3GKWL 4EI6B 3OHXB 2CDEB 4G6JH 5HGGS 4L4TD 5DURD 1NDGB 3HRZA 1SYVB 1PG7L 1UJTA 4KK9D 3TNNB 3N85H 1CBVH 3C5SB 4PJGB 4JKPL 4UQ2A 4S1QH 4L4VB 5I8EA 4L4TA 3KYKL 3RVVC 2PYEA 4JVUA 1RSFA 4NUJB 4NCC1 3MCLL 4WVRA 4YWGL 3VD5A 1YZZA 5IM7B 1MQ8A 4CNIB 5DK0A 5IB4B 4XGZB 5BZDB 3UJJL 2CMRH 3WUZA 1WWWX 2Y06H 2W92A 3PP3H 4G8IB 4A6YL 1JF6A 5BRZE 3RIFF 3VXMB 4WO4A 1ACYL 3K8LA 4G6AD 4HEPG 1NKRA 2EE6A 4HIJB 4WEBL 2V5RA 2ZSVA 1R6VA 3LRGA 5C09E 2ZUSA 3CLFL 4U1GB 1IZKA 3G6DH 4ZPTB 5SWQA 2GUOA 3IGAB 2ED9A 2YOCA 4PY8I 3QDHA 2PTUA 3MO1B 4Y4HD 2CUHA 4X7TB 2BY1A 3I85A 3OKMA 5ITBH 1L6ZA 3C5ZC 2ZOLA 1KTDA 3KJ4C 5CEZL 4EQ3A 1N3NB 4M48L 1F4AA 4CADB 4MJ5B 5TGBB 3HLAA 4N8CH 5E0QA 3OAUL 5ICZB 1H0DA 1TJGL 1VSCA 4LIQL 3O3BA 1KV3A 1HE7A 1XFPA 4U1MB 4LNVA 3QT2A 5CZVL 2HVJB 3TN0C 5T1DH 4W4OA 3SDCA 3SO3C 4QY8A 1NBZB 4NUGH 2IQ9H 1JGLH 2ENYA 2XICA 5BOPA 5DFTA 3QFDB 4P3CL 4W70A 5GGVL 4KMLB 1OQOA 1Z3GH 4EI5A 4PJBE 4F37F 1IM3B 2QADC 3R06B 4GXVL 1S7TB 5HHOB 5JDJA 2VXUL 5JXAL 1OAZH 3JWOC 4KGLA 4U7SA 5D1QA 1S9YA 5CHNB 3AAZB 3ORJA 4OZIA 2CXGA 2AJXL 1G9ML 5LCVL 3U46B 2OK0L 3TVMC 3VFVB 2EXYC 3BGMB 2VXTL 4X7TA 2ATKB 4JPIA 4KROD 4OZ4B 5L7XH 3MUY1 2N7AA 1EO8H 3G5XA 3HN3A 3QPXH 4E41B 5CD5C 3L3DB 4PREB 2FX9H 4PJEF 1XT5A 3ZE1E 3BWUC 1A1NB 3D0LA 3DX7B 3EHBD 5EU6E 3GHEL 5HD8D 5T1KD 3TP4A 4TTGA 2J4WL 2HTLC 4RDQF 2VLLB 3I50L 1FJ1B 4P2YA 1KT2A 1EAPB 4A6YA 1F4YH 3VXMA 2VDQH 5I9QB 4DZ8A 4GG8A 5J1AB 3V4VL 4J3XA 1ZT1A 2Z4QB 3OXRA 3KLSA 1KN2L 2RFXA 1N64H 3I02B 4J6RL 3CCHB 2UZYB 4HQQL 3B9AA 2R29L 5DS8A 3PWLA 3OAZK 3L9RB 1BD2A 4UQ3A 3GKZA 3RUGA 2F8VA 2VLJA 5SWZD 4OD3H 3TNNA 1DQTA 4F7PB 4IRSD 4ZFOB 5BXFA 1K4DB 1UEMA 5C0AA 2GJ6A 2ZOKA 1OAQH 3Q3GA 3SO3B 1JZ5A 1G7HB 3BWAA 4JN2B 1ZK9A 1VB9A 5ACZA 4X8XA 1L0YA 5D2LB 1S5IL 3HE6C 5TDNB 4DVBA 5CSZA 4M6OH 4UUJA 1LEKB 1WZKA 1FGVH 1YYML 1I8IB 1G7HA 4NZRH 2J8UE 3ESUF 4HIEB 4NO5B 3S96B 1O5DT 2YA2A 2APWA 1MJJA 5JMRA 3QQ3B 3ARRA 3O45A 2E7BA 5EH1A 5GGQL 1T80A 2Y7QA 5I1JL 2CSPA 5MERB 3KPSE 3VMOA 2XKNA 3PHSA 4LKXB 4BH8B 4O9HH 4XC1L 1Z5LB 3CIQA 5DT1H 1U8MA 5TE6L 4OKVB 1IQWH 3A6BL 3PGDA 3RL1A 2ZZUT 5FYKL 1B3JA 1MCWW 4XMKH 3OKYA 4UV7L 4PLNC 1EAPA 5JZ7C 3ULVE 5HHOE 2GJZA 4NQED 3FB8A 3JTSB 3K1DA 2BMKA 1WFUA 5CJ5A 4FHBD 3S34L 5JNYA 4QWWC 1KCRL 5EA0H 5KSVB 2YD1A 3TO2B 5AG8A 3VXQB 4ZS7H 3ULVF 5DD1H 3HAEH 4NDMA 5DJAA 4RAUA 3EYUL 2GTZB 1L7IL 1T5WA 5HHMD 4Q0XL 1UWGH 1U92A 1FL3B 3QWRA 1JGVL 4YDIH 4H26B 5JQHC 1FVCA 3BDYH 2JB6A 4MD4A 5GISH 3FOMA 2EDJA 3L1OH 5GZOD 5FOBB 3SDYL 1ZTXL 3T0XA 4G5ZH 5CD3A 2AEIT 2D31B 3UPCA 4MQTB 2D7PA 4KK8D 3IVKB 1IQDB 4RGMC 5CSBA 2IJ0C 2R1WA 1A0QL 1QTYT 3VGDA 3EFDH 3P4LA 4PJHA 2XZCH 2M2DA 3PWPD 3KYNB 4RGOL 5F8QC 2VB5A 1OTTD 4JZNA 4Z7OF 1NUDA 1A6ZA 2GHWB 3BQUC 5J7CC 1SMAA 5EORL 4J1UA 1UA6H 2NY3D 3X12A 4DFIA 4NN7C 4FNLH 3BP5B 4K2UL 3ULVH 3MNVA 5K9KB 5JIPA 2VLRD 3H3PH 3FQTB 3N1MC 3Q6GL 4P3WA 4U1IB 2CIKA 2R0LH 3H7BB 1XR9A 4MXVF 1H5BA 4JN1H 3IFOA 3PXJA 2DM7A 5C0CD 5C0CA 1S7SB 1G7PB 3A67L 4UBDD 5CBAA 2D7QA 4Z7UF 2ITCB 3WN5B 3KJ6H 3VE0B 3B6SA 3QEQE 1ZS8A 1S7UA 1RFDH 4NNPL 5E94B 1CGXA 4Z77B 4YEFA 2IBGA 5DGQA 4ZSOB 1JZ7A 5E5MB 3AREA 2MKLC 3BKMH 1RV6X 4LCWB 3CFCL 5JW5A 3RNKA 1BWMA 1RUKH 2J88L 3MUJA 1DLFL 3ZHKA 3D25A 4K7FA 5E95B 1OGAE 5F9OH 5EU6B 3WXVH 4NRXB 4TVPE 3ARBB 3VA6A 1L9MA 3PGFL 4MB5A 4UINL 1MQKH 4P2QB 5CGTA 5GS1A 4N8CL 3RGVC 3WFDL 1IILE 5E2WH 3FQNB 4UT7H 3RU8H 1J8HD 2MCPL 4QGTA 4GG6A 2UWEA 4L4VA 2P45B 4PGDB 2AXFA 1F13A 1NBVH 1T89A 1G7PA 5CBAB 5K59E 4FABL 2EYTB 4YBQD 2WBWB 3QIBA 2AJYL 1F11A 1S7RB 5T1LD 4PRID 3K4ZA 4S10A 4E5XB 4OIAA 1NFKA 4PG2A 1WBZB 4K8RD 3NCCB 1KC5H 4DOHB 3DUSB 1P4LB 3BUTA 2FD6H 2B39A 1A6UL 3NIGE 5GJSH 4GMSL 5ID0A 4TPRH 4RQQB 2XI9A 1DSFH 3TYGH 2QR0A 1TCMA 4LRNH 3ZLQC 3QIUB 2C4FT 2YWZA 2W91A 4XPAL 1XIWD 2AJXH 5D5ME 2GY7B 3HNTH 1G9MH 4PJXA 4NZDA 3KYNA 1EGJA 1PSKL 1AD9A 3UCRA 1INQA 4DVRL 3WLWD 4X98B 3V8CA 3LKRA 4Y16B 3S88H 4G7VL 1WTLA 4Y4KD 5HYJD 4ZFFA 4YUEH 2W9DH 5F93C 2FB4H 3N1GC 4HKZB 4YAQB 5AEAA 3GNMH 4PRHB 1U3HD 4I0PB 4JGMA 4BQCA 1TTGA 1WBYB 1H3PH 2PR4L 1G6RB 3ZTJG 4PB9H 4GAJL 2AJVH 4ERSL 1IFHH 3P4OA 3AXLA 2WUBL 3D1MC 1MHPL 4TULH 1QKZH 4XPBH 3MRJB 4HW6A 4I9WD 3SE8H 1FE8H 32C2B 4YPGA 2Q3AA 2I26N 2ZUYA 3SJVB 4MJID 3LD8C 4GAFB 2DYPB 5I0ZA 5GHWH 2CLRA 1F6AB 1FORH 4LLDB 5E70A 4MZ3A 1A7PL 4LPVA 4I3RH 1RZKL 5C0BB 3MLPA 4JJHA 1WLHA 1FBIL 2VJXA 1AD0B 2VLKB 5E56A 1W8NA 2GJJA 3H9SB 4PJBF 5C0EB 5HHPA 1FP5A 4QEGA 4L8DA 5T33L 1XZ0A 4YDKL 1HXYB 2ZJSL 3CVIH 1OAQL 3OBAA 3EO1A 5B39A 4OCLC 5FDWA 4EN3D 4P48A 1YMHA 2FGZA 4E42A 3ULSB 5DJZA 4WI9A 3RAJH 4PJXE 2A6IB 3BAEL 2R56L 2RBLA 3SJVD 3T2QA 3QJFA 3W0WE 3IDXL 3V7AG 2EDKA 3UTTA 2YPKA 4P2RB 1EO8L 1MHEA 4MAYC 4AT6B 3GMLA 3VXPA 3TCLA 1AE6H 1R3IH 3K8KA 1F5WA 5I1GL 3MLZL 4OGXH 3ULUF 5FA4A 3BI9X 5TH2A 3VGHA 4OZIE 5CIPB 1EDQA 4G8EA 4J3SA 2HAZA 1P5UA 1MFEH 2D0HA 4MDIB 3KXFE 1OSPH 2BOCB 4DOHE 4QRRA 4JPWL 1DVFB 2QL1A 3SPVB 3QHTC 2Y25A 2XWBB 5TH2B 1UQSB 1U95A 1WZ1H 3LEYL 4S2SB 1E4WH 4QT5B 2YK1H 5TF1H 2CMRL 1EJOH 5C0NC 1Q0XL 1PSKH 1R0AL 3SHSA 3CFJA 3GDBA 5D96B 1EXUB 3WKNA 5K9OA 2VO5A 4XWGH 2HJFA 2GAZA 4WUUD 43C9B 3STZB 5KTEH 1KLGB 1U6AL 5IK3B 3SGEI 5L2KE 2MQ0A 4NM8H 1TZHB 4H5SA 2A0LC 2AJVL 1TZGH 2IH1B 4QKXB 2VAAB 3RPKA 1HCVA 5F9DC 2HJKA 3WFHB 3CMOL 3IFNL 4PP1D 3EOTH 3VFUB 2GW5A 4PJBB 4JR9L 5KVGL 5KOMC 4OZ4A 2YD9A 1WT5C 2NY6B 5C0BA 5AWNL 3ZDXF 1A7RL 3GMRB 1U3YA 5I1JH 2F58L 2NNAA 1A3RL 1HHKB 3LRSB 3EJZD 2L7UA 4LIQH 5ENWB 2FX7H 1NAMB 3IU3B 5I1KL 1D6EA 1PZ5A 1J0JA 3RZCA 5KW9H 5CAYB 4N0RA 1F3RB 1OLLA 2PYEE 1I7ZB 1P6AB 3BKCL 2DQIL 3QHZH 1WCBB 1OP3K 1OSZB 3Q48A 4K3EH 2V7HB 4Y5YB 3QJHA 1LNUA 5I1EL 1XGQA 3VFWA 4Q6YA 3WXWL 1JPFB 3AB0B 5KBNC 2Q6WA 4NPYA 4AMKL 4PY7B 1I3RA 4Y0GA 1KPUA 3M1BA 4U1NA 4PRNB 3DX9B 3BYTA 3U79A 5CILH 1N6QH 3ZKNC 4Z5RB 3SGJA 4M7KH 5TDPB 4H1LB 2FIRT 3EYOA 5DVLA 3OG4B 3DRTA 2P48B 4ZFGH 1QPPA 2DQHH 1VENA 5CKGA 1J11A 3VRJA 3E6HA 1CFNB 3ARBD 1RMFL 2DI9A 3QEQB 3S7GA 4OCYH 4RGMB 1HSBA 2APXA 2FJGB 1YA5A 2PTVA 2DQFB 1JYXA 4GJTB 4ZOCA 3W81A 4YFEA 2NXYD 2GEEA 4N5ED 2XN9D 4HXBL 3AMLA 3B5HA 4ZUSA 3P4MA 2AK4B 5IVXA 1TVBA 4UZGA 2X41A 5HDOA 2IBZX 4G9FB 3WFCL 3WS6A 4JDVB 3FFCA 3GB7A 3W2DH 4K7FB 4FTVA 3MROA 4GFTB 4XGZA 1QR1B 1UKTA 3CAFA 1NDMB 5I66A 3OKKA 4M1GL 4UU9B 4IIQB 1YN7B 2NXYC 3BJ91 1JRHH 4J3UA 3IXTB 3I3BA 4TPRL 3QDGB 3O45B 1FFPB 3BX7C 4PJAF 4V1DD 1JBJA 1D5XB 1ZSDB 1QBAA 1TJIL 2NY7H 3UROR 4J6RH 4PJ5D 4LNRA 2Y5TA 5KS9F 1KGCE 1SBBA 1KXTB 1NBYA 3MBEC 2LE9A 2AAVA 1NSNL 5I17B 4LEXH 5C07E 2A83B 2JB5H 1TJHL 3OL2A 5LWYL 3T2NH 1EGJL 3MOAH 4F7MB 1HQRB 3IDJB 4OF6A 3PV6B 1CD8A 4NCDA 4CU7A 1QSFB 4LSUL 2WW8A 3GSQA 5J6HB 3U7WL 3BPCB 3PDGA 5IQ7L 3VXUB 5JUEH 4TUKL 3JSSA 3QWOA 2ICWA 5DDHA 1QUNA 3UZEA 1BJ1H 2W0FB 4XCFL 4G9DB 3VA2C 2Y9RT 4OZGF 4XC3L 3WNLA 4X5XA 3O11A 5AUMB 2ENSA 1XGUB 3PWNA 4XNYL 1C1EL 4HLJA 2D31A 4N9GA 3DYMA 3MJGX 2CRIA 1BAFL 3TBWA 1B4JH 1B0RB 4HS3B 4U6XA 3O9WB 3HS0B 2NY5C 3CSGA 1FJ1A 2FR4A 3VXTB 1FV1A 3CD4A 5ESAA 2DN7A 4LSTH 2HFEA 2D4FA 4UNVA 3TV3L 3IDJA 1WTGT 1ZVSB 2HVKA 3DBXA 4QRPD 1BBJB 5FYJH 4PJ5A 4MA3B 2ATKA 4M00A 4P9HL 3BGMA 3EUUA 4D94A 1JWSB 5M95B 3VXTA 4JO3H 1D5MB 3D3VA 1BZ9A 4RZCA 4KRPC 3T3ME 3M17A 4UILL 5EO0B 5JQ6L 1ZT4B 4NKMA 4X6FA 4X9HA 4PJCE 3QH3B 3L3HB 3IFLH 3UTSD 1OW0A 3QG6A 5F1IA 3MCLH 1WJ3A 5GIRB 1S8DB 2VQ1A 4M4RA 4U33A 4YXHH 3SGKC 1IGCH 2B1HL 5E5RB 4DZBA 5D1XB 5IVZA 4WTZA 1WZMA 4LLYB 3O41B 3IS1X 5HYQB 4BSJA 4DUVA 3H9HA 4KVNH 5EUKB 4KRPD 4PBVC 5ADPH 2NW2B 2YUVA 4NO3B 3CZFA 1T83C 1NAKH 3B5GA 3FL7A 1NCWH 2JE8A 1NJ9B 1VACB 2CK0H 4IMKC 3VWKB 2Q8BL 5GPRA 2IGFL 4OM1L 1A0QH 3IDIA 1A14L 4ZYKB 3L3GB 4GAGL 4N0CD 4Y4KB 4F9LC 5HYJB 3HC0A 5I18L 3GMQB 3SKUD 1RHHB 3PG2A 2DQEL 4PB0L 4CADA 1H3VA 3X3GL 35C8H 2X1OA 4NJ9H 5I17A 1QSEE 3QG7L 4YDVA 3VJ6A 5FO9B 1X5GA 3JV0A 2HKHH 4PJ7A 1HHIB 2XZAL 2Z31A 4HV8A 4XVTH 5EBLB 3E2HC 3O3EB 3WHE1 5E2TL 2FR4B 2EDLA 4XCCH 3RKDD 5J13B 1LE5A 1FFPA 3T0WA 1A7OH 2HYMA 2R0LL 1S78D 2OI9B 1OD9A 1ZA3B 1XGYL 3QUMA 3VXNB 1XR8A 5CZVH 4XC3H 3QO0A 4TUJA 4F8TA 2J8UF 3NZ8A 3PDOB 5JLZB 4WW1B 4OD1H 3ARZA 1U8KB 1RZ7L 3E2HB 4M1DL 4P5MB 1IGFH 2DTSA 1CFSB 4URTB 2ZNXA 1P4BL 1TVBB 4QNPF 5DEZA 3QWOB 1OAXL 5GRVK 4BUGA 3CFBB 4M6NL 1AXSB 5D8JH 3GSQB 5J6HA 4L9LA 3K0WA 1UT9A 5HHXL 2CLVA 1MRDH 4XNUH 1DANT 4HWBL 3RI5K 1VESA 4APQB 2QV2A 2NXZD 4HUUB 3FO1A 2NYYD 5INCB 4GMSH 4M3KB 4D0DA 3S4SA 1NBQA 1U41A 2VR4A 3MJ7B 4L4VD 1P9MA 3GUTB 1YN6A 5DHVB 5DFVC 5DO2D 5GZND 4BZYA 3MRRB 5LKNA 5EB9A 5DZNA 2YPVL 1T1ZB 5C0DB 5I19H 3NACH 4MWFA 1LNUB 2G2RA 3C9NA 5F70A 3ARFA 2BK8A 5CJOH 2CO6B 2DIBA 3QIBC 1HXMA 2V7HA 3EAKA 2M26A 1RZJL 1B6UA 3CLEH 1WCBA 5GGRY 3MRHA 4BFBD 5C09B 43C9A 1INEL 3EGSA 4LCCA 3PL6B 3RY5A 5KZCB 1C5DB 4PRHD 3T2PA 2I9TA 3EJZC 3ARBC 1ZA6B 1F8TH 1DP0A 3TIDA 1BZ7B 3ULVC 4PB0H 3MRNB 4U7KA 3GJFA 3QWQB 3DMMB 5B21A 4KQ4L 4PV9B 2JCCE 3BVNB 2YA0A 3E6HB 4HIHB 3HR6A 1G9NL 1S7WA 1QKZL 1KNOB 5INDA 3HMXH 5SX4H 1XF3B 1OP5H 2BXZA 4LPWA 1HYSD 5MEQA 3U6RA 4AQOA 1RJZA 3WXWH 3T65B 1X6NA 4QHUA 3WS3B 2YD3A 5JW4N 1I7RA 4O58H 4ZXBD 2VAAA 2HTKC 3LD8B 2YXFA 5ADOL 5B8CC 4M7JL 5L8KB 2AJUL 5HI5C 3DIFA 5ANME 1A6TA 1MH5B 4KV5F 3HZKB 3MMEA 1RZFL 1YEEH 2R9HC 4LDLB 1OB1A 3RIAK 4ZUTA 2HRPH 2I60L 1SYSB 1MIMH 3KPRB 3ROLA 1P1ZB 3RWJA 4F33A 5CFHA 5MENA 2CKBH 3F12B 4XVSH 1KB9J 2ICWI 4P2QD 2FCBA 2LU3A 1RUAH 1T1YA 5T5FH 4S0TD 4G80B 2H26B 5CEZD 3F7YA 2X40A 1A1OB 1JPSH 4G8GE 4FA8A 1I8MA 3MR9B 4ODWB 1DBKL 3VI4F 3QHFH 2NTSP 3ULUL 1JFQH 4GXVH 2F19H 4LLQB 5H37G 1TIUA 3EZJB 4TOYL 4QLRA 4NQVA 3QXVA 4E0RA 3T0ED 1F6AA 3GGWA 4WFGD 5GXBB 2UVEA 5D6DC 2MQCA 3BKYL 2H9GB 4I18B 3MRBB 4KVCL 4YJZL 1EHXA 2BCKB 2X4UA 2MPAL 3BD5A 1BZ7A 4WJ5A 3UTTE 2ESVE 4GRMB 1Z0MA 5D6CB 2IANA 4LBEA 5E00A 2IH1A 2VERN 4MSWA 3UBXA 1QFWI 2F54A 1ADQA 2F53D 5FYKU 3WL9B 1Y0LB 4ETQA 1YEJH 4MQXC 4I0PA 3T3MF 4CMMA 2FJHB 4JY4B 4UOW0 2EDQA 5H35B 4XVJH 5GGSA 3BEWA 1EV2E 1WICA 4ETYA 1NCUA 3EYQD 1A5FH 4B53A 4CW1B 1N2RB 1SY6A 4OUUB 3VWKD 5ESVB 3FN0L 5B3NA 2IQ9L 4M62H 4W68A 4XBEL 3WDJA 4PJDF 1IC4L 2BRRL 2OL3H 1LO3L 3GGWB 2CLRB 1MFBL 4ZNEE 2YD5A 4NN5B 3E6FB 3I50H 3QDME 2OJEA 1MAMH 3FAXA 3BGAA 3LN5A 3BUYB 4QHNB 3G5YA 3SQOH 3PJSB 2X89D 4XCYB 1U8HA 1F11B 3P9LA 2A6JB 5HYFA 3GRWH 1A2YB 4G80A 4I5BB 4Z76A 4GRLD 2W9EH 2V5SA 4X9BA 3CH1B 4M7JH 4MS8C 2X1WL 1A3RH 3Q6FB 4Z7WB 2F8XC 4U3HA 2J5LC 2LAAA 1NKOA 3D9AL 4YC2C 3TF7C 5KVFH 1FPTH 3WE6B 1JGEB 1G7LA 3UXFA 2OR7A 4L1DA 2BFVL 4GRWB 2YRLA 4DKFL 4S0SD 1WIPA 4X4YA 2VH5H 1ZHNA 3NGBC 1VFAB 4LVEA 1AD9B 4YNYA 2YZ1A 1T04A 2VDLH 3NIGF 4OLZL 2H2SD 1LGVA 1AGEA 3QRFM 4KMQA 3UBXI 4FG6C 3O6KH 1A3QA 3WS3A 4X6EB 1FNGA 1F3DH 3BZ4B 1R3HB 5E6ZA 2VZVA 2VLKD 5ACLA 4FMFA 2NY2D 1G9NC 1MF2H 3V0VA 1BM3L 4GRWF 1WBXA 1JN6A 1E27B 3O3DB 2NY1D 4AMKH 1P2CA 3T3PF 4OKDA 5IG7B 2KQMA 4H25B 3BH9B 5IWLA 4OLXH 1F3JA 2H41A 1L0XA 5HDQL 3SCMC 5DSCA 4I2XA 2A77L 3BKJH 4P3DA 4RX4A 2HLFC 3LKQA 3HB3D 1DN0A 1LO4L 3HR5B 1X6LA 2P43B 1AGBB 3ARBA 1WBYA 4J3VA 2EYSA 1KG0A 4MJ6A 4WHDA 4DVRH 2OR9H 3MRPA 5ISZB 5LG1A 4I0PD 1AGEB 4NQDB 4OIIL 3T1FB 3B9KD 4KZEH 5DJDA 4EI5D 4Y1AB 1FLRL 5FHAL 1Q9WA 4BSWB 4QRUB 1FFNA 3WJJA 3UC0H 2VZSA 5CEXA 3IVKA 1UYWH 2A1WL 1S3KL 1A7BA 4XAWL 3V52L 5FM5O 3QCVL 4O2FB 3Q6FA 5T3XD 4JKMA 4LCWD 1KIPB 4ZODA 4HK0B 4TN9A 2W60B 1T5WB 2Z8RA 1QHOA 5CSGA 3QEGH 2G75A 5D4QA 3P9LB 2FECL 5DYOA 3CX5K 3FT2A 1IBGH 2OM5A 5GS0C 2ADIB 5JHDE 1FZJB 2BP3A 4NKQB 1GZPA 3G5YB 5IQ7H 1RZKH 4UV7H 3SDYH 4CRPA 2X05A 4C4KT 5ALCH 1HHGA 3UTPE 3REVB 4JY5H 5GQBA 4OZHE 4YHKH 1HIMH 2IAMC 5CMAA 5BS0D 1AHWB 3TT3L 4K8RH 1TITA 4XVUC 2J2ZA 4X7EC 4AENB 1JV5B 5HHXH 4XMPL 2ESVA 2NY3B 4N0CC 4LSUH 4KJWC 5CLWA 1U91B 4JKWA 4NQDA 1KB5L 1JGVH 1M7DA 1RUQL 2YBRB 3RNKB 3ZE2E 3PWUB 1EFXB 4QTIL 3AREB 4V2BA 2LVCA 2ZUUA 1A9EB 1V7NH 2EDXA 1QFWL 5BZWB 1BZQK 2YD7A 3VFGH 5C08D 1UJ3A 1BQLL 2YXMA 5E4EB 3IFPA 1JGUH 5EBLA 5D7IF 2EDDA 1A6AA 1DQMH 3L6FA 3PP3K 4P9HH 1Z9OA 1QSFA 1EHAA 1ES0A 2XIDA 5DHXB 4HWNA 3QIWA 4MD0A 1T2QH 3RU8L 1QNZH 5KSBA 1PVHA 2A83A 5F7WC 2Y6SD 3CDYA 5K9KA 4XI5D 4LU5L 5HJ3B 2JIXD 3BE1L 3SQBA 4K94C 3L3KB 5F7KC 3X3FH 4L3CA 4JFHE 1JHTA 2GJ6B 2ADJA 4IS6A 5MP6H 4V1DB 4F15B 1VADB 4D0BA 3WFDH 2VDQL 4L8CA 2FZ3B 4GH7B 1ZT7A 4XPFL 3MNZB 5ISZE 4F33B 3W9DA 5IFHL 4UV4L 3WE6A 5CD3B 1Y18A 1HH9B 4JFED 3HAEB 1YNLL 3FTGA 3VXMD 3ULUD 4ACPA 2GY5A 1T7ZA 1FYTD 1Q9LA 5HHMB 5LJYH 1T1XA 1MCEA 4P49A 4DTGH 4BQ6A 5ADOH 2ZWLT 3TYFA 3VXQA 3P30H 1HSBB 5BOZG 4KTDH 3BWAB 2IFGA 5E2WL 5J4MA 2E7LA 2EH8H 4KI5D 1BJ8A 1CVSC 1EEYA 4HWZB 3MRGA 4Y1AD 5B39G 2B8OT 3CUPB 4JFFE 5BO1L 2FX7L 4R0LC 4J12A 1FORL 4RX4D 4HPYL 4I3RL 1CQKA 3U83A 4YBQC 4I3SL 1H9VA 4NO2B 2NLJA 5EOCJ 4BZ1L 4LHUB 5GSVA 1GZQA 2AEQH 2D9QB 2Q6WB 1EVUA 3ZSSA 3MRIB 4U2YA 1KLUA 1KN4H 4PRPA 6FABL 1R5WB 1H8SA 3BH8B 3UEZA 4X5XB 2APBA 4PGBB 4MAUH 3DXAB 5L2KB 1VFBB 5BMFL 4YO0B 1HWHB 5IHLB 5DMKA 2D4DA 1P5VA 4A2LA 4PD4K 2OX5A 3MJ8A 4APQC 1OTSC 2Q76B 4GBXC 2XPGB 3ILQC 4GKNB 4HS8L 3RWIA 4ONFH 2OTUA 1HN1A 3OTTA 1LO2H 2I9LB 4RFOH 2ZOLB 1N8ZA 1W0VA 3TNMA 5IFJB 4K7PH 3OKMB 1RK1B 4C56A 4K3DH 2K9UA 4KY1H 2YN5A 3WJLA 5TE7H 2VDML 2HT2D 5BXFB 2BNQD 2QQKH 3FQRB 2H26A 5DUML 3MV9D 4PJBA 2DL2A 2Q8AL 3O6FB 5I0DA 3UO1H 3SY0A 3T8XB 4Y19A 3MRFA 1FHGA 5DWUH 4LLUB 3RNQB 4ODVH 4NN7B 3DXAA 4QY8B 2RFXB 3CU1A 2VXVL 4XXCC 1EZVY 4R2GB 4JQXA 3D0VA 3ARQA 4PJEE 3ZE1F 1BVKA 5F1NB 3RNQA 4ZUSB 2EDWA 2NLJB 1Q94B 1TETL 2B5IC 3KPNA 3QFJB 3WNOA 4DTGL 1X7QA 1TFHA 3T65A 3OZ9H 1QD0A 1J0IA 1B6DA 1K2DA 2UUDH 4K2UH 3WHXB 5INDB 3QEHB 1IGTB 4FTVE 1I1YA 1JTPA 4Y5XC 4JFQB 1R5IB 2PW2A 4PLKD 4WW2C 5L6YH 3MREA 4YQXL 3N1PC 2X4SB 4K3JL 1YEGL 1I1YB 3Q2CA 3ARTA 5KVGH 4B41A 1FH5L 4JREC 4WGVB 3B4NA 4KK5D 4NHUB 5T5NF 1MRFH 3T04D 2DKUA 4LDEB 4OTXL 1NCCH 1ORSB 4KPHH 5I1HH 1IL1B 4ZOBA 1YY8A 3BO8A 5FKPA 4XXDB 5F6IB 2EDEA 5JW4M 3DV4A 4OGAD 3MYZA 1ZEAL 2JIXA 2ICWJ 1TJGH 2W07A 1NANH 4O58L 2MQ3A 4HUNB 2ITDB 4JO4L 5LXGL 4MXWH 3IS0X 1I7ZA 1WAAE 2V2WA 5ICXA 4MNGB 5BRZB 3ROOB 4YBLB 3WD5L 3WDHA 2I5YH 4QO1A 3EO1B 3MRRA 5I1CL 3KYAA 3QRGH 5GGVH 1QZ1A 4I0CC 1H8OA 3P9MA 5ENWA 3KPOA 1T22A 2C3GA 4O5LL 3MUHL 3LRSA 4WI7A 2OR9L 3QI9D 4EDWH 4R2GC 1TZGL 3BPNC 4LLAA 3CU7A 1NLBH 4CAGA 4W6WB 4JM2D