5H2FU

Crystal structure of the psbm-deletion mutant of photosystem ii
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
97
structure length
97
Chain Sequence
b'ELVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem II protein D1 1
molecule tags Photosynthesis
publication title Mutual relationships between structural and functional changes in a PsbM-deletion mutant of photosystem II.
pubmed doi rcsb
total genus 33
structure length 97
sequence length 97
chains with identical sequence u
ec nomenclature
pdb deposition date 2016-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF06514 PsbU Photosystem II 12 kDa extrinsic protein (PsbU)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.320 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Photosystem II 12 kDa extrinsic protein 5h2fU01
4UB8U 5B5EU 5GTHU 1S5LU 5TISU 3KZIU 2DUYA 5E79U 3A0HU 5KAIU 4IL6U 2AXTU 4PJ0U 5H2FU 3WU2U 5GTIU 5B66U 5KAFU 4UB6U 3A0BU
chains in the Genus database with same CATH superfamily
2M0NA 2WHEA 2FMPA 3JPPA 1X6IA 1VJ5A 4PHPA 3KD3A 3N28A 2ASLA 2HHSA 3CYMA 1ZQYA 2CN1A 2FPLA 1Z00B 2R8IA 5KNIA 5ALSA 2BCRA 2C28A 4B6JA 2JEGA 4PHEA 4IC9A 4QZAA 1SL1A 1QSLA 4USAA 5B66U 3TADC 4O3SA 5J2CA 2YMQA 2NO4A 4J9QA 1XC9A 2XVTA 2BHNA 5HNKA 2XC9A 4UB2A 3HW8A 7ICLA 3TANA 4P4OA 5HHIA 5KL1B 7ICMA 1BVSA 4ECTA 2XY7A 4C4SA 2WB1F 3N7RC 8ICZA 2BPCA 5J0OA 2BPFA 5HR7A 1XWLA 1X9MA 5ALRA 2AU0A 2Y9TA 5ALUA 5C5JA 4P0QA 4EBDA 5ALDA 4DQSA 2CRXA 4MEXA 2HVHA 3F2BA 3QE9Y 2R8GA 3PO5A 4J03A 3RB6A 1S10A 8ICFA 4KTQA 4KLLA 1D8YA 2BR0A 1HIWA 4YN4A 3R9KA 5EWEA 4RUCA 3UXNA 3H0RB 1NZPA 8ICCA 2WFAA 4NL9C 4UAZA 4M04A 4DQRA 3F2CA 3N7SC 5ALEA 2Y0SC 2E8NA 3ISCA 4JMUA 2LKYA 3PO4A 2ZIVB 1T7PA 3GQCA 2KFNA 5J2GA 1SKSA 2C2RA 3K75D 4RQ6A 5L1MA 2KTQA 5J8YA 3M9OB 3RRHA 2MSNA 2HDOA 3MFIA 4M9GA 1COOA 4I2JA 2KJ8A 4Y2TA 4BWJA 2KG5A 3RF9A 2F44A 4C0ZA 5L1LA 5DB7A 5KT6A 2K4PA 3H8MA 2GOLA 3ICXA 2JRZA 4KMOB 5L1JA 3AM9A 8ICNA 2ZIXB 2DPIA 3A0BU 5EE9A 4K4HA 1U47A 4DSEA 3H8WA 1ZJNA 3VCBA 3T5HA 2E8PA 4I2DA 3AQFA 2K4EA 3OSPA 3Q8RB 4CF5A 3NVVA 5DGAA 3LWLA 2ZJ8A 5ALXA 5DBCA 2VJ5A 1L7PA 4MEYA 4R66A 4RQNA 3EZ5A 2ASJA 4RT2A 1RG6A 1SV0C 5E79U 2D6FC 5DB6A 1A76A 2YQEA 2LYHA 1UCVA 1NJWA 3H8SA 1V38A 3GZFA 4RPYA 2VJ4A 2LHTA 2BDPA 4O9MA 3C1YA 4JV0A 4QIWF 5JU5A 4UATA 3UXOA 2G08A 3GIJA 2DQNB 1PZNA 4NM2A 4CF3A 9ICQA 2E3TA 1XO1A 1SWVA 2YMMA 3SV3A 4ELVA 5F3XB 9ICMA 2Y9UA 3RJEA 2FPMA 2K8CB 5D46A 2XCAA 5AI5A 2A3VA 4I2CA 5ALZA 1U48A 4Q43A 1MC8A 4RQMA 4QZEA 1SB3C 2KFZA 3WKAA 4O5KA 3G6YA 3M9NB 2W04A 3HKZF 1L3TA 4NLZA 2D3DA 3IG5A 4CDGA 1C7YA 3KKAA 4GFJA 5AKYA 3N97B 5B5EU 4UBCA 4ECXA 2ISOA 5KFDA 4ECQA 2XI9A 8ICQA 2KIWA 4GC7A 4RQ1A 9ICHA 2QB0B 5KFVA 3C1ZA 4P0PA 4UB8U 4UB4A 4JWMA 3BQ1A 5AKZA 4NV0A 3EYZA 5KFBA 3LVWA 1A6SA 3V6JA 4QW9A 3RRGA 3KHRA 3IHQB 4RU9A 4DQQA 1X9WA 1SL2A 1YT3A 2HOIA 2GH1A 5GTIU 3HP6A 3EPIA 1WCLA 4YP3A 1TAMA 1Q8KA 4J9OA 5AM5A 3LYSA 5F9NA 2W3SA 4DF8A 7ICUA 1Z00A 1L7OA 1Q46A 1RYRA 1PVPA 3MGVA 3C5GA 5KG7A 5KFFA 1COKA 4YD1A 1JALA 4UB6U 2PKEA 1ZQWA 3MGIA 1ZQJA 1NJYA 3PR4A 4P2HA 5J0PA 3JPTA 1RQNA 3QUCA 1SZHA 5AKGA 1X40A 4I27A 1NK0A 3UM9A 4OD0A 8ICBA 2P6RA 1MQ2A 3B0XA 9ICIA 2ZUDA 4KLTA 9ICOA 1AQ6A 3BZKA 4F3OA 1NKBA 1SKWA 3JPRA 4YXJA 2LYAA 5DLGA 4IL6U 4ICAA 2OXOA 2KKVA 2OM6A 5IILA 9ICPA 4EYIB 1CEZA 1ZD4A 2ZXIA 5KG1A 1FFVA 1N62A 2BPGA 2ZIUA 3E2EA 4GLXA 3WU2U 2AQ4A 1UA1A 4Y2QA 4HYKA 2E1FA 2HSZA 5KL8B 1ZQZA 2KVSA 4C8OA 4I28A 2XY5A 3KZXA 4Y2UA 1OXJA 1Y88A 3RAQA 3JPSA 3PSIA 4KLOA 2QARB 4F4XA 1XSLA 1QH9A 2BDUA 2LM1A 3PR5B 5AI8A 3GU3A 2YTUA 5T14A 1N5XA 5KFRA 2A1JB 5J0UA 5IIKA 3UQ2A 1ZQQA 3TARA 5J0TA 2RRDA 5F9LA 3KFUF 5KT2A 3HX0A 4DL7A 2A19A 3IM1A 4F4YA 4QWAA 1T8EA 3AQEA 1ZD2P 4J9NA 3VC8A 1L5UA 1JRPA 3PW4A 4IR1A 3THVA 3K1ZA 1SWWA 4F50A 1KEJA 3KHGA 3UMGA 4UB5A 2W9AA 4PL1A 2E5SA 4RQ7A 5D49A 4O3PA 3KHLA 4EBEA 2DKXA 3L4PA 2XO7A 1IV8A 4WJ3B 1VDVA 4NWIA 1SL0A 3Q8KA 1BPDA 4G9BA 3QX7A 3ISDA 3TADA 4B9UA 5AKXA 4US8A 4GC6A 1NK8A 3ZDBA 3C28A 1ZQHA 2JV3A 4PGQA 2ATLA 1RPLA 2W7OA 4C7ZA 4CE6A 2R8KA 2DGZA 4I2IA 4RQ3A 2HBJA 2WF6A 1J2MA 2AGOA 3M7DA 4FS1A 1PUZA 1ZQKA 4MFCA 2G07A 2Y1JA 3RJHA 4ED0A 5DQGA 1ZYQA 4Y2XA 4DLEA 2YB1A 2I1QA 4QZFA 2FI1A 4QJFB 2P66A 4DS5A 4QWBA 1TAUA 4FZNA 1JIHA 5JRTA 3KBBA 2HOQA 3B9JA 3QU4A 4Z6CA 4J9RA 4PL2A 1LVHA 2BCQA 1S0NA 4DQPA 3SZ2A 3KOOA 1XSNA 7ICQA 1UPHA 4EZ9A 1V85A 1KFTA 1NK6A 3PSFA 4DEZA 2DF4B 2IOHA 2EAOA 1BGXT 4ECWA 3K1RB 2L5YA 2VA3A 2KIVA 8ICJA 2ZTDA 9ICJA 4O3MA 8ICKA 4PHAA 4DL3A 5KFSA 3RR8A 4C8NA 4R63A 5AICA 2LBOA 5J2EA 5KAIU 2KJ5A 8ICLA 1QSSA 4F5NA 4YG2A 3PNCA 1ZRMA 1L7MA 4KITB 2JEJA 9ICTA 3NTUA 2AQ0A 1L6NA 2XY6A 4O5CA 3RJIA 3RBEA 2KZZA 4IQUA 4DLGA 3T3FA 5BPCA 1WUDA 2MUTA 4ED7A 1GO3F 1F0MA 1K5OA 2KNJA 3LVVA 3PX6A 2ODGA 2ZXHA 3FYHA 5AKIA 4MFAA 2ES6A 2JZBB 4TURA 2ZTCA 4JK1A 4DOBA 8ICVA 2YX8A 4TUQA 4UB1A 3T5JA 5H2FU 1KKXA 4LZDA 1KLNA 2HHUA 2M9NA 1IM4A 1F5SA 3CW2C 1KTQA 3OSNA 4DFJA 2W43A 3L5KA 3PW0A 3N7PD 4MFFA 2ZIUB 2EQYA 5AI4A 2RLTA 2WF7A 5ALOA 4DSFA 4ECYA 1P7DA 4I2FA 1WWVA 3D2QA 1DRGA 5KAFU 3AU2A 2JH7A 3ZDEA 5J0QA 4X5VA 5KTQA 8ICGA 5ALFA 1D9DA 3PW5A 4P0QB 2NRZA 1CI4A 1X6JA 4M47A 3HILA 4UB3A 4U7CA 2DKZA 3IP4B 3GV5B 4KMUA 2EANA 4JWNA 1ZQDA 1U45A 4DOAA 4BXOB 4MHVA 3CRXA 2IHNA 4RNOA 4ED6A 1B22A 1ED1A 2W9BB 9ICKA 2W9BA 1N56A 4IQTA 7ICRA 3NUQA 2CPRA 4QW8A 4O3QA 1RXWA 2I5HA 4GXKA 1X42A 1FEZA 4F5QA 5DG8A 5KG0A 4FFDA 4KLIA 3MDCA 5DBBA 4JB3A 9ICEA 3CNHA 1K1QA 4PGYA 2Y1IA 3RJJA 4C7YA 3AUOA 2E8MA 3ETRA 4PGXA 4QWDA 2W11A 9ICBA 3SAHA 2Q4TA 1CRXA 1S77D 3E0FA 4UARA 3MR2A 5DKWA 4QWEA 4F4WA 1Z4OA 4C4RA 2BZFA 4DL4A 5L1IA 2PFPA 2ZTEA 5J2DA 4F92B 2P6UA 5J0SA 8ICAA 2JEFA 4R8UB 1FIQA 3S6JA 1JROA 3QU2A 2VA2A 5ALVA 4GXJA 1S0OA 4P4PA 1FFUA 5HMMA 5ALYA 1T94A 4G3IA 5EE0A 1Z3EB 4RPZA 2WB1C 7ICKA 1L3SA 4KLGA 2BQ3A 4OJLA 5CEHA 1RYUA 5AI6A 2AGPA 4IRKA 1ZQIA 4DOCA 2KD1A 3AL0B 4KLDA 1JXLA 3PSPA 1RZTA 4EELA 4R8UA 4PZOA 2ZG6A 2H3QA 4BGDA 3FAHA 1ZQTA 1ZQRA 2QB0A 7ICNA 5DB8A 3IDWA 5AKLA 1DGSA 2IOFK 4IQVA 3SEIA 4JUZA 3QEBZ 1WG8A 2G09A 3OTQA 4Q8FA 4UASA 2VA8A 3AMZA 1B43A 4I29A 2OEHA 3HWTA 4EZ6A 2K8BB 4M0AA 4EENA 2IHMA 5G5GA 5KFOA 3TFSA 4CCHA 4A8EA 5AHXA 4Q45A 3ZD9A 1D8LA 4GIBA 3V6KA 2C2DA 4B9MA 5ALNA 2W9MA 3Q8SB 4YFKA 3NVZA 2PI4A 5DBAA 4YXMA 5CR0A 2H5XA 3RAXA 4IRDA 1DXSA 2PMZC 4DSKA 3ZD8A 3SI8A 2QLTA 1D9FA 2QARA 2HI0A 5GTHU 3KKAC 5HP4A 5EWFA 3BQ0A 3G6XA 1RM6C 3BDPA 4YMOA 5IIIA 2HHWA 5EE1A 4CGZA 4PJ0U 3C29A 3QU7A 4Y2YA 2UVRA 3NASA 4J9KA 2MUTB 5KFZA 3QZ8A 7ICSA 2K60A 3MR6A 4R65A 1Q3UA 2RP5A 2PXIA 3EPGA 1TK5A 4ELUA 2F3NA 3C23A 2Y0SF 2HBKA 4F4ZA 5EWGA 4TUSA 4EEKA 3MFHA 1ZQOA 2A1JA 1YZ6A 1TE2A 1ZQ1C 4QNLA 1TV9A 3NVWA 5J2AA 4Z6DA 2PFQA 2LM4A 4O3NA 7ICPA 1BPYA 1TK8A 4DCCA 5AM2A 3PSTA 4OJOA 1QQ7A 2O6KA 4PHDA 1JI7A 1Z1BA 2F76X 4NXZA 4KLJA 2G5IB 1X9XA 1Z19A 1L8LA 4EX7A 5DLFA 2FPKA 1PK1B 1ZD5A 8ICXA 3SMVA 2XCPA 5ALWA 4YMMA 1X2IA 3BJYA 4B9VA 9ICLA 4RQ8A 5CB1A 1SXEA 3JPOA 4XA5A 1BPXA 1UT8A 2KMDA 1PK3A 3DEEA 3H0MB 2W9CB 4YD2A 2KJ9A 1L3VA 2J6UA 4KLHA 4Q44A 4DFPA 5HR6A 5KG5A 2I9GA 5J2FA 3OJSA 2R18A 1XS9D 3RFAA 5KG2A 4R64A 1NJZA 4CNQA 3A0HU 5KFKA 3WKDA 4P4MA 2EZXA 2EDUA 1S76D 2EZZA 1UQVA 2MU2A 2I6XA 4JV2A 2AJQA 9ICGA 9ICRA 4FE3A 2NYVA 4IR9A 4F2RA 2Q0ZX 1M6YA 3KHHA 3H0LB 1B0XA 4KX3A 4NLBA 2F8KA 1DGJA 2ZIXA 1D8BA 4CF4A 1KSPA 1IXRA 4BJQA 3C5FA 3KZIU 4TQSA 1L7NA 3D6JA 3Q8MA 3H8JA 1ZQAA 4OCZA 1B4FA 3F2DA 1SXDA 3L3FX 1SZPA 3IRUA 5CJ7A 1LV5A 2KK0A 4BX9C 8ICWA 1TKDA 4PZNA 1JMSA 3SAFA 3UQ0A 3J81j 2W03A 5AM1A 3WKCA 3QUQA 4ECSA 8ICTA 8ICPA 3OJUA 3PMLA 2G06A 2IBKA 4C80A 2KZ3A 1A77A 5CRXA 1ZD3A 1NK4A 3WK4A 3MDAA 4CRXA 5AK5A 4YR3A 2FE9A 3ZI4A 2JH1A 5KFPA 4B9LA 2UVVA 2F2AB 3RH5A 5ALQA 4M9LA 1HUOA 4RQ4A 1XU4A 3C2MA 4Q8EA 2K4IA 4KLEA 2DWQA 2VANA 4F72A 3GDXA 3H4DA 2XGQA 2ESEA 4RZRA 2HBMA 2V4QA 2W8LA 4KN4A 5KFLA 2KSOB 2KE7A 2V4RA 3ZDAA 7ICTA 5KG6A 4HAIA 2RHFA 1UA0A 4RPXA 1HEKA 7ICHA 4DWIA 3SV4A 4PH5A 3MR3A 8ICHA 2W7PA 3RTVA 7ICVA 3SAGA 5ALMA 5KFAA 3DV9A 4NL9A 3MR5A 3GIIA 4EX6A 3F5AA 2ZIWB 2ZIWA 2R8HA 4F8RA 2HBLA 3D2SA 4OJ6A 5K4LA 1S8OA 9ICAA 5TZVA 1OUQA 1K1SA 2DBYA 3KTQA 1PVQA 7ICJA 3Q8LA 5HMLA 3N4MB 1ZRNA 4F93B 5HHHA 1JX4A 3GV8B 4EBCA 2EAMA 2OYYA 4F5RA 2ZJ5A 1V97A 1ZOLA 4UAVA 2KVCA 4FBUA 2IMWP 5IIOA 2FLPA 1RXVA 2HHVA 9ICCA 2KP7A 2DL0A 2UVWA 4M6WA 4E0DA 5J2JA 4O5EA 4UBBA 1KQQA 4NJ8A 2FJ6A 3RH4A 2W8KA 1VLBA 3GIKA 2HMXA 1MN8A 3M1YA 1KDHA 3WK5A 2YMPA 1ZQFA 8ICYA 4QZCA 3MBYA 5KFQA 3BQ2A 5KG4A 5J0WA 4C8MA 3AU6A 4ECUA 2GLEA 5ALTA 1S0VA 5KFIA 5FP0A 3ZDCA 3PX0A 3PW7A 3EWAA 4LJXA 4XRHA 4DL2A 4DS4A 4M9NA 4F2SA 5EE3A 1ZQEA 5CWRA 2JEIA 4Y2JA 1U49A 1ECWA 3QUTA 2AHOB 3HKZC 2F1HA 1MA7A 2YMLA 2BQRA 3FDSA 4ED1A 2C2EA 9ICFA 3UPQA 2H3VA 3UXPA 3V7KA 4M9HA 4DSLA 1SV4A 2OCEA 2E1EA 3I1YA 4KLMA 3BQ7A 5KFJA 1L8OA 3PZPA 1BNOA 2G0AA 2R8JA 1XNSA 2PMZF 2J6TA 1JXEA 3IV6A 2EH9A 3Q8QB 2FDRA 2LMRA 3V7JA 4I2AA 7ICFA 5J2IA 2QB1A 4KLQA 2ZJAA 2K4HA 4QWCA 2HW3A 1X66A 3PV8A 2H3ZA 4FZLA 4I2BA 8ICRA 7ICEA 4AYBF 5BOMA 5CHGA 4QZHA 3HPOA 3RB4A 3QNMA 2QKQA 1O03A 3HJEA 1V9PA 4FZMA 1PVRA 1KBUA 4ECZA 3RB0A 3H7IA 1IIPA 4ED3A 1RYSA 4B9TA 3LDAA 1ZQUA 4Y2RA 5A0LA 2NRTA 3T79A 2HOFA 5L9XA 5J0RA 3I28A 8ICOA 2PI5A 5AM3A 4UAYA 9ICVA 3SENA 1ZJMA 2ISPA 2WTFA 1S5LU 5AKHA 1NK9A 4US9A 4QIWC 1KFSA 5KFYA 1JN3A 5DGBA 1C20A 5BOLA 5KFMA 2NV3A 3TACB 5IIJA 2PFOA 3JPQA 4UAUA 4J9PA 5KFCA 4UAWA 2JMGA 3SYZA 5DDMA 3U26A 4K4IA 1ZQGA 4KN7A 2F1IA 2AGQA 3ETLA 4DQIA 4NM1A 3GILA 8ICIA 8ICMA 2F77X 8ICSA 1LKYB 1BPZA 2AXTU 1QLNA 1N60A 2XIDA 5DG9A 2KHQA 3ED5A 1QQ5A 1NJXA 4I2GA 4BUGA 3RB3A 3HRDD 5AI9A 5ALIA 3M8RA 4DFMA 4OJ5A 5DQHA 5KT5A 2WAQF 5AIBA 3TI0A 3MGHA 1DK2A 4RQ2A 2KV2A 5L1KA 2F8LA 4K4GA 2PFNA 3NGDA 3LK9A 3F5EA 3D2NA 2N1RA 1IG6A 4JV1A 1NZBA 4NY8A 3PX4A 3M9MB 1ZQLA 1ZQPA 2CXYA 5J8YC 2HHXA 5AI0A 3RJGA 9ICSA 2BCUA 4M6WB 4DFDA 4KLUA 2BKEA 1WYGA 2ZUCA 1YZ7A 4MF8A 1ZQSA 3O0FA 2MA1A 3FM9A 3IN5A 1J97A 1NK5A 1ZQXA 1QQ6A 1JUDA 2W55A 2RQ5A 3DDHA 2ZUBA 4Z6EA 5ALPA 4OO1J 4KLFA 5TISU 3BS5A 4ZOHC 5KT7A 5J0XA 4IQWA 1NOMA 3B0YA 3RH6A 2HHQA 2G5HB 3V72A 3BZCA 1N63A 3I76A 2BQUA 1BPEA 4IRCA 3K4GA 1HUZA 3NVYA 2WF5A 3M6KA 4Y2SA 3NS1A 3PMNA 5KFNA 1AROP 3QUBA 1ZQCA 5KFEA 2FMQA 2JXJA 4ED2A 3BQTA 1QSYA 1S0MA 1MSWD 4NLKA 3H40A 1S9FA 1HJPA 5CA7A 3OPXA 3T5LA 1H38A 1ZQBA 3SQIA 2OWOA 9ICXA 3UMBA 4DO9A 4P0PB 2EZYA 2OH2A 4MF2A 4ED8A 3UMCA 1Q3VA 5AK6A 5J2HA 5AKEA 4TUPA 4B9NA 2P35A 2W3RA 4DL6A 1BNPA 2K8AA 3RBDA 3SR6A 2VKQA 2KICA 4IS7A 4RQ0A 2W54A 3RJFA 4QZDA 2KHVA 3CP8A 1QTMA 1WWUA 4Y2PA 3TKAA 2W9CA 3PVXA 2YB4A 4DF4A 2ALZA 1N5WA 3NRWA 1ZQVA 2K89A 4YQWA 4J9LA 4KLSA 3ISBA 2HVIA 2FLLA 8ICUA 2J6SA 3E58A 2C22A 4C8KA 1XO0A 2JHDA 3M8SA 2HCFA 2KSOA 3SD7A 2YN4A 5KFXA 4C4TA 3V6HA 2Z7JA 4DL5A 1QCKA 2KKPA 2B0CA 9ICUA 2GO7A 4Y2VA 4F71A 4BXOA 4FS2A 3WK7A 4KX5A 4AYBC 2V9WA 4EYHB 4M9JA 1XSPA 3WKEA 5IIMA 3WKBA 4YVZA 3RR7A 4QZGA 7ICGA 4YCXA 4F5OA 2DUYA 4XQ8A 2GWSA 5CP2A 5DQIA 1UT5A 4XUSA 4J9MA 1N61A 2IA6A 4DSIA 1SIJA 1T3QA 1U9LA 2BCVA 5D4BA 2KZMA 4YR0A 1T4GA 1T3NA 2ZIVA 4QZBA 1J2NA 1LKYA 5J2BA 4PPXA 7ICOA 3PY8A 4B9SA 1U4BA 2RDIA 3EUB2 3JPNA 4I2HA 4QZ9A 2B21A 4UQGA 1TVAA 5ALHA 5G5HA 5JTIA 2E8OA 4QZ8A 1NK7A 2JZBA 5ALKA 1DK3A 4LZGA 4LVSA 2RDJA 2BCSA 2H3IA 4OJPA 1Z4NA 1S97A 1RQLA 4YMNA 1BPBA 1KRPA 4BWMA 1ZXIA 4I2EA 7ICIA 1Z1VA 4F91B 4FO6A 1KW4A 1ZQMA 3F53A 3ALRA 5KFTA 3H4BA 2MAXA 5ALLA 2NRWA 2UVUA 3C2LA 5AKJA 2JR5A 2AH5A 3QU9A 3GV7B 4ECRA 2LYBA 3WK8A 1N48A 2A1AA 5AM4A 1NKEA 5DDYA 4DFKA 4O3OA 3QXGA 2YY6A 1SV0A 1O08A 4UW9A 1SKRA 3IG8A 5AM0A 4J9SA 4RQ5A 1NKCA 3V7LA 1RDFA 1N2XA 3ORYA 2OHFA 1DOQA 4RUAA 4RNMA 1ZQNA 4U6PA 1TK0A 8ICEA 1KL9A 2JGAA 3M6ZA 5KFUA 1KN5A 1PK1A 1TAQA 2D8CA 3C21A 1NNLA 3AN1A 3GIMA 2KN7A 3BS5B 1TFRA 1EXNA 2NO5A 2NRVA 4NLCA 4NLNA 2WF9A 2H3FA 1X9SA 5JUMA 1FO4A 5C0YA 4BDPA 1CUKA 5AKKA 1NI3A 4Z6FA 2WAQC 5AK3A 4ACOA 1UHUA 1ZETA 3FC4A 3OHAA 2KEYA 4ECVA 2XICA 3EW9A 3PW2A 2FLNA 4DSJA 2NRXA 1A0PA 4FBTA 3TAQA 3ZDDA 2ASDA 1L3UA 5J29A 4NLGA 5KT3A 2HHTA 2EAPA 2IOFA 3AEVA 1F44A 3WK6A 1SGGA 2F1JA 2DFLA 4AP9A 4ELTA 3Q8PB 5IINA 3QEAZ 2BGWA 5EOZA 2WF8A 1WCNA 3OGUA 3TQ1A 9ICWA 4RT3A 4GXIA 5KFWA 1KFDA 3QU5A 3GFKB 3MC1A 3BS7A 1URJA 4O3RA 2B6GA 5J2KA 2VIXA 2MRLA 3RJKA 4RNNA 5AIAA 5DB9A 3TFRA 2LI6A 4F5PA 5AK4A 3C2KA 5ALJA 4YR2A 4M2YA 3T5KA 4O0IA 4QZIA 5DG7A 9ICNA 5KFHA 5KT4A 4ZH4A 5ALGA 5KFGA 3WK9A 3QZ7A 3TAPA 3LWMA 1OW5A 3ONNA 4TQRA 2FMSA 3NRZA 3HT3A 5J0YA 3MABA 3G6VA 4EEYA 1LB2B 3OHBA 1MQ3A 5KG3A 2LPEA 2KOBA 4F4KA 4C8LA 2DPJA 3QYPA 2XGPA
chains in the Genus database with same CATH topology
4UB8U 5B5EU 5GTHU 1S5LU 5TISU 3KZIU 2DUYA 5E79U 3A0HU 5KAIU 4IL6U 2AXTU 4PJ0U 5H2FU 3WU2U 5GTIU 5B66U 5KAFU 4UB6U 3A0BU
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UB8 U;  5B5E U;  5GTH U;  1S5L U;  5TIS U;  3KZI U;  2DUY A;  5E79 U;  3A0H U;  5KAI U;  4IL6 U;  2AXT U;  4PJ0 U;  5H2F U;  3WU2 U;  5GTI U;  5B66 U;  5KAF U;  4UB6 U;  3A0B U; 
#chains in the Genus database with same CATH topology
 2M0N A;  2WHE A;  2FMP A;  3JPP A;  1X6I A;  1VJ5 A;  4PHP A;  3KD3 A;  3N28 A;  2ASL A;  2HHS A;  3CYM A;  1ZQY A;  2CN1 A;  2FPL A;  1Z00 B;  2R8I A;  5KNI A;  5ALS A;  2BCR A;  2C28 A;  4B6J A;  2JEG A;  4PHE A;  4IC9 A;  4QZA A;  1SL1 A;  1QSL A;  4USA A;  5B66 U;  3TAD C;  4O3S A;  5J2C A;  2YMQ A;  2NO4 A;  4J9Q A;  1XC9 A;  2XVT A;  2BHN A;  5HNK A;  2XC9 A;  4UB2 A;  3HW8 A;  7ICL A;  3TAN A;  4P4O A;  5HHI A;  5KL1 B;  7ICM A;  1BVS A;  4ECT A;  2XY7 A;  4C4S A;  2WB1 F;  3N7R C;  8ICZ A;  2BPC A;  5J0O A;  2BPF A;  5HR7 A;  1XWL A;  1X9M A;  5ALR A;  2AU0 A;  2Y9T A;  5ALU A;  5C5J A;  4P0Q A;  4EBD A;  5ALD A;  4DQS A;  2CRX A;  4MEX A;  2HVH A;  3F2B A;  3QE9 Y;  2R8G A;  3PO5 A;  4J03 A;  3RB6 A;  1S10 A;  8ICF A;  4KTQ A;  4KLL A;  1D8Y A;  2BR0 A;  1HIW A;  4YN4 A;  3R9K A;  5EWE A;  4RUC A;  3UXN A;  3H0R B;  1NZP A;  8ICC A;  2WFA A;  4NL9 C;  4UAZ A;  4M04 A;  4DQR A;  3F2C A;  3N7S C;  5ALE A;  2Y0S C;  2E8N A;  3ISC A;  4JMU A;  2LKY A;  3PO4 A;  2ZIV B;  1T7P A;  3GQC A;  2KFN A;  5J2G A;  1SKS A;  2C2R A;  3K75 D;  4RQ6 A;  5L1M A;  2KTQ A;  5J8Y A;  3M9O B;  3RRH A;  2MSN A;  2HDO A;  3MFI A;  4M9G A;  1COO A;  4I2J A;  2KJ8 A;  4Y2T A;  4BWJ A;  2KG5 A;  3RF9 A;  2F44 A;  4C0Z A;  5L1L A;  5DB7 A;  5KT6 A;  2K4P A;  3H8M A;  2GOL A;  3ICX A;  2JRZ A;  4KMO B;  5L1J A;  3AM9 A;  8ICN A;  2ZIX B;  2DPI A;  3A0B U;  5EE9 A;  4K4H A;  1U47 A;  4DSE A;  3H8W A;  1ZJN A;  3VCB A;  3T5H A;  2E8P A;  4I2D A;  3AQF A;  2K4E A;  3OSP A;  3Q8R B;  4CF5 A;  3NVV A;  5DGA A;  3LWL A;  2ZJ8 A;  5ALX A;  5DBC A;  2VJ5 A;  1L7P A;  4MEY A;  4R66 A;  4RQN A;  3EZ5 A;  2ASJ A;  4RT2 A;  1RG6 A;  1SV0 C;  5E79 U;  2D6F C;  5DB6 A;  1A76 A;  2YQE A;  2LYH A;  1UCV A;  1NJW A;  3H8S A;  1V38 A;  3GZF A;  4RPY A;  2VJ4 A;  2LHT A;  2BDP A;  4O9M A;  3C1Y A;  4JV0 A;  4QIW F;  5JU5 A;  4UAT A;  3UXO A;  2G08 A;  3GIJ A;  2DQN B;  1PZN A;  4NM2 A;  4CF3 A;  9ICQ A;  2E3T A;  1XO1 A;  1SWV A;  2YMM A;  3SV3 A;  4ELV A;  5F3X B;  9ICM A;  2Y9U A;  3RJE A;  2FPM A;  2K8C B;  5D46 A;  2XCA A;  5AI5 A;  2A3V A;  4I2C A;  5ALZ A;  1U48 A;  4Q43 A;  1MC8 A;  4RQM A;  4QZE A;  1SB3 C;  2KFZ A;  3WKA A;  4O5K A;  3G6Y A;  3M9N B;  2W04 A;  3HKZ F;  1L3T A;  4NLZ A;  2D3D A;  3IG5 A;  4CDG A;  1C7Y A;  3KKA A;  4GFJ A;  5AKY A;  3N97 B;  5B5E U;  4UBC A;  4ECX A;  2ISO A;  5KFD A;  4ECQ A;  2XI9 A;  8ICQ A;  2KIW A;  4GC7 A;  4RQ1 A;  9ICH A;  2QB0 B;  5KFV A;  3C1Z A;  4P0P A;  4UB8 U;  4UB4 A;  4JWM A;  3BQ1 A;  5AKZ A;  4NV0 A;  3EYZ A;  5KFB A;  3LVW A;  1A6S A;  3V6J A;  4QW9 A;  3RRG A;  3KHR A;  3IHQ B;  4RU9 A;  4DQQ A;  1X9W A;  1SL2 A;  1YT3 A;  2HOI A;  2GH1 A;  5GTI U;  3HP6 A;  3EPI A;  1WCL A;  4YP3 A;  1TAM A;  1Q8K A;  4J9O A;  5AM5 A;  3LYS A;  5F9N A;  2W3S A;  4DF8 A;  7ICU A;  1Z00 A;  1L7O A;  1Q46 A;  1RYR A;  1PVP A;  3MGV A;  3C5G A;  5KG7 A;  5KFF A;  1COK A;  4YD1 A;  1JAL A;  4UB6 U;  2PKE A;  1ZQW A;  3MGI A;  1ZQJ A;  1NJY A;  3PR4 A;  4P2H A;  5J0P A;  3JPT A;  1RQN A;  3QUC A;  1SZH A;  5AKG A;  1X40 A;  4I27 A;  1NK0 A;  3UM9 A;  4OD0 A;  8ICB A;  2P6R A;  1MQ2 A;  3B0X A;  9ICI A;  2ZUD A;  4KLT A;  9ICO A;  1AQ6 A;  3BZK A;  4F3O A;  1NKB A;  1SKW A;  3JPR A;  4YXJ A;  2LYA A;  5DLG A;  4IL6 U;  4ICA A;  2OXO A;  2KKV A;  2OM6 A;  5IIL A;  9ICP A;  4EYI B;  1CEZ A;  1ZD4 A;  2ZXI A;  5KG1 A;  1FFV A;  1N62 A;  2BPG A;  2ZIU A;  3E2E A;  4GLX A;  3WU2 U;  2AQ4 A;  1UA1 A;  4Y2Q A;  4HYK A;  2E1F A;  2HSZ A;  5KL8 B;  1ZQZ A;  2KVS A;  4C8O A;  4I28 A;  2XY5 A;  3KZX A;  4Y2U A;  1OXJ A;  1Y88 A;  3RAQ A;  3JPS A;  3PSI A;  4KLO A;  2QAR B;  4F4X A;  1XSL A;  1QH9 A;  2BDU A;  2LM1 A;  3PR5 B;  5AI8 A;  3GU3 A;  2YTU A;  5T14 A;  1N5X A;  5KFR A;  2A1J B;  5J0U A;  5IIK A;  3UQ2 A;  1ZQQ A;  3TAR A;  5J0T A;  2RRD A;  5F9L A;  3KFU F;  5KT2 A;  3HX0 A;  4DL7 A;  2A19 A;  3IM1 A;  4F4Y A;  4QWA A;  1T8E A;  3AQE A;  1ZD2 P;  4J9N A;  3VC8 A;  1L5U A;  1JRP A;  3PW4 A;  4IR1 A;  3THV A;  3K1Z A;  1SWW A;  4F50 A;  1KEJ A;  3KHG A;  3UMG A;  4UB5 A;  2W9A A;  4PL1 A;  2E5S A;  4RQ7 A;  5D49 A;  4O3P A;  3KHL A;  4EBE A;  2DKX A;  3L4P A;  2XO7 A;  1IV8 A;  4WJ3 B;  1VDV A;  4NWI A;  1SL0 A;  3Q8K A;  1BPD A;  4G9B A;  3QX7 A;  3ISD A;  3TAD A;  4B9U A;  5AKX A;  4US8 A;  4GC6 A;  1NK8 A;  3ZDB A;  3C28 A;  1ZQH A;  2JV3 A;  4PGQ A;  2ATL A;  1RPL A;  2W7O A;  4C7Z A;  4CE6 A;  2R8K A;  2DGZ A;  4I2I A;  4RQ3 A;  2HBJ A;  2WF6 A;  1J2M A;  2AGO A;  3M7D A;  4FS1 A;  1PUZ A;  1ZQK A;  4MFC A;  2G07 A;  2Y1J A;  3RJH A;  4ED0 A;  5DQG A;  1ZYQ A;  4Y2X A;  4DLE A;  2YB1 A;  2I1Q A;  4QZF A;  2FI1 A;  4QJF B;  2P66 A;  4DS5 A;  4QWB A;  1TAU A;  4FZN A;  1JIH A;  5JRT A;  3KBB A;  2HOQ A;  3B9J A;  3QU4 A;  4Z6C A;  4J9R A;  4PL2 A;  1LVH A;  2BCQ A;  1S0N A;  4DQP A;  3SZ2 A;  3KOO A;  1XSN A;  7ICQ A;  1UPH A;  4EZ9 A;  1V85 A;  1KFT A;  1NK6 A;  3PSF A;  4DEZ A;  2DF4 B;  2IOH A;  2EAO A;  1BGX T;  4ECW A;  3K1R B;  2L5Y A;  2VA3 A;  2KIV A;  8ICJ A;  2ZTD A;  9ICJ A;  4O3M A;  8ICK A;  4PHA A;  4DL3 A;  5KFS A;  3RR8 A;  4C8N A;  4R63 A;  5AIC A;  2LBO A;  5J2E A;  5KAI U;  2KJ5 A;  8ICL A;  1QSS A;  4F5N A;  4YG2 A;  3PNC A;  1ZRM A;  1L7M A;  4KIT B;  2JEJ A;  9ICT A;  3NTU A;  2AQ0 A;  1L6N A;  2XY6 A;  4O5C A;  3RJI A;  3RBE A;  2KZZ A;  4IQU A;  4DLG A;  3T3F A;  5BPC A;  1WUD A;  2MUT A;  4ED7 A;  1GO3 F;  1F0M A;  1K5O A;  2KNJ A;  3LVV A;  3PX6 A;  2ODG A;  2ZXH A;  3FYH A;  5AKI A;  4MFA A;  2ES6 A;  2JZB B;  4TUR A;  2ZTC A;  4JK1 A;  4DOB A;  8ICV A;  2YX8 A;  4TUQ A;  4UB1 A;  3T5J A;  5H2F U;  1KKX A;  4LZD A;  1KLN A;  2HHU A;  2M9N A;  1IM4 A;  1F5S A;  3CW2 C;  1KTQ A;  3OSN A;  4DFJ A;  2W43 A;  3L5K A;  3PW0 A;  3N7P D;  4MFF A;  2ZIU B;  2EQY A;  5AI4 A;  2RLT A;  2WF7 A;  5ALO A;  4DSF A;  4ECY A;  1P7D A;  4I2F A;  1WWV A;  3D2Q A;  1DRG A;  5KAF U;  3AU2 A;  2JH7 A;  3ZDE A;  5J0Q A;  4X5V A;  5KTQ A;  8ICG A;  5ALF A;  1D9D A;  3PW5 A;  4P0Q B;  2NRZ A;  1CI4 A;  1X6J A;  4M47 A;  3HIL A;  4UB3 A;  4U7C A;  2DKZ A;  3IP4 B;  3GV5 B;  4KMU A;  2EAN A;  4JWN A;  1ZQD A;  1U45 A;  4DOA A;  4BXO B;  4MHV A;  3CRX A;  2IHN A;  4RNO A;  4ED6 A;  1B22 A;  1ED1 A;  2W9B B;  9ICK A;  2W9B A;  1N56 A;  4IQT A;  7ICR A;  3NUQ A;  2CPR A;  4QW8 A;  4O3Q A;  1RXW A;  2I5H A;  4GXK A;  1X42 A;  1FEZ A;  4F5Q A;  5DG8 A;  5KG0 A;  4FFD A;  4KLI A;  3MDC A;  5DBB A;  4JB3 A;  9ICE A;  3CNH A;  1K1Q A;  4PGY A;  2Y1I A;  3RJJ A;  4C7Y A;  3AUO A;  2E8M A;  3ETR A;  4PGX A;  4QWD A;  2W11 A;  9ICB A;  3SAH A;  2Q4T A;  1CRX A;  1S77 D;  3E0F A;  4UAR A;  3MR2 A;  5DKW A;  4QWE A;  4F4W A;  1Z4O A;  4C4R A;  2BZF A;  4DL4 A;  5L1I A;  2PFP A;  2ZTE A;  5J2D A;  4F92 B;  2P6U A;  5J0S A;  8ICA A;  2JEF A;  4R8U B;  1FIQ A;  3S6J A;  1JRO A;  3QU2 A;  2VA2 A;  5ALV A;  4GXJ A;  1S0O A;  4P4P A;  1FFU A;  5HMM A;  5ALY A;  1T94 A;  4G3I A;  5EE0 A;  1Z3E B;  4RPZ A;  2WB1 C;  7ICK A;  1L3S A;  4KLG A;  2BQ3 A;  4OJL A;  5CEH A;  1RYU A;  5AI6 A;  2AGP A;  4IRK A;  1ZQI A;  4DOC A;  2KD1 A;  3AL0 B;  4KLD A;  1JXL A;  3PSP A;  1RZT A;  4EEL A;  4R8U A;  4PZO A;  2ZG6 A;  2H3Q A;  4BGD A;  3FAH A;  1ZQT A;  1ZQR A;  2QB0 A;  7ICN A;  5DB8 A;  3IDW A;  5AKL A;  1DGS A;  2IOF K;  4IQV A;  3SEI A;  4JUZ A;  3QEB Z;  1WG8 A;  2G09 A;  3OTQ A;  4Q8F A;  4UAS A;  2VA8 A;  3AMZ A;  1B43 A;  4I29 A;  2OEH A;  3HWT A;  4EZ6 A;  2K8B B;  4M0A A;  4EEN A;  2IHM A;  5G5G A;  5KFO A;  3TFS A;  4CCH A;  4A8E A;  5AHX A;  4Q45 A;  3ZD9 A;  1D8L A;  4GIB A;  3V6K A;  2C2D A;  4B9M A;  5ALN A;  2W9M A;  3Q8S B;  4YFK A;  3NVZ A;  2PI4 A;  5DBA A;  4YXM A;  5CR0 A;  2H5X A;  3RAX A;  4IRD A;  1DXS A;  2PMZ C;  4DSK A;  3ZD8 A;  3SI8 A;  2QLT A;  1D9F A;  2QAR A;  2HI0 A;  5GTH U;  3KKA C;  5HP4 A;  5EWF A;  3BQ0 A;  3G6X A;  1RM6 C;  3BDP A;  4YMO A;  5III A;  2HHW A;  5EE1 A;  4CGZ A;  4PJ0 U;  3C29 A;  3QU7 A;  4Y2Y A;  2UVR A;  3NAS A;  4J9K A;  2MUT B;  5KFZ A;  3QZ8 A;  7ICS A;  2K60 A;  3MR6 A;  4R65 A;  1Q3U A;  2RP5 A;  2PXI A;  3EPG A;  1TK5 A;  4ELU A;  2F3N A;  3C23 A;  2Y0S F;  2HBK A;  4F4Z A;  5EWG A;  4TUS A;  4EEK A;  3MFH A;  1ZQO A;  2A1J A;  1YZ6 A;  1TE2 A;  1ZQ1 C;  4QNL A;  1TV9 A;  3NVW A;  5J2A A;  4Z6D A;  2PFQ A;  2LM4 A;  4O3N A;  7ICP A;  1BPY A;  1TK8 A;  4DCC A;  5AM2 A;  3PST A;  4OJO A;  1QQ7 A;  2O6K A;  4PHD A;  1JI7 A;  1Z1B A;  2F76 X;  4NXZ A;  4KLJ A;  2G5I B;  1X9X A;  1Z19 A;  1L8L A;  4EX7 A;  5DLF A;  2FPK A;  1PK1 B;  1ZD5 A;  8ICX A;  3SMV A;  2XCP A;  5ALW A;  4YMM A;  1X2I A;  3BJY A;  4B9V A;  9ICL A;  4RQ8 A;  5CB1 A;  1SXE A;  3JPO A;  4XA5 A;  1BPX A;  1UT8 A;  2KMD A;  1PK3 A;  3DEE A;  3H0M B;  2W9C B;  4YD2 A;  2KJ9 A;  1L3V A;  2J6U A;  4KLH A;  4Q44 A;  4DFP A;  5HR6 A;  5KG5 A;  2I9G A;  5J2F A;  3OJS A;  2R18 A;  1XS9 D;  3RFA A;  5KG2 A;  4R64 A;  1NJZ A;  4CNQ A;  3A0H U;  5KFK A;  3WKD A;  4P4M A;  2EZX A;  2EDU A;  1S76 D;  2EZZ A;  1UQV A;  2MU2 A;  2I6X A;  4JV2 A;  2AJQ A;  9ICG A;  9ICR A;  4FE3 A;  2NYV A;  4IR9 A;  4F2R A;  2Q0Z X;  1M6Y A;  3KHH A;  3H0L B;  1B0X A;  4KX3 A;  4NLB A;  2F8K A;  1DGJ A;  2ZIX A;  1D8B A;  4CF4 A;  1KSP A;  1IXR A;  4BJQ A;  3C5F A;  3KZI U;  4TQS A;  1L7N A;  3D6J A;  3Q8M A;  3H8J A;  1ZQA A;  4OCZ A;  1B4F A;  3F2D A;  1SXD A;  3L3F X;  1SZP A;  3IRU A;  5CJ7 A;  1LV5 A;  2KK0 A;  4BX9 C;  8ICW A;  1TKD A;  4PZN A;  1JMS A;  3SAF A;  3UQ0 A;  3J81 j;  2W03 A;  5AM1 A;  3WKC A;  3QUQ A;  4ECS A;  8ICT A;  8ICP A;  3OJU A;  3PML A;  2G06 A;  2IBK A;  4C80 A;  2KZ3 A;  1A77 A;  5CRX A;  1ZD3 A;  1NK4 A;  3WK4 A;  3MDA A;  4CRX A;  5AK5 A;  4YR3 A;  2FE9 A;  3ZI4 A;  2JH1 A;  5KFP A;  4B9L A;  2UVV A;  2F2A B;  3RH5 A;  5ALQ A;  4M9L A;  1HUO A;  4RQ4 A;  1XU4 A;  3C2M A;  4Q8E A;  2K4I A;  4KLE A;  2DWQ A;  2VAN A;  4F72 A;  3GDX A;  3H4D A;  2XGQ A;  2ESE A;  4RZR A;  2HBM A;  2V4Q A;  2W8L A;  4KN4 A;  5KFL A;  2KSO B;  2KE7 A;  2V4R A;  3ZDA A;  7ICT A;  5KG6 A;  4HAI A;  2RHF A;  1UA0 A;  4RPX A;  1HEK A;  7ICH A;  4DWI A;  3SV4 A;  4PH5 A;  3MR3 A;  8ICH A;  2W7P A;  3RTV A;  7ICV A;  3SAG A;  5ALM A;  5KFA A;  3DV9 A;  4NL9 A;  3MR5 A;  3GII A;  4EX6 A;  3F5A A;  2ZIW B;  2ZIW A;  2R8H A;  4F8R A;  2HBL A;  3D2S A;  4OJ6 A;  5K4L A;  1S8O A;  9ICA A;  5TZV A;  1OUQ A;  1K1S A;  2DBY A;  3KTQ A;  1PVQ A;  7ICJ A;  3Q8L A;  5HML A;  3N4M B;  1ZRN A;  4F93 B;  5HHH A;  1JX4 A;  3GV8 B;  4EBC A;  2EAM A;  2OYY A;  4F5R A;  2ZJ5 A;  1V97 A;  1ZOL A;  4UAV A;  2KVC A;  4FBU A;  2IMW P;  5IIO A;  2FLP A;  1RXV A;  2HHV A;  9ICC A;  2KP7 A;  2DL0 A;  2UVW A;  4M6W A;  4E0D A;  5J2J A;  4O5E A;  4UBB A;  1KQQ A;  4NJ8 A;  2FJ6 A;  3RH4 A;  2W8K A;  1VLB A;  3GIK A;  2HMX A;  1MN8 A;  3M1Y A;  1KDH A;  3WK5 A;  2YMP A;  1ZQF A;  8ICY A;  4QZC A;  3MBY A;  5KFQ A;  3BQ2 A;  5KG4 A;  5J0W A;  4C8M A;  3AU6 A;  4ECU A;  2GLE A;  5ALT A;  1S0V A;  5KFI A;  5FP0 A;  3ZDC A;  3PX0 A;  3PW7 A;  3EWA A;  4LJX A;  4XRH A;  4DL2 A;  4DS4 A;  4M9N A;  4F2S A;  5EE3 A;  1ZQE A;  5CWR A;  2JEI A;  4Y2J A;  1U49 A;  1ECW A;  3QUT A;  2AHO B;  3HKZ C;  2F1H A;  1MA7 A;  2YML A;  2BQR A;  3FDS A;  4ED1 A;  2C2E A;  9ICF A;  3UPQ A;  2H3V A;  3UXP A;  3V7K A;  4M9H A;  4DSL A;  1SV4 A;  2OCE A;  2E1E A;  3I1Y A;  4KLM A;  3BQ7 A;  5KFJ A;  1L8O A;  3PZP A;  1BNO A;  2G0A A;  2R8J A;  1XNS A;  2PMZ F;  2J6T A;  1JXE A;  3IV6 A;  2EH9 A;  3Q8Q B;  2FDR A;  2LMR A;  3V7J A;  4I2A A;  7ICF A;  5J2I A;  2QB1 A;  4KLQ A;  2ZJA A;  2K4H A;  4QWC A;  2HW3 A;  1X66 A;  3PV8 A;  2H3Z A;  4FZL A;  4I2B A;  8ICR A;  7ICE A;  4AYB F;  5BOM A;  5CHG A;  4QZH A;  3HPO A;  3RB4 A;  3QNM A;  2QKQ A;  1O03 A;  3HJE A;  1V9P A;  4FZM A;  1PVR A;  1KBU A;  4ECZ A;  3RB0 A;  3H7I A;  1IIP A;  4ED3 A;  1RYS A;  4B9T A;  3LDA A;  1ZQU A;  4Y2R A;  5A0L A;  2NRT A;  3T79 A;  2HOF A;  5L9X A;  5J0R A;  3I28 A;  8ICO A;  2PI5 A;  5AM3 A;  4UAY A;  9ICV A;  3SEN A;  1ZJM A;  2ISP A;  2WTF A;  1S5L U;  5AKH A;  1NK9 A;  4US9 A;  4QIW C;  1KFS A;  5KFY A;  1JN3 A;  5DGB A;  1C20 A;  5BOL A;  5KFM A;  2NV3 A;  3TAC B;  5IIJ A;  2PFO A;  3JPQ A;  4UAU A;  4J9P A;  5KFC A;  4UAW A;  2JMG A;  3SYZ A;  5DDM A;  3U26 A;  4K4I A;  1ZQG A;  4KN7 A;  2F1I A;  2AGQ A;  3ETL A;  4DQI A;  4NM1 A;  3GIL A;  8ICI A;  8ICM A;  2F77 X;  8ICS A;  1LKY B;  1BPZ A;  2AXT U;  1QLN A;  1N60 A;  2XID A;  5DG9 A;  2KHQ A;  3ED5 A;  1QQ5 A;  1NJX A;  4I2G A;  4BUG A;  3RB3 A;  3HRD D;  5AI9 A;  5ALI A;  3M8R A;  4DFM A;  4OJ5 A;  5DQH A;  5KT5 A;  2WAQ F;  5AIB A;  3TI0 A;  3MGH A;  1DK2 A;  4RQ2 A;  2KV2 A;  5L1K A;  2F8L A;  4K4G A;  2PFN A;  3NGD A;  3LK9 A;  3F5E A;  3D2N A;  2N1R A;  1IG6 A;  4JV1 A;  1NZB A;  4NY8 A;  3PX4 A;  3M9M B;  1ZQL A;  1ZQP A;  2CXY A;  5J8Y C;  2HHX A;  5AI0 A;  3RJG A;  9ICS A;  2BCU A;  4M6W B;  4DFD A;  4KLU A;  2BKE A;  1WYG A;  2ZUC A;  1YZ7 A;  4MF8 A;  1ZQS A;  3O0F A;  2MA1 A;  3FM9 A;  3IN5 A;  1J97 A;  1NK5 A;  1ZQX A;  1QQ6 A;  1JUD A;  2W55 A;  2RQ5 A;  3DDH A;  2ZUB A;  4Z6E A;  5ALP A;  4OO1 J;  4KLF A;  5TIS U;  3BS5 A;  4ZOH C;  5KT7 A;  5J0X A;  4IQW A;  1NOM A;  3B0Y A;  3RH6 A;  2HHQ A;  2G5H B;  3V72 A;  3BZC A;  1N63 A;  3I76 A;  2BQU A;  1BPE A;  4IRC A;  3K4G A;  1HUZ A;  3NVY A;  2WF5 A;  3M6K A;  4Y2S A;  3NS1 A;  3PMN A;  5KFN A;  1ARO P;  3QUB A;  1ZQC A;  5KFE A;  2FMQ A;  2JXJ A;  4ED2 A;  3BQT A;  1QSY A;  1S0M A;  1MSW D;  4NLK A;  3H40 A;  1S9F A;  1HJP A;  5CA7 A;  3OPX A;  3T5L A;  1H38 A;  1ZQB A;  3SQI A;  2OWO A;  9ICX A;  3UMB A;  4DO9 A;  4P0P B;  2EZY A;  2OH2 A;  4MF2 A;  4ED8 A;  3UMC A;  1Q3V A;  5AK6 A;  5J2H A;  5AKE A;  4TUP A;  4B9N A;  2P35 A;  2W3R A;  4DL6 A;  1BNP A;  2K8A A;  3RBD A;  3SR6 A;  2VKQ A;  2KIC A;  4IS7 A;  4RQ0 A;  2W54 A;  3RJF A;  4QZD A;  2KHV A;  3CP8 A;  1QTM A;  1WWU A;  4Y2P A;  3TKA A;  2W9C A;  3PVX A;  2YB4 A;  4DF4 A;  2ALZ A;  1N5W A;  3NRW A;  1ZQV A;  2K89 A;  4YQW A;  4J9L A;  4KLS A;  3ISB A;  2HVI A;  2FLL A;  8ICU A;  2J6S A;  3E58 A;  2C22 A;  4C8K A;  1XO0 A;  2JHD A;  3M8S A;  2HCF A;  2KSO A;  3SD7 A;  2YN4 A;  5KFX A;  4C4T A;  3V6H A;  2Z7J A;  4DL5 A;  1QCK A;  2KKP A;  2B0C A;  9ICU A;  2GO7 A;  4Y2V A;  4F71 A;  4BXO A;  4FS2 A;  3WK7 A;  4KX5 A;  4AYB C;  2V9W A;  4EYH B;  4M9J A;  1XSP A;  3WKE A;  5IIM A;  3WKB A;  4YVZ A;  3RR7 A;  4QZG A;  7ICG A;  4YCX A;  4F5O A;  2DUY A;  4XQ8 A;  2GWS A;  5CP2 A;  5DQI A;  1UT5 A;  4XUS A;  4J9M A;  1N61 A;  2IA6 A;  4DSI A;  1SIJ A;  1T3Q A;  1U9L A;  2BCV A;  5D4B A;  2KZM A;  4YR0 A;  1T4G A;  1T3N A;  2ZIV A;  4QZB A;  1J2N A;  1LKY A;  5J2B A;  4PPX A;  7ICO A;  3PY8 A;  4B9S A;  1U4B A;  2RDI A;  3EUB 2;  3JPN A;  4I2H A;  4QZ9 A;  2B21 A;  4UQG A;  1TVA A;  5ALH A;  5G5H A;  5JTI A;  2E8O A;  4QZ8 A;  1NK7 A;  2JZB A;  5ALK A;  1DK3 A;  4LZG A;  4LVS A;  2RDJ A;  2BCS A;  2H3I A;  4OJP A;  1Z4N A;  1S97 A;  1RQL A;  4YMN A;  1BPB A;  1KRP A;  4BWM A;  1ZXI A;  4I2E A;  7ICI A;  1Z1V A;  4F91 B;  4FO6 A;  1KW4 A;  1ZQM A;  3F53 A;  3ALR A;  5KFT A;  3H4B A;  2MAX A;  5ALL A;  2NRW A;  2UVU A;  3C2L A;  5AKJ A;  2JR5 A;  2AH5 A;  3QU9 A;  3GV7 B;  4ECR A;  2LYB A;  3WK8 A;  1N48 A;  2A1A A;  5AM4 A;  1NKE A;  5DDY A;  4DFK A;  4O3O A;  3QXG A;  2YY6 A;  1SV0 A;  1O08 A;  4UW9 A;  1SKR A;  3IG8 A;  5AM0 A;  4J9S A;  4RQ5 A;  1NKC A;  3V7L A;  1RDF A;  1N2X A;  3ORY A;  2OHF A;  1DOQ A;  4RUA A;  4RNM A;  1ZQN A;  4U6P A;  1TK0 A;  8ICE A;  1KL9 A;  2JGA A;  3M6Z A;  5KFU A;  1KN5 A;  1PK1 A;  1TAQ A;  2D8C A;  3C21 A;  1NNL A;  3AN1 A;  3GIM A;  2KN7 A;  3BS5 B;  1TFR A;  1EXN A;  2NO5 A;  2NRV A;  4NLC A;  4NLN A;  2WF9 A;  2H3F A;  1X9S A;  5JUM A;  1FO4 A;  5C0Y A;  4BDP A;  1CUK A;  5AKK A;  1NI3 A;  4Z6F A;  2WAQ C;  5AK3 A;  4ACO A;  1UHU A;  1ZET A;  3FC4 A;  3OHA A;  2KEY A;  4ECV A;  2XIC A;  3EW9 A;  3PW2 A;  2FLN A;  4DSJ A;  2NRX A;  1A0P A;  4FBT A;  3TAQ A;  3ZDD A;  2ASD A;  1L3U A;  5J29 A;  4NLG A;  5KT3 A;  2HHT A;  2EAP A;  2IOF A;  3AEV A;  1F44 A;  3WK6 A;  1SGG A;  2F1J A;  2DFL A;  4AP9 A;  4ELT A;  3Q8P B;  5IIN A;  3QEA Z;  2BGW A;  5EOZ A;  2WF8 A;  1WCN A;  3OGU A;  3TQ1 A;  9ICW A;  4RT3 A;  4GXI A;  5KFW A;  1KFD A;  3QU5 A;  3GFK B;  3MC1 A;  3BS7 A;  1URJ A;  4O3R A;  2B6G A;  5J2K A;  2VIX A;  2MRL A;  3RJK A;  4RNN A;  5AIA A;  5DB9 A;  3TFR A;  2LI6 A;  4F5P A;  5AK4 A;  3C2K A;  5ALJ A;  4YR2 A;  4M2Y A;  3T5K A;  4O0I A;  4QZI A;  5DG7 A;  9ICN A;  5KFH A;  5KT4 A;  4ZH4 A;  5ALG A;  5KFG A;  3WK9 A;  3QZ7 A;  3TAP A;  3LWM A;  1OW5 A;  3ONN A;  4TQR A;  2FMS A;  3NRZ A;  3HT3 A;  5J0Y A;  3MAB A;  3G6V A;  4EEY A;  1LB2 B;  3OHB A;  1MQ3 A;  5KG3 A;  2LPE A;  2KOB A;  4F4K A;  4C8L A;  2DPJ A;  3QYP A;  2XGP A; 
#chains in the Genus database with same CATH homology
 4UB8 U;  5B5E U;  5GTH U;  1S5L U;  5TIS U;  3KZI U;  2DUY A;  5E79 U;  3A0H U;  5KAI U;  4IL6 U;  2AXT U;  4PJ0 U;  5H2F U;  3WU2 U;  5GTI U;  5B66 U;  5KAF U;  4UB6 U;  3A0B U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...