5H2FU

Crystal structure of the psbm-deletion mutant of photosystem ii
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
97
structure length
97
Chain Sequence
ELVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem II protein D1 1
publication title Mutual relationships between structural and functional changes in a PsbM-deletion mutant of photosystem II.
pubmed doi rcsb
molecule tags Photosynthesis
total genus 33
structure length 97
sequence length 97
chains with identical sequence u
ec nomenclature
pdb deposition date 2016-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF06514 PsbU Photosystem II 12 kDa extrinsic protein (PsbU)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.320 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Photosystem II 12 kDa extrinsic protein 5h2fU01
2DUYA 5E79U 1S5LU 5H2FU 2AXTU 5KAFU 5GTIU 4UB6U 5B66U 4PJ0U 5GTHU 5B5EU 3KZIU 3A0BU 4IL6U 5KAIU 3A0HU 4UB8U 3WU2U 5TISU
chains in the Genus database with same CATH superfamily
3T5JA 3N7PD 3IRUA 2BPCA 9ICUA 4PGXA 4DWIA 2QLTA 4AP9A 5KFMA 3V6KA 2PMZC 5KAFU 1XNSA 1ZQXA 1MN8A 4CRXA 3F5AA 3HW8A 2JHDA 1Z1VA 2HHQA 2WF6A 1Z3EB 2BQUA 4JMUA 4OJPA 4M04A 4NLZA 4K4GA 2EDUA 1T94A 3T5KA 2K8CB 2E5SA 2H5XA 3PSIA 5AKHA 1Q3UA 1HUZA 2LHTA 3LWLA 5KFKA 4FBTA 3UMBA 2KKVA 2HMXA 1ZQQA 2WF5A 2R8JA 4DL4A 4J9PA 2YMPA 5AI9A 2Y9UA 1NK6A 1S0VA 1ZQDA 1UHUA 1PUZA 2QARB 4US8A 3H0RB 3Q8MA 5G5GA 3MR3A 5IIOA 5KFPA 1RM6C 3RJJA 1ZRNA 5KT6A 4DFKA 7ICLA 2XY5A 2KVCA 1PK1A 2ZUBA 1NNLA 1PVPA 3MDAA 3IHQB 4FZMA 1QCKA 3M7DA 1D9DA 3V7JA 1SV0A 3JPPA 2K8AA 7ICKA 1BNOA 2ZIUB 5JUMA 2YTUA 1NKCA 1TV9A 2WF9A 4US9A 8ICQA 1SIJA 4JV0A 4C7YA 2RHFA 4C8MA 1JROA 2KZZA 1B4FA 3C5GA 8ICNA 1NZPA 4DFDA 4KX3A 9ICLA 2H3FA 3PMLA 3GIJA 4J9KA 5J2EA 1RPLA 2ASJA 2KFZA 2DGZA 1ZQIA 5KFRA 3C1ZA 4P4PA 1KFTA 3C29A 3SZ2A 5HR7A 3QYPA 3Q8KA 4I2CA 4QW8A 1BGXT 2H3QA 2HVHA 4YN4A 4YQWA 3BQ0A 3Q8PB 1QQ7A 3KKAA 4UAWA 1HEKA 1BPYA 1CEZA 3IV6A 4RQ4A 1L7NA 4F2RA 9ICAA 2YMMA 3SI8A 5KFIA 4F72A 1KRPA 4RQ1A 3QUTA 4M47A 1D8BA 1TK5A 2ALZA 2OCEA 1L7MA 2FMPA 4QZGA 3R9KA 1XSNA 4ZH4A 4EEKA 1IM4A 5KG6A 3S6JA 8ICKA 4LZGA 4KLMA 4RQ2A 5KFFA 1NZBA 2AQ0A 3MDCA 3MR2A 4JWMA 3TACB 3KOOA 2UVVA 5IIMA 1NJXA 4EZ6A 4DSLA 1ZQWA 2XY7A 5ALIA 4OJ5A 2HOFA 7ICMA 8ICMA 2QB1A 1FFUA 1PK3A 4KTQA 2ESEA 3JPRA 2W9MA 1SXDA 1VJ5A 2XVTA 5CWRA 3RB3A 3UQ0A 1ZQUA 4HAIA 3SR6A 1DOQA 5AKZA 2QARA 4DS5A 3F2BA 4Z6DA 4Y2XA 2HCFA 4E0DA 2K60A 4USAA 1T3QA 4Y2TA 5KG7A 2AGPA 3SMVA 5HR6A 4KLIA 2NRXA 4XUSA 4IRCA 4NM1A 1U49A 2ZIUA 5AKGA 1COKA 1WWUA 2KG5A 1JUDA 3V72A 4CF5A 4YMMA 2G06A 1J97A 2O6KA 1F0MA 3WK8A 4YVZA 4UB1A 5DQHA 3GIIA 1L6NA 4UARA 5KFYA 1SXEA 2CPRA 5IIJA 3HJEA 3AM9A 1ZQCA 3IDWA 2ZJAA 3RFAA 2W43A 3LDAA 4P4OA 8ICBA 1ECWA 5TISU 5IINA 5JTIA 3BJYA 2KE7A 5E79U 4DFMA 1OXJA 4DS4A 2K89A 5J2GA 2AU0A 4J9LA 2I6XA 5J8YA 5KNIA 2PFQA 4BWJA 1S0OA 2Y0SF 3ZD9A 1KBUA 2ZIXB 5AIBA 1XSPA 1PVRA 4Y2JA 4UB5A 1T3NA 2PI4A 4C8KA 3K1ZA 4J9OA 3N97B 3G6XA 3F2CA 3RRHA 1YZ6A 2BPFA 5KG5A 3WK5A 2MRLA 4B9LA 3RH6A 3PW4A 5ALEA 1SB3C 2LYBA 2K8BB 4TUSA 4OD0A 4YD2A 1L7OA 1TKDA 4MFAA 4QZAA 2KTQA 4ICAA 3J81j 3H0LB 2JZBB 5KFOA 2MAXA 2OEHA 3E2EA 4QWCA 2AJQA 3OJUA 1BNPA 1SV0C 2KJ8A 3MGVA 3RJKA 4C8NA 7ICFA 4BXOB 5HHHA 4FS1A 4QIWF 2FE9A 1T4GA 8ICJA 4ED7A 1C7YA 1TAMA 2XICA 2JV3A 4ACOA 2JR5A 8ICSA 4FZLA 1TVAA 2F1HA 3I76A 1SZPA 2K4HA 3U26A 9ICQA 3PX0A 1L3UA 3RTVA 3H8WA 1ZQVA 2EZYA 4KN4A 1KN5A 4DQRA 4MEYA 2E8OA 4NV0A 5L9XA 2NRVA 3TQ1A 3T3FA 1RYUA 3UPQA 2NRTA 3B9JA 2W7OA 2R8HA 2KJ5A 4TURA 4K4IA 2JEIA 3H4BA 5KFDA 3UM9A 3KKAC 3AMZA 4QW9A 4C0ZA 5AKXA 4PGQA 3H8MA 2N1RA 4ZOHC 2IOHA 1MQ3A 1QQ6A 4B9SA 3TAQA 5AI8A 4Y2SA 4RQMA 3MFHA 4X5VA 1DXSA 2BCUA 4IRKA 4F5RA 1U45A 5J29A 4F4XA 3GV7B 1S10A 9ICNA 3PMNA 1NJWA 4GXIA 3NS1A 2BDUA 2W04A 3GU3A 3OSNA 5DGAA 4O5EA 3CP8A 3Q8LA 5AKJA 1COOA 2J6SA 2ZIXA 2KJ9A 3KZXA 3V6JA 3LVVA 5ALGA 3EW9A 1N60A 2BCSA 1DRGA 3A0HU 3NVYA 3C1YA 1WCLA 3C28A 8ICZA 4ED1A 4RZRA 3EYZA 4O5CA 2KMDA 4PPXA 3B0XA 5AM5A 3F5EA 4LZDA 3GIKA 3PR4A 2JZBA 1B0XA 4NM2A 2FLPA 4JV1A 4F2SA 1IV8A 1Q46A 1Z00A 1PVQA 3CYMA 3QE9Y 1BPBA 1X9XA 4MFCA 1ZQYA 5H2FU 5KT2A 3FC4A 3QZ8A 4BXOA 1Z4NA 2HHWA 5J0QA 1ZJMA 3PSFA 3N7RC 3WKAA 3DDHA 4MF2A 4KLHA 2E8NA 5DB6A 1S76D 2HOIA 2V4RA 1ZD4A 1WG8A 4F71A 8ICHA 2G5HB 3M8RA 2W3RA 5DGBA 4I2JA 5KFTA 4J9MA 4ECSA 2UVUA 4QZCA 9ICFA 3KBBA 5L1LA 5DBCA 2F1JA 4EBEA 3RR8A 4IQTA 5ALPA 4QZ9A 9ICKA 3E58A 4RQ8A 5JRTA 1Z4OA 5KT5A 5IIIA 2VA8A 5A0LA 4DL6A 5J8YC 5DBBA 7ICJA 3HKZC 1Y88A 4DCCA 4KLQA 1X6JA 2IHNA 3BQ2A 4G3IA 3FAHA 1ZQRA 8ICTA 1CI4A 3N4MB 4YCXA 4UB8U 2IOFA 5ALOA 4KMUA 2HI0A 3M9OB 2ZIVB 4RT3A 1T7PA 2XIDA 4BX9C 1KDHA 1ZQSA 5ALUA 4UB2A 3RJGA 5J0SA 5ALRA 3RB4A 1KL9A 4QWDA 3H7IA 2D6FC 1ZQBA 2HBLA 4B9NA 2F8KA 5KAIU 4Q44A 3LVWA 2Q4TA 2EAMA 1UT5A 3NUQA 3ETRA 2ASDA 5AKLA 2E8MA 5DG8A 4EBDA 4C8LA 1ZQEA 5HP4A 3GFKB 2K4EA 4Q8EA 4DOBA 2Y1JA 2YB4A 1XWLA 1ZOLA 1N63A 1O08A 2FJ6A 5ALJA 1ZQKA 4UAYA 2I5HA 4Q8FA 1A0PA 3EPGA 2V9WA 3F2DA 5CR0A 5ALLA 4UBCA 4FS2A 2J6UA 2AXTU 3ISCA 2LBOA 4ECQA 1UPHA 5KT7A 1XSLA 4M9JA 1N61A 1X42A 3TFRA 5F9LA 4DL7A 2JMGA 1SZHA 1MSWD 1TE2A 3H4DA 2ZJ5A 5KFQA 1ZQLA 2FLNA 3ZDEA 5ALHA 3KD3A 1NKEA 1UA0A 4R65A 1S5LU 4YMOA 3LYSA 4O0IA 5ALZA 2W8KA 2GH1A 4WJ3B 4GLXA 4I2BA 1V85A 1U9LA 1WUDA 2HSZA 4O3PA 4Q43A 2EH9A 2YN4A 4PHPA 2P6RA 3QU4A 5KFBA 9ICVA 3TANA 4NJ8A 1L8OA 1M6YA 3BS7A 4KLTA 5DQGA 2XCAA 1U4BA 3E0FA 2FMSA 4DSIA 1RYRA 3BQTA 5KFZA 2F44A 4IC9A 2PFNA 4I2HA 2DKZA 1JXEA 4RNMA 3VC8A 5AK6A 2EANA 5HMLA 3Q8RB 4UAZA 3RBDA 5KL8B 4LVSA 1X40A 5AKYA 1QSYA 4YR3A 7ICPA 3NVVA 2AQ4A 2WHEA 5KFXA 3BQ7A 2ZIVA 4B9UA 5ALDA 3ZD8A 2KOBA 3ED5A 1RXVA 4GC7A 4DQSA 5CB1A 4PZNA 5J0TA 1ZQMA 4TQRA 1J2MA 4I2EA 3VCBA 3MR6A 2JGAA 3PW2A 4DL2A 3UXNA 5J0XA 2G0AA 3AEVA 1CRXA 4EYHB 4RUCA 1VLBA 2EZZA 2HHVA 3OHBA 4Y2QA 4NL9A 2P6UA 1L3SA 1SGGA 3K4GA 7ICTA 5ALQA 4PHDA 3PW7A 2HW3A 1B22A 2C2EA 4F50A 4DSEA 5KT4A 4DF8A 2KP7A 3OTQA 2YMQA 1KLNA 3V7KA 5DG9A 4UBBA 4Y2PA 5J2JA 3PW0A 2GO7A 1A6SA 1KFDA 7ICIA 3F53A 1UCVA 3PSPA 4B9MA 1NOMA 3QEBZ 1KTQA 2ES6A 2WAQF 5DB9A 5AK3A 4PHEA 2LM4A 2BCVA 3MBYA 3HPOA 2E1FA 4U6PA 2WTFA 2Y9TA 4DSJA 4IS7A 2LI6A 2I1QA 3QUCA 5EWGA 8ICCA 4RQ0A 4XRHA 4C4TA 4UB4A 1QSLA 9ICRA 1V9PA 5KFAA 5KFLA 1ZETA 5J0YA 2M0NA 3G6YA 2W03A 3L5KA 4RQ7A 4DL3A 2RRDA 3TFSA 4IRDA 2AGQA 1ZQJA 2HHTA 1KEJA 7ICHA 5DLFA 3WKDA 4AYBF 2XY6A 3IM1A 4ED2A 2VJ4A 1Z1BA 4I28A 3C2LA 1SKSA 2JXJA 4EX7A 5J2BA 2VANA 4I2IA 2WB1F 2BKEA 7ICOA 5AK5A 4XA5A 3ICXA 5KFHA 4J9QA 1RXWA 4F5PA 4M6WB 3GV5B 3IG8A 3N28A 2W7PA 3GDXA 1TK0A 3T5LA 3C2MA 2ZIWB 4DFJA 3JPTA 3Q8SB 2DUYA 5CHGA 1ZQ1C 2I9GA 1DGSA 4LJXA 1JIHA 3BZCA 4J9RA 5DB8A 1F5SA 2HBJA 2UVRA 1TFRA 4CNQA 3HILA 4DEZA 4RUAA 2ISPA 5J2FA 2KFNA 4YXJA 2J6TA 4EEYA 2WF8A 3RJFA 4IL6U 2CXYA 2IMWP 4BDPA 3SV4A 5AM1A 5BOLA 2B21A 2EAPA 2H3VA 4RQ5A 4ELUA 5L1IA 4RNNA 4YXMA 2RP5A 2HHXA 1L8LA 3NVWA 5B66U 1LKYB 4KMOB 2C28A 2PXIA 3PZPA 2P35A 3QU7A 1K1QA 4YR0A 4DF4A 4KLSA 3M6KA 4KLDA 1BPZA 2B6GA 3NVZA 4I27A 2XGPA 4F3OA 4DSFA 5KT3A 4R8UB 9ICBA 5L1KA 3RF9A 3HRDD 4Z6CA 3OPXA 4UB3A 1P7DA 2G09A 2OYYA 3AL0B 4EZ9A 2Z7JA 4DQQA 4F8RA 4O3NA 2YQEA 4QZIA 3KTQA 2KHQA 1NJYA 1ZQTA 4C7ZA 2Y0SC 1F44A 2YB1A 4RPZA 5KFJA 2KD1A 4UW9A 2G07A 1IG6A 1X9WA 4IR9A 3UQ2A 2MUTB 1NKBA 5J0PA 1IIPA 5KTQA 1QLNA 2ZTEA 3GQCA 4FBUA 2H3ZA 2ODGA 3AQEA 1NK0A 3M1YA 4YG2A 2EQYA 1RG6A 3RB0A 1ED1A 4RPXA 3JPQA 3H8SA 3QU2A 2QB0B 3O0FA 1NK8A 1K5OA 2HOQA 5D49A 7ICQA 4QZEA 4RQNA 4KLFA 4PJ0U 3SAGA 3PNCA 2ZXIA 4OJ6A 4O3MA 3OJSA 2NRZA 1KKXA 3UMGA 4GXJA 4JV2A 4R66A 4ECUA 3SEIA 1JX4A 2DQNB 5K4LA 5AM3A 4RQ6A 4I29A 2ZIWA 4QIWC 4YMNA 2JRZA 5DB7A 4NL9C 4ECZA 5AM0A 4P2HA 5KG4A 2DF4B 2FPKA 8ICVA 3D6JA 4I2FA 1TAQA 4PH5A 9ICEA 5J2DA 1LVHA 2LKYA 2DPJA 2IBKA 1XS9D 5HNKA 3NRWA 2ATLA 1S97A 5D4BA 2VKQA 5KFEA 3C2KA 2W55A 2MSNA 2W9AA 2DBYA 2PI5A 1QH9A 3K75D 4ED0A 4BJQA 2R8IA 2HBMA 1X9MA 5J2AA 4UATA 3M6ZA 3WU2U 8ICFA 2YMLA 4FE3A 1SV4A 5HHIA 3T79A 4CGZA 1CUKA 2A1AA 5CJ7A 1L7PA 1H38A 1LKYA 4ECWA 4NWIA 1U48A 4OJOA 4F4WA 5EE0A 2LYAA 5GTHU 5FP0A 2XGQA 1SL0A 2D3DA 3KZIU 2PMZF 2AHOB 4ECXA 4XQ8A 2Y1IA 1NJZA 1OUQA 3BDPA 5EOZA 1S9FA 2KIWA 2QKQA 2OM6A 3TKAA 3CNHA 2W11A 1UT8A 5KFGA 4QZ8A 4R63A 2EZXA 4MF8A 4ED6A 8ICUA 3ONNA 1WWVA 4IQUA 1A76A 1S77D 4EX6A 1QSSA 1JI7A 1TAUA 2G5IB 4QZDA 3PR5B 2BHNA 4F4YA 3SENA 4F4KA 2NO5A 1DGJA 3NASA 3L4PA 3QNMA 4KLOA 5ALNA 2MUTA 4DOCA 2W54A 2XCPA 3TADA 4TQSA 3ZDAA 3PV8A 4MEXA 2W8LA 3C5FA 2BPGA 2JEFA 2E1EA 8ICYA 5AIAA 3AQFA 3OSPA 2JEGA 1JXLA 4HYKA 8ICWA 2FDRA 5IIKA 3UMCA 1RYSA 2E8PA 5DBAA 2W9BB 3NRZA 2QB0A 4DFPA 2XC9A 4B9TA 1JALA 3H8JA 5ALKA 4ED8A 9ICOA 5AI6A 3H0MB 2R18A 4KN7A 5J2IA 3NGDA 4EBCA 3PO5A 4IQVA 1SL2A 5KFVA 2M9NA 3RJIA 2HBKA 2WF7A 1MQ2A 2KK0A 1MC8A 4NLBA 1QQ5A 4PZOA 3TAPA 2VIXA 2KNJA 2RQ5A 3BZKA 5CRXA 4K4HA 4NLCA 1L3TA 1K1SA 9ICWA 2RDJA 1KSPA 2MU2A 3UXPA 5EWEA 2ZUDA 2DPIA 3ZDDA 4F5QA 1O03A 1S0NA 2BCQA 1GO3F 5D46A 2WFAA 4OJLA 1ZD3A 1RQNA 5ALWA 5L1MA 4GIBA 5ALVA 2LYHA 2ZUCA 5KFSA 2GLEA 2C22A 3HT3A 3QU5A 1ZQZA 3RAXA 3WK7A 3C23A 5DLGA 4R64A 4EELA 1Q8KA 2NRWA 3IN5A 1D8LA 3LWMA 4M0AA 4YD1A 3RB6A 2AH5A 1SKRA 5BOMA 2PFOA 4Z6FA 3SAHA 1L5UA 4PL2A 2KZ3A 2IHMA 9ICHA 2OH2A 5ALSA 3ZDCA 7ICRA 8ICOA 4UAUA 5KG3A 8ICGA 4IQWA 1ZRMA 4CE6A 1KQQA 1HUOA 1ZQHA 5EE3A 5KG0A 3KHRA 4KLLA 4QZFA 5BPCA 3OGUA 2ZXHA 9ICPA 4B9VA 5F9NA 3Q8QB 4Y2UA 4DQIA 2KVSA 2KN7A 4O3SA 3K1RB 4DOAA 2GOLA 5CA7A 5JU5A 4KX5A 5ALFA 1N56A 4O5KA 4PHAA 4QWEA 4TUQA 2FI1A 2KKPA 7ICSA 2R8KA 5GTIU 4P0PB 5AKKA 1ZJNA 3FDSA 2DWQA 2F3NA 1UA1A 2LMRA 7ICEA 2BQ3A 3TI0A 3SYZA 1XU4A 4OO1J 2KEYA 4TUPA 2CN1A 1B43A 5AK4A 3AN1A 4Y2RA 1J2NA 5F3XB 1ZQOA 2BGWA 3V6HA 4OCZA 2K4PA 3N7SC 4BUGA 1HJPA 5TZVA 2W9BA 2NYVA 2OWOA 4QJFB 4JB3A 2RLTA 2MA1A 4U7CA 2H3IA 3BS5B 2PFPA 3SD7A 4YR2A 4BWMA 4F4ZA 1YZ7A 2HVIA 1BVSA 4I2DA 5HMMA 2ZG6A 5AICA 4C80A 5J0UA 1S8OA 4M9HA 3QUQA 2K4IA 3QZ7A 2GWSA 3RH4A 5B5EU 2FPLA 2VA3A 2A19A 2F76X 4Z6EA 3QXGA 5KFNA 3EWAA 4RQ3A 2PKEA 1AQ6A 3T5HA 1JMSA 2BQRA 4QZBA 3TARA 2VJ5A 2HHUA 4YP3A 1WYGA 2IOFK 4M9NA 1T8EA 1TK8A 2L5YA 2Q0ZX 4UB6U 5T14A 1BPDA 4ECYA 3ZDBA 2F77X 1OW5A 3WK9A 4MHVA 2A1JB 4QWAA 1RZTA 3PX6A 3MGIA 5DDYA 4J9NA 3MFIA 4ECTA 3RJHA 1BPXA 3RR7A 1C20A 2KIVA 5KG2A 4GXKA 8ICEA 4UAVA 2DKXA 3MC1A 4PL1A 5DQIA 1XO0A 8ICAA 5AM4A 3I1YA 4NLNA 3D2QA 2ZTDA 2AGOA 2JH7A 2VA2A 1XC9A 3TADC 1ZQPA 2BCRA 1FO4A 3G6VA 1MA7A 4C8OA 4M9LA 2XI9A 5AI4A 4EYIB 4RU9A 4DO9A 4FZNA 4DSKA 4P4MA 1X2IA 1ZQAA 1DK3A 4JK1A 4I2AA 3KHGA 5J2KA 4P0PA 9ICJA 4GC6A 8ICXA 7ICUA 2F1IA 2W9CB 1U47A 3M9MB 2NV3A 4MFFA 2KHVA 1X6IA 2DL0A 5KL1B 3FM9A 4ECRA 2ZJ8A 2ISOA 7ICNA 5L1JA 1D9FA 5J2HA 3SV3A 3RRGA 3I28A 9ICIA 1FIQA 1NK4A 2OHFA 3SQIA 2KSOB 3WK6A 8ICPA 3CW2C 3BS5A 3ZI4A 1LB2B 4J03A 4BGDA 3EPIA 3PX4A 4O3RA 2R8GA 1D8YA 3PW5A 3PVXA 1S0MA 9ICMA 2WAQC 3ISBA 7ICVA 2UVWA 1VDVA 3KFUF 1X9SA 2DFLA 2EAOA 1Z19A 4RNOA 3M8SA 1PZNA 4CDGA 2F8LA 1LV5A 2LM1A 3ALRA 3C21A 2D8CA 5AHXA 1Q3VA 5C0YA 2BDPA 3RH5A 4F92B 4GFJA 1ZQGA 3WKEA 3EUB2 2V4QA 5AKIA 2BZFA 4PGYA 5KFWA 3LK9A 4O9MA 3AU2A 1Z00B 1FEZA 4AYBC 4KLJA 3KHLA 4CCHA 2JH1A 2A1JA 2LPEA 3HP6A 2BR0A 4I2GA 4CF4A 4F5OA 5AKEA 3ETLA 2WB1C 2YX8A 2XO7A 9ICSA 7ICGA 3HWTA 4NLGA 5KG1A 3RJEA 5G5HA 4O3QA 2YY6A 4Y2YA 1V38A 1SWWA 4UASA 9ICCA 3PSTA 5J2CA 2CRXA 3PY8A 1L3VA 4P0QB 4M9GA 3QUBA 2ASLA 4F93B 4QNLA 3D2SA 1ZD2P 5AM2A 4Q45A 3WKBA 2FLLA 2NO4A 5J0OA 1KW4A 3QX7A 1ZQFA 4A8EA 3PO4A 1ZYQA 4RPYA 4NLKA 4ECVA 3L3FX 5ALTA 1AROP 5DKWA 1A77A 2W9CA 4KLGA 2C2DA 4M6WA 4ELVA 1IXRA 2A3VA 4QZHA 3QEAZ 1SL1A 4CF3A 2B0CA 1URJA 3A0BU 3GILA 4NXZA 5ALXA 1QTMA 3IG5A 2KSOA 2W3SA 2E3TA 3THVA 3KHHA 5CP2A 4F5NA 1ZD5A 5CEHA 2HHSA 1JN3A 3MGHA 3IP4B 3JPNA 3D2NA 4ELTA 3HKZF 3DV9A 1N2XA 4IR1A 3H40A 4DL5A 1ZXIA 4FO6A 4B6JA 3CRXA 4FFDA 4JUZA 2RDIA 5ALYA 5KFCA 4F91B 2OXOA 4Y2VA 8ICIA 3NTUA 5EE9A 1NK5A 3WK4A 5IILA 1BPEA 9ICTA 3AUOA 3RBEA 1UQVA 4JWNA 5KFUA 1X66A 1PK1B 1RQLA 2C2RA 1WCNA 5C5JA 3B0YA 1V97A 3V7LA 3SAFA 4RT2A 1NK9A 9ICGA 3GZFA 2ZTCA 4YFKA 5AI5A 4J9SA 1RDFA 2F2AB 3MR5A 4KLEA 3FYHA 1NK7A 4R8UA 5EWFA 5DG7A 5ALMA 1N5WA 2KICA 3M9NB 5AI0A 9ICXA 1EXNA 2KV2A 4EENA 3JPOA 1ZQNA 4DQPA 2G08A 1HIWA 4QWBA 3JPSA 5DDMA 4KLUA 1N5XA 1JRPA 1YT3A 3MABA 3UXOA 2FMQA 5J0WA 3GIMA 2IA6A 1NI3A 4C4SA 2FPMA 3OHAA 1FFVA 4M2YA 2KZMA 1SKWA 4P0QA 5J0RA 3BQ1A 3ORYA 3WKCA 1N62A 3ISDA 4DLGA 4DLEA 4ED3A 1N48A 3AU6A 2JEJA 3RAQA 3EZ5A 4O3OA 3QU9A 2HDOA 5EE1A 2P66A 4UQGA 8ICLA 3GV8B 1SWVA 1XO1A 4NY8A 3HX0A 1DK2A 3DEEA 4KITB 4C4RA 1KFSA 8ICRA 4G9BA
chains in the Genus database with same CATH topology
2DUYA 5E79U 1S5LU 5H2FU 2AXTU 5KAFU 5GTIU 4UB6U 5B66U 4PJ0U 5GTHU 5B5EU 3KZIU 3A0BU 4IL6U 5KAIU 3A0HU 4UB8U 3WU2U 5TISU
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DUY A;  5E79 U;  1S5L U;  5H2F U;  2AXT U;  5KAF U;  5GTI U;  4UB6 U;  5B66 U;  4PJ0 U;  5GTH U;  5B5E U;  3KZI U;  3A0B U;  4IL6 U;  5KAI U;  3A0H U;  4UB8 U;  3WU2 U;  5TIS U; 
#chains in the Genus database with same CATH topology
 3T5J A;  3N7P D;  3IRU A;  2BPC A;  9ICU A;  4PGX A;  4DWI A;  2QLT A;  4AP9 A;  5KFM A;  3V6K A;  2PMZ C;  5KAF U;  1XNS A;  1ZQX A;  1MN8 A;  4CRX A;  3F5A A;  3HW8 A;  2JHD A;  1Z1V A;  2HHQ A;  2WF6 A;  1Z3E B;  2BQU A;  4JMU A;  4OJP A;  4M04 A;  4NLZ A;  4K4G A;  2EDU A;  1T94 A;  3T5K A;  2K8C B;  2E5S A;  2H5X A;  3PSI A;  5AKH A;  1Q3U A;  1HUZ A;  2LHT A;  3LWL A;  5KFK A;  4FBT A;  3UMB A;  2KKV A;  2HMX A;  1ZQQ A;  2WF5 A;  2R8J A;  4DL4 A;  4J9P A;  2YMP A;  5AI9 A;  2Y9U A;  1NK6 A;  1S0V A;  1ZQD A;  1UHU A;  1PUZ A;  2QAR B;  4US8 A;  3H0R B;  3Q8M A;  5G5G A;  3MR3 A;  5IIO A;  5KFP A;  1RM6 C;  3RJJ A;  1ZRN A;  5KT6 A;  4DFK A;  7ICL A;  2XY5 A;  2KVC A;  1PK1 A;  2ZUB A;  1NNL A;  1PVP A;  3MDA A;  3IHQ B;  4FZM A;  1QCK A;  3M7D A;  1D9D A;  3V7J A;  1SV0 A;  3JPP A;  2K8A A;  7ICK A;  1BNO A;  2ZIU B;  5JUM A;  2YTU A;  1NKC A;  1TV9 A;  2WF9 A;  4US9 A;  8ICQ A;  1SIJ A;  4JV0 A;  4C7Y A;  2RHF A;  4C8M A;  1JRO A;  2KZZ A;  1B4F A;  3C5G A;  8ICN A;  1NZP A;  4DFD A;  4KX3 A;  9ICL A;  2H3F A;  3PML A;  3GIJ A;  4J9K A;  5J2E A;  1RPL A;  2ASJ A;  2KFZ A;  2DGZ A;  1ZQI A;  5KFR A;  3C1Z A;  4P4P A;  1KFT A;  3C29 A;  3SZ2 A;  5HR7 A;  3QYP A;  3Q8K A;  4I2C A;  4QW8 A;  1BGX T;  2H3Q A;  2HVH A;  4YN4 A;  4YQW A;  3BQ0 A;  3Q8P B;  1QQ7 A;  3KKA A;  4UAW A;  1HEK A;  1BPY A;  1CEZ A;  3IV6 A;  4RQ4 A;  1L7N A;  4F2R A;  9ICA A;  2YMM A;  3SI8 A;  5KFI A;  4F72 A;  1KRP A;  4RQ1 A;  3QUT A;  4M47 A;  1D8B A;  1TK5 A;  2ALZ A;  2OCE A;  1L7M A;  2FMP A;  4QZG A;  3R9K A;  1XSN A;  4ZH4 A;  4EEK A;  1IM4 A;  5KG6 A;  3S6J A;  8ICK A;  4LZG A;  4KLM A;  4RQ2 A;  5KFF A;  1NZB A;  2AQ0 A;  3MDC A;  3MR2 A;  4JWM A;  3TAC B;  3KOO A;  2UVV A;  5IIM A;  1NJX A;  4EZ6 A;  4DSL A;  1ZQW A;  2XY7 A;  5ALI A;  4OJ5 A;  2HOF A;  7ICM A;  8ICM A;  2QB1 A;  1FFU A;  1PK3 A;  4KTQ A;  2ESE A;  3JPR A;  2W9M A;  1SXD A;  1VJ5 A;  2XVT A;  5CWR A;  3RB3 A;  3UQ0 A;  1ZQU A;  4HAI A;  3SR6 A;  1DOQ A;  5AKZ A;  2QAR A;  4DS5 A;  3F2B A;  4Z6D A;  4Y2X A;  2HCF A;  4E0D A;  2K60 A;  4USA A;  1T3Q A;  4Y2T A;  5KG7 A;  2AGP A;  3SMV A;  5HR6 A;  4KLI A;  2NRX A;  4XUS A;  4IRC A;  4NM1 A;  1U49 A;  2ZIU A;  5AKG A;  1COK A;  1WWU A;  2KG5 A;  1JUD A;  3V72 A;  4CF5 A;  4YMM A;  2G06 A;  1J97 A;  2O6K A;  1F0M A;  3WK8 A;  4YVZ A;  4UB1 A;  5DQH A;  3GII A;  1L6N A;  4UAR A;  5KFY A;  1SXE A;  2CPR A;  5IIJ A;  3HJE A;  3AM9 A;  1ZQC A;  3IDW A;  2ZJA A;  3RFA A;  2W43 A;  3LDA A;  4P4O A;  8ICB A;  1ECW A;  5TIS U;  5IIN A;  5JTI A;  3BJY A;  2KE7 A;  5E79 U;  4DFM A;  1OXJ A;  4DS4 A;  2K89 A;  5J2G A;  2AU0 A;  4J9L A;  2I6X A;  5J8Y A;  5KNI A;  2PFQ A;  4BWJ A;  1S0O A;  2Y0S F;  3ZD9 A;  1KBU A;  2ZIX B;  5AIB A;  1XSP A;  1PVR A;  4Y2J A;  4UB5 A;  1T3N A;  2PI4 A;  4C8K A;  3K1Z A;  4J9O A;  3N97 B;  3G6X A;  3F2C A;  3RRH A;  1YZ6 A;  2BPF A;  5KG5 A;  3WK5 A;  2MRL A;  4B9L A;  3RH6 A;  3PW4 A;  5ALE A;  1SB3 C;  2LYB A;  2K8B B;  4TUS A;  4OD0 A;  4YD2 A;  1L7O A;  1TKD A;  4MFA A;  4QZA A;  2KTQ A;  4ICA A;  3J81 j;  3H0L B;  2JZB B;  5KFO A;  2MAX A;  2OEH A;  3E2E A;  4QWC A;  2AJQ A;  3OJU A;  1BNP A;  1SV0 C;  2KJ8 A;  3MGV A;  3RJK A;  4C8N A;  7ICF A;  4BXO B;  5HHH A;  4FS1 A;  4QIW F;  2FE9 A;  1T4G A;  8ICJ A;  4ED7 A;  1C7Y A;  1TAM A;  2XIC A;  2JV3 A;  4ACO A;  2JR5 A;  8ICS A;  4FZL A;  1TVA A;  2F1H A;  3I76 A;  1SZP A;  2K4H A;  3U26 A;  9ICQ A;  3PX0 A;  1L3U A;  3RTV A;  3H8W A;  1ZQV A;  2EZY A;  4KN4 A;  1KN5 A;  4DQR A;  4MEY A;  2E8O A;  4NV0 A;  5L9X A;  2NRV A;  3TQ1 A;  3T3F A;  1RYU A;  3UPQ A;  2NRT A;  3B9J A;  2W7O A;  2R8H A;  2KJ5 A;  4TUR A;  4K4I A;  2JEI A;  3H4B A;  5KFD A;  3UM9 A;  3KKA C;  3AMZ A;  4QW9 A;  4C0Z A;  5AKX A;  4PGQ A;  3H8M A;  2N1R A;  4ZOH C;  2IOH A;  1MQ3 A;  1QQ6 A;  4B9S A;  3TAQ A;  5AI8 A;  4Y2S A;  4RQM A;  3MFH A;  4X5V A;  1DXS A;  2BCU A;  4IRK A;  4F5R A;  1U45 A;  5J29 A;  4F4X A;  3GV7 B;  1S10 A;  9ICN A;  3PMN A;  1NJW A;  4GXI A;  3NS1 A;  2BDU A;  2W04 A;  3GU3 A;  3OSN A;  5DGA A;  4O5E A;  3CP8 A;  3Q8L A;  5AKJ A;  1COO A;  2J6S A;  2ZIX A;  2KJ9 A;  3KZX A;  3V6J A;  3LVV A;  5ALG A;  3EW9 A;  1N60 A;  2BCS A;  1DRG A;  3A0H U;  3NVY A;  3C1Y A;  1WCL A;  3C28 A;  8ICZ A;  4ED1 A;  4RZR A;  3EYZ A;  4O5C A;  2KMD A;  4PPX A;  3B0X A;  5AM5 A;  3F5E A;  4LZD A;  3GIK A;  3PR4 A;  2JZB A;  1B0X A;  4NM2 A;  2FLP A;  4JV1 A;  4F2S A;  1IV8 A;  1Q46 A;  1Z00 A;  1PVQ A;  3CYM A;  3QE9 Y;  1BPB A;  1X9X A;  4MFC A;  1ZQY A;  5H2F U;  5KT2 A;  3FC4 A;  3QZ8 A;  4BXO A;  1Z4N A;  2HHW A;  5J0Q A;  1ZJM A;  3PSF A;  3N7R C;  3WKA A;  3DDH A;  4MF2 A;  4KLH A;  2E8N A;  5DB6 A;  1S76 D;  2HOI A;  2V4R A;  1ZD4 A;  1WG8 A;  4F71 A;  8ICH A;  2G5H B;  3M8R A;  2W3R A;  5DGB A;  4I2J A;  5KFT A;  4J9M A;  4ECS A;  2UVU A;  4QZC A;  9ICF A;  3KBB A;  5L1L A;  5DBC A;  2F1J A;  4EBE A;  3RR8 A;  4IQT A;  5ALP A;  4QZ9 A;  9ICK A;  3E58 A;  4RQ8 A;  5JRT A;  1Z4O A;  5KT5 A;  5III A;  2VA8 A;  5A0L A;  4DL6 A;  5J8Y C;  5DBB A;  7ICJ A;  3HKZ C;  1Y88 A;  4DCC A;  4KLQ A;  1X6J A;  2IHN A;  3BQ2 A;  4G3I A;  3FAH A;  1ZQR A;  8ICT A;  1CI4 A;  3N4M B;  4YCX A;  4UB8 U;  2IOF A;  5ALO A;  4KMU A;  2HI0 A;  3M9O B;  2ZIV B;  4RT3 A;  1T7P A;  2XID A;  4BX9 C;  1KDH A;  1ZQS A;  5ALU A;  4UB2 A;  3RJG A;  5J0S A;  5ALR A;  3RB4 A;  1KL9 A;  4QWD A;  3H7I A;  2D6F C;  1ZQB A;  2HBL A;  4B9N A;  2F8K A;  5KAI U;  4Q44 A;  3LVW A;  2Q4T A;  2EAM A;  1UT5 A;  3NUQ A;  3ETR A;  2ASD A;  5AKL A;  2E8M A;  5DG8 A;  4EBD A;  4C8L A;  1ZQE A;  5HP4 A;  3GFK B;  2K4E A;  4Q8E A;  4DOB A;  2Y1J A;  2YB4 A;  1XWL A;  1ZOL A;  1N63 A;  1O08 A;  2FJ6 A;  5ALJ A;  1ZQK A;  4UAY A;  2I5H A;  4Q8F A;  1A0P A;  3EPG A;  2V9W A;  3F2D A;  5CR0 A;  5ALL A;  4UBC A;  4FS2 A;  2J6U A;  2AXT U;  3ISC A;  2LBO A;  4ECQ A;  1UPH A;  5KT7 A;  1XSL A;  4M9J A;  1N61 A;  1X42 A;  3TFR A;  5F9L A;  4DL7 A;  2JMG A;  1SZH A;  1MSW D;  1TE2 A;  3H4D A;  2ZJ5 A;  5KFQ A;  1ZQL A;  2FLN A;  3ZDE A;  5ALH A;  3KD3 A;  1NKE A;  1UA0 A;  4R65 A;  1S5L U;  4YMO A;  3LYS A;  4O0I A;  5ALZ A;  2W8K A;  2GH1 A;  4WJ3 B;  4GLX A;  4I2B A;  1V85 A;  1U9L A;  1WUD A;  2HSZ A;  4O3P A;  4Q43 A;  2EH9 A;  2YN4 A;  4PHP A;  2P6R A;  3QU4 A;  5KFB A;  9ICV A;  3TAN A;  4NJ8 A;  1L8O A;  1M6Y A;  3BS7 A;  4KLT A;  5DQG A;  2XCA A;  1U4B A;  3E0F A;  2FMS A;  4DSI A;  1RYR A;  3BQT A;  5KFZ A;  2F44 A;  4IC9 A;  2PFN A;  4I2H A;  2DKZ A;  1JXE A;  4RNM A;  3VC8 A;  5AK6 A;  2EAN A;  5HML A;  3Q8R B;  4UAZ A;  3RBD A;  5KL8 B;  4LVS A;  1X40 A;  5AKY A;  1QSY A;  4YR3 A;  7ICP A;  3NVV A;  2AQ4 A;  2WHE A;  5KFX A;  3BQ7 A;  2ZIV A;  4B9U A;  5ALD A;  3ZD8 A;  2KOB A;  3ED5 A;  1RXV A;  4GC7 A;  4DQS A;  5CB1 A;  4PZN A;  5J0T A;  1ZQM A;  4TQR A;  1J2M A;  4I2E A;  3VCB A;  3MR6 A;  2JGA A;  3PW2 A;  4DL2 A;  3UXN A;  5J0X A;  2G0A A;  3AEV A;  1CRX A;  4EYH B;  4RUC A;  1VLB A;  2EZZ A;  2HHV A;  3OHB A;  4Y2Q A;  4NL9 A;  2P6U A;  1L3S A;  1SGG A;  3K4G A;  7ICT A;  5ALQ A;  4PHD A;  3PW7 A;  2HW3 A;  1B22 A;  2C2E A;  4F50 A;  4DSE A;  5KT4 A;  4DF8 A;  2KP7 A;  3OTQ A;  2YMQ A;  1KLN A;  3V7K A;  5DG9 A;  4UBB A;  4Y2P A;  5J2J A;  3PW0 A;  2GO7 A;  1A6S A;  1KFD A;  7ICI A;  3F53 A;  1UCV A;  3PSP A;  4B9M A;  1NOM A;  3QEB Z;  1KTQ A;  2ES6 A;  2WAQ F;  5DB9 A;  5AK3 A;  4PHE A;  2LM4 A;  2BCV A;  3MBY A;  3HPO A;  2E1F A;  4U6P A;  2WTF A;  2Y9T A;  4DSJ A;  4IS7 A;  2LI6 A;  2I1Q A;  3QUC A;  5EWG A;  8ICC A;  4RQ0 A;  4XRH A;  4C4T A;  4UB4 A;  1QSL A;  9ICR A;  1V9P A;  5KFA A;  5KFL A;  1ZET A;  5J0Y A;  2M0N A;  3G6Y A;  2W03 A;  3L5K A;  4RQ7 A;  4DL3 A;  2RRD A;  3TFS A;  4IRD A;  2AGQ A;  1ZQJ A;  2HHT A;  1KEJ A;  7ICH A;  5DLF A;  3WKD A;  4AYB F;  2XY6 A;  3IM1 A;  4ED2 A;  2VJ4 A;  1Z1B A;  4I28 A;  3C2L A;  1SKS A;  2JXJ A;  4EX7 A;  5J2B A;  2VAN A;  4I2I A;  2WB1 F;  2BKE A;  7ICO A;  5AK5 A;  4XA5 A;  3ICX A;  5KFH A;  4J9Q A;  1RXW A;  4F5P A;  4M6W B;  3GV5 B;  3IG8 A;  3N28 A;  2W7P A;  3GDX A;  1TK0 A;  3T5L A;  3C2M A;  2ZIW B;  4DFJ A;  3JPT A;  3Q8S B;  2DUY A;  5CHG A;  1ZQ1 C;  2I9G A;  1DGS A;  4LJX A;  1JIH A;  3BZC A;  4J9R A;  5DB8 A;  1F5S A;  2HBJ A;  2UVR A;  1TFR A;  4CNQ A;  3HIL A;  4DEZ A;  4RUA A;  2ISP A;  5J2F A;  2KFN A;  4YXJ A;  2J6T A;  4EEY A;  2WF8 A;  3RJF A;  4IL6 U;  2CXY A;  2IMW P;  4BDP A;  3SV4 A;  5AM1 A;  5BOL A;  2B21 A;  2EAP A;  2H3V A;  4RQ5 A;  4ELU A;  5L1I A;  4RNN A;  4YXM A;  2RP5 A;  2HHX A;  1L8L A;  3NVW A;  5B66 U;  1LKY B;  4KMO B;  2C28 A;  2PXI A;  3PZP A;  2P35 A;  3QU7 A;  1K1Q A;  4YR0 A;  4DF4 A;  4KLS A;  3M6K A;  4KLD A;  1BPZ A;  2B6G A;  3NVZ A;  4I27 A;  2XGP A;  4F3O A;  4DSF A;  5KT3 A;  4R8U B;  9ICB A;  5L1K A;  3RF9 A;  3HRD D;  4Z6C A;  3OPX A;  4UB3 A;  1P7D A;  2G09 A;  2OYY A;  3AL0 B;  4EZ9 A;  2Z7J A;  4DQQ A;  4F8R A;  4O3N A;  2YQE A;  4QZI A;  3KTQ A;  2KHQ A;  1NJY A;  1ZQT A;  4C7Z A;  2Y0S C;  1F44 A;  2YB1 A;  4RPZ A;  5KFJ A;  2KD1 A;  4UW9 A;  2G07 A;  1IG6 A;  1X9W A;  4IR9 A;  3UQ2 A;  2MUT B;  1NKB A;  5J0P A;  1IIP A;  5KTQ A;  1QLN A;  2ZTE A;  3GQC A;  4FBU A;  2H3Z A;  2ODG A;  3AQE A;  1NK0 A;  3M1Y A;  4YG2 A;  2EQY A;  1RG6 A;  3RB0 A;  1ED1 A;  4RPX A;  3JPQ A;  3H8S A;  3QU2 A;  2QB0 B;  3O0F A;  1NK8 A;  1K5O A;  2HOQ A;  5D49 A;  7ICQ A;  4QZE A;  4RQN A;  4KLF A;  4PJ0 U;  3SAG A;  3PNC A;  2ZXI A;  4OJ6 A;  4O3M A;  3OJS A;  2NRZ A;  1KKX A;  3UMG A;  4GXJ A;  4JV2 A;  4R66 A;  4ECU A;  3SEI A;  1JX4 A;  2DQN B;  5K4L A;  5AM3 A;  4RQ6 A;  4I29 A;  2ZIW A;  4QIW C;  4YMN A;  2JRZ A;  5DB7 A;  4NL9 C;  4ECZ A;  5AM0 A;  4P2H A;  5KG4 A;  2DF4 B;  2FPK A;  8ICV A;  3D6J A;  4I2F A;  1TAQ A;  4PH5 A;  9ICE A;  5J2D A;  1LVH A;  2LKY A;  2DPJ A;  2IBK A;  1XS9 D;  5HNK A;  3NRW A;  2ATL A;  1S97 A;  5D4B A;  2VKQ A;  5KFE A;  3C2K A;  2W55 A;  2MSN A;  2W9A A;  2DBY A;  2PI5 A;  1QH9 A;  3K75 D;  4ED0 A;  4BJQ A;  2R8I A;  2HBM A;  1X9M A;  5J2A A;  4UAT A;  3M6Z A;  3WU2 U;  8ICF A;  2YML A;  4FE3 A;  1SV4 A;  5HHI A;  3T79 A;  4CGZ A;  1CUK A;  2A1A A;  5CJ7 A;  1L7P A;  1H38 A;  1LKY A;  4ECW A;  4NWI A;  1U48 A;  4OJO A;  4F4W A;  5EE0 A;  2LYA A;  5GTH U;  5FP0 A;  2XGQ A;  1SL0 A;  2D3D A;  3KZI U;  2PMZ F;  2AHO B;  4ECX A;  4XQ8 A;  2Y1I A;  1NJZ A;  1OUQ A;  3BDP A;  5EOZ A;  1S9F A;  2KIW A;  2QKQ A;  2OM6 A;  3TKA A;  3CNH A;  2W11 A;  1UT8 A;  5KFG A;  4QZ8 A;  4R63 A;  2EZX A;  4MF8 A;  4ED6 A;  8ICU A;  3ONN A;  1WWV A;  4IQU A;  1A76 A;  1S77 D;  4EX6 A;  1QSS A;  1JI7 A;  1TAU A;  2G5I B;  4QZD A;  3PR5 B;  2BHN A;  4F4Y A;  3SEN A;  4F4K A;  2NO5 A;  1DGJ A;  3NAS A;  3L4P A;  3QNM A;  4KLO A;  5ALN A;  2MUT A;  4DOC A;  2W54 A;  2XCP A;  3TAD A;  4TQS A;  3ZDA A;  3PV8 A;  4MEX A;  2W8L A;  3C5F A;  2BPG A;  2JEF A;  2E1E A;  8ICY A;  5AIA A;  3AQF A;  3OSP A;  2JEG A;  1JXL A;  4HYK A;  8ICW A;  2FDR A;  5IIK A;  3UMC A;  1RYS A;  2E8P A;  5DBA A;  2W9B B;  3NRZ A;  2QB0 A;  4DFP A;  2XC9 A;  4B9T A;  1JAL A;  3H8J A;  5ALK A;  4ED8 A;  9ICO A;  5AI6 A;  3H0M B;  2R18 A;  4KN7 A;  5J2I A;  3NGD A;  4EBC A;  3PO5 A;  4IQV A;  1SL2 A;  5KFV A;  2M9N A;  3RJI A;  2HBK A;  2WF7 A;  1MQ2 A;  2KK0 A;  1MC8 A;  4NLB A;  1QQ5 A;  4PZO A;  3TAP A;  2VIX A;  2KNJ A;  2RQ5 A;  3BZK A;  5CRX A;  4K4H A;  4NLC A;  1L3T A;  1K1S A;  9ICW A;  2RDJ A;  1KSP A;  2MU2 A;  3UXP A;  5EWE A;  2ZUD A;  2DPI A;  3ZDD A;  4F5Q A;  1O03 A;  1S0N A;  2BCQ A;  1GO3 F;  5D46 A;  2WFA A;  4OJL A;  1ZD3 A;  1RQN A;  5ALW A;  5L1M A;  4GIB A;  5ALV A;  2LYH A;  2ZUC A;  5KFS A;  2GLE A;  2C22 A;  3HT3 A;  3QU5 A;  1ZQZ A;  3RAX A;  3WK7 A;  3C23 A;  5DLG A;  4R64 A;  4EEL A;  1Q8K A;  2NRW A;  3IN5 A;  1D8L A;  3LWM A;  4M0A A;  4YD1 A;  3RB6 A;  2AH5 A;  1SKR A;  5BOM A;  2PFO A;  4Z6F A;  3SAH A;  1L5U A;  4PL2 A;  2KZ3 A;  2IHM A;  9ICH A;  2OH2 A;  5ALS A;  3ZDC A;  7ICR A;  8ICO A;  4UAU A;  5KG3 A;  8ICG A;  4IQW A;  1ZRM A;  4CE6 A;  1KQQ A;  1HUO A;  1ZQH A;  5EE3 A;  5KG0 A;  3KHR A;  4KLL A;  4QZF A;  5BPC A;  3OGU A;  2ZXH A;  9ICP A;  4B9V A;  5F9N A;  3Q8Q B;  4Y2U A;  4DQI A;  2KVS A;  2KN7 A;  4O3S A;  3K1R B;  4DOA A;  2GOL A;  5CA7 A;  5JU5 A;  4KX5 A;  5ALF A;  1N56 A;  4O5K A;  4PHA A;  4QWE A;  4TUQ A;  2FI1 A;  2KKP A;  7ICS A;  2R8K A;  5GTI U;  4P0P B;  5AKK A;  1ZJN A;  3FDS A;  2DWQ A;  2F3N A;  1UA1 A;  2LMR A;  7ICE A;  2BQ3 A;  3TI0 A;  3SYZ A;  1XU4 A;  4OO1 J;  2KEY A;  4TUP A;  2CN1 A;  1B43 A;  5AK4 A;  3AN1 A;  4Y2R A;  1J2N A;  5F3X B;  1ZQO A;  2BGW A;  3V6H A;  4OCZ A;  2K4P A;  3N7S C;  4BUG A;  1HJP A;  5TZV A;  2W9B A;  2NYV A;  2OWO A;  4QJF B;  4JB3 A;  2RLT A;  2MA1 A;  4U7C A;  2H3I A;  3BS5 B;  2PFP A;  3SD7 A;  4YR2 A;  4BWM A;  4F4Z A;  1YZ7 A;  2HVI A;  1BVS A;  4I2D A;  5HMM A;  2ZG6 A;  5AIC A;  4C80 A;  5J0U A;  1S8O A;  4M9H A;  3QUQ A;  2K4I A;  3QZ7 A;  2GWS A;  3RH4 A;  5B5E U;  2FPL A;  2VA3 A;  2A19 A;  2F76 X;  4Z6E A;  3QXG A;  5KFN A;  3EWA A;  4RQ3 A;  2PKE A;  1AQ6 A;  3T5H A;  1JMS A;  2BQR A;  4QZB A;  3TAR A;  2VJ5 A;  2HHU A;  4YP3 A;  1WYG A;  2IOF K;  4M9N A;  1T8E A;  1TK8 A;  2L5Y A;  2Q0Z X;  4UB6 U;  5T14 A;  1BPD A;  4ECY A;  3ZDB A;  2F77 X;  1OW5 A;  3WK9 A;  4MHV A;  2A1J B;  4QWA A;  1RZT A;  3PX6 A;  3MGI A;  5DDY A;  4J9N A;  3MFI A;  4ECT A;  3RJH A;  1BPX A;  3RR7 A;  1C20 A;  2KIV A;  5KG2 A;  4GXK A;  8ICE A;  4UAV A;  2DKX A;  3MC1 A;  4PL1 A;  5DQI A;  1XO0 A;  8ICA A;  5AM4 A;  3I1Y A;  4NLN A;  3D2Q A;  2ZTD A;  2AGO A;  2JH7 A;  2VA2 A;  1XC9 A;  3TAD C;  1ZQP A;  2BCR A;  1FO4 A;  3G6V A;  1MA7 A;  4C8O A;  4M9L A;  2XI9 A;  5AI4 A;  4EYI B;  4RU9 A;  4DO9 A;  4FZN A;  4DSK A;  4P4M A;  1X2I A;  1ZQA A;  1DK3 A;  4JK1 A;  4I2A A;  3KHG A;  5J2K A;  4P0P A;  9ICJ A;  4GC6 A;  8ICX A;  7ICU A;  2F1I A;  2W9C B;  1U47 A;  3M9M B;  2NV3 A;  4MFF A;  2KHV A;  1X6I A;  2DL0 A;  5KL1 B;  3FM9 A;  4ECR A;  2ZJ8 A;  2ISO A;  7ICN A;  5L1J A;  1D9F A;  5J2H A;  3SV3 A;  3RRG A;  3I28 A;  9ICI A;  1FIQ A;  1NK4 A;  2OHF A;  3SQI A;  2KSO B;  3WK6 A;  8ICP A;  3CW2 C;  3BS5 A;  3ZI4 A;  1LB2 B;  4J03 A;  4BGD A;  3EPI A;  3PX4 A;  4O3R A;  2R8G A;  1D8Y A;  3PW5 A;  3PVX A;  1S0M A;  9ICM A;  2WAQ C;  3ISB A;  7ICV A;  2UVW A;  1VDV A;  3KFU F;  1X9S A;  2DFL A;  2EAO A;  1Z19 A;  4RNO A;  3M8S A;  1PZN A;  4CDG A;  2F8L A;  1LV5 A;  2LM1 A;  3ALR A;  3C21 A;  2D8C A;  5AHX A;  1Q3V A;  5C0Y A;  2BDP A;  3RH5 A;  4F92 B;  4GFJ A;  1ZQG A;  3WKE A;  3EUB 2;  2V4Q A;  5AKI A;  2BZF A;  4PGY A;  5KFW A;  3LK9 A;  4O9M A;  3AU2 A;  1Z00 B;  1FEZ A;  4AYB C;  4KLJ A;  3KHL A;  4CCH A;  2JH1 A;  2A1J A;  2LPE A;  3HP6 A;  2BR0 A;  4I2G A;  4CF4 A;  4F5O A;  5AKE A;  3ETL A;  2WB1 C;  2YX8 A;  2XO7 A;  9ICS A;  7ICG A;  3HWT A;  4NLG A;  5KG1 A;  3RJE A;  5G5H A;  4O3Q A;  2YY6 A;  4Y2Y A;  1V38 A;  1SWW A;  4UAS A;  9ICC A;  3PST A;  5J2C A;  2CRX A;  3PY8 A;  1L3V A;  4P0Q B;  4M9G A;  3QUB A;  2ASL A;  4F93 B;  4QNL A;  3D2S A;  1ZD2 P;  5AM2 A;  4Q45 A;  3WKB A;  2FLL A;  2NO4 A;  5J0O A;  1KW4 A;  3QX7 A;  1ZQF A;  4A8E A;  3PO4 A;  1ZYQ A;  4RPY A;  4NLK A;  4ECV A;  3L3F X;  5ALT A;  1ARO P;  5DKW A;  1A77 A;  2W9C A;  4KLG A;  2C2D A;  4M6W A;  4ELV A;  1IXR A;  2A3V A;  4QZH A;  3QEA Z;  1SL1 A;  4CF3 A;  2B0C A;  1URJ A;  3A0B U;  3GIL A;  4NXZ A;  5ALX A;  1QTM A;  3IG5 A;  2KSO A;  2W3S A;  2E3T A;  3THV A;  3KHH A;  5CP2 A;  4F5N A;  1ZD5 A;  5CEH A;  2HHS A;  1JN3 A;  3MGH A;  3IP4 B;  3JPN A;  3D2N A;  4ELT A;  3HKZ F;  3DV9 A;  1N2X A;  4IR1 A;  3H40 A;  4DL5 A;  1ZXI A;  4FO6 A;  4B6J A;  3CRX A;  4FFD A;  4JUZ A;  2RDI A;  5ALY A;  5KFC A;  4F91 B;  2OXO A;  4Y2V A;  8ICI A;  3NTU A;  5EE9 A;  1NK5 A;  3WK4 A;  5IIL A;  1BPE A;  9ICT A;  3AUO A;  3RBE A;  1UQV A;  4JWN A;  5KFU A;  1X66 A;  1PK1 B;  1RQL A;  2C2R A;  1WCN A;  5C5J A;  3B0Y A;  1V97 A;  3V7L A;  3SAF A;  4RT2 A;  1NK9 A;  9ICG A;  3GZF A;  2ZTC A;  4YFK A;  5AI5 A;  4J9S A;  1RDF A;  2F2A B;  3MR5 A;  4KLE A;  3FYH A;  1NK7 A;  4R8U A;  5EWF A;  5DG7 A;  5ALM A;  1N5W A;  2KIC A;  3M9N B;  5AI0 A;  9ICX A;  1EXN A;  2KV2 A;  4EEN A;  3JPO A;  1ZQN A;  4DQP A;  2G08 A;  1HIW A;  4QWB A;  3JPS A;  5DDM A;  4KLU A;  1N5X A;  1JRP A;  1YT3 A;  3MAB A;  3UXO A;  2FMQ A;  5J0W A;  3GIM A;  2IA6 A;  1NI3 A;  4C4S A;  2FPM A;  3OHA A;  1FFV A;  4M2Y A;  2KZM A;  1SKW A;  4P0Q A;  5J0R A;  3BQ1 A;  3ORY A;  3WKC A;  1N62 A;  3ISD A;  4DLG A;  4DLE A;  4ED3 A;  1N48 A;  3AU6 A;  2JEJ A;  3RAQ A;  3EZ5 A;  4O3O A;  3QU9 A;  2HDO A;  5EE1 A;  2P66 A;  4UQG A;  8ICL A;  3GV8 B;  1SWV A;  1XO1 A;  4NY8 A;  3HX0 A;  1DK2 A;  3DEE A;  4KIT B;  4C4R A;  1KFS A;  8ICR A;  4G9B A; 
#chains in the Genus database with same CATH homology
 2DUY A;  5E79 U;  1S5L U;  5H2F U;  2AXT U;  5KAF U;  5GTI U;  4UB6 U;  5B66 U;  4PJ0 U;  5GTH U;  5B5E U;  3KZI U;  3A0B U;  4IL6 U;  5KAI U;  3A0H U;  4UB8 U;  3WU2 U;  5TIS U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...