5H2FO

Crystal structure of the psbm-deletion mutant of photosystem ii
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
243
structure length
243
Chain Sequence
TLTYDDIVGTGLANKCPTLDDTARGAYPIDSSQTYRIARLCLQPTTFLVKEEPKNKRQEAEFVPTKLVTRETTSLDQIQGELKVNSDGSLTFVEEDGIDFQPVTVQMAGGERIPLLFTVKNLVASTQPNVTSITTSTDFKGEFNVPSYRTANFLDPKGRGLASGYDSAIALPQAKEEELARANVKRFSLTKGQISLNVAKVDGRTGEIAGTFESEQLSDDDMGAHEPHEVKIQGVFYASIEPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutual relationships between structural and functional changes in a PsbM-deletion mutant of photosystem II.
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords Photosystem II protein D1 1
total genus 52
structure length 243
sequence length 243
chains with identical sequence o
ec nomenclature
pdb deposition date 2016-10-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.30 Mainly Beta Beta Barrel Porin Photosystem II, cytochrome c-550 precursor 5h2fO01
3.30.2050.10 Alpha Beta 2-Layer Sandwich photosynthetic oxygen evolving center fold photosynthetic oxygen evolving center domain 5h2fO02
5G39A 4UB6O 5GTIO 5H2FO 5TISO 3A0BO 4IL6O 3KZIO 5KAFO 1S5LO 3A0HO 4UB8O 5G3AA 3JCUO 5G38A 3WU2O 5GTHO 5KAIO 2AXTO 5E79O 5B5EO 5B66O 4PJ0O
chains in the Genus database with same CATH superfamily
1H6S1 3BRYA 3QRCA 3AAAB 1QJ9A 6PRNA 3G7GA 2KXPB 1T16A 1GFOA 4K3CA 2XTRA 4XNKA 4AUIA 1GFNA 3C5OA 5DL5A 5T5FA 3DA3A 4FZLA 3AA6B 4RJWA 4O3ZA 1MPFA 5G39A 4FSPA 4G75A 2KDYA 2KZ7A 4JFBA 3HOEA 2F1VA 2K0LA 3SZVA 1ZHYA 5IYUA 3T20A 4FRTA 4G76A 4XNLA 1IZNA 2PRNA 3VZUX 4IL6O 2N2LA 2K4TA 4GCQA 3SZDA 4FSOA 1S5LO 4GF4A 3AA1B 1THQA 4UB8O 3WU2O 5DL8A 3LK41 2LFUA 4PUXA 4N59A 4O4XA 4N58A 4LSIA 4FZMA 2R4PA 3WI4A 4KRAA 3DA4A 3BRZA 3AAEA 4QQ1A 3BS0A 2XTQA 2J4UP 2KXPA 2WJQA 4RLCA 2Y0KA 2XE1A 3AA7A 3AA1A 3PGSA 2O4VA 3VZTX 4GHBA 4GCPA 3KVDD 1IZNB 1PHOA 3POXA 4CTDA 1G90A 2Y7SA 3LK2A 4UB6O 1QJ8A 4AKRA 1MM5A 3HOLA 4AYNA 5H2FO 4O3YA 4N75A 3VZWX 3A0BO 1HXTA 2XG6A 1T1LA 4N74A 4FT6A 5KAFO 2Y0HA 4F4BA 2R4OA 2OMFA 2XE3A 5DL7A 3JCUO 3DZMA 2JMMA 3AAAA 3LK3B 4FRXA 2N2MA 3WI5A 5DL6A 2AXTO 2FGQX 4FQEA 2M07A 3LK42 3PORA 5KAIO 4AYID 1YS5A 2QTKA 4LSFA 3VY8X 2R89A 1GFPA 2XE5A 3EMNX 4FMSA 3DWNA 3PGUA 3AA0B 3QRAA 3SY9A 3VE1A 2R8AA 3PGRA 4KR4A 4O3XB 2FGRA 2MHLA 3NJTA 2ERVA 2X27X 5EE2A 3UPGA 3VY9X 2F1TA 4AZLA 4LSEA 2YPVA 4AKRB 4LSHA 1BT9A 5G26A 1ZHTA 4B61A 1Q9GA 1BH3A 4C4VB 7PRNA 2IWVA 1HXXA 2J1NA 4AYMC 4C00A 1ZHXA 2Y0LA 2R88A 3UU2A 4GCSA 3TZGA 3A0HO 5G3AA 4C69X 5G38A 5AFUL 1PRNA 2ZFGA 4AYDC 5AFUK 1GFQA 2GE4A 4JCHA 2R4NA 1OPFA 4K3BA 3AA0A 3SY7A 2Y2XA 3PRNA 3VE2A 4C4VA 3PF1A 8PRNA 5PRNA 5GTHO 2LHFA 4PR7A 2KZ7B 4FESA 2ZLDA 4O49A 5B66O 1E54A 3A2SX 2W81C 3RBHA 5D5DA 2W80C 3AA6A 3GP6A 3POUA 3POQA 3HW9A 3PQUA 3PQSA 4Z3TA 3HWBA 5ADXL 2ODJA 3FYXA 2IWWA 4O3WA 3SYSA 4AYEC 4D65A 1ORMA 4BUMX 4D64A 1P4TA 5JDPA 4U9CA 3DWOX 3T24A 1BXWA 1Q9FA 3AAEB 3UAQA 3V8UA 1OSMA 4D5UA 4E1TA 3K19A 4FOZA 4O4UA 2M06A 5GTIO 2KC0A 5TISO 3LK3A 1ZHWA 1MM4A 4AKMA 4KR8A 3T0SA 5GV0A 4FUVA 4RLBA 2XMXA 1GFMA 2WJRA 2R4LA 2WVPA 3JTYA 4AFKA 3KZIO 4E1SA 5ADXK 1HXUA 2XE2A 3AA7B 2PORA 5FVNA 3SYBA 2X9KA 3O0EA 4RL9A 5E79O 3LK2B 5B5EO 4RJXA 3NSGA 4FZNA 2JQYA 2YNKA 4PJ0O 2MNHA 2F1CX 1QJPA 1ZHZA
chains in the Genus database with same CATH topology
5G39A 4UB6O 5GTIO 5H2FO 5TISO 3A0BO 4IL6O 3KZIO 5KAFO 1S5LO 3A0HO 4UB8O 5G3AA 3JCUO 5G38A 3WU2O 5GTHO 5KAIO 2AXTO 5E79O 5B5EO 5B66O 4PJ0O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5G39 A;  4UB6 O;  5GTI O;  5H2F O;  5TIS O;  3A0B O;  4IL6 O;  3KZI O;  5KAF O;  1S5L O;  3A0H O;  4UB8 O;  5G3A A;  3JCU O;  5G38 A;  3WU2 O;  5GTH O;  5KAI O;  2AXT O;  5E79 O;  5B5E O;  5B66 O;  4PJ0 O; 
#chains in the Genus database with same CATH topology
 1H6S 1;  3BRY A;  3QRC A;  3AAA B;  1QJ9 A;  6PRN A;  3G7G A;  2KXP B;  1T16 A;  1GFO A;  4K3C A;  2XTR A;  4XNK A;  4AUI A;  1GFN A;  3C5O A;  5DL5 A;  5T5F A;  3DA3 A;  4FZL A;  3AA6 B;  4RJW A;  4O3Z A;  1MPF A;  5G39 A;  4FSP A;  4G75 A;  2KDY A;  2KZ7 A;  4JFB A;  3HOE A;  2F1V A;  2K0L A;  3SZV A;  1ZHY A;  5IYU A;  3T20 A;  4FRT A;  4G76 A;  4XNL A;  1IZN A;  2PRN A;  3VZU X;  4IL6 O;  2N2L A;  2K4T A;  4GCQ A;  3SZD A;  4FSO A;  1S5L O;  4GF4 A;  3AA1 B;  1THQ A;  4UB8 O;  3WU2 O;  5DL8 A;  3LK4 1;  2LFU A;  4PUX A;  4N59 A;  4O4X A;  4N58 A;  4LSI A;  4FZM A;  2R4P A;  3WI4 A;  4KRA A;  3DA4 A;  3BRZ A;  3AAE A;  4QQ1 A;  3BS0 A;  2XTQ A;  2J4U P;  2KXP A;  2WJQ A;  4RLC A;  2Y0K A;  2XE1 A;  3AA7 A;  3AA1 A;  3PGS A;  2O4V A;  3VZT X;  4GHB A;  4GCP A;  3KVD D;  1IZN B;  1PHO A;  3POX A;  4CTD A;  1G90 A;  2Y7S A;  3LK2 A;  4UB6 O;  1QJ8 A;  4AKR A;  1MM5 A;  3HOL A;  4AYN A;  5H2F O;  4O3Y A;  4N75 A;  3VZW X;  3A0B O;  1HXT A;  2XG6 A;  1T1L A;  4N74 A;  4FT6 A;  5KAF O;  2Y0H A;  4F4B A;  2R4O A;  2OMF A;  2XE3 A;  5DL7 A;  3JCU O;  3DZM A;  2JMM A;  3AAA A;  3LK3 B;  4FRX A;  2N2M A;  3WI5 A;  5DL6 A;  2AXT O;  2FGQ X;  4FQE A;  2M07 A;  3LK4 2;  3POR A;  5KAI O;  4AYI D;  1YS5 A;  2QTK A;  4LSF A;  3VY8 X;  2R89 A;  1GFP A;  2XE5 A;  3EMN X;  4FMS A;  3DWN A;  3PGU A;  3AA0 B;  3QRA A;  3SY9 A;  3VE1 A;  2R8A A;  3PGR A;  4KR4 A;  4O3X B;  2FGR A;  2MHL A;  3NJT A;  2ERV A;  2X27 X;  5EE2 A;  3UPG A;  3VY9 X;  2F1T A;  4AZL A;  4LSE A;  2YPV A;  4AKR B;  4LSH A;  1BT9 A;  5G26 A;  1ZHT A;  4B61 A;  1Q9G A;  1BH3 A;  4C4V B;  7PRN A;  2IWV A;  1HXX A;  2J1N A;  4AYM C;  4C00 A;  1ZHX A;  2Y0L A;  2R88 A;  3UU2 A;  4GCS A;  3TZG A;  3A0H O;  5G3A A;  4C69 X;  5G38 A;  5AFU L;  1PRN A;  2ZFG A;  4AYD C;  5AFU K;  1GFQ A;  2GE4 A;  4JCH A;  2R4N A;  1OPF A;  4K3B A;  3AA0 A;  3SY7 A;  2Y2X A;  3PRN A;  3VE2 A;  4C4V A;  3PF1 A;  8PRN A;  5PRN A;  5GTH O;  2LHF A;  4PR7 A;  2KZ7 B;  4FES A;  2ZLD A;  4O49 A;  5B66 O;  1E54 A;  3A2S X;  2W81 C;  3RBH A;  5D5D A;  2W80 C;  3AA6 A;  3GP6 A;  3POU A;  3POQ A;  3HW9 A;  3PQU A;  3PQS A;  4Z3T A;  3HWB A;  5ADX L;  2ODJ A;  3FYX A;  2IWW A;  4O3W A;  3SYS A;  4AYE C;  4D65 A;  1ORM A;  4BUM X;  4D64 A;  1P4T A;  5JDP A;  4U9C A;  3DWO X;  3T24 A;  1BXW A;  1Q9F A;  3AAE B;  3UAQ A;  3V8U A;  1OSM A;  4D5U A;  4E1T A;  3K19 A;  4FOZ A;  4O4U A;  2M06 A;  5GTI O;  2KC0 A;  5TIS O;  3LK3 A;  1ZHW A;  1MM4 A;  4AKM A;  4KR8 A;  3T0S A;  5GV0 A;  4FUV A;  4RLB A;  2XMX A;  1GFM A;  2WJR A;  2R4L A;  2WVP A;  3JTY A;  4AFK A;  3KZI O;  4E1S A;  5ADX K;  1HXU A;  2XE2 A;  3AA7 B;  2POR A;  5FVN A;  3SYB A;  2X9K A;  3O0E A;  4RL9 A;  5E79 O;  3LK2 B;  5B5E O;  4RJX A;  3NSG A;  4FZN A;  2JQY A;  2YNK A;  4PJ0 O;  2MNH A;  2F1C X;  1QJP A;  1ZHZ A; 
#chains in the Genus database with same CATH homology
 5G39 A;  4UB6 O;  5GTI O;  5H2F O;  5TIS O;  3A0B O;  4IL6 O;  3KZI O;  5KAF O;  1S5L O;  3A0H O;  4UB8 O;  5G3A A;  3JCU O;  5G38 A;  3WU2 O;  5GTH O;  5KAI O;  2AXT O;  5E79 O;  5B5E O;  5B66 O;  4PJ0 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...