5H2FU

Crystal structure of the psbm-deletion mutant of photosystem ii
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
97
structure length
97
Chain Sequence
ELVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem II protein D1 1
publication title Mutual relationships between structural and functional changes in a PsbM-deletion mutant of photosystem II.
pubmed doi rcsb
molecule tags Photosynthesis
total genus 33
structure length 97
sequence length 97
chains with identical sequence u
ec nomenclature
pdb deposition date 2016-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF06514 PsbU Photosystem II 12 kDa extrinsic protein (PsbU)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.320 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Photosystem II 12 kDa extrinsic protein 5h2fU01
5GTHU 3KZIU 5E79U 5GTIU 1S5LU 4UB8U 4PJ0U 4UB6U 2DUYA 5KAIU 3WU2U 5H2FU 5KAFU 3A0BU 5B5EU 4IL6U 2AXTU 5B66U 5TISU 3A0HU
chains in the Genus database with same CATH superfamily
1ZRNA 4NM2A 5KL8B 4EELA 2E5SA 1S0NA 2ZIVB 1Z3EB 5DQHA 4HYKA 1ZQOA 5C0YA 1FFUA 2G09A 1SL1A 2JV3A 4O3NA 2JH1A 4RPXA 2PI5A 1KDHA 3ZD8A 2KSOA 4F4YA 2FPMA 5KFHA 1CRXA 4QIWF 4QIWC 4NY8A 3AEVA 1N5XA 4RQ8A 2KOBA 5KFSA 3C2MA 3OJUA 8ICOA 2RHFA 3C23A 1V38A 2XICA 2HI0A 3TQ1A 3ZDDA 9ICUA 4R63A 1BNOA 2GH1A 5AKKA 3Q8RB 5AK5A 1COOA 4I27A 1ZQYA 4GC6A 5J0UA 2KIWA 3TADA 9ICBA 3EPIA 3PW4A 2LYBA 2OHFA 5KG5A 7ICVA 4UAZA 1LB2B 5EE9A 5KT6A 4U6PA 2H3QA 4F2RA 4O5KA 3A0BU 4RPYA 3JPPA 1NK5A 4BDPA 5KT2A 1XNSA 4DSJA 9ICHA 4QWAA 2J6TA 5CA7A 1PUZA 4DSEA 5J2CA 2D6FC 4M9NA 5HMLA 3RB6A 1X42A 2JH7A 3RAQA 4DL4A 2EZZA 3MGIA 1XO1A 8ICTA 3V6HA 1J2NA 5AHXA 4YFKA 2Y1JA 3M9NB 4DSLA 3SEIA 4F5QA 2QLTA 3GFKB 2KTQA 4C8NA 2RDIA 1Z00A 2FI1A 2W8KA 4X5VA 3RB4A 3NS1A 2MA1A 5J0PA 5GTHU 2KNJA 1RXVA 4F2SA 3OSPA 1ZRMA 4P0QA 3SI8A 4FFDA 3CW2C 5KFQA 5JU5A 5J8YA 4Y2YA 1RDFA 1SZHA 1KQQA 4MFFA 1URJA 3PO5A 3L4PA 2QB0A 2ZTDA 3J81j 1VDVA 4RQNA 3LWLA 5J2AA 2XY6A 9ICWA 5EE1A 4B9VA 4Y2VA 4DWIA 4QWEA 7ICTA 1U9LA 2YMQA 4PGXA 2EH9A 2V4QA 4P0PA 4WJ3B 5KFEA 4KLUA 1KRPA 1NZPA 2EDUA 4FZNA 1OXJA 4R8UB 4UQGA 2AGOA 2P66A 5CJ7A 4KX3A 1PVPA 2ALZA 3BS7A 1NK6A 5DBAA 4ECQA 3V72A 3RRHA 2ZXHA 2YY6A 5AKIA 5DGAA 3HKZF 1DGJA 5IIJA 3LVVA 3ED5A 3CRXA 4NJ8A 4KLOA 4RQ2A 3MDCA 3GV7B 8ICAA 2ZTCA 1SXEA 4IC9A 3PR5B 3QUTA 3QXGA 1SV0A 4B9UA 4XRHA 1ZYQA 3IHQB 1BPDA 4ED7A 4JV1A 4Y2QA 2CN1A 3A0HU 1UT5A 4F5RA 5AIAA 3E0FA 3IM1A 3HT3A 1TK0A 3IG5A 2D8CA 4ICAA 1ZQGA 3KKAC 1KW4A 1Q3UA 4DF4A 5ALKA 8ICUA 4DL2A 3KD3A 9ICAA 4JUZA 2XVTA 2Q0ZX 4ED6A 5ALHA 4JWMA 4F5PA 1MA7A 2ZIWA 3AQFA 4F4XA 2G08A 3TANA 7ICHA 4B9MA 1BPEA 3F5EA 2KKVA 1ZQDA 1V97A 4QW8A 4YCXA 4O3MA 1SKWA 4B9NA 2YQEA 1XSLA 4ED8A 3TFRA 5AM1A 4M9LA 2NRWA 5TZVA 3ZD9A 2BPFA 2G0AA 2HOIA 1TAMA 2H3IA 4IL6U 9ICEA 1U4BA 4DQRA 5G5HA 2ES6A 1WYGA 3H7IA 1XO0A 5AI4A 3JPNA 3NRWA 5GTIU 2ASJA 3M8RA 3H40A 3B0YA 1ZQBA 5ALYA 4NM1A 1AROP 4J9QA 1T7PA 4M0AA 2A19A 2R8IA 4DFJA 5DDMA 1PVQA 1Q46A 4YR0A 3RB3A 2XO7A 3OTQA 1QTMA 2BZFA 1B0XA 3PVXA 1ZQFA 2DF4B 5AICA 4F93B 9ICXA 3BS5B 2G07A 2V9WA 2JR5A 4FS2A 2JHDA 3V6KA 2W9AA 1O08A 9ICKA 4U7CA 2W55A 2ESEA 3QU7A 1VLBA 1KKXA 2WFAA 1KFDA 2PXIA 5D4BA 4Y2RA 1ZOLA 1ZQSA 3PMLA 2FJ6A 3B9JA 4O5EA 3SV4A 3E2EA 8ICNA 2H5XA 4TURA 4J9SA 1DOQA 3Q8QB 2FLLA 1ZQHA 2YMLA 5KG0A 1WWVA 2LI6A 4KLQA 4Z6CA 2BCRA 5KT3A 2ZUDA 5KFGA 1C20A 3MFHA 4ED2A 2QKQA 4I29A 7ICMA 1IV8A 3QEAZ 2R8JA 4I2CA 4EZ9A 3NTUA 3WKDA 2DGZA 5AI0A 4QZIA 1LKYA 4LJXA 4IRKA 1F5SA 2F1HA 4EBEA 2ZIXA 2ISPA 4ZH4A 1JALA 2W9CA 1ZQTA 3K4GA 2XCPA 3PY8A 2EAMA 3HWTA 2W8LA 2LHTA 3HP6A 3N7SC 4EBCA 3UPQA 2R8HA 3M6ZA 5KFRA 5L1KA 5ALSA 2KG5A 4M2YA 4DFMA 4R66A 1JMSA 4E0DA 2FPLA 2KVSA 2EAOA 2RDJA 2BGWA 4NLZA 1UPHA 2KJ9A 1S0VA 3FC4A 2AGQA 5HP4A 1P7DA 1NK9A 1ZQCA 2F8KA 3RB0A 2MUTA 2QARB 4DSFA 3IDWA 2XC9A 3AMZA 1KL9A 2W54A 3BZKA 3PSPA 5DBCA 5DG9A 3KHGA 3SENA 4CNQA 1ZQNA 4C4TA 4DLGA 4NLBA 3WK8A 5DBBA 4I2FA 4FE3A 1A76A 5FP0A 1QSYA 4UAYA 3MR5A 4GXIA 3C2KA 4QWCA 3SAFA 3H0RB 1WCLA 2B21A 1ZJMA 5HR6A 4LVSA 1IIPA 1D8BA 1B43A 5CHGA 3UQ2A 2R18A 4JB3A 3PSFA 2W03A 2KHQA 3THVA 1NKBA 4DL5A 3G6YA 5HHHA 2HOFA 1A6SA 1JUDA 3D6JA 1EXNA 4NLCA 2WB1F 2WB1C 2DKZA 4UASA 4QZ8A 3EWAA 2VANA 4QZEA 2WTFA 2R8KA 1DXSA 3U26A 4DEZA 3PV8A 4O0IA 3BQ0A 4UB4A 3HPOA 2IHMA 4RQ3A 1KN5A 5T14A 1TV9A 1IG6A 3V7LA 3GZFA 2KZ3A 1HJPA 1TK5A 1JXEA 2M9NA 4EZ6A 9ICIA 5AI8A 1NKEA 3F2CA 4MFAA 4GC7A 4TUQA 4ECWA 4RQ7A 3FDSA 3QU2A 4IQTA 3H8SA 7ICQA 3K1RB 1ZQXA 3E58A 2BQRA 3C28A 3WK5A 3RR8A 1HEKA 4I28A 1HUOA 2W04A 4NWIA 5KFIA 2DWQA 3MGHA 2XIDA 3AQEA 3JPTA 1T3NA 4FZLA 3GQCA 5AM4A 3RJKA 1FIQA 3ETLA 5KG4A 3AUOA 4C8KA 4A8EA 3D2NA 4QWDA 1NJZA 3MGVA 2HVIA 4CGZA 4UATA 2C22A 4CF5A 1SZPA 5AK3A 8ICYA 1DK3A 2XCAA 1Z19A 3QYPA 8ICBA 1F0MA 2QB0B 5KFZA 3C5GA 1X40A 3PZPA 5K4LA 2WAQF 4P4MA 4DSKA 3FAHA 4UB8U 2XI9A 1RZTA 3RJIA 3CNHA 4RT2A 2UVUA 2PFOA 4RUCA 1L8OA 2BHNA 4EYIB 4PH5A 1ZQQA 1UA0A 2JEJA 3SMVA 1T94A 3JPOA 4TUSA 2EQYA 3N7PD 7ICLA 5HMMA 5AIBA 2AJQA 4KLFA 3NASA 2UVWA 4TQSA 3AN1A 2PFQA 4JWNA 4F4WA 3PX4A 3ORYA 1QSLA 1B22A 4KLMA 2HCFA 4F92B 4Z6DA 3FYHA 4MHVA 3SR6A 3UQ0A 3WK7A 1ZXIA 4UARA 3G6VA 1SKSA 5ALWA 9ICFA 5AKYA 1RYUA 2K4EA 2VA3A 2HHVA 2K8BB 4XQ8A 3UMGA 2AXTU 3RH4A 4IQWA 2KK0A 1OUQA 2HDOA 9ICTA 5J2JA 3JPQA 2ATLA 3MR6A 1JI7A 4UAVA 5KFLA 5KFOA 4YD1A 4IR9A 4NL9A 3EYZA 1N56A 2LM4A 5KT5A 2F1JA 5JUMA 1YZ6A 3AM9A 4UBBA 4IQVA 3UXOA 3PO4A 5KTQA 1D8LA 5J2FA 1X66A 4YMOA 5F3XB 1YT3A 1XS9D 3Q8LA 1ZQJA 2BR0A 3M1YA 2K4HA 2UVVA 4OJOA 2CXYA 9ICSA 2D3DA 2FMQA 4ELTA 4KLIA 4FBUA 2ZIWB 5C5JA 5AKXA 1QCKA 2HBLA 8ICFA 2BCVA 4FO6A 3RRGA 3KKAA 3T5JA 1NNLA 2NV3A 2OYYA 4KMUA 5ALNA 2RP5A 2KICA 1QQ7A 3RFAA 2F1IA 9ICLA 4CDGA 3GILA 4PL2A 3RH5A 2YMPA 3DDHA 5ALZA 3KTQA 4DS4A 1VJ5A 1NK4A 4P2HA 4JMUA 4J9OA 2A1JB 9ICMA 3VCBA 3CYMA 5DLGA 4C8OA 5BPCA 1L8LA 9ICQA 2ZIVA 5IIMA 5TISU 3GDXA 4US8A 3PMNA 2KZZA 2K4IA 4ACOA 3KOOA 3C29A 2OM6A 2KFZA 2BQUA 5J2GA 4RZRA 3RF9A 2V4RA 4R64A 2R8GA 4P4OA 3JPRA 2F3NA 5ALPA 3HKZC 3TADC 1FFVA 3QZ8A 4ECTA 2I1QA 1QLNA 3NGDA 1S5LU 4JV0A 1RM6C 1L7NA 5ALTA 2E8NA 8ICMA 2DPJA 4DFKA 5J2BA 5KNIA 5DB8A 4ELVA 3K1ZA 3R9KA 5DDYA 4QZCA 5ALFA 3ZI4A 4CE6A 3M9MB 4NV0A 2VA8A 1RPLA 3ZDEA 3GV8B 2W9BB 3RH6A 3SZ2A 8ICLA 5J2IA 4KLDA 3KZIU 2G06A 4QZDA 2EANA 3MBYA 1Z4OA 4ECVA 5DG7A 4DCCA 2JZBB 5KFXA 5AM3A 1DK2A 1L7OA 1ZQEA 2KEYA 2NRZA 3M9OB 3SQIA 4PPXA 3F2BA 5EWEA 4XUSA 5AM5A 2DBYA 2LKYA 2ZIXB 2UVRA 1CEZA 8ICSA 3D2QA 2Y0SF 5CB1A 2W9CB 1KLNA 5J8YC 2NRVA 3OHBA 1L3VA 2Y1IA 3IP4B 1KBUA 5EWFA 8ICIA 4DQQA 1ZD2P 5DG8A 3SAGA 1X9WA 1RXWA 5KFPA 2PFNA 1BVSA 1ZETA 5J0QA 7ICKA 4FS1A 1S0OA 8ICJA 5KFAA 3QU4A 2FLPA 2DPIA 2W3SA 1NJXA 1TVAA 4F72A 5AKGA 4PL1A 3ALRA 5B66U 1SIJA 4KLSA 5CEHA 3ICXA 3PW7A 2IOHA 3QUBA 1JXLA 4RQ4A 2BDPA 2NYVA 5DGBA 2JXJA 3KHRA 2JEIA 5J2DA 1XU4A 1N2XA 4UB2A 3GV5B 3QX7A 4AYBF 4AYBC 2L5YA 4R8UA 3PW0A 1KEJA 4RUAA 3H0MB 2PI4A 3MR2A 5AKZA 7ICOA 4M6WB 4R65A 1SV0C 3EPGA 2C28A 3PR4A 3F2DA 4F71A 3BZCA 2I9GA 2K8CB 1CI4A 1HIWA 3H8MA 4USAA 4Y2SA 9ICRA 4EX7A 3KHHA 4DQIA 2K60A 1ZD4A 3QZ7A 4Q8EA 4KLEA 5DKWA 4JK1A 4EYHB 5AI9A 5J2HA 4ELUA 1L3SA 2H3VA 2ZUBA 5KG1A 1XC9A 4KX5A 3QUCA 4I2HA 5L1MA 1IXRA 3I1YA 5AM2A 5CP2A 4F5NA 1SWVA 2F76X 5KFKA 3FM9A 1X9SA 2EAPA 4B9TA 3KFUF 2WF6A 3RJJA 2KIVA 3M8SA 9ICOA 1PK1B 4C7ZA 2K4PA 2W43A 4ECYA 3BQ1A 2IOFK 9ICNA 4I2JA 4KLHA 3C2LA 1MSWD 3AU6A 4EENA 5KAFU 1XSNA 4QWBA 3RBDA 2YMMA 4NLKA 1S0MA 3Q8SB 4TUPA 5AKLA 3N4MB 4YR3A 1X6IA 2JMGA 5J0OA 3TAQA 5D46A 8ICEA 5DLFA 5ALMA 5DQIA 4KN7A 3SD7A 2ZG6A 4M47A 2XGQA 3RAXA 2ZIUB 3WKCA 3SAHA 2B0CA 4EBDA 2WF9A 1J2MA 4F8RA 1T8EA 4PHDA 3N28A 3NVZA 3KHLA 1X2IA 3ZDCA 4M9HA 2HHUA 3F5AA 2MU2A 1Y88A 1X9XA 2KV2A 3BS5A 4KTQA 8ICXA 1N60A 5AKJA 1ECWA 2KP7A 5HR7A 1SGGA 4ECRA 2KSOB 3NVYA 3QU5A 3RBEA 1D9DA 5AI5A 3EZ5A 2HHQA 1Z1VA 5KT7A 2E8OA 2F8LA 2HW3A 4IR1A 3UXNA 2C2EA 5KL1B 4DQSA 3M7DA 2DQNB 5KT4A 4IRDA 5F9NA 1K5OA 1K1QA 4Q8FA 2XY7A 5KFFA 4CF3A 2MAXA 5JRTA 4C8LA 4UB6U 1K1SA 3EW9A 2KN7A 1N5WA 8ICWA 3ZDAA 4KLLA 5H2FU 1BPXA 4OCZA 1SKRA 4DFPA 4QZ9A 5KG7A 7ICUA 4MFCA 1ZJNA 4DLEA 2BCSA 1N63A 4Q45A 3OGUA 4O3QA 4M9JA 8ICPA 1ZQRA 3OHAA 1TK8A 5IIKA 4ED3A 4GLXA 1ZQLA 4CRXA 2BPCA 3LWMA 1X9MA 7ICEA 2ASDA 5IIOA 3NVVA 4UB3A 2VKQA 3EUB2 1PK3A 4TQRA 2IA6A 4DOCA 4KMOB 3Q8PB 4BGDA 4RQ0A 2NRTA 3IG8A 1NKCA 7ICIA 4O3SA 1Z00B 3T5LA 3BJYA 2ISOA 1KFSA 4PGYA 5F9LA 2F44A 4Y2JA 3IV6A 2C2DA 5J0XA 3HILA 4P0QB 3BQ2A 4XA5A 4NLGA 3V7JA 5EE0A 2QARA 1IM4A 3UM9A 3MR3A 4UBCA 2LYHA 3C5FA 1BPBA 2QB1A 2WAQC 1N62A 2BCQA 3ZDBA 4DSIA 2CRXA 2ZUCA 2YX8A 5HNKA 2JEGA 2OXOA 2G5IB 5ALXA 4RNMA 4P0PB 3ISDA 5ALGA 4OJ6A 2RLTA 1ZQPA 4DL6A 3RJGA 2PMZF 2PMZC 1ZQWA 5J0YA 3RJEA 3CP8A 4US9A 3H0LB 8ICGA 1YZ7A 3T5KA 4F91B 3N97B 3K75D 1UHUA 1ED1A 2WF5A 4PZNA 4C80A 2DFLA 3GIKA 3IRUA 4YG2A 5AK4A 2O6KA 3N7RC 5AM0A 5E79U 1NJWA 2NRXA 5J0TA 4G3IA 4RNNA 3V6JA 5J0SA 1QQ5A 2VJ5A 3DV9A 4LZDA 1X6JA 3WK9A 3PSTA 2GWSA 1DRGA 1QQ6A 4DOAA 4ED0A 5ALIA 1SWWA 5DB6A 4I2DA 1F44A 1MN8A 1SV4A 1SB3C 2CPRA 3KZXA 2DUYA 2Y9UA 4IS7A 5HHIA 2FDRA 3AL0B 2XGPA 1UCVA 2I5HA 3H8WA 4J9RA 2GOLA 4Y2PA 7ICPA 5ALLA 2KE7A 4IRCA 2P35A 1RG6A 1WCNA 3MFIA 8ICVA 5ALRA 1Z1BA 4BJQA 1ZQUA 4RU9A 2DKXA 3F53A 5ALJA 2AHOB 4BUGA 3LDAA 4QZGA 4Q43A 1S9FA 2KVCA 4QZBA 2WHEA 4K4GA 4PZOA 5ALUA 2LPEA 5B5EU 2RRDA 1UQVA 1XWLA 1MQ2A 3NVWA 2J6UA 2FMSA 1KSPA 5CR0A 4M04A 4BXOA 4Y2XA 5J2KA 2ODGA 5J2EA 1TFRA 1B4FA 3SYZA 3HJEA 4PJ0U 2G5HB 5KFCA 3BQ7A 1UT8A 5AI6A 3WKBA 3TKAA 5KG2A 2XY5A 1L3TA 3C21A 2F77X 4ECXA 3GIIA 4AP9A 5BOMA 1FO4A 4DF8A 2I6XA 4KLTA 1S97A 4YMNA 4Q44A 1NK7A 1MQ3A 2E1EA 4CCHA 1NOMA 3ETRA 3WKEA 3QE9Y 4EEYA 3V7KA 2KZMA 5AKEA 4YP3A 4I2GA 2HBMA 4O3PA 4OJLA 3HX0A 3RR7A 2BKEA 2HMXA 5KG3A 4YVZA 4DOBA 4M9GA 5IILA 2HVHA 5ALQA 4UB5A 3Q8MA 2E8PA 1ZQAA 8ICHA 5KFNA 2BQ3A 2E3TA 1D9FA 1TKDA 3Q8KA 2BPGA 5KFMA 2E8MA 5KFTA 3PNCA 1S77D 1UA1A 5JTIA 2VJ4A 2H3ZA 1L7MA 3S6JA 3BDPA 2KJ5A 2BCUA 3I28A 4BWMA 4GIBA 1NK0A 4DFDA 4NL9C 5CRXA 3RJHA 2GO7A 4MF8A 1J97A 4UAWA 1U45A 1S8OA 2HBKA 3WK6A 3WU2U 4ECSA 2K8AA 3KBBA 5KFJA 4RQ5A 2K89A 2AGPA 2ZJ8A 5CWRA 4UW9A 2W9MA 3AU2A 1LKYB 7ICFA 2BDUA 2Z7JA 9ICCA 3UMCA 2Y0SC 2GLEA 4O9MA 4J9PA 2KJ8A 2KMDA 2IBKA 1DGSA 2HSZA 4NLNA 4QJFB 4UB1A 3IN5A 2IMWP 5ALVA 4OJPA 2JRZA 4J9MA 5J0RA 1NI3A 3T5HA 3O0FA 4BX9C 1ZD5A 9ICPA 1JX4A 4I2BA 1FEZA 7ICJA 2HHTA 1CUKA 3WKAA 1JN3A 2PKEA 4DL3A 4NXZA 4MF2A 4OJ5A 1U47A 4O3RA 1JRPA 3ISCA 3MC1A 5EOZA 3TI0A 1C7YA 3NUQA 4OD0A 2MUTB 2N1RA 2MSNA 2FMPA 4DS5A 1NK8A 3PX0A 5KFYA 2AQ4A 2A1JA 5AKHA 4KLGA 2HHXA 1AQ6A 3MDAA 4DL7A 3WK4A 4C0ZA 4RPZA 1LVHA 8ICCA 1KTQA 2WF7A 4YN4A 2P6UA 3C1YA 1ZQZA 1D8YA 1H38A 3I76A 4CF4A 4K4IA 4G9BA 1O03A 4P4PA 3OSNA 4C8MA 4C4RA 1JROA 5KFBA 3OJSA 1U49A 5KFWA 2ASLA 1SXDA 3C1ZA 3LVWA 2YB1A 4Z6FA 3NRZA 3PW2A 4F50A 2KHVA 4B6JA 3H4DA 3B0XA 3H8JA 3L5KA 4F3OA 3ISBA 4QZFA 3DEEA 5ALOA 2W9BA 4KLJA 4Y2UA 9ICGA 2Y9TA 2A1AA 2JGAA 1PZNA 4DO9A 1SL0A 2JEFA 2ZXIA 1A0PA 5KFDA 4RT3A 2AQ0A 3RTVA 3QNMA 4ECZA 3T3FA 2JZBA 1GO3F 3PX6A 1TAQA 4Y2TA 4RQ1A 1ZQIA 3GIMA 3PW5A 5J29A 3LYSA 2IOFA 4O5CA 1WWUA 4QW9A 2E1FA 4JV2A 4F5OA 1OW5A 2WF8A 2OCEA 5IIIA 5IINA 1RQNA 2VA2A 1S76D 5BOLA 3G6XA 1QH9A 2EZXA 2PFPA 1S10A 2KKPA 4ZOHC 2HHWA 1ZQVA 2VIXA 1T4GA 1Q3VA 2KD1A 2HHSA 2RQ5A 3L3FX 4KITB 4MEXA 1WUDA 2FLNA 5KG6A 1BGXT 4IQUA 5L9XA 2C2RA 3QU9A 3GIJA 4YR2A 8ICZA 1A77A 1L5UA 4RNOA 4MEYA 5DB7A 4GXKA 4UAUA 2W3RA 4PHAA 1V85A 2NO4A 2IHNA 3QEBZ 1HUZA 2W7OA 4YQWA 4QZHA 1TE2A 3QUQA 1RQLA 1LV5A 3TACB 4I2EA 8ICQA 1QSSA 3RJFA 3HRDD 1WG8A 2KFNA 4I2AA 4J9KA 2YTUA 3TAPA 5ALEA 2H3FA 2B6GA 2W11A 2A3VA 4O3OA 3M6KA 1BPYA 4GXJA 8ICKA 3ONNA 3HW8A 1RYRA 4F4KA 1KFTA 5AK6A 3PSIA 2AU0A 4PGQA 5KFVA 2ZTEA 2HBJA 1L7PA 5L1LA 4M6WA 2M0NA 3TFSA 3H4BA 7ICGA 5DB9A 3OPXA 3BQTA 2EZYA 4HAIA 3VC8A 4YMMA 1M6YA 1L3UA 4RQMA 1L6NA 1N48A 2ZJ5A 3GU3A 1Z4NA 2HOQA 4LZGA 4QNLA 2LBOA 4FZMA 2Q4TA 5L1IA 1ZQMA 1N61A 4QZAA 2OWOA 2W7PA 1ZD3A 4F4ZA 2OH2A 4OO1J 4RQ6A 9ICJA 4B9SA 5D49A 1BPZA 4EX6A 4K4HA 3UXPA 3UMBA 5EE3A 4ED1A 3T79A 4PHPA 5G5GA 1NJYA 4PHEA 3JPSA 2YB4A 1MC8A 1TAUA 4C7YA 5EWGA 3D2SA 3MABA 5J0WA 4FBTA 4C4SA 7ICNA 4GFJA 4YD2A 1T3QA 1ZQ1C 4YXMA 4DQPA 7ICSA 1PK1A 2P6RA 3SV3A 2ZJAA 1V9PA 4BWJA 2NO5A 5ALDA 2J6SA 1PVRA 9ICVA 1RYSA 1NZBA 4EEKA 5KFUA 8ICRA 4Z6EA 5L1JA 2FPKA 7ICRA 2LMRA 4I2IA 3LK9A 4J9NA 1ZQKA 2F2AB 4ECUA 5DQGA 2DL0A 2OEHA 1BNPA 2FE9A 2MRLA 1XSPA 1Q8KA 2AH5A 4J03A 1U48A 4BXOB 4KN4A 2ZIUA 5KAIU 3TARA 2LM1A 1SL2A 1COKA 2LYAA 4YXJA 1JIHA 5A0LA 2YN4A 4J9LA 4B9LA
chains in the Genus database with same CATH topology
5GTHU 3KZIU 5E79U 5GTIU 1S5LU 4UB8U 4PJ0U 4UB6U 2DUYA 5KAIU 3WU2U 5H2FU 5KAFU 3A0BU 5B5EU 4IL6U 2AXTU 5B66U 5TISU 3A0HU
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GTH U;  3KZI U;  5E79 U;  5GTI U;  1S5L U;  4UB8 U;  4PJ0 U;  4UB6 U;  2DUY A;  5KAI U;  3WU2 U;  5H2F U;  5KAF U;  3A0B U;  5B5E U;  4IL6 U;  2AXT U;  5B66 U;  5TIS U;  3A0H U; 
#chains in the Genus database with same CATH topology
 1ZRN A;  4NM2 A;  5KL8 B;  4EEL A;  2E5S A;  1S0N A;  2ZIV B;  1Z3E B;  5DQH A;  4HYK A;  1ZQO A;  5C0Y A;  1FFU A;  2G09 A;  1SL1 A;  2JV3 A;  4O3N A;  2JH1 A;  4RPX A;  2PI5 A;  1KDH A;  3ZD8 A;  2KSO A;  4F4Y A;  2FPM A;  5KFH A;  1CRX A;  4QIW F;  4QIW C;  4NY8 A;  3AEV A;  1N5X A;  4RQ8 A;  2KOB A;  5KFS A;  3C2M A;  3OJU A;  8ICO A;  2RHF A;  3C23 A;  1V38 A;  2XIC A;  2HI0 A;  3TQ1 A;  3ZDD A;  9ICU A;  4R63 A;  1BNO A;  2GH1 A;  5AKK A;  3Q8R B;  5AK5 A;  1COO A;  4I27 A;  1ZQY A;  4GC6 A;  5J0U A;  2KIW A;  3TAD A;  9ICB A;  3EPI A;  3PW4 A;  2LYB A;  2OHF A;  5KG5 A;  7ICV A;  4UAZ A;  1LB2 B;  5EE9 A;  5KT6 A;  4U6P A;  2H3Q A;  4F2R A;  4O5K A;  3A0B U;  4RPY A;  3JPP A;  1NK5 A;  4BDP A;  5KT2 A;  1XNS A;  4DSJ A;  9ICH A;  4QWA A;  2J6T A;  5CA7 A;  1PUZ A;  4DSE A;  5J2C A;  2D6F C;  4M9N A;  5HML A;  3RB6 A;  1X42 A;  2JH7 A;  3RAQ A;  4DL4 A;  2EZZ A;  3MGI A;  1XO1 A;  8ICT A;  3V6H A;  1J2N A;  5AHX A;  4YFK A;  2Y1J A;  3M9N B;  4DSL A;  3SEI A;  4F5Q A;  2QLT A;  3GFK B;  2KTQ A;  4C8N A;  2RDI A;  1Z00 A;  2FI1 A;  2W8K A;  4X5V A;  3RB4 A;  3NS1 A;  2MA1 A;  5J0P A;  5GTH U;  2KNJ A;  1RXV A;  4F2S A;  3OSP A;  1ZRM A;  4P0Q A;  3SI8 A;  4FFD A;  3CW2 C;  5KFQ A;  5JU5 A;  5J8Y A;  4Y2Y A;  1RDF A;  1SZH A;  1KQQ A;  4MFF A;  1URJ A;  3PO5 A;  3L4P A;  2QB0 A;  2ZTD A;  3J81 j;  1VDV A;  4RQN A;  3LWL A;  5J2A A;  2XY6 A;  9ICW A;  5EE1 A;  4B9V A;  4Y2V A;  4DWI A;  4QWE A;  7ICT A;  1U9L A;  2YMQ A;  4PGX A;  2EH9 A;  2V4Q A;  4P0P A;  4WJ3 B;  5KFE A;  4KLU A;  1KRP A;  1NZP A;  2EDU A;  4FZN A;  1OXJ A;  4R8U B;  4UQG A;  2AGO A;  2P66 A;  5CJ7 A;  4KX3 A;  1PVP A;  2ALZ A;  3BS7 A;  1NK6 A;  5DBA A;  4ECQ A;  3V72 A;  3RRH A;  2ZXH A;  2YY6 A;  5AKI A;  5DGA A;  3HKZ F;  1DGJ A;  5IIJ A;  3LVV A;  3ED5 A;  3CRX A;  4NJ8 A;  4KLO A;  4RQ2 A;  3MDC A;  3GV7 B;  8ICA A;  2ZTC A;  1SXE A;  4IC9 A;  3PR5 B;  3QUT A;  3QXG A;  1SV0 A;  4B9U A;  4XRH A;  1ZYQ A;  3IHQ B;  1BPD A;  4ED7 A;  4JV1 A;  4Y2Q A;  2CN1 A;  3A0H U;  1UT5 A;  4F5R A;  5AIA A;  3E0F A;  3IM1 A;  3HT3 A;  1TK0 A;  3IG5 A;  2D8C A;  4ICA A;  1ZQG A;  3KKA C;  1KW4 A;  1Q3U A;  4DF4 A;  5ALK A;  8ICU A;  4DL2 A;  3KD3 A;  9ICA A;  4JUZ A;  2XVT A;  2Q0Z X;  4ED6 A;  5ALH A;  4JWM A;  4F5P A;  1MA7 A;  2ZIW A;  3AQF A;  4F4X A;  2G08 A;  3TAN A;  7ICH A;  4B9M A;  1BPE A;  3F5E A;  2KKV A;  1ZQD A;  1V97 A;  4QW8 A;  4YCX A;  4O3M A;  1SKW A;  4B9N A;  2YQE A;  1XSL A;  4ED8 A;  3TFR A;  5AM1 A;  4M9L A;  2NRW A;  5TZV A;  3ZD9 A;  2BPF A;  2G0A A;  2HOI A;  1TAM A;  2H3I A;  4IL6 U;  9ICE A;  1U4B A;  4DQR A;  5G5H A;  2ES6 A;  1WYG A;  3H7I A;  1XO0 A;  5AI4 A;  3JPN A;  3NRW A;  5GTI U;  2ASJ A;  3M8R A;  3H40 A;  3B0Y A;  1ZQB A;  5ALY A;  4NM1 A;  1ARO P;  4J9Q A;  1T7P A;  4M0A A;  2A19 A;  2R8I A;  4DFJ A;  5DDM A;  1PVQ A;  1Q46 A;  4YR0 A;  3RB3 A;  2XO7 A;  3OTQ A;  1QTM A;  2BZF A;  1B0X A;  3PVX A;  1ZQF A;  2DF4 B;  5AIC A;  4F93 B;  9ICX A;  3BS5 B;  2G07 A;  2V9W A;  2JR5 A;  4FS2 A;  2JHD A;  3V6K A;  2W9A A;  1O08 A;  9ICK A;  4U7C A;  2W55 A;  2ESE A;  3QU7 A;  1VLB A;  1KKX A;  2WFA A;  1KFD A;  2PXI A;  5D4B A;  4Y2R A;  1ZOL A;  1ZQS A;  3PML A;  2FJ6 A;  3B9J A;  4O5E A;  3SV4 A;  3E2E A;  8ICN A;  2H5X A;  4TUR A;  4J9S A;  1DOQ A;  3Q8Q B;  2FLL A;  1ZQH A;  2YML A;  5KG0 A;  1WWV A;  2LI6 A;  4KLQ A;  4Z6C A;  2BCR A;  5KT3 A;  2ZUD A;  5KFG A;  1C20 A;  3MFH A;  4ED2 A;  2QKQ A;  4I29 A;  7ICM A;  1IV8 A;  3QEA Z;  2R8J A;  4I2C A;  4EZ9 A;  3NTU A;  3WKD A;  2DGZ A;  5AI0 A;  4QZI A;  1LKY A;  4LJX A;  4IRK A;  1F5S A;  2F1H A;  4EBE A;  2ZIX A;  2ISP A;  4ZH4 A;  1JAL A;  2W9C A;  1ZQT A;  3K4G A;  2XCP A;  3PY8 A;  2EAM A;  3HWT A;  2W8L A;  2LHT A;  3HP6 A;  3N7S C;  4EBC A;  3UPQ A;  2R8H A;  3M6Z A;  5KFR A;  5L1K A;  5ALS A;  2KG5 A;  4M2Y A;  4DFM A;  4R66 A;  1JMS A;  4E0D A;  2FPL A;  2KVS A;  2EAO A;  2RDJ A;  2BGW A;  4NLZ A;  1UPH A;  2KJ9 A;  1S0V A;  3FC4 A;  2AGQ A;  5HP4 A;  1P7D A;  1NK9 A;  1ZQC A;  2F8K A;  3RB0 A;  2MUT A;  2QAR B;  4DSF A;  3IDW A;  2XC9 A;  3AMZ A;  1KL9 A;  2W54 A;  3BZK A;  3PSP A;  5DBC A;  5DG9 A;  3KHG A;  3SEN A;  4CNQ A;  1ZQN A;  4C4T A;  4DLG A;  4NLB A;  3WK8 A;  5DBB A;  4I2F A;  4FE3 A;  1A76 A;  5FP0 A;  1QSY A;  4UAY A;  3MR5 A;  4GXI A;  3C2K A;  4QWC A;  3SAF A;  3H0R B;  1WCL A;  2B21 A;  1ZJM A;  5HR6 A;  4LVS A;  1IIP A;  1D8B A;  1B43 A;  5CHG A;  3UQ2 A;  2R18 A;  4JB3 A;  3PSF A;  2W03 A;  2KHQ A;  3THV A;  1NKB A;  4DL5 A;  3G6Y A;  5HHH A;  2HOF A;  1A6S A;  1JUD A;  3D6J A;  1EXN A;  4NLC A;  2WB1 F;  2WB1 C;  2DKZ A;  4UAS A;  4QZ8 A;  3EWA A;  2VAN A;  4QZE A;  2WTF A;  2R8K A;  1DXS A;  3U26 A;  4DEZ A;  3PV8 A;  4O0I A;  3BQ0 A;  4UB4 A;  3HPO A;  2IHM A;  4RQ3 A;  1KN5 A;  5T14 A;  1TV9 A;  1IG6 A;  3V7L A;  3GZF A;  2KZ3 A;  1HJP A;  1TK5 A;  1JXE A;  2M9N A;  4EZ6 A;  9ICI A;  5AI8 A;  1NKE A;  3F2C A;  4MFA A;  4GC7 A;  4TUQ A;  4ECW A;  4RQ7 A;  3FDS A;  3QU2 A;  4IQT A;  3H8S A;  7ICQ A;  3K1R B;  1ZQX A;  3E58 A;  2BQR A;  3C28 A;  3WK5 A;  3RR8 A;  1HEK A;  4I28 A;  1HUO A;  2W04 A;  4NWI A;  5KFI A;  2DWQ A;  3MGH A;  2XID A;  3AQE A;  3JPT A;  1T3N A;  4FZL A;  3GQC A;  5AM4 A;  3RJK A;  1FIQ A;  3ETL A;  5KG4 A;  3AUO A;  4C8K A;  4A8E A;  3D2N A;  4QWD A;  1NJZ A;  3MGV A;  2HVI A;  4CGZ A;  4UAT A;  2C22 A;  4CF5 A;  1SZP A;  5AK3 A;  8ICY A;  1DK3 A;  2XCA A;  1Z19 A;  3QYP A;  8ICB A;  1F0M A;  2QB0 B;  5KFZ A;  3C5G A;  1X40 A;  3PZP A;  5K4L A;  2WAQ F;  4P4M A;  4DSK A;  3FAH A;  4UB8 U;  2XI9 A;  1RZT A;  3RJI A;  3CNH A;  4RT2 A;  2UVU A;  2PFO A;  4RUC A;  1L8O A;  2BHN A;  4EYI B;  4PH5 A;  1ZQQ A;  1UA0 A;  2JEJ A;  3SMV A;  1T94 A;  3JPO A;  4TUS A;  2EQY A;  3N7P D;  7ICL A;  5HMM A;  5AIB A;  2AJQ A;  4KLF A;  3NAS A;  2UVW A;  4TQS A;  3AN1 A;  2PFQ A;  4JWN A;  4F4W A;  3PX4 A;  3ORY A;  1QSL A;  1B22 A;  4KLM A;  2HCF A;  4F92 B;  4Z6D A;  3FYH A;  4MHV A;  3SR6 A;  3UQ0 A;  3WK7 A;  1ZXI A;  4UAR A;  3G6V A;  1SKS A;  5ALW A;  9ICF A;  5AKY A;  1RYU A;  2K4E A;  2VA3 A;  2HHV A;  2K8B B;  4XQ8 A;  3UMG A;  2AXT U;  3RH4 A;  4IQW A;  2KK0 A;  1OUQ A;  2HDO A;  9ICT A;  5J2J A;  3JPQ A;  2ATL A;  3MR6 A;  1JI7 A;  4UAV A;  5KFL A;  5KFO A;  4YD1 A;  4IR9 A;  4NL9 A;  3EYZ A;  1N56 A;  2LM4 A;  5KT5 A;  2F1J A;  5JUM A;  1YZ6 A;  3AM9 A;  4UBB A;  4IQV A;  3UXO A;  3PO4 A;  5KTQ A;  1D8L A;  5J2F A;  1X66 A;  4YMO A;  5F3X B;  1YT3 A;  1XS9 D;  3Q8L A;  1ZQJ A;  2BR0 A;  3M1Y A;  2K4H A;  2UVV A;  4OJO A;  2CXY A;  9ICS A;  2D3D A;  2FMQ A;  4ELT A;  4KLI A;  4FBU A;  2ZIW B;  5C5J A;  5AKX A;  1QCK A;  2HBL A;  8ICF A;  2BCV A;  4FO6 A;  3RRG A;  3KKA A;  3T5J A;  1NNL A;  2NV3 A;  2OYY A;  4KMU A;  5ALN A;  2RP5 A;  2KIC A;  1QQ7 A;  3RFA A;  2F1I A;  9ICL A;  4CDG A;  3GIL A;  4PL2 A;  3RH5 A;  2YMP A;  3DDH A;  5ALZ A;  3KTQ A;  4DS4 A;  1VJ5 A;  1NK4 A;  4P2H A;  4JMU A;  4J9O A;  2A1J B;  9ICM A;  3VCB A;  3CYM A;  5DLG A;  4C8O A;  5BPC A;  1L8L A;  9ICQ A;  2ZIV A;  5IIM A;  5TIS U;  3GDX A;  4US8 A;  3PMN A;  2KZZ A;  2K4I A;  4ACO A;  3KOO A;  3C29 A;  2OM6 A;  2KFZ A;  2BQU A;  5J2G A;  4RZR A;  3RF9 A;  2V4R A;  4R64 A;  2R8G A;  4P4O A;  3JPR A;  2F3N A;  5ALP A;  3HKZ C;  3TAD C;  1FFV A;  3QZ8 A;  4ECT A;  2I1Q A;  1QLN A;  3NGD A;  1S5L U;  4JV0 A;  1RM6 C;  1L7N A;  5ALT A;  2E8N A;  8ICM A;  2DPJ A;  4DFK A;  5J2B A;  5KNI A;  5DB8 A;  4ELV A;  3K1Z A;  3R9K A;  5DDY A;  4QZC A;  5ALF A;  3ZI4 A;  4CE6 A;  3M9M B;  4NV0 A;  2VA8 A;  1RPL A;  3ZDE A;  3GV8 B;  2W9B B;  3RH6 A;  3SZ2 A;  8ICL A;  5J2I A;  4KLD A;  3KZI U;  2G06 A;  4QZD A;  2EAN A;  3MBY A;  1Z4O A;  4ECV A;  5DG7 A;  4DCC A;  2JZB B;  5KFX A;  5AM3 A;  1DK2 A;  1L7O A;  1ZQE A;  2KEY A;  2NRZ A;  3M9O B;  3SQI A;  4PPX A;  3F2B A;  5EWE A;  4XUS A;  5AM5 A;  2DBY A;  2LKY A;  2ZIX B;  2UVR A;  1CEZ A;  8ICS A;  3D2Q A;  2Y0S F;  5CB1 A;  2W9C B;  1KLN A;  5J8Y C;  2NRV A;  3OHB A;  1L3V A;  2Y1I A;  3IP4 B;  1KBU A;  5EWF A;  8ICI A;  4DQQ A;  1ZD2 P;  5DG8 A;  3SAG A;  1X9W A;  1RXW A;  5KFP A;  2PFN A;  1BVS A;  1ZET A;  5J0Q A;  7ICK A;  4FS1 A;  1S0O A;  8ICJ A;  5KFA A;  3QU4 A;  2FLP A;  2DPI A;  2W3S A;  1NJX A;  1TVA A;  4F72 A;  5AKG A;  4PL1 A;  3ALR A;  5B66 U;  1SIJ A;  4KLS A;  5CEH A;  3ICX A;  3PW7 A;  2IOH A;  3QUB A;  1JXL A;  4RQ4 A;  2BDP A;  2NYV A;  5DGB A;  2JXJ A;  3KHR A;  2JEI A;  5J2D A;  1XU4 A;  1N2X A;  4UB2 A;  3GV5 B;  3QX7 A;  4AYB F;  4AYB C;  2L5Y A;  4R8U A;  3PW0 A;  1KEJ A;  4RUA A;  3H0M B;  2PI4 A;  3MR2 A;  5AKZ A;  7ICO A;  4M6W B;  4R65 A;  1SV0 C;  3EPG A;  2C28 A;  3PR4 A;  3F2D A;  4F71 A;  3BZC A;  2I9G A;  2K8C B;  1CI4 A;  1HIW A;  3H8M A;  4USA A;  4Y2S A;  9ICR A;  4EX7 A;  3KHH A;  4DQI A;  2K60 A;  1ZD4 A;  3QZ7 A;  4Q8E A;  4KLE A;  5DKW A;  4JK1 A;  4EYH B;  5AI9 A;  5J2H A;  4ELU A;  1L3S A;  2H3V A;  2ZUB A;  5KG1 A;  1XC9 A;  4KX5 A;  3QUC A;  4I2H A;  5L1M A;  1IXR A;  3I1Y A;  5AM2 A;  5CP2 A;  4F5N A;  1SWV A;  2F76 X;  5KFK A;  3FM9 A;  1X9S A;  2EAP A;  4B9T A;  3KFU F;  2WF6 A;  3RJJ A;  2KIV A;  3M8S A;  9ICO A;  1PK1 B;  4C7Z A;  2K4P A;  2W43 A;  4ECY A;  3BQ1 A;  2IOF K;  9ICN A;  4I2J A;  4KLH A;  3C2L A;  1MSW D;  3AU6 A;  4EEN A;  5KAF U;  1XSN A;  4QWB A;  3RBD A;  2YMM A;  4NLK A;  1S0M A;  3Q8S B;  4TUP A;  5AKL A;  3N4M B;  4YR3 A;  1X6I A;  2JMG A;  5J0O A;  3TAQ A;  5D46 A;  8ICE A;  5DLF A;  5ALM A;  5DQI A;  4KN7 A;  3SD7 A;  2ZG6 A;  4M47 A;  2XGQ A;  3RAX A;  2ZIU B;  3WKC A;  3SAH A;  2B0C A;  4EBD A;  2WF9 A;  1J2M A;  4F8R A;  1T8E A;  4PHD A;  3N28 A;  3NVZ A;  3KHL A;  1X2I A;  3ZDC A;  4M9H A;  2HHU A;  3F5A A;  2MU2 A;  1Y88 A;  1X9X A;  2KV2 A;  3BS5 A;  4KTQ A;  8ICX A;  1N60 A;  5AKJ A;  1ECW A;  2KP7 A;  5HR7 A;  1SGG A;  4ECR A;  2KSO B;  3NVY A;  3QU5 A;  3RBE A;  1D9D A;  5AI5 A;  3EZ5 A;  2HHQ A;  1Z1V A;  5KT7 A;  2E8O A;  2F8L A;  2HW3 A;  4IR1 A;  3UXN A;  2C2E A;  5KL1 B;  4DQS A;  3M7D A;  2DQN B;  5KT4 A;  4IRD A;  5F9N A;  1K5O A;  1K1Q A;  4Q8F A;  2XY7 A;  5KFF A;  4CF3 A;  2MAX A;  5JRT A;  4C8L A;  4UB6 U;  1K1S A;  3EW9 A;  2KN7 A;  1N5W A;  8ICW A;  3ZDA A;  4KLL A;  5H2F U;  1BPX A;  4OCZ A;  1SKR A;  4DFP A;  4QZ9 A;  5KG7 A;  7ICU A;  4MFC A;  1ZJN A;  4DLE A;  2BCS A;  1N63 A;  4Q45 A;  3OGU A;  4O3Q A;  4M9J A;  8ICP A;  1ZQR A;  3OHA A;  1TK8 A;  5IIK A;  4ED3 A;  4GLX A;  1ZQL A;  4CRX A;  2BPC A;  3LWM A;  1X9M A;  7ICE A;  2ASD A;  5IIO A;  3NVV A;  4UB3 A;  2VKQ A;  3EUB 2;  1PK3 A;  4TQR A;  2IA6 A;  4DOC A;  4KMO B;  3Q8P B;  4BGD A;  4RQ0 A;  2NRT A;  3IG8 A;  1NKC A;  7ICI A;  4O3S A;  1Z00 B;  3T5L A;  3BJY A;  2ISO A;  1KFS A;  4PGY A;  5F9L A;  2F44 A;  4Y2J A;  3IV6 A;  2C2D A;  5J0X A;  3HIL A;  4P0Q B;  3BQ2 A;  4XA5 A;  4NLG A;  3V7J A;  5EE0 A;  2QAR A;  1IM4 A;  3UM9 A;  3MR3 A;  4UBC A;  2LYH A;  3C5F A;  1BPB A;  2QB1 A;  2WAQ C;  1N62 A;  2BCQ A;  3ZDB A;  4DSI A;  2CRX A;  2ZUC A;  2YX8 A;  5HNK A;  2JEG A;  2OXO A;  2G5I B;  5ALX A;  4RNM A;  4P0P B;  3ISD A;  5ALG A;  4OJ6 A;  2RLT A;  1ZQP A;  4DL6 A;  3RJG A;  2PMZ F;  2PMZ C;  1ZQW A;  5J0Y A;  3RJE A;  3CP8 A;  4US9 A;  3H0L B;  8ICG A;  1YZ7 A;  3T5K A;  4F91 B;  3N97 B;  3K75 D;  1UHU A;  1ED1 A;  2WF5 A;  4PZN A;  4C80 A;  2DFL A;  3GIK A;  3IRU A;  4YG2 A;  5AK4 A;  2O6K A;  3N7R C;  5AM0 A;  5E79 U;  1NJW A;  2NRX A;  5J0T A;  4G3I A;  4RNN A;  3V6J A;  5J0S A;  1QQ5 A;  2VJ5 A;  3DV9 A;  4LZD A;  1X6J A;  3WK9 A;  3PST A;  2GWS A;  1DRG A;  1QQ6 A;  4DOA A;  4ED0 A;  5ALI A;  1SWW A;  5DB6 A;  4I2D A;  1F44 A;  1MN8 A;  1SV4 A;  1SB3 C;  2CPR A;  3KZX A;  2DUY A;  2Y9U A;  4IS7 A;  5HHI A;  2FDR A;  3AL0 B;  2XGP A;  1UCV A;  2I5H A;  3H8W A;  4J9R A;  2GOL A;  4Y2P A;  7ICP A;  5ALL A;  2KE7 A;  4IRC A;  2P35 A;  1RG6 A;  1WCN A;  3MFI A;  8ICV A;  5ALR A;  1Z1B A;  4BJQ A;  1ZQU A;  4RU9 A;  2DKX A;  3F53 A;  5ALJ A;  2AHO B;  4BUG A;  3LDA A;  4QZG A;  4Q43 A;  1S9F A;  2KVC A;  4QZB A;  2WHE A;  4K4G A;  4PZO A;  5ALU A;  2LPE A;  5B5E U;  2RRD A;  1UQV A;  1XWL A;  1MQ2 A;  3NVW A;  2J6U A;  2FMS A;  1KSP A;  5CR0 A;  4M04 A;  4BXO A;  4Y2X A;  5J2K A;  2ODG A;  5J2E A;  1TFR A;  1B4F A;  3SYZ A;  3HJE A;  4PJ0 U;  2G5H B;  5KFC A;  3BQ7 A;  1UT8 A;  5AI6 A;  3WKB A;  3TKA A;  5KG2 A;  2XY5 A;  1L3T A;  3C21 A;  2F77 X;  4ECX A;  3GII A;  4AP9 A;  5BOM A;  1FO4 A;  4DF8 A;  2I6X A;  4KLT A;  1S97 A;  4YMN A;  4Q44 A;  1NK7 A;  1MQ3 A;  2E1E A;  4CCH A;  1NOM A;  3ETR A;  3WKE A;  3QE9 Y;  4EEY A;  3V7K A;  2KZM A;  5AKE A;  4YP3 A;  4I2G A;  2HBM A;  4O3P A;  4OJL A;  3HX0 A;  3RR7 A;  2BKE A;  2HMX A;  5KG3 A;  4YVZ A;  4DOB A;  4M9G A;  5IIL A;  2HVH A;  5ALQ A;  4UB5 A;  3Q8M A;  2E8P A;  1ZQA A;  8ICH A;  5KFN A;  2BQ3 A;  2E3T A;  1D9F A;  1TKD A;  3Q8K A;  2BPG A;  5KFM A;  2E8M A;  5KFT A;  3PNC A;  1S77 D;  1UA1 A;  5JTI A;  2VJ4 A;  2H3Z A;  1L7M A;  3S6J A;  3BDP A;  2KJ5 A;  2BCU A;  3I28 A;  4BWM A;  4GIB A;  1NK0 A;  4DFD A;  4NL9 C;  5CRX A;  3RJH A;  2GO7 A;  4MF8 A;  1J97 A;  4UAW A;  1U45 A;  1S8O A;  2HBK A;  3WK6 A;  3WU2 U;  4ECS A;  2K8A A;  3KBB A;  5KFJ A;  4RQ5 A;  2K89 A;  2AGP A;  2ZJ8 A;  5CWR A;  4UW9 A;  2W9M A;  3AU2 A;  1LKY B;  7ICF A;  2BDU A;  2Z7J A;  9ICC A;  3UMC A;  2Y0S C;  2GLE A;  4O9M A;  4J9P A;  2KJ8 A;  2KMD A;  2IBK A;  1DGS A;  2HSZ A;  4NLN A;  4QJF B;  4UB1 A;  3IN5 A;  2IMW P;  5ALV A;  4OJP A;  2JRZ A;  4J9M A;  5J0R A;  1NI3 A;  3T5H A;  3O0F A;  4BX9 C;  1ZD5 A;  9ICP A;  1JX4 A;  4I2B A;  1FEZ A;  7ICJ A;  2HHT A;  1CUK A;  3WKA A;  1JN3 A;  2PKE A;  4DL3 A;  4NXZ A;  4MF2 A;  4OJ5 A;  1U47 A;  4O3R A;  1JRP A;  3ISC A;  3MC1 A;  5EOZ A;  3TI0 A;  1C7Y A;  3NUQ A;  4OD0 A;  2MUT B;  2N1R A;  2MSN A;  2FMP A;  4DS5 A;  1NK8 A;  3PX0 A;  5KFY A;  2AQ4 A;  2A1J A;  5AKH A;  4KLG A;  2HHX A;  1AQ6 A;  3MDA A;  4DL7 A;  3WK4 A;  4C0Z A;  4RPZ A;  1LVH A;  8ICC A;  1KTQ A;  2WF7 A;  4YN4 A;  2P6U A;  3C1Y A;  1ZQZ A;  1D8Y A;  1H38 A;  3I76 A;  4CF4 A;  4K4I A;  4G9B A;  1O03 A;  4P4P A;  3OSN A;  4C8M A;  4C4R A;  1JRO A;  5KFB A;  3OJS A;  1U49 A;  5KFW A;  2ASL A;  1SXD A;  3C1Z A;  3LVW A;  2YB1 A;  4Z6F A;  3NRZ A;  3PW2 A;  4F50 A;  2KHV A;  4B6J A;  3H4D A;  3B0X A;  3H8J A;  3L5K A;  4F3O A;  3ISB A;  4QZF A;  3DEE A;  5ALO A;  2W9B A;  4KLJ A;  4Y2U A;  9ICG A;  2Y9T A;  2A1A A;  2JGA A;  1PZN A;  4DO9 A;  1SL0 A;  2JEF A;  2ZXI A;  1A0P A;  5KFD A;  4RT3 A;  2AQ0 A;  3RTV A;  3QNM A;  4ECZ A;  3T3F A;  2JZB A;  1GO3 F;  3PX6 A;  1TAQ A;  4Y2T A;  4RQ1 A;  1ZQI A;  3GIM A;  3PW5 A;  5J29 A;  3LYS A;  2IOF A;  4O5C A;  1WWU A;  4QW9 A;  2E1F A;  4JV2 A;  4F5O A;  1OW5 A;  2WF8 A;  2OCE A;  5III A;  5IIN A;  1RQN A;  2VA2 A;  1S76 D;  5BOL A;  3G6X A;  1QH9 A;  2EZX A;  2PFP A;  1S10 A;  2KKP A;  4ZOH C;  2HHW A;  1ZQV A;  2VIX A;  1T4G A;  1Q3V A;  2KD1 A;  2HHS A;  2RQ5 A;  3L3F X;  4KIT B;  4MEX A;  1WUD A;  2FLN A;  5KG6 A;  1BGX T;  4IQU A;  5L9X A;  2C2R A;  3QU9 A;  3GIJ A;  4YR2 A;  8ICZ A;  1A77 A;  1L5U A;  4RNO A;  4MEY A;  5DB7 A;  4GXK A;  4UAU A;  2W3R A;  4PHA A;  1V85 A;  2NO4 A;  2IHN A;  3QEB Z;  1HUZ A;  2W7O A;  4YQW A;  4QZH A;  1TE2 A;  3QUQ A;  1RQL A;  1LV5 A;  3TAC B;  4I2E A;  8ICQ A;  1QSS A;  3RJF A;  3HRD D;  1WG8 A;  2KFN A;  4I2A A;  4J9K A;  2YTU A;  3TAP A;  5ALE A;  2H3F A;  2B6G A;  2W11 A;  2A3V A;  4O3O A;  3M6K A;  1BPY A;  4GXJ A;  8ICK A;  3ONN A;  3HW8 A;  1RYR A;  4F4K A;  1KFT A;  5AK6 A;  3PSI A;  2AU0 A;  4PGQ A;  5KFV A;  2ZTE A;  2HBJ A;  1L7P A;  5L1L A;  4M6W A;  2M0N A;  3TFS A;  3H4B A;  7ICG A;  5DB9 A;  3OPX A;  3BQT A;  2EZY A;  4HAI A;  3VC8 A;  4YMM A;  1M6Y A;  1L3U A;  4RQM A;  1L6N A;  1N48 A;  2ZJ5 A;  3GU3 A;  1Z4N A;  2HOQ A;  4LZG A;  4QNL A;  2LBO A;  4FZM A;  2Q4T A;  5L1I A;  1ZQM A;  1N61 A;  4QZA A;  2OWO A;  2W7P A;  1ZD3 A;  4F4Z A;  2OH2 A;  4OO1 J;  4RQ6 A;  9ICJ A;  4B9S A;  5D49 A;  1BPZ A;  4EX6 A;  4K4H A;  3UXP A;  3UMB A;  5EE3 A;  4ED1 A;  3T79 A;  4PHP A;  5G5G A;  1NJY A;  4PHE A;  3JPS A;  2YB4 A;  1MC8 A;  1TAU A;  4C7Y A;  5EWG A;  3D2S A;  3MAB A;  5J0W A;  4FBT A;  4C4S A;  7ICN A;  4GFJ A;  4YD2 A;  1T3Q A;  1ZQ1 C;  4YXM A;  4DQP A;  7ICS A;  1PK1 A;  2P6R A;  3SV3 A;  2ZJA A;  1V9P A;  4BWJ A;  2NO5 A;  5ALD A;  2J6S A;  1PVR A;  9ICV A;  1RYS A;  1NZB A;  4EEK A;  5KFU A;  8ICR A;  4Z6E A;  5L1J A;  2FPK A;  7ICR A;  2LMR A;  4I2I A;  3LK9 A;  4J9N A;  1ZQK A;  2F2A B;  4ECU A;  5DQG A;  2DL0 A;  2OEH A;  1BNP A;  2FE9 A;  2MRL A;  1XSP A;  1Q8K A;  2AH5 A;  4J03 A;  1U48 A;  4BXO B;  4KN4 A;  2ZIU A;  5KAI U;  3TAR A;  2LM1 A;  1SL2 A;  1COK A;  2LYA A;  4YXJ A;  1JIH A;  5A0L A;  2YN4 A;  4J9L A;  4B9L A; 
#chains in the Genus database with same CATH homology
 5GTH U;  3KZI U;  5E79 U;  5GTI U;  1S5L U;  4UB8 U;  4PJ0 U;  4UB6 U;  2DUY A;  5KAI U;  3WU2 U;  5H2F U;  5KAF U;  3A0B U;  5B5E U;  4IL6 U;  2AXT U;  5B66 U;  5TIS U;  3A0H U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...