5H2FO

Crystal structure of the psbm-deletion mutant of photosystem ii
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
243
structure length
243
Chain Sequence
TLTYDDIVGTGLANKCPTLDDTARGAYPIDSSQTYRIARLCLQPTTFLVKEEPKNKRQEAEFVPTKLVTRETTSLDQIQGELKVNSDGSLTFVEEDGIDFQPVTVQMAGGERIPLLFTVKNLVASTQPNVTSITTSTDFKGEFNVPSYRTANFLDPKGRGLASGYDSAIALPQAKEEELARANVKRFSLTKGQISLNVAKVDGRTGEIAGTFESEQLSDDDMGAHEPHEVKIQGVFYASIEPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutual relationships between structural and functional changes in a PsbM-deletion mutant of photosystem II.
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords Photosystem II protein D1 1
total genus 52
structure length 243
sequence length 243
chains with identical sequence o
ec nomenclature
pdb deposition date 2016-10-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.30 Mainly Beta Beta Barrel Porin Photosystem II, cytochrome c-550 precursor 5h2fO01
3.30.2050.10 Alpha Beta 2-Layer Sandwich photosynthetic oxygen evolving center fold photosynthetic oxygen evolving center domain 5h2fO02
5KAFO 5B5EO 2AXTO 3A0BO 1S5LO 5GTIO 5KAIO 5E79O 4UB8O 5G39A 5GTHO 5B66O 5H2FO 3WU2O 3JCUO 5G3AA 4PJ0O 3KZIO 4UB6O 4IL6O 3A0HO 5TISO 5G38A
chains in the Genus database with same CATH superfamily
3NSGA 4AYNA 2FGQX 2XE3A 3A2SX 2AXTO 2WVPA 3LK42 5GTIO 3SY7A 4CTDA 4KR4A 3HW9A 5KAIO 4AYID 4FSPA 3DWNA 4C69X 4RJXA 3PGUA 1GFNA 3PGSA 4N58A 4FUVA 1MPFA 1THQA 2Y0HA 3PQUA 4O3ZA 4UB8O 1PHOA 5DL6A 2W81C 3VE2A 4AKRB 3PGRA 2IWWA 4O49A 4O4UA 2LHFA 3AA0A 4K3BA 2PORA 4FRTA 3T20A 2KZ7A 4O4XA 3WU2O 3AA6B 4PR7A 1T1LA 4PJ0O 3KZIO 4G76A 4UB6O 3VE1A 3BRYA 1QJ9A 2M07A 4AZLA 2JQYA 2Y0KA 3AA1A 3NJTA 3SY9A 7PRNA 1MM4A 4B61A 5IYUA 3PRNA 1BH3A 4E1TA 3LK41 3HWBA 4FT6A 3T0SA 2F1TA 5TISO 3VY8X 2XE2A 4LSFA 4O3XB 4AFKA 4C00A 5B5EO 3A0BO 2MNHA 3UAQA 1IZNB 1MM5A 4AYEC 3V8UA 3UPGA 1T16A 4BUMX 4N74A 3DZMA 1ZHYA 2KXPA 3POQA 4GCPA 1OPFA 2R8AA 5DL5A 5PRNA 4F4BA 2K0LA 3HOLA 5D5DA 4FRXA 3RBHA 4E1SA 4K3CA 4C4VA 5FVNA 2X27X 4XNKA 5GTHO 3LK3A 4G75A 3HOEA 3G7GA 8PRNA 2R4LA 4FSOA 4QQ1A 1Q9FA 3PQSA 5T5FA 2Y2XA 2KC0A 2WJQA 4O3WA 1G90A 1P4TA 3LK2A 3GP6A 3DWOX 3QRAA 4LSEA 2ERVA 4RJWA 4GF4A 4D64A 1GFPA 5EE2A 2R4NA 3AA1B 3EMNX 2PRNA 2JMMA 3A0HO 4IL6O 4O3YA 2Y7SA 4AYDC 3BS0A 3JTYA 4AKMA 2N2LA 1ORMA 2F1CX 2ODJA 3BRZA 3FYXA 4D5UA 1HXTA 2MHLA 2IWVA 1S5LO 2KDYA 4JCHA 1ZHXA 4XNLA 1H6S1 3SYBA 3AA7B 5AFUK 4FZNA 2WJRA 3POXA 3QRCA 5GV0A 1QJPA 5ADXL 1GFQA 2KXPB 4AUIA 2F1VA 2OMFA 2XG6A 2J1NA 2XMXA 1ZHTA 5G39A 5DL8A 4AKRA 5ADXK 4FESA 2KZ7B 2R89A 4FOZA 3SZVA 2LFUA 1HXUA 1HXXA 3JCUO 2K4TA 2ZFGA 4U9CA 5G3AA 3AAEA 1Q9GA 3AA6A 2XTRA 4N59A 4D65A 4Z3TA 3DA3A 3LK2B 4GCSA 3PORA 2Y0LA 3VZTX 4KR8A 3AAAA 2FGRA 3PF1A 2XE5A 4FZMA 3TZGA 3WI5A 4JFBA 4FZLA 3SZDA 1QJ8A 5G38A 6PRNA 1ZHWA 5DL7A 3KVDD 5KAFO 1IZNA 3C5OA 2ZLDA 1OSMA 3DA4A 5G26A 4FMSA 1BXWA 3AA7A 3T24A 2R88A 3VZUX 3K19A 5AFUL 2N2MA 1GFMA 5E79O 4PUXA 3POUA 4LSIA 2M06A 1BT9A 3AA0B 4GHBA 3VZWX 3LK3B 2W80C 4LSHA 4C4VB 2XTQA 4RLCA 5B66O 2J4UP 2R4OA 5H2FO 4KRAA 5JDPA 2QTKA 2R4PA 2XE1A 1PRNA 2O4VA 1YS5A 3VY9X 3SYSA 1GFOA 3AAEB 2X9KA 4N75A 4RL9A 3WI4A 3O0EA 1ZHZA 4GCQA 3UU2A 4FQEA 2GE4A 2YNKA 3AAAB 4AYMC 4RLBA 1E54A 2YPVA
chains in the Genus database with same CATH topology
5KAFO 5B5EO 2AXTO 3A0BO 1S5LO 5GTIO 5KAIO 5E79O 4UB8O 5G39A 5GTHO 5B66O 5H2FO 3WU2O 3JCUO 5G3AA 4PJ0O 3KZIO 4UB6O 4IL6O 3A0HO 5TISO 5G38A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KAF O;  5B5E O;  2AXT O;  3A0B O;  1S5L O;  5GTI O;  5KAI O;  5E79 O;  4UB8 O;  5G39 A;  5GTH O;  5B66 O;  5H2F O;  3WU2 O;  3JCU O;  5G3A A;  4PJ0 O;  3KZI O;  4UB6 O;  4IL6 O;  3A0H O;  5TIS O;  5G38 A; 
#chains in the Genus database with same CATH topology
 3NSG A;  4AYN A;  2FGQ X;  2XE3 A;  3A2S X;  2AXT O;  2WVP A;  3LK4 2;  5GTI O;  3SY7 A;  4CTD A;  4KR4 A;  3HW9 A;  5KAI O;  4AYI D;  4FSP A;  3DWN A;  4C69 X;  4RJX A;  3PGU A;  1GFN A;  3PGS A;  4N58 A;  4FUV A;  1MPF A;  1THQ A;  2Y0H A;  3PQU A;  4O3Z A;  4UB8 O;  1PHO A;  5DL6 A;  2W81 C;  3VE2 A;  4AKR B;  3PGR A;  2IWW A;  4O49 A;  4O4U A;  2LHF A;  3AA0 A;  4K3B A;  2POR A;  4FRT A;  3T20 A;  2KZ7 A;  4O4X A;  3WU2 O;  3AA6 B;  4PR7 A;  1T1L A;  4PJ0 O;  3KZI O;  4G76 A;  4UB6 O;  3VE1 A;  3BRY A;  1QJ9 A;  2M07 A;  4AZL A;  2JQY A;  2Y0K A;  3AA1 A;  3NJT A;  3SY9 A;  7PRN A;  1MM4 A;  4B61 A;  5IYU A;  3PRN A;  1BH3 A;  4E1T A;  3LK4 1;  3HWB A;  4FT6 A;  3T0S A;  2F1T A;  5TIS O;  3VY8 X;  2XE2 A;  4LSF A;  4O3X B;  4AFK A;  4C00 A;  5B5E O;  3A0B O;  2MNH A;  3UAQ A;  1IZN B;  1MM5 A;  4AYE C;  3V8U A;  3UPG A;  1T16 A;  4BUM X;  4N74 A;  3DZM A;  1ZHY A;  2KXP A;  3POQ A;  4GCP A;  1OPF A;  2R8A A;  5DL5 A;  5PRN A;  4F4B A;  2K0L A;  3HOL A;  5D5D A;  4FRX A;  3RBH A;  4E1S A;  4K3C A;  4C4V A;  5FVN A;  2X27 X;  4XNK A;  5GTH O;  3LK3 A;  4G75 A;  3HOE A;  3G7G A;  8PRN A;  2R4L A;  4FSO A;  4QQ1 A;  1Q9F A;  3PQS A;  5T5F A;  2Y2X A;  2KC0 A;  2WJQ A;  4O3W A;  1G90 A;  1P4T A;  3LK2 A;  3GP6 A;  3DWO X;  3QRA A;  4LSE A;  2ERV A;  4RJW A;  4GF4 A;  4D64 A;  1GFP A;  5EE2 A;  2R4N A;  3AA1 B;  3EMN X;  2PRN A;  2JMM A;  3A0H O;  4IL6 O;  4O3Y A;  2Y7S A;  4AYD C;  3BS0 A;  3JTY A;  4AKM A;  2N2L A;  1ORM A;  2F1C X;  2ODJ A;  3BRZ A;  3FYX A;  4D5U A;  1HXT A;  2MHL A;  2IWV A;  1S5L O;  2KDY A;  4JCH A;  1ZHX A;  4XNL A;  1H6S 1;  3SYB A;  3AA7 B;  5AFU K;  4FZN A;  2WJR A;  3POX A;  3QRC A;  5GV0 A;  1QJP A;  5ADX L;  1GFQ A;  2KXP B;  4AUI A;  2F1V A;  2OMF A;  2XG6 A;  2J1N A;  2XMX A;  1ZHT A;  5G39 A;  5DL8 A;  4AKR A;  5ADX K;  4FES A;  2KZ7 B;  2R89 A;  4FOZ A;  3SZV A;  2LFU A;  1HXU A;  1HXX A;  3JCU O;  2K4T A;  2ZFG A;  4U9C A;  5G3A A;  3AAE A;  1Q9G A;  3AA6 A;  2XTR A;  4N59 A;  4D65 A;  4Z3T A;  3DA3 A;  3LK2 B;  4GCS A;  3POR A;  2Y0L A;  3VZT X;  4KR8 A;  3AAA A;  2FGR A;  3PF1 A;  2XE5 A;  4FZM A;  3TZG A;  3WI5 A;  4JFB A;  4FZL A;  3SZD A;  1QJ8 A;  5G38 A;  6PRN A;  1ZHW A;  5DL7 A;  3KVD D;  5KAF O;  1IZN A;  3C5O A;  2ZLD A;  1OSM A;  3DA4 A;  5G26 A;  4FMS A;  1BXW A;  3AA7 A;  3T24 A;  2R88 A;  3VZU X;  3K19 A;  5AFU L;  2N2M A;  1GFM A;  5E79 O;  4PUX A;  3POU A;  4LSI A;  2M06 A;  1BT9 A;  3AA0 B;  4GHB A;  3VZW X;  3LK3 B;  2W80 C;  4LSH A;  4C4V B;  2XTQ A;  4RLC A;  5B66 O;  2J4U P;  2R4O A;  5H2F O;  4KRA A;  5JDP A;  2QTK A;  2R4P A;  2XE1 A;  1PRN A;  2O4V A;  1YS5 A;  3VY9 X;  3SYS A;  1GFO A;  3AAE B;  2X9K A;  4N75 A;  4RL9 A;  3WI4 A;  3O0E A;  1ZHZ A;  4GCQ A;  3UU2 A;  4FQE A;  2GE4 A;  2YNK A;  3AAA B;  4AYM C;  4RLB A;  1E54 A;  2YPV A; 
#chains in the Genus database with same CATH homology
 5KAF O;  5B5E O;  2AXT O;  3A0B O;  1S5L O;  5GTI O;  5KAI O;  5E79 O;  4UB8 O;  5G39 A;  5GTH O;  5B66 O;  5H2F O;  3WU2 O;  3JCU O;  5G3A A;  4PJ0 O;  3KZI O;  4UB6 O;  4IL6 O;  3A0H O;  5TIS O;  5G38 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...