5H2FO

Crystal structure of the psbm-deletion mutant of photosystem ii
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
243
structure length
243
Chain Sequence
b'TLTYDDIVGTGLANKCPTLDDTARGAYPIDSSQTYRIARLCLQPTTFLVKEEPKNKRQEAEFVPTKLVTRETTSLDQIQGELKVNSDGSLTFVEEDGIDFQPVTVQMAGGERIPLLFTVKNLVASTQPNVTSITTSTDFKGEFNVPSYRTANFLDPKGRGLASGYDSAIALPQAKEEELARANVKRFSLTKGQISLNVAKVDGRTGEIAGTFESEQLSDDDMGAHEPHEVKIQGVFYASIEPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem II protein D1 1
publication title Mutual relationships between structural and functional changes in a PsbM-deletion mutant of photosystem II.
pubmed doi rcsb
molecule tags Photosynthesis
total genus 52
structure length 243
sequence length 243
chains with identical sequence o
ec nomenclature
pdb deposition date 2016-10-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.30 Mainly Beta Beta Barrel Porin Photosystem II, cytochrome c-550 precursor 5h2fO01
3.30.2050.10 Alpha Beta 2-Layer Sandwich photosynthetic oxygen evolving center fold photosynthetic oxygen evolving center domain 5h2fO02
3WU2O 5TISO 1S5LO 3JCUO 5B66O 4UB8O 4IL6O 3KZIO 5GTHO 5G38A 5G39A 3A0BO 2AXTO 5E79O 5H2FO 5G3AA 5B5EO 5KAFO 4PJ0O 3A0HO 5GTIO 5KAIO 4UB6O
chains in the Genus database with same CATH superfamily
2XTRA 2KXPB 2ODJA 4G75A 1G90A 3DWNA 2XG6A 3LK42 2F1VA 4AYDC 4FZMA 4AYNA 4LSIA 3SZVA 5DL7A 2R89A 3DWOX 2M06A 2Y0HA 3KVDD 4AYID 3QRCA 4E1TA 4O3ZA 2N2MA 4FRXA 3KZIO 4C00A 1QJ9A 5GTHO 4C69X 1BXWA 3BRZA 5FVNA 4D64A 2KZ7B 3G7GA 3T20A 4O3XB 2J4UP 1ZHYA 4FRTA 5G38A 1T16A 3AA1A 3UAQA 2F1TA 2QTKA 3PRNA 4GCPA 5ADXK 1ZHTA 5DL8A 1BH3A 4O3YA 5G3AA 3V8UA 2K4TA 2WVPA 2XE5A 4Z3TA 4RJXA 2XE2A 3PORA 6PRNA 3POUA 4D5UA 1GFNA 1GFQA 1Q9GA 2F1CX 4FT6A 5GTIO 5KAIO 2IWVA 2PRNA 4FZNA 2XTQA 3LK2B 3POQA 4N59A 3WU2O 2K0LA 3AA6A 3DZMA 4KRAA 4CTDA 2W80C 4KR8A 3SZDA 1S5LO 3AAAB 7PRNA 3RBHA 4FOZA 5ADXL 5B66O 3PQUA 3BRYA 4XNLA 4AYMC 3TZGA 2LHFA 1GFPA 2X9KA 4AYEC 4RLBA 3T0SA 4O3WA 3EMNX 4O49A 2Y2XA 2Y0KA 3JTYA 1MPFA 1HXUA 2XMXA 3A0BO 3GP6A 1HXXA 2WJQA 1PHOA 3SY7A 4O4UA 3AA7B 3AAEA 3LK3B 3VY8X 2R8AA 3HOLA 2XE1A 4RL9A 2R88A 2R4NA 2ZLDA 2M07A 3C5OA 5EE2A 4LSFA 1GFOA 2YNKA 1OPFA 4AKRB 1BT9A 4C4VA 4AUIA 2KC0A 2R4OA 4N75A 5TISO 3VZUX 2Y0LA 3HW9A 3T24A 3DA4A 4JCHA 4BUMX 1IZNA 1Q9FA 4G76A 1ORMA 4FUVA 3UU2A 1QJ8A 3LK2A 3PGUA 4AFKA 1MM5A 2FGRA 4UB8O 3VE1A 2KXPA 1HXTA 2WJRA 3AA1B 3AA0B 2W81C 4FSPA 3AAAA 4IL6O 4U9CA 1MM4A 3PQSA 1PRNA 4KR4A 4AZLA 4PUXA 5AFUK 4GCSA 1ZHWA 2ERVA 5GV0A 2KDYA 3NJTA 4FQEA 4N58A 4K3CA 2FGQX 4PR7A 4RJWA 2AXTO 5E79O 4GHBA 1THQA 2Y7SA 2YPVA 2KZ7A 4K3BA 2J1NA 4N74A 5DL6A 3UPGA 3A2SX 3HOEA 4E1SA 4RLCA 3A0HO 4UB6O 3JCUO 3VE2A 3SYSA 2JQYA 5D5DA 1E54A 3PF1A 4LSHA 5G26A 5AFUL 2O4VA 1ZHXA 4GCQA 1QJPA 4AKRA 2PORA 3BS0A 4XNKA 4LSEA 3PGSA 5IYUA 2R4LA 2OMFA 3HWBA 4JFBA 5T5FA 8PRNA 3WI5A 5JDPA 5DL5A 3VY9X 3AAEB 3DA3A 1ZHZA 4FMSA 1OSMA 3SY9A 4D65A 4F4BA 1GFMA 3AA0A 4FSOA 2MHLA 2ZFGA 4FZLA 3SYBA 3WI4A 5G39A 3PGRA 4O4XA 2XE3A 2GE4A 5H2FO 2R4PA 1P4TA 3O0EA 1T1LA 3LK41 2MNHA 3FYXA 4GF4A 4FESA 4C4VB 2IWWA 3NSGA 3VZWX 2X27X 5B5EO 5KAFO 3K19A 3AA6B 2JMMA 3POXA 4PJ0O 3QRAA 1IZNB 1H6S1 1YS5A 2LFUA 4AKMA 3VZTX 4B61A 3AA7A 3LK3A 4QQ1A 2N2LA 5PRNA
chains in the Genus database with same CATH topology
3WU2O 5TISO 1S5LO 3JCUO 5B66O 4UB8O 4IL6O 3KZIO 5GTHO 5G38A 5G39A 3A0BO 2AXTO 5E79O 5H2FO 5G3AA 5B5EO 5KAFO 4PJ0O 3A0HO 5GTIO 5KAIO 4UB6O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WU2 O;  5TIS O;  1S5L O;  3JCU O;  5B66 O;  4UB8 O;  4IL6 O;  3KZI O;  5GTH O;  5G38 A;  5G39 A;  3A0B O;  2AXT O;  5E79 O;  5H2F O;  5G3A A;  5B5E O;  5KAF O;  4PJ0 O;  3A0H O;  5GTI O;  5KAI O;  4UB6 O; 
#chains in the Genus database with same CATH topology
 2XTR A;  2KXP B;  2ODJ A;  4G75 A;  1G90 A;  3DWN A;  2XG6 A;  3LK4 2;  2F1V A;  4AYD C;  4FZM A;  4AYN A;  4LSI A;  3SZV A;  5DL7 A;  2R89 A;  3DWO X;  2M06 A;  2Y0H A;  3KVD D;  4AYI D;  3QRC A;  4E1T A;  4O3Z A;  2N2M A;  4FRX A;  3KZI O;  4C00 A;  1QJ9 A;  5GTH O;  4C69 X;  1BXW A;  3BRZ A;  5FVN A;  4D64 A;  2KZ7 B;  3G7G A;  3T20 A;  4O3X B;  2J4U P;  1ZHY A;  4FRT A;  5G38 A;  1T16 A;  3AA1 A;  3UAQ A;  2F1T A;  2QTK A;  3PRN A;  4GCP A;  5ADX K;  1ZHT A;  5DL8 A;  1BH3 A;  4O3Y A;  5G3A A;  3V8U A;  2K4T A;  2WVP A;  2XE5 A;  4Z3T A;  4RJX A;  2XE2 A;  3POR A;  6PRN A;  3POU A;  4D5U A;  1GFN A;  1GFQ A;  1Q9G A;  2F1C X;  4FT6 A;  5GTI O;  5KAI O;  2IWV A;  2PRN A;  4FZN A;  2XTQ A;  3LK2 B;  3POQ A;  4N59 A;  3WU2 O;  2K0L A;  3AA6 A;  3DZM A;  4KRA A;  4CTD A;  2W80 C;  4KR8 A;  3SZD A;  1S5L O;  3AAA B;  7PRN A;  3RBH A;  4FOZ A;  5ADX L;  5B66 O;  3PQU A;  3BRY A;  4XNL A;  4AYM C;  3TZG A;  2LHF A;  1GFP A;  2X9K A;  4AYE C;  4RLB A;  3T0S A;  4O3W A;  3EMN X;  4O49 A;  2Y2X A;  2Y0K A;  3JTY A;  1MPF A;  1HXU A;  2XMX A;  3A0B O;  3GP6 A;  1HXX A;  2WJQ A;  1PHO A;  3SY7 A;  4O4U A;  3AA7 B;  3AAE A;  3LK3 B;  3VY8 X;  2R8A A;  3HOL A;  2XE1 A;  4RL9 A;  2R88 A;  2R4N A;  2ZLD A;  2M07 A;  3C5O A;  5EE2 A;  4LSF A;  1GFO A;  2YNK A;  1OPF A;  4AKR B;  1BT9 A;  4C4V A;  4AUI A;  2KC0 A;  2R4O A;  4N75 A;  5TIS O;  3VZU X;  2Y0L A;  3HW9 A;  3T24 A;  3DA4 A;  4JCH A;  4BUM X;  1IZN A;  1Q9F A;  4G76 A;  1ORM A;  4FUV A;  3UU2 A;  1QJ8 A;  3LK2 A;  3PGU A;  4AFK A;  1MM5 A;  2FGR A;  4UB8 O;  3VE1 A;  2KXP A;  1HXT A;  2WJR A;  3AA1 B;  3AA0 B;  2W81 C;  4FSP A;  3AAA A;  4IL6 O;  4U9C A;  1MM4 A;  3PQS A;  1PRN A;  4KR4 A;  4AZL A;  4PUX A;  5AFU K;  4GCS A;  1ZHW A;  2ERV A;  5GV0 A;  2KDY A;  3NJT A;  4FQE A;  4N58 A;  4K3C A;  2FGQ X;  4PR7 A;  4RJW A;  2AXT O;  5E79 O;  4GHB A;  1THQ A;  2Y7S A;  2YPV A;  2KZ7 A;  4K3B A;  2J1N A;  4N74 A;  5DL6 A;  3UPG A;  3A2S X;  3HOE A;  4E1S A;  4RLC A;  3A0H O;  4UB6 O;  3JCU O;  3VE2 A;  3SYS A;  2JQY A;  5D5D A;  1E54 A;  3PF1 A;  4LSH A;  5G26 A;  5AFU L;  2O4V A;  1ZHX A;  4GCQ A;  1QJP A;  4AKR A;  2POR A;  3BS0 A;  4XNK A;  4LSE A;  3PGS A;  5IYU A;  2R4L A;  2OMF A;  3HWB A;  4JFB A;  5T5F A;  8PRN A;  3WI5 A;  5JDP A;  5DL5 A;  3VY9 X;  3AAE B;  3DA3 A;  1ZHZ A;  4FMS A;  1OSM A;  3SY9 A;  4D65 A;  4F4B A;  1GFM A;  3AA0 A;  4FSO A;  2MHL A;  2ZFG A;  4FZL A;  3SYB A;  3WI4 A;  5G39 A;  3PGR A;  4O4X A;  2XE3 A;  2GE4 A;  5H2F O;  2R4P A;  1P4T A;  3O0E A;  1T1L A;  3LK4 1;  2MNH A;  3FYX A;  4GF4 A;  4FES A;  4C4V B;  2IWW A;  3NSG A;  3VZW X;  2X27 X;  5B5E O;  5KAF O;  3K19 A;  3AA6 B;  2JMM A;  3POX A;  4PJ0 O;  3QRA A;  1IZN B;  1H6S 1;  1YS5 A;  2LFU A;  4AKM A;  3VZT X;  4B61 A;  3AA7 A;  3LK3 A;  4QQ1 A;  2N2L A;  5PRN A; 
#chains in the Genus database with same CATH homology
 3WU2 O;  5TIS O;  1S5L O;  3JCU O;  5B66 O;  4UB8 O;  4IL6 O;  3KZI O;  5GTH O;  5G38 A;  5G39 A;  3A0B O;  2AXT O;  5E79 O;  5H2F O;  5G3A A;  5B5E O;  5KAF O;  4PJ0 O;  3A0H O;  5GTI O;  5KAI O;  4UB6 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...