5H2BA

Structure of a novel antibody g196
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
216
structure length
216
Chain Sequence
QVKLQESGAELVKPGASVKLSCKASGYTFTNYWMHWVKLRPGQGFEWIGEINPSNGGSNYNEKFKRKATLTVDKSSSTAYMQLSSLTSEDSAVFYCSIWDSYFDYWGQGTTLTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords G196 antibody Heavy chain
publication title G196 epitope tag system: a novel monoclonal antibody, G196, recognizes the small, soluble peptide DLVPR with high affinity.
pubmed doi rcsb
molecule tags Immune system
total genus 39
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2016-10-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5h2bA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5h2bA02
4GXUM 3SKUD 4LMQI 5KW9H 3DX6B 2O5YL 5D1QD 3KXFA 1CI5A 3NCJL 1LP9B 5FUZH 5KSBA 2HFFA 3FQUB 5DXWA 1WIOA 4DZ8B 4N90E 1S8DA 4XWGH 1YJDC 3RIFK 1Q9KA 3I02B 1H3GA 4FQCL 1B4JL 2VABB 4KKBD 4OV5A 4U6YA 4GMSL 3GMNB 4TULH 3A67L 5CAYB 5CJQH 1OB1B 1HHGA 5LQBH 5AYQA 3QUKB 5A40E 4CN1A 1LVEA 1WWBX 5I18H 4OKVA 3V6FB 1JWMA 4RSVA 1RURL 4N0UA 4LHUG 3W9EB 1ZHNA 2EEBA 1G0YR 5GGTH 4GG8B 2G75B 4XI5D 4P2RA 1F4WH 3GSXB 1YMME 1F4XL 3Q1SL 1EHLH 3ES6B 2DMCA 4F2MB 1N5AA 3NA4A 4X4MA 3OKNA 3S6CA 3GSOB 3OX8B 1FV1B 1WIUA 4WO4D 1QFUH 4FQXB 2ADJB 2NX5E 4NDMB 4PJXB 3SE4A 3QG6B 4MQSB 3S88H 1UVQA 4U3XA 2OR9L 4DFIA 2IGFH 4IOFC 3E3QE 1U8NA 3SKNA 4QRTB 1JRHL 3IAPA 5EIIA 2VR4A 4JJHA 3WXVL 1G7JB 3TF7C 4LPUA 5JIHA 4OD2B 4I3RL 1EXUA 4AL8L 4MAUH 3BIBX 5EU7E 1JGDA 1RVFH 1W0VA 5C0BB 4N0YH 1U8IB 1U3JA 4Q6IB 5DJCB 3PWNB 3KWWB 4FQLL 3MRQA 4YDKH 3ARPA 1YQVH 1R5VB 2WWMC 4ODTL 4PRIB 1PFCA 4UU9A 2RHEA 1BIIA 1BJ1J 4NKIL 1P6FA 4I3SH 4ZFFA 4XPAH 1S7SA 1CZ8H 3CC5A 1T1XB 1E6OH 2D0FA 3NCYS 4M93C 3D18A 3KGRA 5IROA 1MLBA 4XP4H 4D0BB 2RAMA 5E2TL 3MTRA 2YKLH 5E8NA 5D1ZA 3F58L 4RMTA 2GSGA 5D6DC 2F54A 2P5EA 3B4NA 4IMLB 5B4MC 3MV7E 3QEQE 4D3CL 4UV7L 3WDIA 1TJIH 3X14B 4NNYA 4WRLA 3ULUE 4NQEA 3RVWC 1BFOB 2FB4L 2GSIA 4RMUA 5I1IL 4K7PL 2BNQB 1LD9B 1AGBA 1HNGA 3W2DH 3P9MA 1QEWA 3O81A 3BPNC 2PW2B 4KKLD 1DBBL 3MRJA 5BS0B 1HI6B 3NMEA 3GBNH 5DMKA 2F5AH 4F7TA 2NTFB 2BOCB 3MV8B 5HVHC 3MQIA 5IV2A 1OAYH 5JW4M 2OP4L 1I7TB 2XI9A 3MPCA 4JPKL 4L1HA 3TIEB 3ZMRA 5I76B 2KQNA 2E27L 5A1AA 3QIWB 1FRGH 5IMKB 4NOBA 2AJVL 4PJFA 4ZNEE 2A1WH 1TPXC 3PWVA 2VC2H 4J7RA 4N68A 1YEFL 4AH2A 1X9QA 1XF1A 1R5WB 1T04A 4PG2C 4DZBA 4LARL 5EC1A 2R1WA 1QG3A 1FO0B 4PJ7E 2UY6A 3V6ZB 1VEOA 3DYOA 32C2B 5TF1H 3FAWA 1FNEA 1RI8A 3MA9L 5CEZL 4WFHE 1LEGA 2NY5H 1K6QL 4XNXH 3UJJH 3BJ91 5HDQH 4FA8A 1AE6L 1I85A 1KN4L 1RJLA 2YHGA 3S8WA 4Q9QL 3QWOA 2NY1B 3UROR 4JHZA 2DBLH 2YD8A 1L0YA 2NTSP 3UJIL 1EAJA 2EC9T 4Z7OE 4YDVB 5SX5K 4HUXA 3V79C 1UWEL 3OL2A 5J6GA 1BBDH 1KIPA 1F6AA 1I1AD 1VKXB 2YPLE 3BT2L 2AEIT 3RWHA 4PJGF 1YEGH 1A9BA 1J88A 1IBGL 5IHUH 1C08B 2YZ1A 2XTJB 1XF3B 3GIVB 1OAXL 3KPPA 3V4PH 5A16A 2B0SL 4KY1L 3ELAT 1QFWM 1YJDH 5CHNB 5D6CA 5C0AD 3EDFA 5E7FA 1I3UA 1VACA 4JM4L 3UP1A 1AKJB 4FTVB 4LLYB 3MLVH 4XTRD 3C6LA 5DJ0B 5C8JA 2VN7A 5JPNA 4M7KH 1BQLL 3AM8C 1KTLA 1A3LH 4XBEH 1BGXL 1EBPA 1BVKB 4LFHG 2HJLA 5KS9F 2JTDA 4M4RA 2BY0A 3R06A 5FGBC 2Y5TA 5IR1A 1U8JB 1MJ7H 2GITA 2A9ML 4MDJA 3VG9B 4XPTL 1KPRA 2C4FT 3K8MA 1HXYB 4JFHE 3I75A 4DN4H 1GPOL 3J8F7 5IFHL 5T1KA 4X7CC 2UWEF 3JWOL 2XWJA 5FGSA 2IADB 3VFTA 5KSAA 4U1KA 1MREH 1JFQH 2E3VA 3ZYOA 3QXAB 4DKEL 5JOPD 3MNWA 4Y4HD 4P4KA 1KELL 4XVSH 2OR7A 4H26A 3WO4B 5EZLB 1XF4B 1A02N 1CD8A 4L8CB 2LE9A 1ACYH 4H0HB 2HLAB 2X70B 3L5WA 2IQAA 3KPQA 4R2GB 2OZ4A 1DQLL 2VISB 3VRJA 1R24B 5HYEA 2WBKA 2XRAH 3W5NA 1OP9A 2X1PA 1XCTA 1EDQA 4GQ9H 5EBMA 1CICB 4Z78B 2ARJA 3IXTB 4XNYH 4YXLL 4M5YL 1U93B 5HHOA 1F4YL 4LSPH 4X6DB 3UTTD 4JVWA 4JVPA 2D7QA 5T33L 2BVUA 4PJGE 3DHMA 4JFOA 3RIFF 4M1DL 4JY5H 3EIFA 4XVJL 1AC0A 2V9TA 4DVRL 1PDKA 5BV7C 2X09A 1EGJH 4QHLB 3V52L 3SCMB 4LF3B 2NY6B 4WTZG 1QTYT 3EUUA 3MLXH 2RJMA 4HUVB 4L29A 2NX5B 4MLSA 4LGRB 2DAVA 5C07B 4U1LB 1UXWB 4Y2OA 4G8EB 4WUKL 1PY4A 4YIQA 5JNYB 5I30H 3MRCA 5E7BA 5DJAA 4L3CA 3DTXA 5HYSA 3NH7L 1WSST 3LKSB 4FABH 1MWAB 2NYYC 4LLDB 3FO1A 5JXEA 3IGAB 3ILPA 3MBXL 4N9GB 2H45A 4AG4L 1RAMA 1HEZB 4N8VG 2J8UA 3BGMB 4F7CA 3Q3GB 3BMVA 2J2ZA 5AUMA 3B9KB 4GRLD 4KUCF 1OLZA 1TNNA 1BBJB 3RL1A 4BA8A 5DVOA 4RX4A 4QXUL 1HHKA 3HFML 2P48B 1LK2B 5IJKC 1DN0A 3IFLL 1U3HD 4OIAA 4JFXB 4QRSB 1VEMA 5L2KA 1RIVH 3FT4A 4FXKA 3IJHA 2XKNA 3SE3C 3FQNA 5MEQB 4XRCB 1AH1A 1Z3GH 1KEMH 1NGXA 4EOWH 4K8RD 4L9LA 2AK1L 4I9WE 4WI7A 3TYFA 3WDJA 1YY8B 4ZDHB 4R8WL 4HMEA 3MV7B 3UCRA 3QEQB 2IJ0C 4GBXB 1A7RL 3SGJA 2VLMD 4K7PX 1D5BA 3FOMA 5F1KC 3CFBB 4UOW1 1GGCH 3IDJA 3N9GH 2BDNL 1GGTA 4YHML 5J13C 5L8LB 3MLRH 1OPGL 1K4DA 2Z8SA 3LQAC 5I1HL 2PO6A 3BXNB 1DEDA 1A6VL 3REWA 4W6WB 3W0WB 5L8KB 1X4ZA 3P40A 5AAMA 1RK0B 3D85A 5ADPL 1NAKL 2AKRB 1EIBA 1MCRA 3DXAD 4UQ3A 2BZDA 2WP3T 3OZ9H 5AD0B 3DV6A 3BH9B 2N7BA 3GJFB 1A22B 1CYGA 5ADOH 1IFHL 3NGBB 2DQFA 4PGEB 4PLKC 1I1CA 1RUPL 2ZG1A 4OIBA 3MRMA 4NCDA 2DLTA 4DGIL 4G8IA 1UACL 1F3DJ 4MD0A 4HV8A 3OKOA 5FDYA 2A74A 3STLA 1EHNA 3KLAB 3BW9A 4MD5B 4PJ7B 4HS8L 5EOTA 1N8ZA 3HMWL 4LOUC 2FSEA 3HRZB 3STZA 4JO4L 4U49A 2HFEB 2B1AL 5BZWA 3GBMH 2H8PA 4R0LA 2DJ4A 3BO8B 3UO1H 1NBZB 3D48R 3KR3L 5IWLC 1MJUL 1MRCL 5FYLE 4Z0XB 3QQNA 5DVLA 2N56A 5DJ2A 5TDNB 1C5CL 1RJCA 3UTPD 1AQKH 5KW9L 3G08B 3MJ9H 1G7QA 1OAKL 3EOBA 2OYPA 4KI5C 5FUZL 3EKCA 4GKNB 1DUYA 2FJGB 1NFIB 2JCCE 5E1AA 3KPSD 3GSRA 5DTFA 1PKQE 3AMLA 3KYAA 4R4FH 4ALAL 4C55A 1HHIA 1UM4H 3M17B 4F9PA 5IHZA 8CGTA 5BRZE 1Z5LB 4G8GB 3H7LA 3IRZA 4M9PA 4AT6B 4RZCA 3QDJA 4M7LL 3RHWF 2JJTA 1JHTA 4MA3B 2ZCLH 3NCEB 4TULL 2OSLB 5CJQL 2HJFA 3T0WA 5A2FA 2OTPA 3G6JA 2P5WD 3K74B 5I18L 1JN6B 5D7JC 2EE9A 4LQFH 3MRDB 4PV8A 5DK0B 2D4FA 1MIMH 1NKRA 1I1FA 1U8LA 2R0WH 4O58H 4Z7NE 2ADFH 2CDFB 5GGTL 4AIZA 5HYQB 1F4WL 1QKZH 4XC1L 1IAIH 4HUNB 1DBJL 1OD9A 1KIRA 1NFDF 3VGDA 4YBLB 3KYMB 2R1XB 4K9EC 3HA0A 5ENWB 5L0QC 3UDWC 4QF1B 5I19L 4N9OB 5FO8B 3S88L 5JO5A 3ARDA 4LDLB 2X2YA 4E42A 4OAWA 2IGFL 3O6KH 3DYPA 5ESVA 5CBAA 3ZKXB 1TTFA 4JFFA 4IHOB 3DPBA 5GGSB 4HSQA 5HD8C 3P0YL 1C12A 3FTGB 5F7FA 1J5OH 3CSYB 4MAUL 1QRKA 1KJ2B 3MGTB 3BUTA 1P7HL 4JJ5A 1RVFL 1GOGA 4LPYA 3OKLB 4N0YL 2FD6H 1N6VA 3RWGA 3UTSE 5GZNC 2B2XL 4P9MH 1I9RH 4YDKL 4R9HA 1YQVL 2JB5L 3C87A 3O9WB 4LP4A 4MNGA 4NRXA 5KAQG 2EDRA 4L8DB 3BQUB 5FOBB 4IOIB 1A6TB 5HGAB 2G2RA 4K94H 4XBPA 4XPAL 3P73B 2Z31B 4BUGA 3BGFC 1XEDA 4XP4L 1KB5H 4BJLA 2YKLL 3GSUB 4GJTB 1C5DB 3BIAX 1T5XB 2EDNA 3G5VB 1KCUL 1FZOB 5EUKA 4LHUA 2VXVH 2R4SH 3C5SA 3MV9E 3ZKQD 4CKVX 1S7XA 1TJIL 3PJSB 3GSQA 5JDJA 4OTXH 2EDDA 1JGEA 4Z8FH 5C0BD 1II4E 3WXWH 3MFGB 3CZJA 2X4NA 3O4OB 4ZO9A 4MGXA 5IVOA 3LKPB 4MAYB 5ID1A 4LEOB 3AREB 3K2UH 5D72H 1HILB 4PRID 1I7UA 4K3HA 3TJEL 5HGHA 5TE6H 4NJ9H 5HJ3B 3EYSH 3BDYH 4JM2B 1HH6B 3GI8H 5F3HB 2AS5M 2EO9A 3SGDH 3TBVB 3FFDA 4BH7B 4PG9A 3FAXA 4A2LA 1A4KB 1V7NH 3QCUH 2NY2C 4ZSOA 2FH8A 3LQZA 1RFDL 1VGKB 3DUSB 1NMCB 2Z35A 1P7QD 3S97C 3QDMB 1FRGL 5DSCB 2ORBH 4KDTA 2A1WL 3LQAH 5GPRA 2VC2L 4YDLC 1KLUA 5D2LA 4N1CA 2YN5A 5E8OB 3RGVB 4HBCH 4K55A 4JRYA 4YNYB 3RJQB 3ALWA 4WU5A 5IMMA 4PJCF 2PW1A 3HPLA 4EXKA 4AYFA 1XGPA 4KK5C 5LGHH 3ZT7A 1S7QB 1S9VB 1YNTA 3T4YA 4XAKE 2BNQD 4WEBL 2Y5EA 2I27N 5MEPB 2NXYC 3T0VA 2NR6D 3DUUB 3VGHA 4XNXL 3UJJL 2BSSA 1FSKB 3F62A 4Y5VC 5HDQL 3PIQA 4NO0B 1JZ6A 5KSBE 3QPXH 3IKCB 4KKAD 3MV8D 3TN0B 4I2XE 1GIGH 3IDIA 4NQCB 5B38G 3RNKA 2DBLL 2DQJH 3U82B 3FCTA 3QIWD 3QQ9C 1EVUA 4R3SB 4RAVA 3VGAC 2APFA 3JTTA 2YD3A 2G5BA 4GRWB 1S9XA 1N3NB 3D2UA 5FDWA 2BSRA 1VADA 2HT3C 3I6GB 4HEPG 2ADIA 3VFOA 3MUHL 1BBDL 2MCPL 2PF6A 3OKMB 3LDBB 3O41B 4ODBD 1LNUA 1YEGL 1RUQH 4EI5B 1B9ZA 3FQXB 2FZ3A 4N0UE 5IHUL 2HN7B 4HIJA 5ECJE 1MFCH 5J9PA 1T2QH 5DHVH 2FJHB 4P2RE 4XB7A 3HZYA 1YJDL 5H37H 4G9FB 3KPMA 4KTEH 4Z7UE 5TGBA 3SOBH 2NY1D 1D9KA 4LCUA 2CLVB 3VFPB 5ITFA 3MLVL 1FLTX 2KL6A 2L7JA 1T0MA 2MHAA 3EDDA 3OHXA 3O2VH 3AS1A 4K23L 3H9SA 1A3LL 3CX5K 3HMXH 1LP9F 2W59A 4M61A 5F88A 2RFXB 3MACL 3VJ6A 2Z4QA 3PABA 3WN5A 1HSBB 3MROB 3PWLA 4MB4A 1JF1B 1E4XI 3K0WA 3SE8H 5F7MC 2XTJD 3VXMB 4F9LC 3MRLB 1PQZB 4PYHA 1R3HA 4CAGA 1PKOA 4RFEB 3MLZL 4DGVH 1MREL 1JFQL 5K9OB 2JCCB 1N6QL 4P46D 2GJJA 2R9HD 2RB8A 1QBBA 4O51A 5IEKB 4XVSL 4K9EH 3LCYA 4JFPB 1PKQB 4FTVD 4PRHE 5KOMC 43C9B 5I1CH 2F53A 3FQRA 4Y8AA 5BRZB 2WWKO 1ACYL 2YRZA 4EI6A 5HSFA 5HYJA 1JYVA 3QDAA 2XPGB 1JNNL 5IBUG 2GK2A 2XRAL 5F9JA 3SDAC 4UBDC 2FATH 4OLXL 4ISVB 1FL3A 1IM3A 2DQEH 4GQ9L 2ZUYA 3EYVA 1U8HA 3UTQA 2F54E 4XNYL 3QUXB 3LKOA 2GJZB 4P59L 4EJ1C 4MQXC 1RULH 4LSPL 1VPOH 4OQTH 5KG9A 4WW2C 4CUCA 3C9NA 2Q8AL 4CMHC 4JY5L 4EUPH 3S35H 5ALBH 4N90D 1ADQH 3VDBA 3AFLA 1F11B 3RAJL 5GRVK 3JV5A 3VXSA 1K5NB 1EGJL 2AJXL 2W0FA 3HC0A 1JHKL 2O61B 3RL2A 1KJVB 1E28A 4R2GD 3BZEA 1CFSA 3BISA 2I9TB 2C1PB 2F5BH 4JAMB 4ODUA 1MY5A 4X5WA 3O8XC 5I30L 5ICZA 5FO7B 1GHFL 1ERNA 2BSED 5DEFA 1EJOH 1CICD 2VDLH 3DROB 2AERT 3ARBB 4TNWF 2HMIC 1BEYH 5HHXH 4LKCA 5C09A 2V7HA 3ARGC 4X6BB 4K7FB 5J1TC 4J4PD 1F97A 1ZHBB 1NLDL 4XVUD 1NC4D 2XQBH 1YMMD 1M7DA 3UTSB 1CFTA 1RJZA 1T4KA 2YD9A 2IG2H 3GJFK 3MCLH 1MCCA 3O6ML 3SCMD 3V7AG 2WBJA 2NY6D 1L7TH 3H7BB 5T3ZH 3GSVA 4OZ4B 2NX5D 3OF6A 3T77B 4NNXB 5I2IB 5LGJB 5I74B 1B6UA 1RIVL 1SM3L 3OXSB 2JKXA 3Q6FB 1Z3GL 3RKDD 1KEML 1LDSA 1QOKA 1X5LA 4EOWL 4P4RB 4DEPC 1JVKA 5IGXH 5D7IF 1KTDA 5MEOA 4FFWC 5EG6C 2YSSA 4NKMA 1IKNC 1G9EA 5J8OA 3GSWA 1TZHA 2XN9E 1I4FB 3BZ4B 4ENEC 2X5PA 5C0CA 3T0EA 1DE4B 2GTZA 5CBEA 2ZSVA 4HMDA 4KZEL 3N9GL 4MNQE 1K2DA 3B9KD 4RFNB 1I8LA 4IIQB 5E0QA 3ZHKA 1KC5H 5DJ8B 5F8RC 3FFCA 4Y5YB 2YWYA 3BAEH 3B5HA 5C71A 3HE6B 5AWNL 1FC2D 4F37F 3T2QA 1VESA 2WIIB 4WTZA 5CEXB 3O8XD 4GLRI 3OZ9L 2FGZA 3PP3K 4QRQA 3LN4A 4P2QE 4XCEA 4JZNB 3SEPA 2VLJA 5ADOL 5JUEH 2V7NA 5F7DA 4JZJB 4DW2L 4UAOC 5EN2B 4APQC 3CFKA 5T1MB 1Z9MA 2V2XA 1TZIA 4O2CB 3MV7D 1XIWB 3RWFB 3QEQD 3N0PB 4CDGC 3NFPA 4N8VA 4Z76B 3WNKA 2PTTA 5CD5D 2N7AA 1EEUA 3ULUD 3QH3A 4MXQD 1DSFH 2GJ6A 3EZ8A 2IAMC 2VKXA 2X4TA 4LCYA 3GBML 3W0WD 4WTWA 3MUY1 2C3WA 4Z0BH 5E9DE 1NLBH 3KXFB 4ELKA 5J57B 5KSBB 2PR4H 2HFFB 3AU1A 3VWKA 1KCLA 2GCYA 2VH5H 1S8DB 5GXBB 4XCCH 1AQKL 5T3XE 1Q9KB 1GOHA 1OAQH 1EA9C 2DQTH 1DFBL 1N4XL 4XCNA 4OV5B 4F3FA 3WNOA 2BFVH 2FJFA 4PBVC 4U6YB 2CH8A 4YC2C 2ZUXA 4R4FL 2E9JA 5HTSA 5DHXB 4U6TA 1SEQH 4G6ML 1QR4A 1HHGB 2UZYB 3V8OA 4OKVB 3VH8G 4WFHD 1JWMB 7CGTA 5HHOE 1T83A 4DOHE 4N0UB 3EHBC 4HGKC 1ZHNB 3Q5YA 4Q2ZA 1QBLH 1LO3H 4NQSA 4P2RB 3RZCA 5IEHA 1W8OA 3GRWH 1UKTA 4O58L 2ADFL 1BZ9A 4XCYA 2Y4SA 4LNVA 5B3NA 1N5AB 2W07A 3OKNB 1IAIL 2E6JA 1FGNL 5HVWA 4H8WL 4H1LH 1A4JA 1WF5A 4HUUA 1UVQB 1CDHA 4PBXA 1U8NB 3SKNB 1CDGA 2BOBA 2AQ1A 2YPLD 4OGAD 5DUMH 5B39G 1IAKA 1OWWA 3JWNC 4R4BA 1AY1H 5EIIB 2ADGA 3O6KL 1CGTA 4I0CC 1EXUB 4P3CH 4Z7WA 2VR9A 1XR9A 1ZGLA 1JGDB 2WQRA 1W0VB 3ZO0A 1J5OL 3GHBH 2VDOH 3MRQB 4M7ZC 1CBVH 4UU9B 2FD6L 2R23A 1BIIB 4OZIA 1JMZA 4IRZL 4ZFFB 4KFZC 1S7SB 4M4PA 3ZL4H 3CC5B 5L2KE 1PJ9A 4M6ML 3DX9A 3SBWC 1WWCA 4WFGD 1IGML 2AEQH 3BHBA 3D18B 2A83A 1MLBB 2JF1A 4IOSD 5IF0A 4K94L 2FO4A 5D1ZB 5E8NB 3RUGA 1W0YT 2BMKA 5ERWA 2GSGB 2F54B 2P5EB 4NBZB 1B0WA 4ZUSA 4P3WA 4JFHD 1KB5L 1Y6MR 3V7MA 1SYSA 4NNYB 2KBGA 3TIDA 3K4DA 4NQEB 2GSIB 1IM9A 3OR6A 2VXVL 2R4SL 5I17B 1AGBB 4WV1C 3P9MB 3OAYH 1MOEA 1QEWB 4MXVE 4ETYA 4OTXL 4Z8FL 3MRJB 2EXYC 4P23D 4YUEH 3U4AA 2AEPL 3RDTA 3TT1H 5DMKB 4F7TB 5KBNC 4FFZH 5IV2B 1ES0A 4KK6C 4L5FH 5D72L 2EXWD 4PLJD 4NJ9L 3BQUD 3EYSL 2APWA 3BDYL 3QQ4A 3O6FC 2R56H 3GI8L 3VE0A 2Z31D 5ESAA 4MHHI 2R0ZL 3RX8A 4PJFB 3PWVB 3CJJA 1V7NL 3QCUL 1EMTH 3IB4A 4AH2B 3HC4L 4OSUL 1T04B 4DZBB 5EC1B 2R1WB 1G6RB 1OVZA 5I15L 3LQAL 2R8SL 3I6LE 1V5JA 2BVPA 1FNEB 5DFTA 1LEGB 3CCHA 5E94A 3BN3B 5JIKA 4MHHG 5IQ7H 3HN3A 1FVDA 3ZTJG 3VI3F 4MAYD 1RJLB 5AYUH 1KBGH 4Y4KC 3ARED 5E6IA 4DAGH 5DEZA 3QWOB 4WUUA 5FK9A 5L88H 2DBJA 4KH2A 4JM2D 4XP9H 1QLFA 1FVEA 2VDPH 4UTBH 2OTWA 3VRLF 6CGTA 4NWTL 3ZLQC 1I9JH 2ICCA 4HUXB 1PAMA 4NHUA 2DQJL 1HINH 3QDMD 4BSWA 5J6GB 1JYNA 4XMLH 1KIPB 1F6AB 3O2DH 2XWBA 3SE9H 3QDJE 3GO1H 1T5WA 3KPLA 3RWHB 3ZT5A 3RGVD 1A9BB 1QBAA 3GSNH 1NCBH 4TVPD 1KXTB 4QRUA 3KPPB 1HYRC 3G6JE 5A16B 5TH2A 1BAFH 3EOYG 2WANA 1RUQL 1NEUA 2B7DT 5D6CB 4AK1A 2HYMA 1YEDA 5HDBE 3HB3D 1MEXH 1VACB 4K71C 2AGJH 3K46A 4I9WD 4MA7L 2D7PA 3C6LB 5C8JB 5JPNB 3SGKC 3EFFA 3TN0D 3WFEH 4NJAH 1KTLB 3SOBL 4CU8A 1JUFA 5D5MA 2L4OA 3UAJC 2HJLB 4IRJA 2GFBA 1YEEH 3V95A 3K8LA 3R06B 2Y5TB 3SDDA 5IR1B 4WWKC 2GITB 2JJSC 3O2VL 3UZVB 1KEGL 3HMXL 1GC1H 1CQKA 1KPRB 4KK9D 3RVXC 2OJZH 3I75B 4JFFE 2FBJH 4TNVK 2YC1A 1V3MA 5HDLA 1NUDA 2XWJB 2AXJA 3VFTB 1QFOA 3KAAA 5KSAB 4P2OA 4U1KB 3TESA 4OGZA 1EFQA 3MNWB 1F90H 4P4KB 2V17H 4H26B 1IC1A 1VFMA 5BOPA 3A6OA 1LE9A 3FRPG 4DGVL 5GISL 5JMOC 2PYEA 2DQIH 1U42A 5CGTA 4I18C 5B38A 3L5WB 4HD9A 4XXDA 2IQAB 3KPQB 4K9EL 3OXRA 4RRPG 3ULSA 4RWHA 3VRJB 5I1CL 5KVEH 4OB5H 3U79A 2MJWA 3GZKA 2VXTH 1XCTB 4WENB 5EBMB 2ARJB 3CU1A 5FYJE 2FCBA 2Q7NA 4NN6C 5JZ7C 1KYOK 5HHOB 4XB8A 4YGVB 4DOHB 4PJ8C 1OW0A 2FATL 3QEGH 4ZAKA 5FYLD 2BXYA 1BQUA 4WHTA 5B3JF 3SHSA 4JFOB 3VXQB 5L6YL 1ZHLA 2NW3A 2VITA 2PYFB 2R2BA 4EXPX 4W4OA 4AEIH 3VXMD 5GGRY 3ME0A 1S9YA 3PHOA 2XOTA 4HKBA 3QNZA 3TC9A 5BJTA 2EEAA 1MLCA 4NM8H 3UAJD 3NPSB 4TSBH 3S35L 3TBWA 5ALBL 4L29B 5D1XC 5BW7A 3W9DA 4WCYL 3ARFC 4Y5XC 4YIQB 5BRZD 2XACC 3MRCB 5DJAB 2I24N 4L3CB 3DTXB 5HYSB 5I9QC 1WZLA 2X44D 2F5BL 3FO1B 2W60A 3ILPB 1OCWH 1A1MA 4JKPH 3OGOE 3OJMB 3QXTA 2VDLL 4GW1A 4I0PA 2J8UB 4NBYB 4F7CB 5EU5A 1BEYL 3IJSA 3QUXD 4UIMA 1UENA 3HAEH 5AUMB 3IYLW 1HXMA 3RL1B 5C2UB 4JRYE 3SDXF 2Z92A 1A8JH 3MX0A 4OZHA 1HHKB 2VDMH 3L7FA 1UH4A 1DN0B 4I0KA 5IMLA 5LCVH 4UI2A 3FZUD 2DIJA 2XIDA 1EEQA 5DEGA 5L2KB 3FT4B 4FXKB 3IJHB 2XKNB 3FQNB 5T3ZL 1E27A 5JZ7D 1NGXB 4JFEA 2E7LC 4L9LB 4EDXA 1OAZH 3S7GA 2OMBA 3TYFB 3NIGF 5C0FA 5D1QA 5E4EB 3DGGA 2XQYK 2BVQA 2JJWA 3G9VA 2FRGP 1MCLA 4MJ5A 1ORQA 4K3DL 1UJ3A 43CAA 5IGXL 1D5BB 3FOMB 1XF5A 2WP3O 1IQDA 3EZJB 3IDJB 3FKUS 2YA1A 1K4DB 2P24A 5HI4D 2PO6B 1S9WA 3REWB 3P9WB 4OQ1A 5C08E 4RGNB 3D85B 3LS5H 1ZLSL 1BZ7A 3UTSD 1KC5L 4OLWH 2X9XA 3MNZA 5JW4N 3D3VE 4PP2A 3BAEL 4UQ3B 2BVYA 3DIFB 4U1GB 3DV6B 5A3IC 2W9DH 4ZXBC 4PR5A 2DQFB 4LLVA 3MRMB 2DWDA 4G43A 2X05A 4G8IB 5C9KA 3NBNA 4MD0B 4HV8B 4NYLA 3OKOB 2A74B 5JUEL 1B3JA 3STLB 3LAFA 3BW9B 4F8TA 2MKWA 3HKFA 5IVXA 2FIRT 5EOTB 1N8ZB 4XC3H 2FSEB 1L7IL 2D7TH 1MAJA 3STZB 3H9SE 2VZOA 3VW3L 2GI7A 3MV9D 5BZWB 5KZCB 1AQDA 4R0LB 4WO4A 3X11A 4L3EE 1SMAA 1NCTA 1H3UA 1WBZA 4P5MA 3WMSA 3RVTC 1DSFL 1S7VA 1SYVA 5DJ2B 4YX2L 2XY1A 3OJDA 4JQXC 1I7RA 3RWCA 3HE6D 3MODH 1H3TA 4Z0BL 1RIUL 1NLBL 1G7QB 3EOBB 4LAJH 2PR4L 2CKBA 1K9TA 1DUYB 4LGSB 4FNLH 4EUPG 2VH5L 5E1AB 3GSRB 4XCCL 4HUKB 5DTFB 5CS7A 1EVTC 1OAQL 3ARRA 5CD3A 1HHIB 3SKOA 3NIGE 1UKSA 2CK2A 3MC0A 4HGWA 2LFGA 5IHZB 1KTKE 2NY3B 2VUOA 4PJAB 2BFVL 1OF2A 5MP6H 1JZ8A 5HYJE 3R1GH 4RZCB 5IB1A 5KVDH 3QDJB 5EOCH 1XIWD 3QYCA 1FFPA 5EBGA 1JHTB 1NUGA 4M62H 1HKLH 3BDXA 3MO1A 5A3ID 2HJFB 5CIPA 3G6JB 3TT3H 4POZC 4BYHA 3AROA 1LDPL 4XAKD 5I1GL 5HHME 3E6FA 4KJQD 1P4BH 4PV8B 3PL6C 1I1FB 1U8LB 1RU9L 4AIZB 4G6FB 2ICWI 4KRPC 2O93L 1UFUA 3GRWL 4B7IA 1DUZA 1KIRB 2XICA 4WW1A 1B2WH 4PY7A 5KANI 3L6FA 4QWWD 3L3JA 3MNVA 3PG2A 2XZAH 5DK3A 2F19H 2QJDA 3LEVL 3STBA 3DSNA 3W82A 1WAAF 1WC7A 2AI0H 3ARDB 3FQTA 3QHZH 4UB0L 5JO5B 4E42B 4OAWB 2CRZA 4GAJH 5ESVB 5CBAB 1RY7B 5I1EL 1J8KA 4JFFB 4X9FA 1MFEL 4MZ2A 1AY1L 3BPLB 1C12B 4S1RH 5LG1A 5C09E 2AJZA 2IMMA 3TBSB 2IH1B 4KV5E 4P2RD 4JJ5B 5I71C 2FECL 3RWGB 5T1LA 2R2HA 3GHBL 4U2ZA 4ZPVA 2FHBA 4MNGB 4NRXB 1J1XH 5I1DA 5E08L 1CBVL 2UY7A 4NFDA 4FFVD 2G2RB 4XBPB 3S9DB 1ZEAH 1VDGA 3ZL4L 1T03L 4TNVF 1EV2E 4IMKC 2AEQL 4B53A 5D6DA 1NCDH 1MI5A 1D5ZA 4OUOA 3VH8A 4MSWA 2E9WA 3S35X 2QQLH 4KRPD 1ZTXH 1JZ4A 4LHUB 3C5SB 5C0CE 1S7XB 1ZE3C 4XWOD 2HJKA 3GSQB 5SV4A 3D25A 1JGEB 2C3GA 3LMJL 5DJZA 2X4NB 5ESQA 1VGEH 2DQDH 5DMIH 2VYRE 2BP3A 5ID1B 1MY7A 5DO2D 1I7UB 2WUCH 5HGHB 3P11H 2AV1A 5CJXC 4YUEL 2OL3H 1NANH 5SX5H 3TT1L 4FFZL 3FFDB 2OJEA 4PG9B 1LWRA 1ZANH 3M07A 3IFNL 4ZSOB 3LQZB 3GUTA 5D1ZD 2Z35B 5B39A 2R56L 2YXMA 4R90H 1UXSA 2F54D 2OQJA 5F97E 1P5VA 2VLRA 5EO0A 2NY0C 3UMTA 4HS3A 1KLUB 1EMTL 5D2LB 4PG2A 1UB6A 5K9JH 4OGXH 4TOYL 4JRYB 3KHOA 1MSPA 1KT2A 1CXKA 1DBAH 2ZJSH 1MVUA 4BQ9A 4WU5B 5IMMB 2PW1B 3HPLB 1XGPB 1YNTB 3T4YB 5JA9A 4HUWA 5CJBA 1IAMA 1X7QB 4M8QA 4U0RC 5IQ7L 1IEBA 4UINH 4LL9A 1C5BL 4FQXC 2BSSB 5DD5L 1WUNT 3PIQB 3OSKA 1CFBA 1YYLH 1MHPL 4BQ8A 1KBGL 3TO4D 4DK3A 4EDWH 1MRDH 3IDIB 1XMWA 5L88L 4P5TD 1FGVH 1D6VL 3FB8A 3RNKB 3FCTB 1S78C 1Q0XH 4DK6A 4RAVB 1B88A 5I6XB 4NZDA 2VDPL 4UTBL 3BKCH 3JTTB 2G5BB 1S9XB 3D2UB 5FDWB 1I9JL 1VADB 2BSRB 4JFZL 4H1LG 1HINL 2ADIB 3VFOB 2YR3A 4HKZA 4XMLL 1QHPA 1PY9A 1JZ5A 3O2DL 3SE9L 4HT1H 3GO1L 4JCMA 1LNUB 4ODXA 4XNZB 3GSNL 2FZ3B 1NCBL 1Y6KR 4HIJB 2GHWB 5IK3A 5J11C 5J9PB 1BAFL 4IS6B 1UA6L 1AXIB 4PRPE 1TVBA 3HZYB 4A6YH 1N5YH 3KPMB 3FT2A 2WM0A 3MJ7A 5T5NG 3VMNA 2YRPA 5TGBB 2IBGA 1D9KB 4LCUB 3F8UB 3MJ9A 5ITFB 1YNLH 4ZMAT 5D96C 4JPIA 3BSZH 1T0MB 3AM8A 4E41A 2MHAB 4X9HA 5FKPA 4DKDC 3OHXB 4N8PA 3VFSA 3QXWA 3H9SB 1IGYA 5ABDE 2XN9D 2XV6B 4U1IA 5F88B 4M61B 3VJ6B 5FGBA 2Z4QB 1YEEL 3PABB 3WN5B 2XA8H 3DX8A 3QZWG 4MNQD 2FX9H 3OKKA 5BXFA 1UCTA 1YY9D 3VFNA 3C5ZD 3PWLB 1GC1L 4RMQA 3BN9D 2KUTA 4S1SH 2FBJL 4AIXA 4JREC 1R3HB 3ZE1E 2ARJQ 2VOTA 2YD1A 1MFAH 4P2QD 3MXVL 2V17L 2K1MA 4O51B 5IB3A 4HMCA 4QHKI 3WL9A 3MA7A 2F53B 3FQRB 1JNHA 1IVLA 4QXGH 4OZIE 5HYJB 4GKOA 2IPKA 3C60D 4HIEA 3E8UL 1KENH 3FB6A 3MLUH 5K33A 5F9JB 3BKML 3ARTA 2VXTL 3BESR 1FL3B 1IM3B 1GGIH 3EYVB 1U8HB 1G7MA 2W0LA 2PXYC 3NIDF 3UTQB 3LKOB 2R39A 3QEGL 5E9DD 2IF7A 5T1KD 5KG9B 1T0PB 1OOAA 4OLUH 5CUSH 3U30C 1PX4A 3VXTA 3C9NB 5KSAD 3DETC 1B4RA 2XA3A 3ARXA 4P4KD 4AEIL 5T3XD 2DQGH 4JO1H 3JTSA 1YEJL 4KAQL 5ICYA 3VXSB 2Y6SC 2MKLC 3U9UA 2W0FB 1XGQA 3TZVC 4NM8L 3VI4F 3HC0B 3BP6A 4TSBL 1UQSA 4Y4FD 5FHBL 3RL2B 4DKAA 3MLSH 1E28B 3BZEB 1RMFL 1QQDA 1CFSB 4XCFL 3SJVE 3O2WH 3PXJA 3WFZA 4ODUB 2LU4A 2Z8WC 5J1AA 4X5WB 5ICZB 3DXAA 2EE2A 5DEFB 5FYJU 1P6AB 2X4RA 4LKCB 2KQMA 5C09B 5L8JB 5HHOD 2V7HB 4JHAH 5EUOA 1OCWL 4JKPL 2H2PD 2GT9A 4X0KA 2CJUH 2CQVA 3TP4A 1FNAA 4KXZI 3UYPA 2B4CH 2WBWB 1M7DB 4QY8A 1CFTB 1MHCA 1RJZB 1T4KB 2GKIA 1J11A 5C6TH 4PJHF 4D9RE 3QNYA 2WBJB 1T6VN 1QR1A 5IJKA 3FRPA 3GSVB 1DN2A 4YHYC 1ZVHA 2EZ0D 1Q72H 4M7JH 4RRPA 3SE3A 5DJYB 1FORH 1F02I 4WUUE 3A6CH 4YFEA 1MJ8H 3OMZA 2F8XC 2ZP0T 5IUSA 5I8OL 1WEJH 1F45A 5MEOB 3ULVE 4O02H 1DR9A 1YPZF 2IPUG 4YHPA 2YSSB 4NKMB 2G9HA 4J12A 3GSWB 1TTGA 1TZHB 2X4SA 1A1NA 1MCWM 2ERJB 3MMEA 4NC1C 1N6UA 5C0CB 3T0EB 3NVQA 2GTZB 5CBEB 2ZSVB 3WUWG 1K2DB 2FEDD 4OT1H 4Q6YA 4YAQA 4GO6B 2BCKA 4NHCH 3FFCB 3VG0L 1KNOA 1HQ4A 1JV5A 3F7RA 4PJ9C 1C8PA 4RX4D 5CGYC 4GG6A 4MA8H 2OXHA 3LS5L 1IGJA 4IEFB 4OLWL 2C7UA 4IM8A 1K8DA 2W9EH 1D3CA 5L2KD 4QRQB 3LN4B 5DZOA 4XCEB 2P5WA 3CK0H 2VLJB 1NBVL 2V7NB 5F7DB 2J6EH 5E8DH 1Z2KA 3ZDXE 3CFKB 4I3GA 1OSPH 2V2XB 4MJ6A 1TZIB 1OT1A 3EJZC 3NFPB 4HIXL 4N8VB 3QUYC 2PTTB 2HTLD 3FRUA 5TPWL 3QH3B 4XC3L 2GJ6B 2D7TL 5TFSH 2YUXA 3MLTA 2X4TB 4LCYB 1IT9H 5DRWA 4LLUA 1KPVA 2WIMA 5IWLA 1IGFH 5FXCH 3GI9H 1JMXA 3QBTB 4RBPK 3S5LG 1BOGA 2NW2A 3AU1B 4X80L 1I9IH 3VWKB 3EYFA 2GCYB 3MODL 4YFDB 1NMBL 4NZTH 2VDRH 4ZFOA 2GIYA 1NDMA 2ARWA 4YDIH 1HNFA 2DQHH 1XCQA 4XCNB 4F3FB 2FJFB 2PYEE 4FNLL 2OR8A 1TFHA 3R0MA 1FNSH 2W65A 1L9MA 4AY0A 2Z93B 5C0JA 2H32A 4MS8C 4PJ9D 5MP6L 5CGYD 1AXSA 5KVDL 3I6LD 1IC4L 1JCKA 5KZCD 4M62L 4RGMB 1HKLL 5IQ9A 3OWEA 2HKHH 4Q2ZB 1U2CA 1MJJA 3C2AH 5D7JA 1J8HE 4NQSB 4MB3A 3RZCB 2APVA 1CL7L 5IEHB 3HAEG 5E5MA 4ZFZA 1P4IL 1EEZA 1A0QH 1BZ9B 1I8IA 4XCYB 2HT2D 4V2CB 3MYJA 2F58H 3R8QA 4FQPA 4ZOEA 4OCYH 5GZOC 1IQWL 3B8SA 1FO0H 3QUMA 1A4JB 4HC1H 4HUUB 4ELMF 1E6JH 2NY3D 3UDWA 2BOBB 1OLLA 1GRWA 1I7ZA 2XZAL 2OTUA 5CZVH 3QDJD 2F19L 1IAKB 4R4BB 4Y16D 3QHZL 2ADGB 2AI0L 4ZOCA 4PGZA 4XHJD 1CD9B 1CDJA 3IKKA 4Z7WB 1XR9B 1ZGLB 2APXA 3FQWA 3S98A 3U6RA 4U1JA 2NXZB 1P7QA 3WS6C 2ZOLA 3QA3A 4OQTA 4X5LA 4Z9KB 4YHLL 4OZHE 2DD8H 3WUZA 4YPJA 2R23B 4P48A 4EUPA 4OZIB 3INUH 5HPMA 1ADQA 4U6HA 2R4RH 3U0TA 2FEEI 3DX9B 1XZ0A 3BHBB 4JFEE 2A83B 3O6LH 3RY6A 4XP5L 5IF0B 3I3EA 2FO4B 4OLYH 3RUGB 1ZEAL 4NQVA 2BMKB 5ERWB 5T1DH 4OF8A 4LSRH 4ZUSB 4PYGA 1G9ML 1AGFA 5HXMA 4JFFD 2CR6A 5DJDA 1SYSB 3MOAL 3TH4T 5GS0C 5IM7A 3TIDB 5K9KA 5I8CA 1IM9B 2QQLL 3U9PL 1INDH 3DOSA 3OR6B 4OFYA 3RVUC 1T2XA 1V8HA 1J1PH 5H35A 4L8SA 1VGEL 3RDTB 2DQDL 1MCOH 5J4MA 5DMIL 5CCKH 1ES0B 3HTLX 2J5LB 2WUCL 2Y7QA 3P11L 2OL3L 3QQ4B 3OKDA 5F6HJ 5FYJD 5ESAB 2ICWA 3QPQC 3VE0B 4X5XA 3TA3C 1ZANL 3B5GA 1M4KA 5SX4H 3Q2CA 2FYYA 3GNMH 2DDQH 2ZUVA 5IVXE 3JWDC 4ONOA 4OZFH 3ZT6A 4JEGB 2N4IA 4KC3B 5GGVH 1T7VA 4KTDH 2X1OA 4LHUD 4ZUTA 2BVPB 4GSDH 4OGXL 3CCHB 5E94B 1UKQA 4X7FC 2ZJSL 2D03L 5EB9A 2DKSA 4PP1C 5CJOH 1X5IA 5IVNA 5GGQH 1FVDB 4QLRA 3WKMH 1KCRH 3ZE2F 1TETH 3PDDA 4WUUB 4UINL 5FK9B 2CDGA 3RPKA 1UEYA 2JLLA 1QLFB 1YYLL 1FVEB 3BEVA 1J0HA 3MUGA 1NGPH 1S5IH 1MRDL 2OTWB 3V6OC 4EDWL 5GS0D 1BF8A 3ORJA 5ITBH 1FGVL 4NHUB 4WGVB 4P46A 4BSWB 3QULA 3RVUD 1OTUC 4ZS7H 2I60L 3BKCL 4LSQH 1ND0A 2FX8H 2Q3AA 3MXWH 1BFTA 4ESKA 1T5WB 5HHVH 3KPLB 3RTQC 4EN3D 5EOCJ 3G5XA 4GQPH 4JRYD 1VFOA 3KYKL 4QRUB 1MAML 5TH2B 4IDLA 4HT1L 3HZVA 3F12A 3QRGL 5DK2A 3O9WC 4K8RL 3IF1A 3C2SA 1YEDB 4NCC1 5GGVY 1KJ3L 5FGCE 4MCZA 2C3HA 4YK4B 4I5BA 4A6YL 3EFFB 1N5YL 3CXHK 5DDHA 1OY3B 3DV4A 1JUFB 5D5MB 4OFPA 4IRJB 2GFBB 4IJ3C 3QI9C 4NRYA 1T1ZA 3BSZL 5K59F 3SDDB 5KSUA 3HZMA 5DD1H 3C08H 3RP1A 4QTHA 2XA8L 5C08D 2FX9L 5BQ7A 1TQCC 3O4OC 2YC1B 1K3IA 3D3VD 4GAGH 3QDHA 4P2OB 1IILE 4PJAF 3DVGA 5AZEH 4YR6A 4N1HB 2OM5A 2WW8A 3NAAL 1QSZA 1LE9B 1MFAL 4XPGL 3LSOA 4J4PA 2PYEB 3TJHC 4YBQD 3DX7A 4LSUH 1OTUD 5EU6E 1D9KD 5B38B 4XXDB 4F80A 3OXRB 3DMMD 4JDVA 5DMGC 3ULSB 3UPRA 2WK2A 4PJDF 1NC4A 2JIXA 3C5JA 1KOAA 4YHOH 2VZTA 2H41A 2WUBH 4QXGL 3B3IA 3QJFA 1SEBA 5K93A 3H9SD 3K8KA 3QHFH 1CIDA 5JPMA 4HS6A 4M9OA 4H1LA 1KENL 5LXGH 1JGVH 4LIQL 4WEMB 4L3ED 2GQHA 3MRKA 4ZAKB 4WHTB 1GGIL 1DQJA 3BPOC 4OCWH 3GJFH 1MI5E 3V6BR 1ZHLB 2NW3B 2R0LL 2VITB 2R2BB 1Q9LA 5F93C 5EBLA 1FSKC 4WW2A 1S9YB 3PHOB 4HKBB 1WCQA 3QNZB 5CUSL 5BJTB 1MLCB 4I48A 3TBWB 4KTYA 4PS4H 4L3AA 4OM0L 2DQGL 4JO1L 3W9DB 4QCIA 4WIQA 1ZA3A 2F53D 5IB5A 4N5UA 3MLWH 4N5EC 4TPRL 5HYJD 3MLSL 5EDXA 3W11C 4BFEA 2QQNH 2VL5A 4OUUA 3O8XA 2AEWA 2W60B 2D0HA 3QZWA 1A1MB 1L6XA 5DD3H 1IC5H 3TVMC 1CE1L 2P42B 5H8DA 2BJMH 4GW1B 4I0PB 5EU5B 1ZOXA 3IJSB 4UIMB 5HHMD 1HE7A 2VLRE 3ARGA 4XPHL 3HHRB 4JHAL 4BH8A 3MRGA 1HXMB 2CJUL 2Z92B 5E8EA 4OZHB 2B4CL 3HLAA 3L7FB 3WHE1 5C0NC 5IMLB 1JE6A 4H25A 3VXSD 5DEGB 3NIFE 3IFOA 3JZ7A 4U1NA 3M8OL 1E27B 4KUZH 5EO9A 4JFEB 2Q6WA 5GS2D 1RZKC 4EDXB 2DYPD 1Q72L 3KYOA 5C0FB 1RUAL 5CINH 5D1QB 5IBUB 3DGGB 4D0DA 2BVQB 3A6CL 4JKMA 1MJ8L 2LQRA 4MJ5B 1ORQB 3T4AA 1UH3A 2QADC 43CAB 3E6HA 4LGPB 1WEJL 4POUB 1XF5B 1IQDB 3LD8B 4ODHL 5DUPH 4O02L 1IKNA 4KQ3H 5C09D 2P24B 1S9WB 2YPVH 2XKSA 1Q9OA 4KJPC 4Z6AT 2MNUA 1H3PH 4UDTA 4X9BA 4HKXA 4LEXL 1BZ7B 3GM8A 1UGNA 4Z7QE 3MNZB 4NHCL 4PP2B 1F2XK 3FT3A 3W11D 2CXKA 2WBJD 4MA8L 4PR5B 5D2LF 4LLVB 3VWJC 4ZOAA 2DWEA 3HE7C 2W9EL 2O5YH 2DWDB 4G43B 2I5YL 3NCJH 1TQBB 5I0ZA 3CK0L 3QSKB 4NYLB 4Y1AA 2J6EL 5E8DL 4APQA 5IVXB 1RZGB 3MRRA 4E41E 4HWUA 2DICA 1KJ2H 3NA9H 2HT4D 4YZFE 4FQCH 5C0ND 1B4JH 4L4VA 2H26A 5D2NC 5C0CD 1AQDB 4QHNA 1MQ8A 4WO4B 3X11B 4CMMA 1WBZB 4P5MB 3F6LA 4M3JA 5E2VH 1S7VB 2IAMA 1SYVB 3WIHA 5TFSL 4WI2A 3OJDB 3A67H 1I7RB 3RWCB 4LQ1A 2YPLA 4QRRA 2YD2A 1JPSH 4JRWA 3VGBA 3GI9L 1TJHH 5DURB 1F6LL 1RURH 1BZQK 2HVJA 2CKBB 3MRNA 4NZTL 3CU7A 2VDRL 3CAFA 2ED9A 5CD3B 3JWOC 3SKOB 1AD0A 3ARBC 2DQHL 4GMTH 4HGWB 5HVGB 1EO8H 1OF2B 5IB1B 3PWJA 1LHZA 1FNSL 2UVFA 1FFPB 3QFDA 5H94A 3MO1B 5GGSY 1WISA 3WUWA 5CIPB 2CDEA 3V5KA 1B90A 2OR9H 4XP6H 5GGRA 2PUQT 3E6FB 2KDGA 1WJ3A 2HKHL 4Z5RA 3OV6A 5FGCB 1YMHA 3V5HA 3C2AL 2C4FU 3VWKD 4OI7A 1DUZB 5B8CC 4WW1B 5FM5O 1FL5A 1A0QL 4PY7B 3RX7A 2BHYA 3P0VH 1XR8A 1ZS8A 3EYQD 3L6FB 4KQ4H 1MNUL 2F58L 4U33A 3L3JB 3MNVB 5MHSE 2EIDA 5TE4H 1AHWC 2FX7H 35C8L 4OCYL 2YWZA 2AW2A 4ODTH 4JDTL 1FO0L 2FO1A 4TVPH 1QFWI 1RZ7L 1WC7B 3FQTB 4P23A 1E6JL 4ZNCD 4YDJA 4LVNC 3IDYC 4WHYH 5CZVL 4Y5YC 5JORA 4X7SH 4JO3H 5E2TH 2AJZB 2ED8A 5TE7H 3VD3A 3F58H 5EUOE 5I73C 3DVFA 4MVBD 3S5LA 4HCRH 3RZCD 4UV7H 3H3KA 5T1LB 4PJGA 2R2HB 1KACB 3MV11 4EKXA 3QB7C 4ZPVB 2PKDA 5MENE 4GRWH 5HYFA 5I1DB 2DD8L 4K7PH 4PJBF 3INUL 4JHBA 2R4RL 3SBWA 4R4ND 4M93B 1MCQA 4YXKH 3O6LL 4S2SA 1M7XA 4UNUA 3RVVD 1MCIA 5IBLD 2OP4H 4JPKH 2IH3A 1MI5B 1D5ZB 4DQOH 3VH8B 4EZMA 3BGAA 4MSWB 4LSRL 5LWYL 1IGTA 2A77L 1YEHH 4MJ2A 1AI1H 5ELIA 1UADC 4K07A 5CKAA 2HJKB 15C8H 3D25B 2AJYL 1OWRM 5D7SL 2NXZD 1OQOA 4LARH 5DJZB 4HZLA 1INDL 5ESQB 2IBZX 2ZCHL 1GGYA 1T3FA 1U36A 4GG6E 1RZKH 1J1PL 2AV1B 2UWEA 5CEZH 2WQ8A 1MCOL 5HVHB 1A14L 5CCKL 2OJEB 1DLFH 1AE6H 2RIKA 1CFNA 3FHAA 3GUTB 3O6FA 5B39B 4U7MA 5DGQA 1UXSB 1RZJC 2A6DA 2OQJB 1TPXB 2VLRB 4K7PY 5EO0B 1CGSH 1TIUA 3UJIH 3ZDZE 4HS3B 1T1YA 5EZOH 1UB6B 3GNML 3LKNA 4YHNA 3X3GL 3ZTNH 2DDQL 3MBEC 4RMSA 4DUXA 1KT2B 1MVUB 3EO0A 2E9IA 1P7KA 3CGTA 5JW4R 1IM9D 3RFZC 4KTDL 1DBKH 4HUWB 1Y0LA 1BOYA 4GSDL 4BZ1H 4M8QB 4R7DA 3MUJA 4JR9H 4PJEF 1WITA 5BMFL 1IEBB 2GTWA 3D87B 5CJOL 1EZVX 2MWCA 3KVQA 4Y19A 5GGQL 3WIFA 2CLZA 3RDTD 3WKML 4Y4KA 3SJVD 1OAXH 4FG6D 5D7KE 2B0SH 2I26N 1TETL 2FWOA 1QSFE 4KY1H 3KPRA 4KI5E 4NN5C 3FB8B 4PY8I 3S36X 4KROC 1KN2L 5F8QC 4JM4H 1NGPL 1ZLUH 4WDIA 5ITBL 3DNKA 2YD5A 2KPNA 4MX7A 1BQLH 1MPAL 1QZ1A 1F3DH 3U1SL 4HKZB 3SKJH 3ZKNC 3TCXA 1BGXH 1W72A 2FX8L 3MXWL 3FO0H 4NUJA 5HHVL 5B22A 4ODXB 4OZGF 2A9MH 3SGEH 3WSQH 4D9RD 4XPTH 2N1KA 4XPFL 5IK3B 1S7WA 5BVJA 1WICA 1TVBB 1GPOH 4BFGA 2A9NL 2DI8A 3BRFA 3L3DA 3FT2B 3MJ7B 1J1OH 5E6ID 1KPUA 4O00A 4U1SA 4WUUD 3RIAK 5JW3H 1RUKH 4W4NA 2V2TA 1MWAL 1ROWA 2L0DA 3SGKA 4JPIB 1HWGB 4E41B 3MBED 3ULVD 4Y89A 5FKPB 5C3TA 2Z8VC 2EDXA 3VFSB 2X4PA 1FFQA 2GK0A 1IGYB 4NGHH 4F33A 4U1IB 3MRIA 5E99H 2EIEA 4WWKA 3DX8B 3QIBC 2JJSA 1G6VK 3VXUA 3OKKB 5BXFB 3VFNB 5I8KH 4QOKA 1ZVYA 2Y06L 5DD1L 3C08L 6FABL 3LKQB 4WU7A 1WT5C 1E4WL 5F6IC 3PGCA 1FIEA 2KZWA 3EO1A 4YXLH 2DLGA 5GRVL 1F4YH 1U3YA 5CSZA 4PJEE 4KROD 2XXCB 2NZIA 4PV9A 2JJUA 5T5FH 5AZEL 1ORSA 4M1DH 5IB3B 1AO7A 3WL9B 3MA7B 4OCXH 3JV4A 1JNHB 1QUNA 5LBSH 2JJVA 2A6KA 3FO9A 4I18A 2VLLA 5SX4I 5JA8B 4LSUL 2IPKB 4L4TE 3V52H 3IVKA 4HIEB 5JR1L 3ULUL 4IRJD 3FB6B 5GSVA 2EDYA 2WUBL 5IIEA 1NUNB 4NKDA 3I9GH 1J0ZA 4QRPA 5FHAL 1G7MB 5LXGL 1JGVL 1FFNA 4PJ8A 5DUBA 2I07A 3CDFA 3EGSA 5SWQA 3LHPL 5E8PA 3VXTB 4OCWL 3X12A 4OZFG 3ZYIA 5ICXA 1BP3B 1BVLA 1CQYA 5BV7B 3JTSB 5ICYB 2O26U 4X6EA 3D0LA 4OD3H 5FYKE 3U9UB 1XGQB 3BP6B 1QYGH 2PYED 1UQSB 3QNXA 3TO2A 5D1XA 4PS4L 2NZ9C 4QXUH 1QQDB 1WQVT 4PRNA 5F9DC 4DVBA 3ARFA 3TBTA 3PQYE 3OG4B 4Y5XA 3MLWL 5MI0C 3BP4A 5J1AB 4GW5A 3BVNA 4JPVL 3DXAB 5E24E 3RKPA 3VXRE 3QIUC 2LTQC 2X4RB 2BY2A 2QQNL 4JB9H 3ZKMC 4HLZH 5IFAL 4YLQT 1U8OA 5EUOB 1RIHH 4ZAKD 2GT9B 4OCLC 1IC5L 4S1DD 4X0KB 5CJ5A 2BJML 3TFKC 1J8HD 1A7RH 4QY8B 1MHCB 2CIIA 3B83A 3WNNA 3J7HA 1MF2L 4YHMH 3C6LC 4G7VH 3QNYB 1OPGH 1QR1B 5TF0A 2P7TA 3MV9A 1A6VH 3UPAA 2E6QA 4J2XA 1WWWX 3P3YA 5CLTA 2HLFD 4KZDL 2JE8A 1LE5A 1NAKH 3DBXA 2Z8RA 5B21A 4LK4A 2E7LA 1RZJH 3CX5J 4PTUA 5CINL 3LIZH 4YHPB 3VXPA 1NFDA 2G9HB 1T89A 1A1NB 2X4SB 3MMEB 1FAIL 2DOCA 5DA4A 5DUPL 5J13B 2QLVB 4YAQB 3DO3A 2EDLA 4XGZA 2BCKB 3QUZC 3KG5A 4HS8H 1GJIA 1KNOB 2YPVL 3RPIA 1JZ2A 3HMWH 4RA3A 5DD0H 1HQ4B 1JV5B 2RBLA 5L9DL 4GG6B 4J3OC 1H3PL 4JO4H 3FHQA 4LLMA 1UCBH 1QRNE 2H2SD 1IGJB 2C7UB 2E8ZA 1K8DB 3KR3H 1MRCH 1DL7L 2P5WB 4ZXBA 5J0BA 3T2PA 4GXVH 4JFED 3VRIA 1C5CH 5L7XH 4J8RA 3IS1X 2R2EA 2B5IC 4QXWA 4TN9A 4YHKH 3P4MA 3TFKD 1OAKH 4MJ6B 3G5ZA 4WI8A 1Q94A 1X3DA 3VFUA 1FYHB 4I2XA 4M48H 2XKUA 3IDUA 3FRUB 3T3MF 4ALAH 1BWWA 1KJ2L 3B9EA 5J12C 3JXAA 3NA9L 4TTDD 3MLTB 5DRWB 2C1OA 4LLAA 4LLUB 1KPVB 2EYRA 4MNHA 4M7LH 3KJ4C 5E2VL 2R29H 3JV6A 4JQXA 4KJWD 1F58H 1BOGB 2NW2B 2CUHA 1A6UH 5E4IA 3EYFB 1JPSL 4ZFOB 3B2UD 1NDMB 3O4LE 1TJHL 4KMTH 1XCQB 1N0XH 3BP5A 4Y0GA 2Q76A 4MJIA 4XC1H 1DBJH 2W65B 4Z7UA 4GMTL 2EDWA 4MMZC 5C0JB 2H32B 4MLIA 1EO8L 3OGCB 4ONFL 2DLHA 2OI9C 1AXSB 3MJ8A 1P9MC 5ISZA 12E8L 5IQ9B 4Q0XH 4HLJA 5I19H 4J3SA 1MJJB 4XP6L 3KPOA 5D7JB 3RRQA 4UTAH 4V2BA 2BERA 3PL6A 2EYTA 3A0OA 1R6VA 5E5MB 4ZFZB 3P0YH 5GS3A 1EEZB 4YO0A 2YPKA 1I8IB 5DURD 3RX5A 3MYJB 5E4EC 2NY4C 2E8YA 2X9WA 1U8PA 1FDLH 1G6RH 1YUHA 3SGJC 3QUMB 1BFSA 4OLZL 1HHHA 5FB8A 4M43L 3GKZA 3P0VL 2B2XH 4L1DA 3MGOA 4KQ4L 4BZYA 5L0QB 2QKIA 2VSCA 5TE4L 2BNRA 2JB5H 3HNTH 1NH6A 1I7ZB 2FX7L 2CPCA 4PRHA 3MV01 2OTUB 3UBXG 2PO6C 4TVPL 2BRRH 3WLWC 4UNVA 1CTNA 3D0VA 4UOJA 5DRNB 1FG9C 4HPYH 4Y8DC 3UJTL 4U1GC 4U1HA 4X7SL 3FQWB 1PZ5A 4JO3L 1T1WA 3U6RB 1LGVA 4U1JB 3FN0H 5TE7L 1X5KA 1P7QB 1NGWA 3P4OA 2J4WH 1DANT 4Z7VF 2ZOLB 3QA3B 5F9WC 2OLDA 1KCUH 1LO4L 4HCRL 4OBSA 4I4WA 4S11A 3RBSA 4EUPB 4DKFH 5HPMB 4U6HB 4LPVA 3U0TB 5C0EA 3PV6A 3K1KC 1XZ0B 1IARB 4NQVB 3TJEH 3BE1L 5E6YA 3BH8A 2NMSA 3BGFB 4IOFD 4IMKA 5E2JA 1K8IA 1AGFB 3MREA 3QT2A 1VENA 4YXKL 5DJDB 3TO4A 2ZOKA 1YC8A 5IM7B 4AZ8A 4DQOL 5K9KB 4P5TA 2VR5A 1RFDH 5I8CB 1W2KT 4F57H 1YEHL 4PREA 5IB4A 1AI1L 2D4DA 4MCYA 1QPXA 4BK4A 5E1HB 4DZ8A 1S5HA 15C8L 1WFNA 1YQ2A 1F3RB 3CXDH 5T1LD 5H35B 4L8SB 5EU6D 3UYRH 3QDGA 1MCNA 2WWMD 2AK4A 1BD2E 3CLEL 4Y2DC 1RZKL 4KU1A 2Y7QB 5CJXA 4WEBH 3VDCA 4X6CF 2VQTA 2JJTC 1LO2H 3OKDB 2ICWB 3BYTA 4X5XB 1HZHL 1DLFL 2NY2B 3V8CA 1SY6L 2FYYB 4YE4H 4P2CG 4Y1AE 4PGCA 3KLHC 3CH1A 1MI5D 1JRHI 5T3XH 5B4MD 4MA1C 3TBYA 1BIHA 1CGSL 5EZOL 4L4VE 4ZUTB 3ZTNL 4YQXL 4C54A 3GSXA 4P0DA 1CFVH 2QTEA 1J7VR 3RVWD 1YDPA 2XN9A 3GEWB 4QEGA 2CXGA 1I3VA 1NMAH 3GDBA 4Z7VE 1DBKL 2MCPH 2NXYB 4HG4K 4BZ1L 4MNQA 4QRRE 4JR9L 2HP4A 3C5ZA 5I1JL 4UV4L 2CDGB 5ACZA 2MSPA 3L9RA 5H2BA 3ARDC 4AENA 3BEVB 3MUGB 2CRIA 4W6XB 2DQUL 4KRMB 2HG5A 1YECH 25C8H 1RZFH 1QLRA 4P46B 4P2QA 3VGAB 4QO1A 3QULB 1FCGA 2VLRD 1ND0B 3AUVA 4GH7B 4LASH 3G5XB 3SKMA 3CX2A 4M7LT 4P99A 1JGLL 4K23H 3RJDA 3SKJL 3UEZA 5J6HA 3C60A 4JHWH 3MACH 3DWTA 3FO0L 3HZVB 4WHYG 3F12B 5DK2B 1KIQA 3IF1B 4WVRA 3WSQL 1G84A 3LB6C 1H8OA 2JK5A 3B9DA 3OAUH 3U83A 3IFPA 4MCZB 4TUKH 4I5BB 5E9DA 1J1OL 5JW3L 1RUKL 2GEEA 1HKFA 4X6CE 3MUZ1 3DV4B 5DDHB 4BFIA 3MLZH 1FYTE 2ZUQC 1N6QH 4JPWH 2FBOJ 4NRYB 1T1ZB 3AB0C 2CSPA 1NQBA 5ANMA 2QHRL 1W0WA 5KSUB 3O3UN 4NGHL 3HZMB 3SPVA 5E99L 4Y4FA 4QTHB 3VD9A 1JNNH 4Y7MA 4WWID 5BQ7B 5D7IA 4H8WC 4DCQA 5I8KL 5HPOA 4OLXH 3ESUF 1Q38A 3DVGB 3G6AA 3PGDA 1F4HA 4YR6B 4P59H 1NBYA 4UMGA 4MB5A 5DZNA 1GXEA 5I0DA 1GZQA 1G9NL 1OTSC 3LSOB 3DX7B 3GK8L 2Q8AH 5T5FL 2UV3A 4HWZA 4JDVB 5DC4B 3B8YA 3UPRB 1CXLA 4OCXL 1NC4B 2JIXB 2PETA 3C5JB 1YMMB 5LBSL 2HH0H 4E41D 3RAJH 1OT2A 3B3IB 3QJFB 1SEBB 2AJXH 3LY6A 5JPMB 4HS6B 1JHKH 4MJ4A 4H1LB 4HC1A 4RMRA 1B0GA 1QD0A 2MOVA 5D8JH 3MRKB 3FO2A 4XMPH 3LPGA 3I9GL 2PXYA 1DQJB 3P4NA 3LS4H 1GHFH 3GMPA 3ARUA 1Q9LB 4H0IA 1LMKA 4MWFA 5EBLB 4PLNC 4WW2B 1IGIH 4K94C 5KS9E 2WSKA 4ODWA 1FNGA 3BD4A 1WTGT 4WI6A 4CMHB 1QFHA 1AGCA 5HYIA 4I48B 2X89A 4HAGA 5LJYH 1AIFA 1NLDH 2C3XA 5E03A 4OD1H 4QCIB 1ZA3B 5IB5B 3EYOA 3TZVA 3VD7A 4OD3L 4BZ2H 5I6XC 1I8MA 1F8TH 5GRXG 1N7MH 3BZFA 2UWEE 1QYGL 4YDVA 4OFKA 3O6MH 2VL5B 4OUUB 4GKSA 1UG9A 3O8XB 4BQCA 3QZWB 1FZMA 1SM3H 1SVZA 5E56A 4F58L 4JB9L 3ARGB 1S7RA 5IW1A 2VIRA 4BH8B 1RIHL 4HFUL 3MRGB 5EFIA 1UWXK 1WCBA 4FQIH 1FIGL 5E8EB 3HLAB 3O3BA 2IWGA 2DM2A 4H25B 4KZEH 3I50L 5FYKU 3IFOB 4G7VL 4U1NB 5EO9B 5MHSD 2Q6WB 1JWSA 4Y19E 5AWNH 3NCCB 1C16A 1PVHA 3KYOB 3HG1A 4D0DB 3TNMA 1X5YA 4DEPB 3KPRE 2X4OA 1RZJL 3T4AB 1Q8MA 3E6HB 1A47A 1GGUA 2NYYD 3JUYA 1KIUA 5INDA 3LIZL 4DW2H 1Q9OB 2FGWL 1A7NL 1AXTH 4HDIB 4G7YL 4OZFA 4UDTB 4HKXB 3ARSA 4W6YB 1J0YA 1PD6A 1QFPA 4PJ9A 1AGEB 3FT3B 5DD0L 5MEND 2DTML 4NRZA 4ONGL 1UCBL 4XMKL 4UT7H 4U0QB 5HHNA 1OGTA 1FZJA 2DWEB 3F6IA 4NO2A 4X4YA 1A2YA 4NO3A 4GXVL 3KS0H 1PEWA 5L7XL 4UAOB 4PPTA 4Y1AB 5FKAA 4APQB 3ROLA 5IP4A 2VJXA 3MRRB 4YHKL 5GSRA 2YUVA 1KYOJ 4XZUA 1DFBH 1N4XH 3F7PC 3D9AH 4L4VB 2H26B 4GAYA 3MSPA 3QUYA 4QHNB 1MCSA 4M48L 4CMMB 3VXUE 2IAMB 4PJIF 1H8SA 4FQQA 4QOKE 5J89A 1SJVA 2ZPKL 3DARA 4G6MH 4LF3A 1WV7T 2YPLB 4QRRB 4XNMA 2F74A 3U4BH 3V4VL 1J9CT 4Y16A 4D0CA 2R29L 2PCPA 1F58L 1A6AA 2HVJB 4YHIA 3ZSSA 3UC0L 1A6UL 3MRNB 4X8JA 1AO7E 1CT8A 4PLKD 1AFVL 4KMTL 3FB5A 1AD0B 5D93C 3QQ3A 1NAMH 1N0XL 4HJ0C 4ETQA 3PWJB 5FGRA 4TSCH 3QFDB 2QHLA 2CIKA 5H94B 5ETUA 1FGNH 4LOUD 3WUWB 4H8WH 4U05A 5HI5C 2CDEB 3IU3A 4QRPE 2YD6A 3V5KB 5GGRB 2XZZA 4BELD 1T6WA 1DDHA 1LK2A 1L6ZA 4Q0XL 1KLFA 1Z9SA 1ZLVK 4HLZG 4Z5RB 4XT1C 3G5YA 4O5LH 4XNQA 1YMHB 3V5HB 1P5UA 2CMRH 4UTAL 4B50A 4GFTB 4WI9A 5D7KD 4PGBA 5EOQH 1QSFD 1FL5B 2A0LC 3N1QC 3QAZC 4GT7A 4KI5D 3C6SA 1XR8B 1ZS8B 3EDKA 5FEBA 5C0IA 1NCAL 1B6DA 1FH5H 1VEPA 5HGGS 5C1MB 4CNIA 1FDLL 1G6RL 5GRJH 4JY4A 3TPKA 4P23B 4XPBH 4D8PA 3EAKA 4IRZH 1RD6A 4WJ5B 4JQIL 4YDJB 3HNTL 5LAXA 4M6MH 3WFHA 2VSDA 5JORB 1O5DT 1IGMH 2BRRL 2CUMA 4LLWA 5KVFL 3IDGA 4M1GH 4HPYL 2ENSA 4ZTOH 3K81A 5D7JD 3EDJA 4M1CC 1JJUA 3S5LB 3S34H 1XGTA 2MTPA 3GHEH 3FN0L 3CDCA 4PJGB 3WS6A 4M7ZB 1RK1A 2J4WL 2O5XH 4PRAA 1MQKL 1QFWL 3N06B 5DVKA 2VDQL 4DKFL 5C92A 4OCRH 5EPMA 4LRIC 1UH2A 5BVPL 4JVUA 1T20A 3EO9H 1CD1A 1XGRA 2AEPH 4LCWA 2YUWA 3WLBA 2WV3A 4S2SB 1Q0YL 2AXGA 5FFLA 4E5XA 2MFNA 2IH3B 4QT5A 1NFDE 2LU3A 3NOIA 1IGTB 5HD8D 2R0ZH 2HKFH 3WKNA 3HC4H 4OSUH 4HZLB 5I15H 5F7KC 4F57L 1T3FB 4JKLA 2R8SH 2P46B 4PRBA 5GZND 4EN3A 2UWEB 5JIIA 3CXDL 3U7WL 1AP2A 3EOTL 3M17A 2FIKA 4L4TD 3UYRL 1AD9A 5K9QI 3E1F1 1OM3H 3DVNA 3CSBA 4GAFB 3WJJC 1CFNB 4P2YA 4LVHC 5CP3H 1UT9A 3O6FB 3WBDA 5DFWH 3UBXA 3GM0A 1LO2L 4OIIL 4X9GA 4XHQA 2A6DB 3TA3A 2EKSA 3L5XH 3QXUA 3V4UH 4UIKL 1T1YB 4YE4L 3LKNB 4YHNB 2VQ1A 3CFJA 5K9QG 4NWTH 3EO0B 4QNPF 1P7KB 5T3XL 4HK3N 2DF3A 5F21B 4KGJA 3S37H 3T0BA 1Y0LB 1T0NA 4OFYD 1A7PH 4NN7C 4CVUA 3V0WL 4R7DB 4YHZL 2AXHA 1CFVL 4ORGA 1R0AH 5FYKD 1HQRA 3OJ2C 2GTWB 1U9KA 1NMAL 2OZ4L 4Y19B 1SBSH 4U31A 1MHEA 3WIFB 2CLZB 3HUJF 4Y4KB 5AAWA 3WHE0 5C08A 2W9LA 3PQYD 2FWOB 3D3VA 3KPRB 1CWVA 3VXRD 3HI6L 5ILTH 4ZUWA 3QJHA 3V6OA 2R1YA 4WDIB 2NY2D 4MJIE 4MA7H 1YEIH 2VERN 1YECL 4MX7B 1BM3H 25C8L 3CZFA 1RZFL 2A73A 3VDAA 4LPCA 4ZUVA 4LPWA 1YN6A 3DMMA 4HK0A 1W72B 2JELL 3RTQA 4R97C 4NUJB 5ISZE 4NSKA 3I6KA 4LASL 3EYUH 4J3TA 3V9FA 5GS2H 3RBGA 1I3RA 1KEGH 4NPYA 4KK5D 4WI4A 1S7WB 4RQQA 1C7TA 1EBAA 4JHWL 4OBRA 5BVJB 3AY4C 4L3EA 4MD4A 5CZKA 2NXYD 4G6AC 4G3YH 3UX9B 3L3DB 3IU4H 4H5SA 5CILH 1KPUB 2ITDA 3ZDYF 4U1SB 1CF8H 1MFBH 4K71B 5JXAH 4M5ZL 3SDXA 3OAUL 2V2TB 1T66C 4H20H 4I13B 4PJCE 3RWEA 4TUKL 1JYWA 4FFYL 2X4PB 3ECBA 2VNCA 2GK0B 4F33B 1P53A 4E0RA 3MRIB 5GISH 3QQ9D 3QI9A 4JPWL 2Y1VA 4WWKB 4GS7C 2BNRE 3VXUB 2HT3D 1RZ8A 4QOKB 2EE3A 2P45B 1MH5A 5I1KL 1OP3K 4WU7B 3PGCB 4F7EA 3EO1B 1G7HA 2WLZA 5EH1A 4PRDA 5CSZB 1QP1A 4M3KB 3GMQA 3O3DA 5I75C 4PV9B 1EHAA 5L6YH 1ORSB 1AO7B 1U3ZA 5F3HA 3LRSA 3HUJE 3JV4B 4FQ1L 3C8KA 2A6KB 1SJHA 3FO9B 4I18B 2VLLB 4NQDE 4PJXF 1VGKA 1KLGA 3H3BC 3IVKB 4OCMC 3MGAA 1NCUA 3PXHA 4C56A 4AIOA 3MRFA 5GSVB 3SDCC 2HH0L 2P8LA 4NKDB 4WCYH 3EDEA 4QRPB 4RISH 1HYSC 4NN6B 1FFNB 1L0QA 2DYPA 1QVOA 2IQ9L 4PJ8B 5D8JL 5DUBB 2I07B 3EGSB 5SWQB 4J3XA 4XMPL 4WTXA 3P9LA 5E8PB 4GRMA 5F70A 2DJUA 3LS4L 3X12B 1Z9LA 5ICXB 2X40A 1LP9E 1XGYL 5SV3A 1BVLB 1IGIL 3CVHH 2YBRA 3O4LD 3IKCA 4X6EB 3D0LB 1FQ9C 2ATPA 5CZXC 1IC7H 4OFDA 5DQDL 5J3HC 4LSSL 3I2CH 3QNXB 3TO2B 2M2DA 1BHGA 5D1XB 3N50A 2AJ3A 3QDGE 4OD1L 4PRNB 2AK4E 1XH3A 4DVBB 4EVNA 1AC6A 2JIXD 3ARFB 3TBTB 2DN7A 4BZ2L 4Y5XB 1EHXA 4OF7A 3BP4B 1F8TL 4GW5B 3BVNB 1N7ML 4YFLI 5I9QB 4CDHA 1A9EA 2ZUWA 3SDAD 1NL0L 4D94A 4UBDD 3Q0HA 1U8OB 1M1SA 1Y18A 3UZQA 5HBBA 3TVMA 3AAZA 3X13A 3DYMA 4L8BA 2Z9TA 2AABH 4Q9CA 3GMMA 3L5IA 3P30L 4BQ6A 3RNQA 4D9QE 4MQXD 4CADA 1MAKA 3KHQA 1OTTC 4K3DH 2CIIB 5SWZA 1N59A 1HIML 4FQIL 3QHTC 5DT1H 1DVFC 2P7TB 1S7UA 3MV9B 5HY9A 1KULA 1EUTA 3SDYH 1GSMA 2Y36H 1ZLSH 1LE5B 3DBXB 4PJXE 5HI3C 2VWEC 1IGCH 1NC2D 3IXAA 4PTUB 1TNMA 3VXPB 1NFDB 4KI1A 2Q7YA 3RA7H 2XG4A 1CXFA 3O0RH 5GIRA 3VFMA 2HMID 1LO0H 4P2OC 3ARGD 4XGZB 1WAAA 3RPIB 2AP2A 5C0BE 1L7IH 2O5ZL 4QHMA 1CGWA 3VW3H 1AXTL 4LLMB 4RCAA 1LQSR 1DQQA 4LKXA 2VAAA 3ZHDA 4YWGL 3EJYC 4IDJL 5M7QA 4YX2H 4CL7A 4ZXBB 5C86A 1NGYA 2D7OA 3VRIB 2FHCA 1KFAH 4J8RB 4UT7L 3VWJA 3HE7A 1ETZA 2ITCA 2IPUK 3GKWH 1RIUH 2R2EB 3K3QA 2C3VA 3P4MB 5HHQA 4U6VH 3G5ZB 3CSPA 1Q94B 1MCPL 3VFUB 4I2XB 4W68A 4FFWD 2P43B 1CR9H 4X7TA 5E5RB 5ANME 1UWGH 2OK0H 3CVIL 4ENED 3D9AL 5D2NA 5I1AA 3NTCH 2C1OB 1X6LA 3QO0A 4LCIH 2EYRB 4MNHB 1ITCA 4NUGL 5DF0A 5D7IE 3JV6B 4FN0A 3FOLA 3KYNA 5F1SA 3BIKA 1BD2D 2J12B 5BS0E 2BY3A 3DUHA 3K7UA 4JO2H 3U4BL 5DQ9A 1LDPH 5I1GH 2YXFA 1GC1C 1WFOA 3BP5B 4C59B 2Q76B 1RU9H 4N0CC 4TYUA 4LCCA 4IRSC 4PRPA 3BX7C 4MJIB 1A1OA 1BQHG 4EIGB 4Y1AD 4I0PC 4APQD 4Z7UB 1NAML 3PNWA 4LVOC 4DTGH 4TSCL 1TZGL 3MJ8B 3PP4H 1MCJA 4L4VD 1U8MA 2BRQA 3SQOH 2LU7A 5C6WH 3LEVH 2AAVA 3WEXA 2IAMD 2X4UA 4UB0H 5IT2H 3KLDA 3KPOB 4WGWB 5I1EH 5KSVA 1PGRB 3U0PA 3PL6B 2EYTB 4QRRD 1INQA 1LO5A 1DQDL 1TMCB 1MFEH 4YO0B 4O5LL 2YPKB 3NZ8A 2G5RA 2CMRL 4KRPB 5D1QC 5B8CA 5EOQL 3WS3A 4JANA 1U8PB 1YUHB 5DYOA 2G60H 1HHHB 5FB8B 1CK0H 3LD8C 3MGOB 1AHWA 1FH5L 2QKIB 3WNPA 3PV7A 3U4EB 2BNRB 4PRHB 2CRMA 3RQ3A 4KKBC 5E08H 4JZOA 1CFQA 5GRJL 2A6IA 4XPBL 4X6DF 3D0VB 4JLRA 2YZ8A 3K4AA 3V0AC 3VGGA 1T03H 3ARZA 3QWRD 1CGVA 4U1HB 1CGUA 1JK8A 2CO6B 4N0FA 1PZ5B 1ZGLM 1T1WB 2I9LA 1CCZA 3EHBD 1NGWB 1T7YA 5CMAA 3T65A 2KH2B 3P4OB 4LU5H 4M1GL 1OSZA 4ZTOL 5I71B 4GW4A 5IFJA 1FL6A 3S34L 3X17A 4I4WB 3GHEL 4FTVE 4PB0H 2FR4A 4X4ZA 4XI5C 2H1PL 3CUPA 2O5XL 4B7LA 4FQ2H 5C0EB 1N64H 2VXSH 3PV6B 3LMJH 3BFOA 1ACZA 3L3OA 4J6RH 4OCRL 3G9AB 2OBGA 4ZUUA 3HG1E 4E9LA 4WO4C 3BH8B 3EO9L 1K8IB 3TGXA 3MREB 3WHXA 4HHAA 1M71A 3SJVA 3DRTA 3TO4B 2ZOKB 5GJTH 2CR3A 3IFNH 4P5TB 5DD6A 1KXQE 4NC1E 4PREB 4R6UA 5IB4B 1WFTA 4MCYB 2HKFL 3B9VA 3CFDA 4HXAH 1S5HB 4OF6A 2EYSA 4TOYH 4G6JL 3QDGB 2AK4B 1WZ1L 1QLEH 2P47B 4NP4L 1EPFA 3E2HC 1IAII 5ACLA 1IL1A 1C5BH 1OM3L 5DD5H 3C09C 1H5BC 5F1IA 4DJMA 1G7LA 1MHPH 3KS0J 4PGCB 3U0WH 2IEPA 2E7MA 3CH1B 3ULUF 3AVEA 4X6DE 3L5XL 3TBYB 2NY0B 1P84K 1D6VH 2EDBA 3V4UL 4AM0A 4QXTA 3MBEA 2Q20A 1FZKA 1YDPB 2XN9B 3LQMA 4JFZH 1ZT4A 2E7CA 4UILL 3S37L 4C58B 1A7PL 4MNQB 3T1WA 4U0RB 5DI8A 1R0AL 5JIPA 2EXYD 3W39A 3C5ZB 1QNZL 5C07E 1A6ZA 1SBSL 2VB5A 5ACZB 3FONA 3L9RB 3TV3L 4KKLC 4S1QH 5H2BB 4AENB 4KK6D 1CE6A 5F96H 4V1DA 4NZRL 1UA6H 2HG5B 3L3HA 3QG7H 1BWMA 3O6FD 1QLRB 1RJYA 5ILTL 4P2QB 2ZUUA 4PJ7F 4LSVH 3T2NH 1HDMA 2ATKA 3HR5A 1YEIL 1BM3L 5IMOA 3SKMB 2LABA 1IKFH 3CMOH 5J6HB 3C60B 4XH2A 1MELA 3ALPA 3DRQA 4OM1L 3EYUL 1X44A 2YA0A 2V9RA 4KDWA 4KHXH 1KIQB 3BPCA 4MDJB 1SVCP 5J11B 4GXUN 3N1FC 2JK5B 3AXLA 4Y19D 5EIQA 3IFPB 4Z7OF 4FZ8H 4Y4KD 5E9DB 4G3YL 5T1KB 3WFDH 4CVXA 1BLNA 3IU4L 5CILL 1CF8L 1MFBL 4BFIB 1KB9K 3KPRD 5JXAL 3JSSA 5BZDA 4PJHA 5D96B 4H20L 3MXVH 4NNPL 5I8EA 4PTTA 2ZKHH 5ANMB 1W0WB 4G9DA 5GGTA 3VI3E 5HGBA 3SGDI 3MFFA 1QSEA 3SPVB 2DM3A 1PX3A 4Y4FB 5IG7A 1E4KC 3QIBA 1AGDA 1OP5H 3E8UH 3K2MC 5D7IB 5I17A 3W0WE 4DCQB 3BD5A 1I1AC 3BKMH 1YPZA 3VRLE 1E4XH 4P5KA 3IDMA 1WT5A 5KTEH 3H3PH 3G6AB 3PGDB 4JREB 3DI3B 1NBYB 3ESVF 1GZQB 1ZT7A 1WTLA 3KNBA 4KUCD 3MJGX 2RCSH 3TLRA 1J8HA 2RGSA 4HWZB 4ONHA 2VLKA 5EORH 5GS1C 4LDEB 3UPCA 3VD5A 4MMXC 4OF5A 4KAQH 1YEJH 1CDIA 4WI3A 4XTRC 4NCC2 7FABH 2D2OA 5EWIH 1IRAY 1G6RA 4UDUA 1B0GB 2HAZA 5FHBH 2BVOA 4LCWE 4WWKD 2E6PA 1RMFH 4XCFH 3VXUD 3FO2B 1A5FH 4WEUD 2PXYB 4NQTA 4RISL 4QOKD 3P4NB 3RVXD 3RHWK 3GMPB 4U7KA 1U6AH 4MWFB 3B2VH 4PGDA 3AGVA 1SBBA 1CLOH 3U30B 1INEL 1FNLA 4ODWB 1FNGB 4KMQA 2DI7A 1AGCB 1GOFA 1EEYA 3BKJH 1CG9A 1G9MC 1AIFB 1AO7D 3CVHL 1UM6L 3IETA 3WO3B 4Y4HC 2VTFA 1C7SA 1MRFH 3EYOB 3TZVB 1I8MB 3TNNA 1IC7L 3BZFB 3I2CL 5GRWA 4GKSB 4G8GE 3Q6GH 5DRZA 1FZMB 3QFJA 3QIUA 3L3KA 4QRPD 1FN4A 4AMKH 2NQCA 2M1KA 4PJ8D 1S7RB 5IW1B 2VIRB 5I8OH 5EFIB 3LRHA 2EIBA 3JV0A 2CKBH 2W91A 1WCBB 2AABL 4RAUA 2W38A 5FM8A 5H37G 2CLRA 2PTVA 2R69H 2AVGA 1WBYA 3QCTL 3S96A 3O3BB 4LHQB 5DT1L 3RWIA 4YPGA 5IW6A 2Y9RT 5B3JE 4YHYB 4JM2F 3VG0H 1JWSB 5D1XD 1V7MH 2QQQA 4ZS6C 3EOAA 1C16B 3F5WA 3SDYL 1K4CA 3CXHJ 4LPTA 1TVHA 3HG1B 4WFGE 2Y36L 3ARFD 5CIPH 1CTOA 1T80A 1DJSA 3TNMB 2GW5A 1IGCL 2X4OB 2YEZA 1LEKA 4GUPA 2LV4A 3V6OE 1NBVH 5INDB 3KJ6H 1HN1A 3ARQA 1MCDA 3RA7L 4ELMA 4LVEA 2Y25A 3O0RL 4DUVA 4M6NL 1LO0L 4OZFB 4ZTPL 4HIXH 4TQEH 3BD3A 5GRYA 3QUZA 1NJ9A 5GGUA 5TPWH 3VXNA 4PJ9B 4GRLC 4NRZB 5M95B 3H2WA 4GLRH 2H8PB 2PTUA 4MZ3A 5HHNB 1OGTB 1FZJB 2XYCA 3NACH 1N2RA 1U3HC 2XT1B 4NO2B 4X4YB 1A2YB 5F44A 4NO3B 3SDXE 4X80H 2UZXB 4S0SD 1KFAL 2H9GA 5FKAB 2AQ2A 3ROLB 1NMBH 2X1WL 5FA3A 3GKWL 3ZSTA 4K8RC 4YGVA 3OKEA 4GRWF 5GSRB 1R5IA 4TUOA 4U6VL 3LVEA 4XZUB 1KSRA 3EBAA 3S37X 3VXQA 4AEHH 1U41A 4GAYB 3QUYB 4FQHA 2PYFA 1CR9L 1UWGL 2OK0L 4FQQB 3MR9A 3NTCL 4LRNH 4ZS6D 4XNMB 3LPFA 4LCIL 2PNDA 3NCYP 2F74B 1YC7A 4D9QD 1IC4H 4Y16B 4D0CB 2PCPB 2ZCKL 3TWCL 2EECA 4HF5H 1A6AB 4YHIB 5D71H 4Z95H 4LP5A 2DMBA 4X8JB 4ZXBD 4JO2L 1CT8B 5F7UA 5DS8A 1TTUA 1CL7H 3FB5B 2D7MA 1P1ZA 3QQ3B 1P4IH 3S4SG 4ETQB 5F9OH 2H3NA 3O3EA 3FMGH 1H0DA 5IJVA 3QDME 2CIKB 2WINA 4C56E 1A3QA 1FVCA 1ED3A 1IQWH 5ETUB 2I25N 4DTGL 3IU3B 1P9MA 5EO1A 3PP4L 1DDHB 5BCAA 2NLJA 4TVPE 4TTGA 3SQOL 4JKWA 3RVTD 3G5YB 4XNQB 5IT2L 5C6PB 5A2JH 4FMFA 2JCCF 1KCKA 2DLEA 4PGBB 5E70A 3TM6A 1DBML 5C2BH 4Y88A 3C6SB 3IJYA 2EIZA 1CLCA 5C0IB 1ZVSA 3P4LA 4NQCE 4KVNL 1MFNA 1M05A 4MJID 4CNIB 4YHLH 4JN2A 2G60L 4JY4B 4QGTA 1I3GH 1CK0L 4TSAL 4D8PB 4GRWE 5EU6A 4RFOL<