5H2FU

Crystal structure of the psbm-deletion mutant of photosystem ii
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
97
structure length
97
Chain Sequence
ELVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutual relationships between structural and functional changes in a PsbM-deletion mutant of photosystem II.
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords Photosystem II protein D1 1
total genus 33
structure length 97
sequence length 97
chains with identical sequence u
ec nomenclature
pdb deposition date 2016-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF06514 PsbU Photosystem II 12 kDa extrinsic protein (PsbU)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.320 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Photosystem II 12 kDa extrinsic protein 5h2fU01
4UB8U 5B66U 4IL6U 4UB6U 5H2FU 5TISU 5KAIU 2AXTU 3KZIU 5E79U 5GTHU 5KAFU 5GTIU 3A0BU 2DUYA 5B5EU 4PJ0U 3A0HU 3WU2U 1S5LU
chains in the Genus database with same CATH superfamily
1SZHA 3RJIA 4C8MA 4YR2A 2EAPA 4QNLA 4O0IA 1KN5A 3TADC 1LV5A 7ICVA 3DV9A 3M9OB 3PY8A 3SENA 3BQ7A 3ORYA 2XO7A 5B66U 1U47A 8ICLA 4KLDA 4JWNA 1MN8A 2F77X 5AK4A 3CNHA 3SAHA 3NRZA 1NOMA 1L8OA 3C5FA 5L1JA 3D2NA 8ICVA 3NGDA 2Y1IA 2D6FC 3WK4A 4O3OA 5KL8B 1ZQZA 4RQNA 5AKXA 4DL7A 3IM1A 4M04A 1JXEA 4NY8A 5C0YA 4I27A 2QLTA 3ZDBA 5AHXA 2F1HA 4IQVA 1NJYA 5KFZA 2HBMA 4IL6U 1A76A 4FS1A 9ICMA 3RR8A 1L3SA 4YVZA 1F5SA 3QE9Y 7ICMA 1SL2A 4UBCA 2JGAA 4Y2VA 1URJA 3JPRA 3LK9A 5KAFU 4CNQA 4PHAA 2GOLA 4ECRA 4M9NA 1K1SA 2K8CB 5IINA 2MSNA 2J6TA 1PVPA 2VANA 2VA8A 1S97A 7ICIA 4J9SA 4F93B 1Y88A 4YXMA 2PI5A 4ED8A 1QQ7A 4UB5A 3H8MA 1O03A 4XQ8A 1UHUA 5IILA 5KG7A 3H40A 1RYUA 1SL0A 4DL5A 3RB4A 4YXJA 3KBBA 1CI4A 2MUTA 2KN7A 1TAQA 5DBAA 4MFCA 2K4IA 3A0BU 2P6UA 3H4DA 5DG7A 3M6ZA 3HP6A 1RZTA 1SV0C 3NRWA 4QJFB 4DOAA 1XWLA 4ACOA 1FO4A 2WFAA 3G6VA 3QZ8A 1RXVA 1SZPA 1CUKA 3CYMA 4DFPA 3RH6A 5JRTA 3PVXA 1MQ3A 4J9LA 4O3SA 3TAPA 2YQEA 4O3NA 3HT3A 1ZQMA 4EENA 2XGPA 2W9CA 2VA2A 2G0AA 2ZG6A 1ZQDA 2LYBA 2HHSA 1COOA 3HKZC 4C8OA 2Q0ZX 3OJUA 4YD1A 2C2EA 8ICXA 3TACB 5KFDA 9ICRA 3PX0A 3KFUF 2BQUA 3I1YA 3MDCA 4DCCA 5KT3A 2AGQA 1LKYA 4RPZA 1C7YA 4F5QA 3HPOA 1ZQWA 3GFKB 4PPXA 5ALFA 3ZD8A 3IP4B 5AM4A 4YR0A 2QKQA 8ICJA 1T4GA 3IDWA 4F4YA 5ALVA 3QU4A 3QUBA 4IQUA 4DF4A 4J9QA 1TVAA 2RDJA 2FPMA 5EE0A 3SQIA 2XIDA 3JPSA 1NZBA 2E1EA 1ZJNA 2OXOA 3GZFA 1L7MA 1Q3UA 2IHNA 1TAMA 3T5LA 1J2NA 1ZQAA 4NM2A 5BOLA 2WF5A 1KLNA 4RQ7A 2P35A 4AYBC 1TK8A 1VJ5A 4K4GA 2F3NA 2CN1A 1OXJA 1Z1VA 1ZQEA 2W55A 2F8KA 2DL0A 2ZIXB 3THVA 4B9VA 1WCLA 1ZQ1C 2F76X 2ZTEA 2EZYA 3MGHA 2XY7A 9ICOA 2ATLA 1N62A 2ASJA 4F5RA 3AQFA 8ICZA 1ZQCA 4J9MA 5KFXA 4F2RA 4P0PB 3MDAA 2OWOA 1VDVA 3JPTA 3PX4A 2XY6A 4I2DA 1DRGA 2JZBB 1BVSA 4GXIA 2YMLA 1NKCA 2ZJ8A 3G6YA 1L7OA 4F4WA 4DSJA 5AICA 5KFCA 5JTIA 2WF7A 4ZH4A 4DFJA 3HW8A 5ALMA 3OHBA 4YQWA 2L5YA 1KEJA 2A19A 5KFHA 3BZKA 4LZGA 2F1JA 4Z6EA 3N4MB 2PXIA 4GIBA 2C2RA 3OGUA 5L1MA 5HHHA 3GDXA 4Z6CA 5J8YA 3KKAC 3PW7A 4QZDA 3RJFA 2PFPA 2KZ3A 4ED2A 4Q43A 4CF3A 1NJXA 1NJZA 5KFFA 3G6XA 5HP4A 4QZIA 1ZJMA 3WK5A 4M9LA 4R64A 2J6SA 5ALXA 5J0YA 3C1ZA 2ZUCA 5K4LA 2DPIA 8ICIA 5FP0A 2IOHA 1TKDA 1ZD5A 2KKVA 3BZCA 3DDHA 1BPEA 5J2BA 1L3TA 1TK0A 2DFLA 1EXNA 2KIVA 2NYVA 1ZXIA 3PO4A 2ISPA 5AM5A 2G5HB 4P4PA 4DS4A 1ED1A 1IM4A 2YTUA 9ICGA 1Q3VA 3B0YA 4C7ZA 3QXGA 3MR6A 2G09A 2VA3A 4UB6U 3MFHA 4EZ6A 5EWEA 4P0QA 2Y1JA 3RJKA 4DLEA 2YB1A 3GV7B 3RBEA 4JK1A 2QB0B 4B9SA 1A77A 9ICXA 4J9RA 2B6GA 1ZQJA 4R8UB 5KFMA 1HUZA 5KFTA 1S0NA 3Q8MA 8ICYA 2HBJA 4TQRA 5KAIU 4RQ6A 3HWTA 2ODGA 1N63A 1UPHA 4OJPA 2ASLA 4KLQA 4JMUA 4TUQA 4KLHA 5EE1A 3N28A 3AUOA 4C7YA 5D49A 1COKA 3HRDD 3ONNA 2KKPA 7ICRA 3H8SA 5HMLA 3V72A 1ZQQA 2DUYA 2WF9A 5KG0A 4CRXA 2BPGA 1JXLA 4GC7A 1ZQUA 3GU3A 2MA1A 1SWWA 1XO1A 5DLFA 3AL0B 5ALYA 2PI4A 1N56A 4YMNA 3SV3A 3A0HU 4RU9A 2FMPA 3M8RA 2PKEA 2W03A 3V7KA 2HHUA 2KVCA 3UPQA 3QUQA 5KT4A 1KFSA 3QU5A 4KLLA 3WK9A 1K5OA 1YT3A 1MQ2A 5CP2A 3HILA 4NLNA 5E79U 2KJ5A 2H3ZA 2ZIUB 1B43A 1JUDA 3PSIA 4K4HA 3C1YA 5AKEA 2JZBA 3HJEA 9ICTA 4BUGA 2HHXA 1IV8A 3PO5A 3F2CA 1NZPA 9ICAA 2JMGA 1BNOA 2WTFA 2CXYA 3L3FX 5EWFA 3ZDEA 3TARA 4M2YA 1JI7A 2YY6A 2RP5A 2GO7A 4RQMA 4CE6A 2PFQA 5DQIA 2G08A 2ZIXA 5DBBA 1QQ6A 2WF6A 3T5KA 4FFDA 4UARA 4M9HA 1TE2A 2JEFA 2H3FA 4F72A 2F1IA 3Q8RB 2N1RA 3K1ZA 4M6WB 4TUSA 7ICSA 2JV3A 4FE3A 4NL9A 1TK5A 5J2IA 5KFSA 3Q8LA 4KX3A 4Y2RA 1ZOLA 3ISCA 4ECQA 4B9NA 2JH7A 8ICUA 2HCFA 4QZGA 4F5PA 1RM6C 5L1LA 2KHQA 4P4MA 5D4BA 3TAQA 7ICOA 3H0MB 2IA6A 2Y9TA 3QUTA 2WHEA 4RPYA 3TI0A 4DL6A 1HEKA 3MBYA 2JRZA 5KT7A 2QARB 1S77D 2FMSA 9ICBA 3RTVA 2XICA 3M9NB 3M8SA 4FO6A 3RRGA 3KD3A 3RB0A 1XS9D 4ED3A 3FYHA 4QZEA 4KMOB 5KFVA 2E3TA 4RUAA 2XGQA 3RJGA 3RB6A 1LKYB 4KLTA 1XO0A 5AKGA 3JPOA 4KLEA 2Q4TA 4BDPA 2HVIA 5EOZA 2IHMA 5HR6A 5CWRA 1NK9A 4PHDA 5KFWA 2KP7A 7ICNA 1C20A 2KFZA 1ZRMA 2W9CB 2ZJAA 1NKBA 5KG6A 4UBBA 5KFKA 3GIMA 4Q8EA 4I2GA 2KFNA 2GWSA 1XU4A 1Z00B 3CW2C 3GQCA 5AKYA 4B9LA 3BQTA 4UB2A 4YG2A 1AQ6A 1NK6A 9ICJA 2NRVA 4GFJA 3EUB2 5KFUA 4I2EA 3NVWA 1JMSA 1KW4A 3E2EA 8ICCA 4DWIA 1WCNA 1S0OA 8ICOA 4HYKA 2MUTB 3ETRA 4F4KA 4DL4A 2Y0SC 2EQYA 5J0XA 7ICFA 1DK2A 2JXJA 5KFAA 1JRPA 2B21A 8ICNA 3NTUA 2KICA 5JUMA 4FZNA 1RQLA 3WKBA 2KV2A 4QW9A 1BGXT 4RPXA 4O9MA 4UB4A 2MU2A 7ICJA 4F3OA 1NK4A 4UQGA 3UXPA 3KHHA 2MAXA 3J81j 4KLMA 5EWGA 2W04A 3QEAZ 9ICNA 4Y2UA 4ED1A 2FLLA 1B22A 4ECSA 3ISBA 3D6JA 1RDFA 5KT2A 2AQ0A 1JX4A 2EH9A 5J0WA 2KJ8A 4YD2A 4B9TA 5AI9A 4K4IA 2FI1A 1S76D 8ICSA 4M47A 4ZOHC 4R65A 3EYZA 5HR7A 4JV2A 2M9NA 1ZQBA 5J2FA 3AU2A 3HKZF 4PZOA 4QWCA 4LVSA 2E5SA 1PVRA 3C2KA 3EPIA 5KG4A 4O3RA 2D8CA 1NK0A 1TFRA 4YFKA 2OM6A 1ZQIA 9ICQA 3NVYA 7ICKA 3S6JA 2ZTCA 4ED7A 3WU2U 3KTQA 4OJLA 1X9XA 3KHGA 3AEVA 3BQ0A 7ICTA 3FDSA 2I6XA 3TANA 1F44A 3RJHA 3ALRA 5KFOA 5B5EU 2OH2A 4TQSA 1A6SA 1A0PA 3DEEA 4C80A 1ZQVA 5J0PA 2BCSA 3SAFA 2M0NA 4DSEA 4CCHA 2W7OA 3V7JA 5ALSA 3N7PD 5DLGA 7ICUA 4KX5A 9ICEA 2F44A 5CHGA 4X5VA 1OUQA 4QZBA 3KHRA 2YMPA 4UB3A 3TFSA 4NLBA 4QWDA 1CRXA 2W9BA 1X66A 1MA7A 4Y2XA 3RJEA 5ALWA 1V38A 5AKJA 3UXNA 3ICXA 4M0AA 9ICSA 3RFAA 2LM4A 3PW5A 4IR9A 4J9NA 1YZ7A 1ZQPA 1XSLA 2Y0SF 5ALTA 2E8MA 1ZQOA 1NK5A 3H0LB 4DF8A 2W8LA 7ICGA 1V9PA 4R63A 2WF8A 1SKWA 4O3MA 3GIKA 4ELUA 3Q8SB 3OJSA 5CRXA 5DBCA 1T3QA 2W3SA 1SIJA 4LZDA 1LVHA 2HHVA 1QQ5A 3SD7A 2RLTA 1QCKA 2FPKA 1P7DA 8ICQA 4OJOA 2BR0A 4YCXA 2BCVA 1S0MA 2K4EA 1NKEA 4RNNA 2R8IA 2KSOA 4XUSA 2R8HA 4KLOA 3RH4A 4UAYA 4MEYA 2RRDA 3C23A 2YX8A 4PZNA 4J03A 2FLPA 1FEZA 4FBTA 4F2SA 3LVVA 4J9OA 2XY5A 4KN7A 3ZDAA 5ALOA 2ZIWA 4Q8FA 3QEBZ 5AM2A 1BPBA 4O5CA 1WWVA 3FAHA 1NK8A 5ALGA 4I2AA 4DFDA 1ECWA 2ZXHA 3V6KA 4KLUA 4RT2A 4ED6A 4FZMA 5AKZA 4O5KA 3B0XA 4BGDA 1S8OA 4IR1A 3K1RB 4KLFA 2KHVA 1J2MA 4M9JA 2ASDA 4Y2TA 1IXRA 4IC9A 3L5KA 2EAMA 4M9GA 5J2AA 3NS1A 3Q8KA 4NM1A 2G06A 4KTQA 1L7PA 2RDIA 1PK1A 2IMWP 5ALDA 3PW0A 4OD0A 9ICIA 4J9PA 4QZHA 1RYRA 4O3PA 5ALQA 1U4BA 1MSWD 4FZLA 3QU7A 1UA0A 1HUOA 5GTHU 4BJQA 3RAXA 1DGJA 5CA7A 2E8NA 1FFUA 3RF9A 4RQ1A 2UVWA 4O5EA 4ECYA 3BS5B 4IQTA 2HHTA 5L1IA 4U7CA 3ZI4A 4UB1A 5JU5A 2ZTDA 1NNLA 5AI4A 2I9GA 3KZXA 1QSYA 3F5AA 4I2HA 3I28A 1NI3A 4P4OA 1Z00A 2QB1A 1V85A 4I2IA 3D2QA 4DQQA 4ELTA 3PZPA 1QSLA 4KITB 1X6JA 2LBOA 1X6IA 4QZFA 4RT3A 2LI6A 3PSFA 4UATA 4IQWA 3FM9A 4BWJA 1RPLA 4US9A 2DQNB 5KG5A 3BJYA 5J0QA 2R8GA 4F92B 1ZQFA 4DQSA 3ISDA 3C21A 2BCUA 3H8WA 5D46A 5DQGA 5KFPA 2KZMA 4QWBA 3Q8QB 8ICWA 2FJ6A 1D8LA 4PHEA 2IBKA 3LWLA 1XSNA 3QNMA 4FBUA 2QARA 4MF8A 4KN4A 4F91B 1IIPA 3RAQA 1KQQA 5AKLA 1X40A 4DL3A 3WKEA 2DKZA 2PMZC 4ICAA 4QIWF 3LWMA 2ZUDA 2VIXA 1B4FA 2MRLA 4RQ4A 1U48A 4DFKA 4QZ9A 5J0TA 5AKIA 2KOBA 3UQ2A 4BXOA 3T79A 5KFLA 1T3NA 1JN3A 5J0UA 3KZIU 4EEYA 3OHAA 2JHDA 2ZUBA 3SEIA 2FE9A 4QZCA 5DDYA 4JV0A 3BQ1A 2IOFA 5ALUA 4M6WA 4RQ0A 2V4QA 2ZIVA 4DQIA 1B0XA 1KFDA 4KLJA 4QZAA 3C28A 1HIWA 2C2DA 2W9MA 2KD1A 1ZQGA 2BGWA 1D9DA 5CEHA 2HHQA 4EX7A 4C8KA 1L5UA 1RXWA 3V7LA 3OSPA 3EWAA 3HX0A 2GH1A 1JALA 2ALZA 1L7NA 4UAZA 1J97A 2IOFK 1SGGA 1S9FA 4QZ8A 4NXZA 1SV0A 2FPLA 4RQ5A 2JH1A 2KG5A 3BDPA 4ECXA 4BX9C 2FLNA 2ZIUA 2HSZA 4Y2JA 4OCZA 1ZQTA 4PJ0U 4ELVA 1JIHA 1D8BA 5KL1B 5ALIA 1KL9A 1V97A 2K89A 4NWIA 1ZRNA 2R18A 4PGQA 2NV3A 4C4RA 2RQ5A 4EYIB 3VC8A 4C8NA 4EBEA 1ZETA 4YMOA 4RNOA 4UAUA 4KMUA 5BOMA 4Y2PA 4Y2SA 2V4RA 5AM0A 5DB9A 4CGZA 3IV6A 5J2DA 2EZXA 5AI5A 4CDGA 4HAIA 3D2SA 5J0OA 1CEZA 3MR5A 1TAUA 1S10A 1NJWA 4RQ8A 3SZ2A 5AIBA 4I2FA 4JB3A 3JPPA 2OHFA 4DEZA 3O0FA 5DB6A 1ZD4A 3PX6A 2RHFA 3PW2A 9ICUA 4G3IA 1Z4OA 8ICGA 5BPCA 2BQ3A 4R8UA 1QH9A 5T14A 2DGZA 4I2BA 4NLCA 4AP9A 2K8BB 2QB0A 4IRCA 1DXSA 3M9MB 1L6NA 4YP3A 4C0ZA 5C5JA 3ED5A 3NVZA 4P0QB 2Z7JA 3QUCA 4UW9A 2NO5A 3UMGA 2FDRA 4UASA 5DQHA 3T5HA 1K1QA 5KTQA 2LM1A 4C8LA 2AH5A 5DGAA 2NO4A 2W11A 2E8OA 5KFRA 1SV4A 2BDUA 5KNIA 3C5GA 1PZNA 4Q44A 3PW4A 2H5XA 5AK6A 5KFYA 4F4ZA 2AGOA 3SMVA 5AI8A 8ICFA 3UM9A 4MHVA 4UAVA 5DGBA 3AM9A 4DSKA 3WK8A 5KG2A 2BZFA 8ICAA 2DKXA 3EPGA 1X2IA 1IG6A 2BPCA 3H7IA 1BPXA 2A1JA 3AN1A 2UVVA 1RG6A 2ESEA 5F3XB 4DSLA 4DSFA 5DG9A 2WB1C 1Z19A 3QX7A 5DDMA 4B9UA 3KOOA 1KSPA 1UT5A 4PL2A 1DOQA 3WK6A 5L9XA 4DQRA 1O08A 1ZQRA 4PL1A 3RBDA 2BKEA 4Y2QA 5CB1A 4F8RA 3K4GA 8ICPA 3CRXA 4F4XA 2J6UA 3RJJA 1ZQHA 2PFNA 3ZD9A 1FIQA 1PUZA 1UT8A 3ETLA 3H4BA 2AGPA 4R66A 1AROP 2XCAA 2BCRA 4I29A 8ICKA 4USAA 5J2JA 4OO1J 2I5HA 2GLEA 4EX6A 1Z3EB 3PSPA 1UQVA 4MFFA 4DOBA 2DF4B 4Z6DA 9ICVA 2KIWA 4EYHB 5KT5A 3QYPA 3F5EA 1KRPA 4P0PA 2W43A 2R8JA 3MFIA 5HNKA 1L8LA 1JROA 5AM1A 2W7PA 1Z1BA 2BCQA 3RR7A 4RQ2A 5EE3A 3GIJA 2A1JB 1X9MA 4LJXA 1N2XA 7ICQA 1QSSA 8ICBA 1T7PA 3IG8A 3H0RB 3QZ7A 2YMQA 3LYSA 5J2EA 4MEXA 4NV0A 3GV5B 1Q8KA 4DSIA 1ZYQA 3R9KA 1KFTA 4MFAA 5ALHA 2UVRA 4KLGA 5TISU 3CP8A 2HW3A 3Q8PB 2DBYA 5AM3A 1WWUA 9ICFA 3RH5A 4PHPA 4ECWA 2KEYA 1WG8A 5KFEA 3SI8A 4DLGA 3E58A 5ALKA 7ICPA 3UQ0A 3JPQA 5AK3A 5DKWA 4UB8U 4TURA 4E0DA 3WKDA 3V6HA 3ZDDA 1ZQSA 2LMRA 5ALEA 5J8YC 4F5NA 4IRDA 1T94A 1H38A 2C28A 3EW9A 4I28A 4I2JA 2WAQC 5J29A 4JV1A 4P2HA 1L3UA 5ALZA 2AHOB 3B9JA 5J0SA 1L3VA 2HVHA 5H2FU 2NRWA 4NL9C 2W8KA 2I1QA 5A0LA 1BNPA 2W54A 1ZQXA 4A8EA 1Q46A 2AQ4A 2Y9UA 4QIWC 2HOFA 1X9SA 9ICWA 2B0CA 5ALJA 5ALNA 1RYSA 2WB1F 9ICCA 2BPFA 2W9AA 2DPJA 2OEHA 5IIJA 2CRXA 3QU9A 2F8LA 2K4HA 1X9WA 3NVVA 4ECZA 1SKSA 5KFJA 5HMMA 5AI0A 2ISOA 5DG8A 2BQRA 3TQ1A 4Z6FA 1U45A 2K60A 8ICTA 2JR5A 9ICLA 2AU0A 2A1AA 2YN4A 1U49A 3I76A 5IIIA 3M6KA 3SR6A 1ZD2P 4I2CA 2YB4A 4AYBF 3NUQA 5J2CA 1UA1A 1ZQNA 4C4SA 3LVWA 4PGYA 1KBUA 2O6KA 2KVSA 5ALRA 1FFVA 2HI0A 3GILA 4QWAA 4QW8A 2G5IB 3PR5B 5F9NA 2C22A 2OYYA 2JEIA 5HHIA 2KE7A 3UMCA 3MGVA 3T3FA 3UXOA 2CPRA 4MF2A 2LYAA 1F0MA 1SXDA 3NASA 2KZZA 3WKAA 1NK7A 3E0FA 2BDPA 5IIKA 4PH5A 2HMXA 2ZIVB 3JPNA 4G9BA 5J2GA 4FS2A 3PMLA 5ALLA 2XI9A 4IRKA 1HJPA 3WK7A 5L1KA 2KK0A 2EAOA 1KKXA 4CF5A 2AXTU 3C29A 3IN5A 4BXOB 1GO3F 2HBLA 5KFGA 3OPXA 1VLBA 5IIMA 2BHNA 4US8A 1ZQKA 5F9LA 5DB7A 5GTIU 5ALPA 4NLKA 1KDHA 2ZJ5A 4XA5A 4F5OA 4GXKA 1MC8A 3L4PA 2E8PA 3VCBA 5TZVA 1T8EA 2LYHA 1KTQA 3IRUA 2KJ9A 2R8KA 5KFBA 8ICHA 1DGSA 4OJ6A 4CF4A 1LB2B 2ZXIA 4UAWA 5J2HA 3WKCA 1X42A 4RNMA 2FMQA 2G07A 2WAQF 1BPDA 2A3VA 3GV8B 2AJQA 2LHTA 1RQNA 5AI6A 1D8YA 3MR3A 4KLSA 4GLXA 7ICLA 1XSPA 4ECUA 3K75D 4F50A 2HOIA 5KT6A 3M1YA 3TKAA 4NLZA 2EDUA 3N7RC 2NRXA 3TFRA 1QLNA 4YMMA 4GXJA 3BS7A 4U6PA 3F2BA 2V9WA 1TV9A 3BQ2A 3ZDCA 4QWEA 1D9FA 4EBDA 2HBKA 4O3QA 7ICEA 4OJ5A 3C2LA 5AIAA 4GC6A 5KFQA 4B6JA 4JWMA 1N61A 4Q45A 2HOQA 4DO9A 2OCEA 3BS5A 3MABA 4JUZA 1DK3A 4ECTA 1N48A 3F2DA 5KFNA 3PNCA 2KNJA 1SL1A 2ES6A 4DL2A 4NLGA 1WUDA 1ZQLA 1BPZA 4DQPA 4YR3A 8ICRA 5DB8A 1PK1B 2LPEA 3MGIA 5AKHA 9ICKA 5CJ7A 4Y2YA 3PMNA 2KTQA 1N5WA 4RZRA 4DOCA 3IHQB 1QTMA 1N5XA 3SV4A 4EZ9A 2NRZA 1ZD3A 2JEGA 4DFMA 3H8JA 3N97B 4EBCA 3GIIA 3UMBA 2D3DA 8ICMA 3AMZA 4WJ3B 1S5LU 2VJ4A 3LDAA 1N60A 4IS7A 5AK5A 3KHLA 2JEJA 3EZ5A 3SYZA 4ECVA 9ICPA 9ICHA 3IG5A 3M7DA 2VJ5A 1XC9A 4F71A 5J0RA 4NJ8A 7ICHA 1SB3C 1PK3A 2KMDA 3SAGA 2VKQA 5KFIA 2EANA 5KG1A 2ZIWB 3F53A 2XVTA 5G5GA 1YZ6A 5J2KA 4XRHA 3U26A 3AQEA 5KG3A 2H3QA 3OTQA 3RB3A 2XC9A 4RUCA 3FC4A 4YN4A 1SWVA 8ICEA 2H3VA 1Z4NA 2UVUA 4C4TA 4EELA 2F2AB 2KSOB 3MR2A 2PFOA 1UCVA 1BPYA 2EZZA 4KLIA 5IIOA 3N7SC 5AKKA 3PV8A 5CR0A 2H3IA 3PSTA 1PVQA 4ED0A 2LKYA 1S0VA 4DS5A 1OW5A 4BWMA 3OSNA 4B9MA 4RQ3A 2HHWA 1SXEA 5G5HA 4PGXA 3V6JA 2XCPA 3RRHA 4TUPA 3MC1A 3C2MA 2PMZF 1WYGA 3PR4A 3TADA 2DWQA 2W9BB 3T5JA 2W3RA 2E1FA 2NRTA 4J9KA 1ZQYA 1U9LA 1M6YA 3QU2A 2K4PA 2P66A 4EEKA 2K8AA 5EE9A 1XNSA 2HDOA 2YMMA 2P6RA 3AU6A 3KKAA 1SKRA
chains in the Genus database with same CATH topology
4UB8U 5B66U 4IL6U 4UB6U 5H2FU 5TISU 5KAIU 2AXTU 3KZIU 5E79U 5GTHU 5KAFU 5GTIU 3A0BU 2DUYA 5B5EU 4PJ0U 3A0HU 3WU2U 1S5LU
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UB8 U;  5B66 U;  4IL6 U;  4UB6 U;  5H2F U;  5TIS U;  5KAI U;  2AXT U;  3KZI U;  5E79 U;  5GTH U;  5KAF U;  5GTI U;  3A0B U;  2DUY A;  5B5E U;  4PJ0 U;  3A0H U;  3WU2 U;  1S5L U; 
#chains in the Genus database with same CATH topology
 1SZH A;  3RJI A;  4C8M A;  4YR2 A;  2EAP A;  4QNL A;  4O0I A;  1KN5 A;  3TAD C;  1LV5 A;  7ICV A;  3DV9 A;  3M9O B;  3PY8 A;  3SEN A;  3BQ7 A;  3ORY A;  2XO7 A;  5B66 U;  1U47 A;  8ICL A;  4KLD A;  4JWN A;  1MN8 A;  2F77 X;  5AK4 A;  3CNH A;  3SAH A;  3NRZ A;  1NOM A;  1L8O A;  3C5F A;  5L1J A;  3D2N A;  8ICV A;  3NGD A;  2Y1I A;  2D6F C;  3WK4 A;  4O3O A;  5KL8 B;  1ZQZ A;  4RQN A;  5AKX A;  4DL7 A;  3IM1 A;  4M04 A;  1JXE A;  4NY8 A;  5C0Y A;  4I27 A;  2QLT A;  3ZDB A;  5AHX A;  2F1H A;  4IQV A;  1NJY A;  5KFZ A;  2HBM A;  4IL6 U;  1A76 A;  4FS1 A;  9ICM A;  3RR8 A;  1L3S A;  4YVZ A;  1F5S A;  3QE9 Y;  7ICM A;  1SL2 A;  4UBC A;  2JGA A;  4Y2V A;  1URJ A;  3JPR A;  3LK9 A;  5KAF U;  4CNQ A;  4PHA A;  2GOL A;  4ECR A;  4M9N A;  1K1S A;  2K8C B;  5IIN A;  2MSN A;  2J6T A;  1PVP A;  2VAN A;  2VA8 A;  1S97 A;  7ICI A;  4J9S A;  4F93 B;  1Y88 A;  4YXM A;  2PI5 A;  4ED8 A;  1QQ7 A;  4UB5 A;  3H8M A;  1O03 A;  4XQ8 A;  1UHU A;  5IIL A;  5KG7 A;  3H40 A;  1RYU A;  1SL0 A;  4DL5 A;  3RB4 A;  4YXJ A;  3KBB A;  1CI4 A;  2MUT A;  2KN7 A;  1TAQ A;  5DBA A;  4MFC A;  2K4I A;  3A0B U;  2P6U A;  3H4D A;  5DG7 A;  3M6Z A;  3HP6 A;  1RZT A;  1SV0 C;  3NRW A;  4QJF B;  4DOA A;  1XWL A;  4ACO A;  1FO4 A;  2WFA A;  3G6V A;  3QZ8 A;  1RXV A;  1SZP A;  1CUK A;  3CYM A;  4DFP A;  3RH6 A;  5JRT A;  3PVX A;  1MQ3 A;  4J9L A;  4O3S A;  3TAP A;  2YQE A;  4O3N A;  3HT3 A;  1ZQM A;  4EEN A;  2XGP A;  2W9C A;  2VA2 A;  2G0A A;  2ZG6 A;  1ZQD A;  2LYB A;  2HHS A;  1COO A;  3HKZ C;  4C8O A;  2Q0Z X;  3OJU A;  4YD1 A;  2C2E A;  8ICX A;  3TAC B;  5KFD A;  9ICR A;  3PX0 A;  3KFU F;  2BQU A;  3I1Y A;  3MDC A;  4DCC A;  5KT3 A;  2AGQ A;  1LKY A;  4RPZ A;  1C7Y A;  4F5Q A;  3HPO A;  1ZQW A;  3GFK B;  4PPX A;  5ALF A;  3ZD8 A;  3IP4 B;  5AM4 A;  4YR0 A;  2QKQ A;  8ICJ A;  1T4G A;  3IDW A;  4F4Y A;  5ALV A;  3QU4 A;  3QUB A;  4IQU A;  4DF4 A;  4J9Q A;  1TVA A;  2RDJ A;  2FPM A;  5EE0 A;  3SQI A;  2XID A;  3JPS A;  1NZB A;  2E1E A;  1ZJN A;  2OXO A;  3GZF A;  1L7M A;  1Q3U A;  2IHN A;  1TAM A;  3T5L A;  1J2N A;  1ZQA A;  4NM2 A;  5BOL A;  2WF5 A;  1KLN A;  4RQ7 A;  2P35 A;  4AYB C;  1TK8 A;  1VJ5 A;  4K4G A;  2F3N A;  2CN1 A;  1OXJ A;  1Z1V A;  1ZQE A;  2W55 A;  2F8K A;  2DL0 A;  2ZIX B;  3THV A;  4B9V A;  1WCL A;  1ZQ1 C;  2F76 X;  2ZTE A;  2EZY A;  3MGH A;  2XY7 A;  9ICO A;  2ATL A;  1N62 A;  2ASJ A;  4F5R A;  3AQF A;  8ICZ A;  1ZQC A;  4J9M A;  5KFX A;  4F2R A;  4P0P B;  3MDA A;  2OWO A;  1VDV A;  3JPT A;  3PX4 A;  2XY6 A;  4I2D A;  1DRG A;  2JZB B;  1BVS A;  4GXI A;  2YML A;  1NKC A;  2ZJ8 A;  3G6Y A;  1L7O A;  4F4W A;  4DSJ A;  5AIC A;  5KFC A;  5JTI A;  2WF7 A;  4ZH4 A;  4DFJ A;  3HW8 A;  5ALM A;  3OHB A;  4YQW A;  2L5Y A;  1KEJ A;  2A19 A;  5KFH A;  3BZK A;  4LZG A;  2F1J A;  4Z6E A;  3N4M B;  2PXI A;  4GIB A;  2C2R A;  3OGU A;  5L1M A;  5HHH A;  3GDX A;  4Z6C A;  5J8Y A;  3KKA C;  3PW7 A;  4QZD A;  3RJF A;  2PFP A;  2KZ3 A;  4ED2 A;  4Q43 A;  4CF3 A;  1NJX A;  1NJZ A;  5KFF A;  3G6X A;  5HP4 A;  4QZI A;  1ZJM A;  3WK5 A;  4M9L A;  4R64 A;  2J6S A;  5ALX A;  5J0Y A;  3C1Z A;  2ZUC A;  5K4L A;  2DPI A;  8ICI A;  5FP0 A;  2IOH A;  1TKD A;  1ZD5 A;  2KKV A;  3BZC A;  3DDH A;  1BPE A;  5J2B A;  1L3T A;  1TK0 A;  2DFL A;  1EXN A;  2KIV A;  2NYV A;  1ZXI A;  3PO4 A;  2ISP A;  5AM5 A;  2G5H B;  4P4P A;  4DS4 A;  1ED1 A;  1IM4 A;  2YTU A;  9ICG A;  1Q3V A;  3B0Y A;  4C7Z A;  3QXG A;  3MR6 A;  2G09 A;  2VA3 A;  4UB6 U;  3MFH A;  4EZ6 A;  5EWE A;  4P0Q A;  2Y1J A;  3RJK A;  4DLE A;  2YB1 A;  3GV7 B;  3RBE A;  4JK1 A;  2QB0 B;  4B9S A;  1A77 A;  9ICX A;  4J9R A;  2B6G A;  1ZQJ A;  4R8U B;  5KFM A;  1HUZ A;  5KFT A;  1S0N A;  3Q8M A;  8ICY A;  2HBJ A;  4TQR A;  5KAI U;  4RQ6 A;  3HWT A;  2ODG A;  1N63 A;  1UPH A;  4OJP A;  2ASL A;  4KLQ A;  4JMU A;  4TUQ A;  4KLH A;  5EE1 A;  3N28 A;  3AUO A;  4C7Y A;  5D49 A;  1COK A;  3HRD D;  3ONN A;  2KKP A;  7ICR A;  3H8S A;  5HML A;  3V72 A;  1ZQQ A;  2DUY A;  2WF9 A;  5KG0 A;  4CRX A;  2BPG A;  1JXL A;  4GC7 A;  1ZQU A;  3GU3 A;  2MA1 A;  1SWW A;  1XO1 A;  5DLF A;  3AL0 B;  5ALY A;  2PI4 A;  1N56 A;  4YMN A;  3SV3 A;  3A0H U;  4RU9 A;  2FMP A;  3M8R A;  2PKE A;  2W03 A;  3V7K A;  2HHU A;  2KVC A;  3UPQ A;  3QUQ A;  5KT4 A;  1KFS A;  3QU5 A;  4KLL A;  3WK9 A;  1K5O A;  1YT3 A;  1MQ2 A;  5CP2 A;  3HIL A;  4NLN A;  5E79 U;  2KJ5 A;  2H3Z A;  2ZIU B;  1B43 A;  1JUD A;  3PSI A;  4K4H A;  3C1Y A;  5AKE A;  2JZB A;  3HJE A;  9ICT A;  4BUG A;  2HHX A;  1IV8 A;  3PO5 A;  3F2C A;  1NZP A;  9ICA A;  2JMG A;  1BNO A;  2WTF A;  2CXY A;  3L3F X;  5EWF A;  3ZDE A;  3TAR A;  4M2Y A;  1JI7 A;  2YY6 A;  2RP5 A;  2GO7 A;  4RQM A;  4CE6 A;  2PFQ A;  5DQI A;  2G08 A;  2ZIX A;  5DBB A;  1QQ6 A;  2WF6 A;  3T5K A;  4FFD A;  4UAR A;  4M9H A;  1TE2 A;  2JEF A;  2H3F A;  4F72 A;  2F1I A;  3Q8R B;  2N1R A;  3K1Z A;  4M6W B;  4TUS A;  7ICS A;  2JV3 A;  4FE3 A;  4NL9 A;  1TK5 A;  5J2I A;  5KFS A;  3Q8L A;  4KX3 A;  4Y2R A;  1ZOL A;  3ISC A;  4ECQ A;  4B9N A;  2JH7 A;  8ICU A;  2HCF A;  4QZG A;  4F5P A;  1RM6 C;  5L1L A;  2KHQ A;  4P4M A;  5D4B A;  3TAQ A;  7ICO A;  3H0M B;  2IA6 A;  2Y9T A;  3QUT A;  2WHE A;  4RPY A;  3TI0 A;  4DL6 A;  1HEK A;  3MBY A;  2JRZ A;  5KT7 A;  2QAR B;  1S77 D;  2FMS A;  9ICB A;  3RTV A;  2XIC A;  3M9N B;  3M8S A;  4FO6 A;  3RRG A;  3KD3 A;  3RB0 A;  1XS9 D;  4ED3 A;  3FYH A;  4QZE A;  4KMO B;  5KFV A;  2E3T A;  4RUA A;  2XGQ A;  3RJG A;  3RB6 A;  1LKY B;  4KLT A;  1XO0 A;  5AKG A;  3JPO A;  4KLE A;  2Q4T A;  4BDP A;  2HVI A;  5EOZ A;  2IHM A;  5HR6 A;  5CWR A;  1NK9 A;  4PHD A;  5KFW A;  2KP7 A;  7ICN A;  1C20 A;  2KFZ A;  1ZRM A;  2W9C B;  2ZJA A;  1NKB A;  5KG6 A;  4UBB A;  5KFK A;  3GIM A;  4Q8E A;  4I2G A;  2KFN A;  2GWS A;  1XU4 A;  1Z00 B;  3CW2 C;  3GQC A;  5AKY A;  4B9L A;  3BQT A;  4UB2 A;  4YG2 A;  1AQ6 A;  1NK6 A;  9ICJ A;  2NRV A;  4GFJ A;  3EUB 2;  5KFU A;  4I2E A;  3NVW A;  1JMS A;  1KW4 A;  3E2E A;  8ICC A;  4DWI A;  1WCN A;  1S0O A;  8ICO A;  4HYK A;  2MUT B;  3ETR A;  4F4K A;  4DL4 A;  2Y0S C;  2EQY A;  5J0X A;  7ICF A;  1DK2 A;  2JXJ A;  5KFA A;  1JRP A;  2B21 A;  8ICN A;  3NTU A;  2KIC A;  5JUM A;  4FZN A;  1RQL A;  3WKB A;  2KV2 A;  4QW9 A;  1BGX T;  4RPX A;  4O9M A;  4UB4 A;  2MU2 A;  7ICJ A;  4F3O A;  1NK4 A;  4UQG A;  3UXP A;  3KHH A;  2MAX A;  3J81 j;  4KLM A;  5EWG A;  2W04 A;  3QEA Z;  9ICN A;  4Y2U A;  4ED1 A;  2FLL A;  1B22 A;  4ECS A;  3ISB A;  3D6J A;  1RDF A;  5KT2 A;  2AQ0 A;  1JX4 A;  2EH9 A;  5J0W A;  2KJ8 A;  4YD2 A;  4B9T A;  5AI9 A;  4K4I A;  2FI1 A;  1S76 D;  8ICS A;  4M47 A;  4ZOH C;  4R65 A;  3EYZ A;  5HR7 A;  4JV2 A;  2M9N A;  1ZQB A;  5J2F A;  3AU2 A;  3HKZ F;  4PZO A;  4QWC A;  4LVS A;  2E5S A;  1PVR A;  3C2K A;  3EPI A;  5KG4 A;  4O3R A;  2D8C A;  1NK0 A;  1TFR A;  4YFK A;  2OM6 A;  1ZQI A;  9ICQ A;  3NVY A;  7ICK A;  3S6J A;  2ZTC A;  4ED7 A;  3WU2 U;  3KTQ A;  4OJL A;  1X9X A;  3KHG A;  3AEV A;  3BQ0 A;  7ICT A;  3FDS A;  2I6X A;  3TAN A;  1F44 A;  3RJH A;  3ALR A;  5KFO A;  5B5E U;  2OH2 A;  4TQS A;  1A6S A;  1A0P A;  3DEE A;  4C80 A;  1ZQV A;  5J0P A;  2BCS A;  3SAF A;  2M0N A;  4DSE A;  4CCH A;  2W7O A;  3V7J A;  5ALS A;  3N7P D;  5DLG A;  7ICU A;  4KX5 A;  9ICE A;  2F44 A;  5CHG A;  4X5V A;  1OUQ A;  4QZB A;  3KHR A;  2YMP A;  4UB3 A;  3TFS A;  4NLB A;  4QWD A;  1CRX A;  2W9B A;  1X66 A;  1MA7 A;  4Y2X A;  3RJE A;  5ALW A;  1V38 A;  5AKJ A;  3UXN A;  3ICX A;  4M0A A;  9ICS A;  3RFA A;  2LM4 A;  3PW5 A;  4IR9 A;  4J9N A;  1YZ7 A;  1ZQP A;  1XSL A;  2Y0S F;  5ALT A;  2E8M A;  1ZQO A;  1NK5 A;  3H0L B;  4DF8 A;  2W8L A;  7ICG A;  1V9P A;  4R63 A;  2WF8 A;  1SKW A;  4O3M A;  3GIK A;  4ELU A;  3Q8S B;  3OJS A;  5CRX A;  5DBC A;  1T3Q A;  2W3S A;  1SIJ A;  4LZD A;  1LVH A;  2HHV A;  1QQ5 A;  3SD7 A;  2RLT A;  1QCK A;  2FPK A;  1P7D A;  8ICQ A;  4OJO A;  2BR0 A;  4YCX A;  2BCV A;  1S0M A;  2K4E A;  1NKE A;  4RNN A;  2R8I A;  2KSO A;  4XUS A;  2R8H A;  4KLO A;  3RH4 A;  4UAY A;  4MEY A;  2RRD A;  3C23 A;  2YX8 A;  4PZN A;  4J03 A;  2FLP A;  1FEZ A;  4FBT A;  4F2S A;  3LVV A;  4J9O A;  2XY5 A;  4KN7 A;  3ZDA A;  5ALO A;  2ZIW A;  4Q8F A;  3QEB Z;  5AM2 A;  1BPB A;  4O5C A;  1WWV A;  3FAH A;  1NK8 A;  5ALG A;  4I2A A;  4DFD A;  1ECW A;  2ZXH A;  3V6K A;  4KLU A;  4RT2 A;  4ED6 A;  4FZM A;  5AKZ A;  4O5K A;  3B0X A;  4BGD A;  1S8O A;  4IR1 A;  3K1R B;  4KLF A;  2KHV A;  1J2M A;  4M9J A;  2ASD A;  4Y2T A;  1IXR A;  4IC9 A;  3L5K A;  2EAM A;  4M9G A;  5J2A A;  3NS1 A;  3Q8K A;  4NM1 A;  2G06 A;  4KTQ A;  1L7P A;  2RDI A;  1PK1 A;  2IMW P;  5ALD A;  3PW0 A;  4OD0 A;  9ICI A;  4J9P A;  4QZH A;  1RYR A;  4O3P A;  5ALQ A;  1U4B A;  1MSW D;  4FZL A;  3QU7 A;  1UA0 A;  1HUO A;  5GTH U;  4BJQ A;  3RAX A;  1DGJ A;  5CA7 A;  2E8N A;  1FFU A;  3RF9 A;  4RQ1 A;  2UVW A;  4O5E A;  4ECY A;  3BS5 B;  4IQT A;  2HHT A;  5L1I A;  4U7C A;  3ZI4 A;  4UB1 A;  5JU5 A;  2ZTD A;  1NNL A;  5AI4 A;  2I9G A;  3KZX A;  1QSY A;  3F5A A;  4I2H A;  3I28 A;  1NI3 A;  4P4O A;  1Z00 A;  2QB1 A;  1V85 A;  4I2I A;  3D2Q A;  4DQQ A;  4ELT A;  3PZP A;  1QSL A;  4KIT B;  1X6J A;  2LBO A;  1X6I A;  4QZF A;  4RT3 A;  2LI6 A;  3PSF A;  4UAT A;  4IQW A;  3FM9 A;  4BWJ A;  1RPL A;  4US9 A;  2DQN B;  5KG5 A;  3BJY A;  5J0Q A;  2R8G A;  4F92 B;  1ZQF A;  4DQS A;  3ISD A;  3C21 A;  2BCU A;  3H8W A;  5D46 A;  5DQG A;  5KFP A;  2KZM A;  4QWB A;  3Q8Q B;  8ICW A;  2FJ6 A;  1D8L A;  4PHE A;  2IBK A;  3LWL A;  1XSN A;  3QNM A;  4FBU A;  2QAR A;  4MF8 A;  4KN4 A;  4F91 B;  1IIP A;  3RAQ A;  1KQQ A;  5AKL A;  1X40 A;  4DL3 A;  3WKE A;  2DKZ A;  2PMZ C;  4ICA A;  4QIW F;  3LWM A;  2ZUD A;  2VIX A;  1B4F A;  2MRL A;  4RQ4 A;  1U48 A;  4DFK A;  4QZ9 A;  5J0T A;  5AKI A;  2KOB A;  3UQ2 A;  4BXO A;  3T79 A;  5KFL A;  1T3N A;  1JN3 A;  5J0U A;  3KZI U;  4EEY A;  3OHA A;  2JHD A;  2ZUB A;  3SEI A;  2FE9 A;  4QZC A;  5DDY A;  4JV0 A;  3BQ1 A;  2IOF A;  5ALU A;  4M6W A;  4RQ0 A;  2V4Q A;  2ZIV A;  4DQI A;  1B0X A;  1KFD A;  4KLJ A;  4QZA A;  3C28 A;  1HIW A;  2C2D A;  2W9M A;  2KD1 A;  1ZQG A;  2BGW A;  1D9D A;  5CEH A;  2HHQ A;  4EX7 A;  4C8K A;  1L5U A;  1RXW A;  3V7L A;  3OSP A;  3EWA A;  3HX0 A;  2GH1 A;  1JAL A;  2ALZ A;  1L7N A;  4UAZ A;  1J97 A;  2IOF K;  1SGG A;  1S9F A;  4QZ8 A;  4NXZ A;  1SV0 A;  2FPL A;  4RQ5 A;  2JH1 A;  2KG5 A;  3BDP A;  4ECX A;  4BX9 C;  2FLN A;  2ZIU A;  2HSZ A;  4Y2J A;  4OCZ A;  1ZQT A;  4PJ0 U;  4ELV A;  1JIH A;  1D8B A;  5KL1 B;  5ALI A;  1KL9 A;  1V97 A;  2K89 A;  4NWI A;  1ZRN A;  2R18 A;  4PGQ A;  2NV3 A;  4C4R A;  2RQ5 A;  4EYI B;  3VC8 A;  4C8N A;  4EBE A;  1ZET A;  4YMO A;  4RNO A;  4UAU A;  4KMU A;  5BOM A;  4Y2P A;  4Y2S A;  2V4R A;  5AM0 A;  5DB9 A;  4CGZ A;  3IV6 A;  5J2D A;  2EZX A;  5AI5 A;  4CDG A;  4HAI A;  3D2S A;  5J0O A;  1CEZ A;  3MR5 A;  1TAU A;  1S10 A;  1NJW A;  4RQ8 A;  3SZ2 A;  5AIB A;  4I2F A;  4JB3 A;  3JPP A;  2OHF A;  4DEZ A;  3O0F A;  5DB6 A;  1ZD4 A;  3PX6 A;  2RHF A;  3PW2 A;  9ICU A;  4G3I A;  1Z4O A;  8ICG A;  5BPC A;  2BQ3 A;  4R8U A;  1QH9 A;  5T14 A;  2DGZ A;  4I2B A;  4NLC A;  4AP9 A;  2K8B B;  2QB0 A;  4IRC A;  1DXS A;  3M9M B;  1L6N A;  4YP3 A;  4C0Z A;  5C5J A;  3ED5 A;  3NVZ A;  4P0Q B;  2Z7J A;  3QUC A;  4UW9 A;  2NO5 A;  3UMG A;  2FDR A;  4UAS A;  5DQH A;  3T5H A;  1K1Q A;  5KTQ A;  2LM1 A;  4C8L A;  2AH5 A;  5DGA A;  2NO4 A;  2W11 A;  2E8O A;  5KFR A;  1SV4 A;  2BDU A;  5KNI A;  3C5G A;  1PZN A;  4Q44 A;  3PW4 A;  2H5X A;  5AK6 A;  5KFY A;  4F4Z A;  2AGO A;  3SMV A;  5AI8 A;  8ICF A;  3UM9 A;  4MHV A;  4UAV A;  5DGB A;  3AM9 A;  4DSK A;  3WK8 A;  5KG2 A;  2BZF A;  8ICA A;  2DKX A;  3EPG A;  1X2I A;  1IG6 A;  2BPC A;  3H7I A;  1BPX A;  2A1J A;  3AN1 A;  2UVV A;  1RG6 A;  2ESE A;  5F3X B;  4DSL A;  4DSF A;  5DG9 A;  2WB1 C;  1Z19 A;  3QX7 A;  5DDM A;  4B9U A;  3KOO A;  1KSP A;  1UT5 A;  4PL2 A;  1DOQ A;  3WK6 A;  5L9X A;  4DQR A;  1O08 A;  1ZQR A;  4PL1 A;  3RBD A;  2BKE A;  4Y2Q A;  5CB1 A;  4F8R A;  3K4G A;  8ICP A;  3CRX A;  4F4X A;  2J6U A;  3RJJ A;  1ZQH A;  2PFN A;  3ZD9 A;  1FIQ A;  1PUZ A;  1UT8 A;  3ETL A;  3H4B A;  2AGP A;  4R66 A;  1ARO P;  2XCA A;  2BCR A;  4I29 A;  8ICK A;  4USA A;  5J2J A;  4OO1 J;  2I5H A;  2GLE A;  4EX6 A;  1Z3E B;  3PSP A;  1UQV A;  4MFF A;  4DOB A;  2DF4 B;  4Z6D A;  9ICV A;  2KIW A;  4EYH B;  5KT5 A;  3QYP A;  3F5E A;  1KRP A;  4P0P A;  2W43 A;  2R8J A;  3MFI A;  5HNK A;  1L8L A;  1JRO A;  5AM1 A;  2W7P A;  1Z1B A;  2BCQ A;  3RR7 A;  4RQ2 A;  5EE3 A;  3GIJ A;  2A1J B;  1X9M A;  4LJX A;  1N2X A;  7ICQ A;  1QSS A;  8ICB A;  1T7P A;  3IG8 A;  3H0R B;  3QZ7 A;  2YMQ A;  3LYS A;  5J2E A;  4MEX A;  4NV0 A;  3GV5 B;  1Q8K A;  4DSI A;  1ZYQ A;  3R9K A;  1KFT A;  4MFA A;  5ALH A;  2UVR A;  4KLG A;  5TIS U;  3CP8 A;  2HW3 A;  3Q8P B;  2DBY A;  5AM3 A;  1WWU A;  9ICF A;  3RH5 A;  4PHP A;  4ECW A;  2KEY A;  1WG8 A;  5KFE A;  3SI8 A;  4DLG A;  3E58 A;  5ALK A;  7ICP A;  3UQ0 A;  3JPQ A;  5AK3 A;  5DKW A;  4UB8 U;  4TUR A;  4E0D A;  3WKD A;  3V6H A;  3ZDD A;  1ZQS A;  2LMR A;  5ALE A;  5J8Y C;  4F5N A;  4IRD A;  1T94 A;  1H38 A;  2C28 A;  3EW9 A;  4I28 A;  4I2J A;  2WAQ C;  5J29 A;  4JV1 A;  4P2H A;  1L3U A;  5ALZ A;  2AHO B;  3B9J A;  5J0S A;  1L3V A;  2HVH A;  5H2F U;  2NRW A;  4NL9 C;  2W8K A;  2I1Q A;  5A0L A;  1BNP A;  2W54 A;  1ZQX A;  4A8E A;  1Q46 A;  2AQ4 A;  2Y9U A;  4QIW C;  2HOF A;  1X9S A;  9ICW A;  2B0C A;  5ALJ A;  5ALN A;  1RYS A;  2WB1 F;  9ICC A;  2BPF A;  2W9A A;  2DPJ A;  2OEH A;  5IIJ A;  2CRX A;  3QU9 A;  2F8L A;  2K4H A;  1X9W A;  3NVV A;  4ECZ A;  1SKS A;  5KFJ A;  5HMM A;  5AI0 A;  2ISO A;  5DG8 A;  2BQR A;  3TQ1 A;  4Z6F A;  1U45 A;  2K60 A;  8ICT A;  2JR5 A;  9ICL A;  2AU0 A;  2A1A A;  2YN4 A;  1U49 A;  3I76 A;  5III A;  3M6K A;  3SR6 A;  1ZD2 P;  4I2C A;  2YB4 A;  4AYB F;  3NUQ A;  5J2C A;  1UA1 A;  1ZQN A;  4C4S A;  3LVW A;  4PGY A;  1KBU A;  2O6K A;  2KVS A;  5ALR A;  1FFV A;  2HI0 A;  3GIL A;  4QWA A;  4QW8 A;  2G5I B;  3PR5 B;  5F9N A;  2C22 A;  2OYY A;  2JEI A;  5HHI A;  2KE7 A;  3UMC A;  3MGV A;  3T3F A;  3UXO A;  2CPR A;  4MF2 A;  2LYA A;  1F0M A;  1SXD A;  3NAS A;  2KZZ A;  3WKA A;  1NK7 A;  3E0F A;  2BDP A;  5IIK A;  4PH5 A;  2HMX A;  2ZIV B;  3JPN A;  4G9B A;  5J2G A;  4FS2 A;  3PML A;  5ALL A;  2XI9 A;  4IRK A;  1HJP A;  3WK7 A;  5L1K A;  2KK0 A;  2EAO A;  1KKX A;  4CF5 A;  2AXT U;  3C29 A;  3IN5 A;  4BXO B;  1GO3 F;  2HBL A;  5KFG A;  3OPX A;  1VLB A;  5IIM A;  2BHN A;  4US8 A;  1ZQK A;  5F9L A;  5DB7 A;  5GTI U;  5ALP A;  4NLK A;  1KDH A;  2ZJ5 A;  4XA5 A;  4F5O A;  4GXK A;  1MC8 A;  3L4P A;  2E8P A;  3VCB A;  5TZV A;  1T8E A;  2LYH A;  1KTQ A;  3IRU A;  2KJ9 A;  2R8K A;  5KFB A;  8ICH A;  1DGS A;  4OJ6 A;  4CF4 A;  1LB2 B;  2ZXI A;  4UAW A;  5J2H A;  3WKC A;  1X42 A;  4RNM A;  2FMQ A;  2G07 A;  2WAQ F;  1BPD A;  2A3V A;  3GV8 B;  2AJQ A;  2LHT A;  1RQN A;  5AI6 A;  1D8Y A;  3MR3 A;  4KLS A;  4GLX A;  7ICL A;  1XSP A;  4ECU A;  3K75 D;  4F50 A;  2HOI A;  5KT6 A;  3M1Y A;  3TKA A;  4NLZ A;  2EDU A;  3N7R C;  2NRX A;  3TFR A;  1QLN A;  4YMM A;  4GXJ A;  3BS7 A;  4U6P A;  3F2B A;  2V9W A;  1TV9 A;  3BQ2 A;  3ZDC A;  4QWE A;  1D9F A;  4EBD A;  2HBK A;  4O3Q A;  7ICE A;  4OJ5 A;  3C2L A;  5AIA A;  4GC6 A;  5KFQ A;  4B6J A;  4JWM A;  1N61 A;  4Q45 A;  2HOQ A;  4DO9 A;  2OCE A;  3BS5 A;  3MAB A;  4JUZ A;  1DK3 A;  4ECT A;  1N48 A;  3F2D A;  5KFN A;  3PNC A;  2KNJ A;  1SL1 A;  2ES6 A;  4DL2 A;  4NLG A;  1WUD A;  1ZQL A;  1BPZ A;  4DQP A;  4YR3 A;  8ICR A;  5DB8 A;  1PK1 B;  2LPE A;  3MGI A;  5AKH A;  9ICK A;  5CJ7 A;  4Y2Y A;  3PMN A;  2KTQ A;  1N5W A;  4RZR A;  4DOC A;  3IHQ B;  1QTM A;  1N5X A;  3SV4 A;  4EZ9 A;  2NRZ A;  1ZD3 A;  2JEG A;  4DFM A;  3H8J A;  3N97 B;  4EBC A;  3GII A;  3UMB A;  2D3D A;  8ICM A;  3AMZ A;  4WJ3 B;  1S5L U;  2VJ4 A;  3LDA A;  1N60 A;  4IS7 A;  5AK5 A;  3KHL A;  2JEJ A;  3EZ5 A;  3SYZ A;  4ECV A;  9ICP A;  9ICH A;  3IG5 A;  3M7D A;  2VJ5 A;  1XC9 A;  4F71 A;  5J0R A;  4NJ8 A;  7ICH A;  1SB3 C;  1PK3 A;  2KMD A;  3SAG A;  2VKQ A;  5KFI A;  2EAN A;  5KG1 A;  2ZIW B;  3F53 A;  2XVT A;  5G5G A;  1YZ6 A;  5J2K A;  4XRH A;  3U26 A;  3AQE A;  5KG3 A;  2H3Q A;  3OTQ A;  3RB3 A;  2XC9 A;  4RUC A;  3FC4 A;  4YN4 A;  1SWV A;  8ICE A;  2H3V A;  1Z4N A;  2UVU A;  4C4T A;  4EEL A;  2F2A B;  2KSO B;  3MR2 A;  2PFO A;  1UCV A;  1BPY A;  2EZZ A;  4KLI A;  5IIO A;  3N7S C;  5AKK A;  3PV8 A;  5CR0 A;  2H3I A;  3PST A;  1PVQ A;  4ED0 A;  2LKY A;  1S0V A;  4DS5 A;  1OW5 A;  4BWM A;  3OSN A;  4B9M A;  4RQ3 A;  2HHW A;  1SXE A;  5G5H A;  4PGX A;  3V6J A;  2XCP A;  3RRH A;  4TUP A;  3MC1 A;  3C2M A;  2PMZ F;  1WYG A;  3PR4 A;  3TAD A;  2DWQ A;  2W9B B;  3T5J A;  2W3R A;  2E1F A;  2NRT A;  4J9K A;  1ZQY A;  1U9L A;  1M6Y A;  3QU2 A;  2K4P A;  2P66 A;  4EEK A;  2K8A A;  5EE9 A;  1XNS A;  2HDO A;  2YMM A;  2P6R A;  3AU6 A;  3KKA A;  1SKR A; 
#chains in the Genus database with same CATH homology
 4UB8 U;  5B66 U;  4IL6 U;  4UB6 U;  5H2F U;  5TIS U;  5KAI U;  2AXT U;  3KZI U;  5E79 U;  5GTH U;  5KAF U;  5GTI U;  3A0B U;  2DUY A;  5B5E U;  4PJ0 U;  3A0H U;  3WU2 U;  1S5L U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...