5H2WA

Crystal structure of the karyopherin kap60p bound to the sumo protease ulp1p (150-340)
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
421
structure length
416
Chain Sequence
LPQMTQQLNSDDMQEQLSATVKFRQILSREHRPPIDVVIQAGVVPRLVEFMRENQPEMLQLEAAWALTNIASGTSAQTKVVVDADAVPLFIQLLYTGSVEVKEQAIWALGNVAGDSTDYRDYVLQCNAMEPILGLFNSNKPSLIRTATWTLSNLCRGKKPQPDWSVVSQALPTLAKLIYSMDTETLVDACWAISYLSDGPQEAIQAVIDVRIPKRLVELLSHESTLVQTPALRAVGNIVTGNDLQTQVVINAGVLPALRLLLSSPKENIKKEACWTISNITAGNTEQIQAVIDANLIPPLVKLLEVAEYKTKKEACWAISNASSGGLQRPDIIRYLVSQGCIKPLCDLLEIADNRIIEVTLDALENILKMGEADKEANENADFIEKAGGMEKIFNCQQNENDKIYEKAYKIIETYF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Importin subunit alpha
publication title Structures of the Karyopherins Kap121p and Kap60p Bound to the Nuclear Pore-Targeting Domain of the SUMO Protease Ulp1p
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Protein transport/hydrolase
total genus 161
structure length 416
sequence length 421
chains with identical sequence C
ec nomenclature
pdb deposition date 2016-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00514 Arm Armadillo/beta-catenin-like repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.10.10 Mainly Alpha Alpha Horseshoe Leucine-rich Repeat Variant Leucine-rich Repeat Variant 5h2wA00
1GCJA 3PSPA 3GQ2A 3V6YA 3C2HA 3K7WA 4I2WA 1Q1SC 1O6PA 4IMJA 4YK6A 4HTVA 2Z5JA 2X1GF 3BX2A 1G3JA 3Q0NA 5EKGA 3BCTA 3FEXC 4EVTA 5BZ5A 3DADA 4BQKA 3K49A 3A6PA 4XZRB 4U54A 3VWAA 1XM9A 3Q5UA 5KL8A 3WOZA 2XA7B 2Z5NA 3Q0LA 4DZSA 3OUWA 4EV9A 5LSWA 4EVPA 2YNSA 5KLRB 3RZ9A 5JJAA 1EE5A 5KLAA 2DB0A 4B8JA 2QNAA 3ZINA 4ZDUA 5E6QB 4CRUB 4L7MA 2GL7A 4E4VA 4PLSA 4DB9A 4RV1A 1LRVA 3BSXA 3IBVA 1M5NS 1U6GC 2X19B 2FV2A 1M8XA 3BWTA 4D4EA 3ZIQA 4U5UA 2IE4A 4EV8A 3IFQA 3NMWA 5EWPA 3K5YA 3L3FX 1EJYI 4PLRA 3V71A 5D5KC 4GMNA 2JAKA 3T7UA 4YJEA 4R10A 4U58A 3TPOA 1IBRB 3Q0SA 1M8YA 4LACA 3WYFC 3GB8A 3BSBA 4K6JA 5BYMA 2Z5MA 3UKYB 2JDQA 3Q0OA 4CB9A 2C1TA 4YJLA 3VE6A 3ND2A 4V3RA 1I7XA 3K5QA 4DBAA 5CTTA 3TJ3A 4DVGB 5EKFA 4G3AA 2Z5OA 3WPTA 4HXTA 3DW8A 1Z2CB 4B18A 3H3DX 1QBKB 4U5NA 4RXHB 2BAPA 1OYZA 4R0ZA 4FZFA 4I2ZA 3UVUA 1B3UA 4O27A 1QZ7A 4HNMA 5BZVA 4KZGA 3OPBA 5BZUA 4CBAA 1Q1TC 2IX3A 3RZXA 1M1EA 3LTJA 5K6SA 4PLQA 3BTRC 2PF4A 2PKGA 2QMRA 3ODRA 4U5OA 3BX3A 3ODSA 1M8ZA 1TH1A 3O2TA 3L3QA 2NPPA 4DB6A 4JW2B 4D49A 4WV6A 1V18A 3ZIOA 4BA3A 2F31A 1BK6A 3EBBA 2NYLA 4TNMA 3L6YA 3ZIRA 1W63A 4QMJA 3GVOA 4U5LA 5SVZA 2H4MA 2Z6GA 4MFUA 1XQSA 1PJNB 5SWFA 4A0CA 5H2WA 3UKWB 3C2GA 3Q0RA 3K62A 4U5VA 3WOYA 5KLTB 2QK1A 3GS3A 4H3KA 1T08A 1XQRA 5J3VA 4QMIA 4ADYA 2NPPB 4BPLA 3QHEA 3K4EA 2WTKA 3GVTA 2C1MA 4H3HA 3GRLA 4NEEA 5DN7A 4OIHA 3K61A 2NYLB 4R11A 2YJYA 4MZ5E 2Z6HA 1W63B 3NOWA 2Z5KA 3GNIA 3QMLC 3PSTA 3OUXA 4B8PA 5H2XA 1M8WA 4UADA 3TT9A 4B8OA 4HM9A 5FC8E 3QG9A 3O2QA 4CT6B 2IAEA 1UN0A 3UL0B 2IWHA 2YNRA 4YGXA 3L6XA 4MFVA 4I5LA 4CV5B 3ZKVA 1EJLI 4JLQA 3FGAA 3Q0PA 1O6OA 3K5ZA 5B56A 2NYMA 2OT8A 3GAEA 1IALA 1QGRA 3LWWA 2P8QA 3TX7A 3ZHPA 1BK5A 4NZWA 1Y2AC 3NMXA 1IB2A 3NMZA 1W9CA 2IAEB 3EA5B 4FZDA 3K7VA 5SW9A 4PVZA 4I5NA 3TJZB 4UAEA 4GMOA 1IQ1C 2JKRA 1UPKA 1UKLA 1JPPA 1I7WA 2VGLA 3V74A 3OQSA 1F59A 1HO8A 2OF3A 4CB8A 2Q5DA 5HUWC 3Q0QA 3FGAB 2BCTA 3FEYC 4U5SA 4YI0C 2W3CA 2NYMB 3AU3A 4QMHA 2JKTA 3W3UA 5AEIA 4MZ6E 4UWXA 4K92A 4U3JC 4FFBC 1WA5B 4OO6A 3UL1B 4FQ3A 3O4XA 5KL1A 5HUYC 2JKRB 3Q0MA 3O2SA 2VGLB 4UAFB 4EVAA 2BNXA 4CRVB 2RU4A 2IW3A 3LTMA 1LUJA 2QK2A 4UQIA 4P6ZB 3QGBA 1EE4A 4P6ZG 2JKTB 1JDHA 3QGCA 4IMIA 4DB8A 3C5WA 4Y5JA 1PJMB 1JPWA 1WA5C 4FZAA 3EG5B 4RZPA 4FDDA 5BZ1A 3K64A 4V3QA 4CT7B 3TPMA 2BKUB 3UKZB 2RU4B 5K9SA 1UPLA 4V3OA 4DJSA 2IE3A 3UKXB 4UQIB 3ZIPA 5HHGE 3OBVA 3KNDA 1QGKA 2XA7A
chains in the Genus database with same CATH superfamily
1GCJA 3PSPA 3GQ2A 3V6YA 3C2HA 3K7WA 4I2WA 1Q1SC 1O6PA 4IMJA 4YK6A 4HTVA 2Z5JA 2X1GF 3VLEA 3BX2A 1G3JA 3Q0NA 1LSHA 5EKGA 3BCTA 3BVSA 3FEXC 4EVTA 5BZ5A 3DADA 4BQKA 3K49A 3A6PA 4XZRB 4U54A 3VWAA 1XM9A 3Q5UA 5KL8A 3WOZA 2XA7B 2Z5NA 3Q0LA 4DZSA 3OUWA 4EV9A 4FP7A 3SLAA 5LSWA 4EVPA 2YNSA 4I2SA 5KLRB 3RZ9A 5JJAA 1EE5A 5KLAA 2DB0A 4B8JA 2QNAA 3ZINA 4ZDUA 5E6QB 4CRUB 4L7MA 2GL7A 4E4VA 4PLSA 4DB9A 4RV1A 3UJ0A 1LRVA 3BSXA 3IBVA 1M5NS 1U6GC 2X19B 2FV2A 1M8XA 3BWTA 4I1EA 4D4EA 3ZIQA 5CL6A 4I6IA 4U5UA 2IE4A 4EV8A 3IFQA 3NMWA 5EWPA 3K5YA 3L3FX 1EJYI 4PLRA 3V71A 5D5KC 4GMNA 5CL8A 2JAKA 3T7UA 4I7IA 4YJEA 4R10A 4U58A 3TPOA 1IBRB 3Q0SA 1M8YA 4LACA 3WYFC 3GB8A 3BSBA 4K6JA 5BYMA 2Z5MA 3UKYB 4U2XD 2JDQA 3Q0OA 4CB9A 2C1TA 4YJLA 3VE6A 5CL7A 3ND2A 4V3RA 1I7XA 3K5QA 4DBAA 5CTTA 3TJ3A 4DVGB 5EKFA 4G3AA 2Z5OA 3WPTA 4HXTA 3DW8A 1Z2CB 4B18A 3H3DX 4JW2A 1QBKB 4U5NA 3T8SA 4RXHB 2BAPA 5CLBA 4JKQA 1OYZA 4R0ZA 4FZFA 1N4KA 4I2ZA 3UVUA 1B3UA 4O27A 1QZ7A 4HNMA 5BZVA 4KZGA 3OPBA 5BZUA 4CBAA 1Q1TC 3UJ4A 2IX3A 3RZXA 1M1EA 3LTJA 5K6SA 4PLQA 3BTRC 2PF4A 2PKGA 2QMRA 3ODRA 1TE4A 4U5OA 3BX3A 3ODSA 1M8ZA 1TH1A 3O2TA 3L3QA 2NPPA 4I96A 4DB6A 3JXYA 4JW2B 4D49A 4WV6A 1V18A 3ZIOA 4BA3A 2F31A 1BK6A 3EBBA 2NYLA 4TNMA 3L6YA 3ZIRA 1W63A 4QMJA 3GVOA 4U5LA 5SVZA 2H4MA 2Z6GA 4MFUA 1XQSA 1PJNB 5SWFA 4A0CA 5H2WA 3UKWB 3C2GA 3Q0RA 3VLDA 3K62A 3ZILA 4U5VA 3WOYA 3JX7A 5KLTB 2QK1A 3GS3A 4H3KA 1T08A 1XQRA 5J3VA 4QMIA 2XOAA 4L4HA 3SL9A 4ADYA 2NPPB 4BPLA 3QHEA 3K4EA 2WTKA 3GVTA 5KUBA 2C1MA 4H3HA 3GRLA 4NEEA 5DN7A 4OIHA 3K61A 3VLFA 2NYLB 4R11A 2YJYA 4MZ5E 2Z6HA 1W63B 3NOWA 2Z5KA 3GNIA 3QMLC 3PSTA 3OUXA 4B8PA 5H2XA 4A3VA 1M8WA 4UADA 3TT9A 4B8OA 4HM9A 5FC8E 3QG9A 3O2QA 4CT6B 3ZIKA 5CL4A 2IAEA 1UN0A 3UL0B 2IWHA 2YNRA 4YGXA 3L6XA 4MFVA 4I5LA 4CV5B 3ZKVA 1EJLI 4JLQA 3FGAA 3Q0PA 1O6OA 3K5ZA 5B56A 2NYMA 2OT8A 3GAEA 1IALA 1QGRA 3LWWA 2P8QA 3TX7A 3ZHPA 1BK5A 4NZWA 1Y2AC 3NMXA 1IB2A 3NMZA 5CLEA 1W9CA 2IAEB 3EA5B 4FZDA 5CL9A 3K7VA 5SW9A 4PVZA 4I3NA 4I5NA 3TJZB 5CLCA 4UAEA 4I37A 4GMOA 1IQ1C 2JKRA 1UPKA 1UKLA 1JPPA 1I7WA 2VGLA 3V74A 3OQSA 1F59A 4A3TA 1HO8A 2OF3A 4CB8A 2Q5DA 5HUWC 5CLDA 3Q0QA 3FGAB 2BCTA 3FEYC 4U5SA 4YI0C 2W3CA 2NYMB 3AU3A 4QMHA 2JKTA 3W3UA 3JXZA 5AEIA 4MZ6E 4UWXA 4K92A 4U3JC 4FFBC 1WA5B 4OO6A 3UL1B 4FQ3A 3O4XA 5KL1A 5HUYC 2JKRB 3Q0MA 3O2SA 2VGLB 4UAFB 5CLAA 4EVAA 2BNXA 4CRVB 2RU4A 2IW3A 3LTMA 1LUJA 2QK2A 5CL5A 4UQIA 4P6ZB 3QGBA 1EE4A 4P6ZG 2JKTB 1JDHA 3QGCA 4IMIA 4DB8A 3C5WA 4Y5JA 4I0YA 1PJMB 4L4IA 3JY1A 1JPWA 1WA5C 4FZAA 3EG5B 4I8MA 4RZPA 4FDDA 5BZ1A 3K64A 4V3QA 4CT7B 3TPMA 2BKUB 4JW3C 3UKZB 2RU4B 5K9SA 1UPLA 4V3OA 4DJSA 2IE3A 3UKXB 4UQIB 3ZIPA 5HHGE 5CL3A 3OBVA 3KNDA 1QGKA 2XA7A
chains in the Genus database with same CATH topology
1GCJA 3PSPA 3GQ2A 3V6YA 3C2HA 3K7WA 4I2WA 1Q1SC 1O6PA 4IMJA 4YK6A 4HTVA 2Z5JA 2X1GF 3VLEA 3BX2A 1G3JA 3Q0NA 5EKGA 3BCTA 3BVSA 3FEXC 4EVTA 5BZ5A 3DADA 4BQKA 3K49A 3A6PA 4XZRB 4U54A 3VWAA 1XM9A 3Q5UA 5KL8A 3WOZA 2XA7B 2Z5NA 3Q0LA 4DZSA 3OUWA 4EV9A 4FP7A 3SLAA 5LSWA 4EVPA 2YNSA 4I2SA 5KLRB 3RZ9A 5JJAA 1EE5A 5KLAA 2DB0A 4B8JA 2QNAA 3ZINA 4ZDUA 5E6QB 4CRUB 4L7MA 2GL7A 4E4VA 4PLSA 4DB9A 4RV1A 1LRVA 3BSXA 3IBVA 1M5NS 1U6GC 2X19B 2FV2A 1M8XA 3BWTA 4I1EA 4D4EA 3ZIQA 5CL6A 4I6IA 4U5UA 2IE4A 4EV8A 3IFQA 3NMWA 5EWPA 3K5YA 3L3FX 1EJYI 4PLRA 3V71A 5D5KC 4GMNA 5CL8A 2JAKA 3T7UA 4I7IA 4YJEA 4R10A 4U58A 3TPOA 1IBRB 3Q0SA 1M8YA 4LACA 3WYFC 3GB8A 3BSBA 4K6JA 5BYMA 2Z5MA 3UKYB 4U2XD 2JDQA 3Q0OA 4CB9A 2C1TA 4YJLA 3VE6A 5CL7A 3ND2A 4V3RA 1I7XA 3K5QA 4DBAA 5CTTA 3TJ3A 4DVGB 5EKFA 4G3AA 2Z5OA 3WPTA 4HXTA 3DW8A 1Z2CB 4B18A 3H3DX 4JW2A 1QBKB 4U5NA 4RXHB 2BAPA 5CLBA 4JKQA 1OYZA 4R0ZA 4FZFA 4I2ZA 3UVUA 1B3UA 4O27A 1QZ7A 4HNMA 5BZVA 4KZGA 3OPBA 5BZUA 4CBAA 1Q1TC 2IX3A 3RZXA 1M1EA 3LTJA 5K6SA 4PLQA 3BTRC 2PF4A 2PKGA 2QMRA 3ODRA 1TE4A 4U5OA 3BX3A 3ODSA 1M8ZA 1TH1A 3O2TA 3L3QA 2NPPA 4I96A 4DB6A 3JXYA 4JW2B 4D49A 4WV6A 1V18A 3ZIOA 4BA3A 2F31A 1BK6A 3EBBA 2NYLA 4TNMA 3L6YA 3ZIRA 1W63A 4QMJA 3GVOA 4U5LA 5SVZA 2H4MA 2Z6GA 4MFUA 1XQSA 1PJNB 5SWFA 4A0CA 5H2WA 3UKWB 3C2GA 3Q0RA 3VLDA 3K62A 3ZILA 4U5VA 3WOYA 3JX7A 5KLTB 2QK1A 3GS3A 4H3KA 1T08A 1XQRA 5J3VA 4QMIA 2XOAA 4L4HA 3SL9A 4ADYA 2NPPB 4BPLA 3QHEA 3K4EA 2WTKA 3GVTA 5KUBA 2C1MA 4H3HA 3GRLA 4NEEA 5DN7A 4OIHA 3K61A 3VLFA 2NYLB 4R11A 2YJYA 4MZ5E 2Z6HA 1W63B 3NOWA 2Z5KA 3GNIA 3QMLC 3PSTA 3OUXA 4B8PA 5H2XA 4A3VA 1M8WA 4UADA 3TT9A 4B8OA 4HM9A 5FC8E 3QG9A 3O2QA 4CT6B 3ZIKA 5CL4A 2IAEA 1UN0A 3UL0B 2IWHA 2YNRA 4YGXA 3L6XA 4MFVA 4I5LA 4CV5B 3ZKVA 1EJLI 4JLQA 3FGAA 3Q0PA 1O6OA 3K5ZA 5B56A 2NYMA 2OT8A 3GAEA 1IALA 1QGRA 3LWWA 2P8QA 3TX7A 3ZHPA 1BK5A 4NZWA 1Y2AC 3NMXA 1IB2A 3NMZA 5CLEA 1W9CA 2IAEB 3EA5B 4FZDA 5CL9A 3K7VA 5SW9A 4PVZA 4I3NA 4I5NA 3TJZB 5CLCA 4UAEA 4I37A 4GMOA 1IQ1C 2JKRA 1UPKA 1UKLA 1JPPA 1I7WA 2VGLA 3V74A 3OQSA 1F59A 4A3TA 1HO8A 2OF3A 4CB8A 2Q5DA 5HUWC 5CLDA 3Q0QA 3FGAB 2BCTA 3FEYC 4U5SA 4YI0C 2W3CA 2NYMB 3AU3A 4QMHA 2JKTA 3W3UA 3JXZA 5AEIA 4MZ6E 4UWXA 4K92A 4U3JC 4FFBC 1WA5B 4OO6A 3UL1B 4FQ3A 3O4XA 5KL1A 5HUYC 2JKRB 3Q0MA 3O2SA 2VGLB 4UAFB 5CLAA 4EVAA 2BNXA 4CRVB 2RU4A 2IW3A 3LTMA 1LUJA 2QK2A 5CL5A 4UQIA 4P6ZB 3QGBA 1EE4A 4P6ZG 2JKTB 1JDHA 3QGCA 4IMIA 4DB8A 3C5WA 4Y5JA 4I0YA 1PJMB 4L4IA 3JY1A 1JPWA 1WA5C 4FZAA 3EG5B 4I8MA 4RZPA 4FDDA 5BZ1A 3K64A 4V3QA 4CT7B 3TPMA 2BKUB 4JW3C 3UKZB 2RU4B 5K9SA 1UPLA 4V3OA 4DJSA 2IE3A 3UKXB 4UQIB 3ZIPA 5HHGE 5CL3A 3OBVA 3KNDA 1QGKA 2XA7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GCJ A;  3PSP A;  3GQ2 A;  3V6Y A;  3C2H A;  3K7W A;  4I2W A;  1Q1S C;  1O6P A;  4IMJ A;  4YK6 A;  4HTV A;  2Z5J A;  2X1G F;  3BX2 A;  1G3J A;  3Q0N A;  5EKG A;  3BCT A;  3FEX C;  4EVT A;  5BZ5 A;  3DAD A;  4BQK A;  3K49 A;  3A6P A;  4XZR B;  4U54 A;  3VWA A;  1XM9 A;  3Q5U A;  5KL8 A;  3WOZ A;  2XA7 B;  2Z5N A;  3Q0L A;  4DZS A;  3OUW A;  4EV9 A;  5LSW A;  4EVP A;  2YNS A;  5KLR B;  3RZ9 A;  5JJA A;  1EE5 A;  5KLA A;  2DB0 A;  4B8J A;  2QNA A;  3ZIN A;  4ZDU A;  5E6Q B;  4CRU B;  4L7M A;  2GL7 A;  4E4V A;  4PLS A;  4DB9 A;  4RV1 A;  1LRV A;  3BSX A;  3IBV A;  1M5N S;  1U6G C;  2X19 B;  2FV2 A;  1M8X A;  3BWT A;  4D4E A;  3ZIQ A;  4U5U A;  2IE4 A;  4EV8 A;  3IFQ A;  3NMW A;  5EWP A;  3K5Y A;  3L3F X;  1EJY I;  4PLR A;  3V71 A;  5D5K C;  4GMN A;  2JAK A;  3T7U A;  4YJE A;  4R10 A;  4U58 A;  3TPO A;  1IBR B;  3Q0S A;  1M8Y A;  4LAC A;  3WYF C;  3GB8 A;  3BSB A;  4K6J A;  5BYM A;  2Z5M A;  3UKY B;  2JDQ A;  3Q0O A;  4CB9 A;  2C1T A;  4YJL A;  3VE6 A;  3ND2 A;  4V3R A;  1I7X A;  3K5Q A;  4DBA A;  5CTT A;  3TJ3 A;  4DVG B;  5EKF A;  4G3A A;  2Z5O A;  3WPT A;  4HXT A;  3DW8 A;  1Z2C B;  4B18 A;  3H3D X;  1QBK B;  4U5N A;  4RXH B;  2BAP A;  1OYZ A;  4R0Z A;  4FZF A;  4I2Z A;  3UVU A;  1B3U A;  4O27 A;  1QZ7 A;  4HNM A;  5BZV A;  4KZG A;  3OPB A;  5BZU A;  4CBA A;  1Q1T C;  2IX3 A;  3RZX A;  1M1E A;  3LTJ A;  5K6S A;  4PLQ A;  3BTR C;  2PF4 A;  2PKG A;  2QMR A;  3ODR A;  4U5O A;  3BX3 A;  3ODS A;  1M8Z A;  1TH1 A;  3O2T A;  3L3Q A;  2NPP A;  4DB6 A;  4JW2 B;  4D49 A;  4WV6 A;  1V18 A;  3ZIO A;  4BA3 A;  2F31 A;  1BK6 A;  3EBB A;  2NYL A;  4TNM A;  3L6Y A;  3ZIR A;  1W63 A;  4QMJ A;  3GVO A;  4U5L A;  5SVZ A;  2H4M A;  2Z6G A;  4MFU A;  1XQS A;  1PJN B;  5SWF A;  4A0C A;  5H2W A;  3UKW B;  3C2G A;  3Q0R A;  3K62 A;  4U5V A;  3WOY A;  5KLT B;  2QK1 A;  3GS3 A;  4H3K A;  1T08 A;  1XQR A;  5J3V A;  4QMI A;  4ADY A;  2NPP B;  4BPL A;  3QHE A;  3K4E A;  2WTK A;  3GVT A;  2C1M A;  4H3H A;  3GRL A;  4NEE A;  5DN7 A;  4OIH A;  3K61 A;  2NYL B;  4R11 A;  2YJY A;  4MZ5 E;  2Z6H A;  1W63 B;  3NOW A;  2Z5K A;  3GNI A;  3QML C;  3PST A;  3OUX A;  4B8P A;  5H2X A;  1M8W A;  4UAD A;  3TT9 A;  4B8O A;  4HM9 A;  5FC8 E;  3QG9 A;  3O2Q A;  4CT6 B;  2IAE A;  1UN0 A;  3UL0 B;  2IWH A;  2YNR A;  4YGX A;  3L6X A;  4MFV A;  4I5L A;  4CV5 B;  3ZKV A;  1EJL I;  4JLQ A;  3FGA A;  3Q0P A;  1O6O A;  3K5Z A;  5B56 A;  2NYM A;  2OT8 A;  3GAE A;  1IAL A;  1QGR A;  3LWW A;  2P8Q A;  3TX7 A;  3ZHP A;  1BK5 A;  4NZW A;  1Y2A C;  3NMX A;  1IB2 A;  3NMZ A;  1W9C A;  2IAE B;  3EA5 B;  4FZD A;  3K7V A;  5SW9 A;  4PVZ A;  4I5N A;  3TJZ B;  4UAE A;  4GMO A;  1IQ1 C;  2JKR A;  1UPK A;  1UKL A;  1JPP A;  1I7W A;  2VGL A;  3V74 A;  3OQS A;  1F59 A;  1HO8 A;  2OF3 A;  4CB8 A;  2Q5D A;  5HUW C;  3Q0Q A;  3FGA B;  2BCT A;  3FEY C;  4U5S A;  4YI0 C;  2W3C A;  2NYM B;  3AU3 A;  4QMH A;  2JKT A;  3W3U A;  5AEI A;  4MZ6 E;  4UWX A;  4K92 A;  4U3J C;  4FFB C;  1WA5 B;  4OO6 A;  3UL1 B;  4FQ3 A;  3O4X A;  5KL1 A;  5HUY C;  2JKR B;  3Q0M A;  3O2S A;  2VGL B;  4UAF B;  4EVA A;  2BNX A;  4CRV B;  2RU4 A;  2IW3 A;  3LTM A;  1LUJ A;  2QK2 A;  4UQI A;  4P6Z B;  3QGB A;  1EE4 A;  4P6Z G;  2JKT B;  1JDH A;  3QGC A;  4IMI A;  4DB8 A;  3C5W A;  4Y5J A;  1PJM B;  1JPW A;  1WA5 C;  4FZA A;  3EG5 B;  4RZP A;  4FDD A;  5BZ1 A;  3K64 A;  4V3Q A;  4CT7 B;  3TPM A;  2BKU B;  3UKZ B;  2RU4 B;  5K9S A;  1UPL A;  4V3O A;  4DJS A;  2IE3 A;  3UKX B;  4UQI B;  3ZIP A;  5HHG E;  3OBV A;  3KND A;  1QGK A;  2XA7 A; 
#chains in the Genus database with same CATH topology
 1GCJ A;  3PSP A;  3GQ2 A;  3V6Y A;  3C2H A;  3K7W A;  4I2W A;  1Q1S C;  1O6P A;  4IMJ A;  4YK6 A;  4HTV A;  2Z5J A;  2X1G F;  3VLE A;  3BX2 A;  1G3J A;  3Q0N A;  1LSH A;  5EKG A;  3BCT A;  3BVS A;  3FEX C;  4EVT A;  5BZ5 A;  3DAD A;  4BQK A;  3K49 A;  3A6P A;  4XZR B;  4U54 A;  3VWA A;  1XM9 A;  3Q5U A;  5KL8 A;  3WOZ A;  2XA7 B;  2Z5N A;  3Q0L A;  4DZS A;  3OUW A;  4EV9 A;  4FP7 A;  3SLA A;  5LSW A;  4EVP A;  2YNS A;  4I2S A;  5KLR B;  3RZ9 A;  5JJA A;  1EE5 A;  5KLA A;  2DB0 A;  4B8J A;  2QNA A;  3ZIN A;  4ZDU A;  5E6Q B;  4CRU B;  4L7M A;  2GL7 A;  4E4V A;  4PLS A;  4DB9 A;  4RV1 A;  3UJ0 A;  1LRV A;  3BSX A;  3IBV A;  1M5N S;  1U6G C;  2X19 B;  2FV2 A;  1M8X A;  3BWT A;  4I1E A;  4D4E A;  3ZIQ A;  5CL6 A;  4I6I A;  4U5U A;  2IE4 A;  4EV8 A;  3IFQ A;  3NMW A;  5EWP A;  3K5Y A;  3L3F X;  1EJY I;  4PLR A;  3V71 A;  5D5K C;  4GMN A;  5CL8 A;  2JAK A;  3T7U A;  4I7I A;  4YJE A;  4R10 A;  4U58 A;  3TPO A;  1IBR B;  3Q0S A;  1M8Y A;  4LAC A;  3WYF C;  3GB8 A;  3BSB A;  4K6J A;  5BYM A;  2Z5M A;  3UKY B;  4U2X D;  2JDQ A;  3Q0O A;  4CB9 A;  2C1T A;  4YJL A;  3VE6 A;  5CL7 A;  3ND2 A;  4V3R A;  1I7X A;  3K5Q A;  4DBA A;  5CTT A;  3TJ3 A;  4DVG B;  5EKF A;  4G3A A;  2Z5O A;  3WPT A;  4HXT A;  3DW8 A;  1Z2C B;  4B18 A;  3H3D X;  4JW2 A;  1QBK B;  4U5N A;  3T8S A;  4RXH B;  2BAP A;  5CLB A;  4JKQ A;  1OYZ A;  4R0Z A;  4FZF A;  1N4K A;  4I2Z A;  3UVU A;  1B3U A;  4O27 A;  1QZ7 A;  4HNM A;  5BZV A;  4KZG A;  3OPB A;  5BZU A;  4CBA A;  1Q1T C;  3UJ4 A;  2IX3 A;  3RZX A;  1M1E A;  3LTJ A;  5K6S A;  4PLQ A;  3BTR C;  2PF4 A;  2PKG A;  2QMR A;  3ODR A;  1TE4 A;  4U5O A;  3BX3 A;  3ODS A;  1M8Z A;  1TH1 A;  3O2T A;  3L3Q A;  2NPP A;  4I96 A;  4DB6 A;  3JXY A;  4JW2 B;  4D49 A;  4WV6 A;  1V18 A;  3ZIO A;  4BA3 A;  2F31 A;  1BK6 A;  3EBB A;  2NYL A;  4TNM A;  3L6Y A;  3ZIR A;  1W63 A;  4QMJ A;  3GVO A;  4U5L A;  5SVZ A;  2H4M A;  2Z6G A;  4MFU A;  1XQS A;  1PJN B;  5SWF A;  4A0C A;  5H2W A;  3UKW B;  3C2G A;  3Q0R A;  3VLD A;  3K62 A;  3ZIL A;  4U5V A;  3WOY A;  3JX7 A;  5KLT B;  2QK1 A;  3GS3 A;  4H3K A;  1T08 A;  1XQR A;  5J3V A;  4QMI A;  2XOA A;  4L4H A;  3SL9 A;  4ADY A;  2NPP B;  4BPL A;  3QHE A;  3K4E A;  2WTK A;  3GVT A;  5KUB A;  2C1M A;  4H3H A;  3GRL A;  4NEE A;  5DN7 A;  4OIH A;  3K61 A;  3VLF A;  2NYL B;  4R11 A;  2YJY A;  4MZ5 E;  2Z6H A;  1W63 B;  3NOW A;  2Z5K A;  3GNI A;  3QML C;  3PST A;  3OUX A;  4B8P A;  5H2X A;  4A3V A;  1M8W A;  4UAD A;  3TT9 A;  4B8O A;  4HM9 A;  5FC8 E;  3QG9 A;  3O2Q A;  4CT6 B;  3ZIK A;  5CL4 A;  2IAE A;  1UN0 A;  3UL0 B;  2IWH A;  2YNR A;  4YGX A;  3L6X A;  4MFV A;  4I5L A;  4CV5 B;  3ZKV A;  1EJL I;  4JLQ A;  3FGA A;  3Q0P A;  1O6O A;  3K5Z A;  5B56 A;  2NYM A;  2OT8 A;  3GAE A;  1IAL A;  1QGR A;  3LWW A;  2P8Q A;  3TX7 A;  3ZHP A;  1BK5 A;  4NZW A;  1Y2A C;  3NMX A;  1IB2 A;  3NMZ A;  5CLE A;  1W9C A;  2IAE B;  3EA5 B;  4FZD A;  5CL9 A;  3K7V A;  5SW9 A;  4PVZ A;  4I3N A;  4I5N A;  3TJZ B;  5CLC A;  4UAE A;  4I37 A;  4GMO A;  1IQ1 C;  2JKR A;  1UPK A;  1UKL A;  1JPP A;  1I7W A;  2VGL A;  3V74 A;  3OQS A;  1F59 A;  4A3T A;  1HO8 A;  2OF3 A;  4CB8 A;  2Q5D A;  5HUW C;  5CLD A;  3Q0Q A;  3FGA B;  2BCT A;  3FEY C;  4U5S A;  4YI0 C;  2W3C A;  2NYM B;  3AU3 A;  4QMH A;  2JKT A;  3W3U A;  3JXZ A;  5AEI A;  4MZ6 E;  4UWX A;  4K92 A;  4U3J C;  4FFB C;  1WA5 B;  4OO6 A;  3UL1 B;  4FQ3 A;  3O4X A;  5KL1 A;  5HUY C;  2JKR B;  3Q0M A;  3O2S A;  2VGL B;  4UAF B;  5CLA A;  4EVA A;  2BNX A;  4CRV B;  2RU4 A;  2IW3 A;  3LTM A;  1LUJ A;  2QK2 A;  5CL5 A;  4UQI A;  4P6Z B;  3QGB A;  1EE4 A;  4P6Z G;  2JKT B;  1JDH A;  3QGC A;  4IMI A;  4DB8 A;  3C5W A;  4Y5J A;  4I0Y A;  1PJM B;  4L4I A;  3JY1 A;  1JPW A;  1WA5 C;  4FZA A;  3EG5 B;  4I8M A;  4RZP A;  4FDD A;  5BZ1 A;  3K64 A;  4V3Q A;  4CT7 B;  3TPM A;  2BKU B;  4JW3 C;  3UKZ B;  2RU4 B;  5K9S A;  1UPL A;  4V3O A;  4DJS A;  2IE3 A;  3UKX B;  4UQI B;  3ZIP A;  5HHG E;  5CL3 A;  3OBV A;  3KND A;  1QGK A;  2XA7 A; 
#chains in the Genus database with same CATH homology
 1GCJ A;  3PSP A;  3GQ2 A;  3V6Y A;  3C2H A;  3K7W A;  4I2W A;  1Q1S C;  1O6P A;  4IMJ A;  4YK6 A;  4HTV A;  2Z5J A;  2X1G F;  3VLE A;  3BX2 A;  1G3J A;  3Q0N A;  5EKG A;  3BCT A;  3BVS A;  3FEX C;  4EVT A;  5BZ5 A;  3DAD A;  4BQK A;  3K49 A;  3A6P A;  4XZR B;  4U54 A;  3VWA A;  1XM9 A;  3Q5U A;  5KL8 A;  3WOZ A;  2XA7 B;  2Z5N A;  3Q0L A;  4DZS A;  3OUW A;  4EV9 A;  4FP7 A;  3SLA A;  5LSW A;  4EVP A;  2YNS A;  4I2S A;  5KLR B;  3RZ9 A;  5JJA A;  1EE5 A;  5KLA A;  2DB0 A;  4B8J A;  2QNA A;  3ZIN A;  4ZDU A;  5E6Q B;  4CRU B;  4L7M A;  2GL7 A;  4E4V A;  4PLS A;  4DB9 A;  4RV1 A;  1LRV A;  3BSX A;  3IBV A;  1M5N S;  1U6G C;  2X19 B;  2FV2 A;  1M8X A;  3BWT A;  4I1E A;  4D4E A;  3ZIQ A;  5CL6 A;  4I6I A;  4U5U A;  2IE4 A;  4EV8 A;  3IFQ A;  3NMW A;  5EWP A;  3K5Y A;  3L3F X;  1EJY I;  4PLR A;  3V71 A;  5D5K C;  4GMN A;  5CL8 A;  2JAK A;  3T7U A;  4I7I A;  4YJE A;  4R10 A;  4U58 A;  3TPO A;  1IBR B;  3Q0S A;  1M8Y A;  4LAC A;  3WYF C;  3GB8 A;  3BSB A;  4K6J A;  5BYM A;  2Z5M A;  3UKY B;  4U2X D;  2JDQ A;  3Q0O A;  4CB9 A;  2C1T A;  4YJL A;  3VE6 A;  5CL7 A;  3ND2 A;  4V3R A;  1I7X A;  3K5Q A;  4DBA A;  5CTT A;  3TJ3 A;  4DVG B;  5EKF A;  4G3A A;  2Z5O A;  3WPT A;  4HXT A;  3DW8 A;  1Z2C B;  4B18 A;  3H3D X;  4JW2 A;  1QBK B;  4U5N A;  4RXH B;  2BAP A;  5CLB A;  4JKQ A;  1OYZ A;  4R0Z A;  4FZF A;  4I2Z A;  3UVU A;  1B3U A;  4O27 A;  1QZ7 A;  4HNM A;  5BZV A;  4KZG A;  3OPB A;  5BZU A;  4CBA A;  1Q1T C;  2IX3 A;  3RZX A;  1M1E A;  3LTJ A;  5K6S A;  4PLQ A;  3BTR C;  2PF4 A;  2PKG A;  2QMR A;  3ODR A;  1TE4 A;  4U5O A;  3BX3 A;  3ODS A;  1M8Z A;  1TH1 A;  3O2T A;  3L3Q A;  2NPP A;  4I96 A;  4DB6 A;  3JXY A;  4JW2 B;  4D49 A;  4WV6 A;  1V18 A;  3ZIO A;  4BA3 A;  2F31 A;  1BK6 A;  3EBB A;  2NYL A;  4TNM A;  3L6Y A;  3ZIR A;  1W63 A;  4QMJ A;  3GVO A;  4U5L A;  5SVZ A;  2H4M A;  2Z6G A;  4MFU A;  1XQS A;  1PJN B;  5SWF A;  4A0C A;  5H2W A;  3UKW B;  3C2G A;  3Q0R A;  3VLD A;  3K62 A;  3ZIL A;  4U5V A;  3WOY A;  3JX7 A;  5KLT B;  2QK1 A;  3GS3 A;  4H3K A;  1T08 A;  1XQR A;  5J3V A;  4QMI A;  2XOA A;  4L4H A;  3SL9 A;  4ADY A;  2NPP B;  4BPL A;  3QHE A;  3K4E A;  2WTK A;  3GVT A;  5KUB A;  2C1M A;  4H3H A;  3GRL A;  4NEE A;  5DN7 A;  4OIH A;  3K61 A;  3VLF A;  2NYL B;  4R11 A;  2YJY A;  4MZ5 E;  2Z6H A;  1W63 B;  3NOW A;  2Z5K A;  3GNI A;  3QML C;  3PST A;  3OUX A;  4B8P A;  5H2X A;  4A3V A;  1M8W A;  4UAD A;  3TT9 A;  4B8O A;  4HM9 A;  5FC8 E;  3QG9 A;  3O2Q A;  4CT6 B;  3ZIK A;  5CL4 A;  2IAE A;  1UN0 A;  3UL0 B;  2IWH A;  2YNR A;  4YGX A;  3L6X A;  4MFV A;  4I5L A;  4CV5 B;  3ZKV A;  1EJL I;  4JLQ A;  3FGA A;  3Q0P A;  1O6O A;  3K5Z A;  5B56 A;  2NYM A;  2OT8 A;  3GAE A;  1IAL A;  1QGR A;  3LWW A;  2P8Q A;  3TX7 A;  3ZHP A;  1BK5 A;  4NZW A;  1Y2A C;  3NMX A;  1IB2 A;  3NMZ A;  5CLE A;  1W9C A;  2IAE B;  3EA5 B;  4FZD A;  5CL9 A;  3K7V A;  5SW9 A;  4PVZ A;  4I3N A;  4I5N A;  3TJZ B;  5CLC A;  4UAE A;  4I37 A;  4GMO A;  1IQ1 C;  2JKR A;  1UPK A;  1UKL A;  1JPP A;  1I7W A;  2VGL A;  3V74 A;  3OQS A;  1F59 A;  4A3T A;  1HO8 A;  2OF3 A;  4CB8 A;  2Q5D A;  5HUW C;  5CLD A;  3Q0Q A;  3FGA B;  2BCT A;  3FEY C;  4U5S A;  4YI0 C;  2W3C A;  2NYM B;  3AU3 A;  4QMH A;  2JKT A;  3W3U A;  3JXZ A;  5AEI A;  4MZ6 E;  4UWX A;  4K92 A;  4U3J C;  4FFB C;  1WA5 B;  4OO6 A;  3UL1 B;  4FQ3 A;  3O4X A;  5KL1 A;  5HUY C;  2JKR B;  3Q0M A;  3O2S A;  2VGL B;  4UAF B;  5CLA A;  4EVA A;  2BNX A;  4CRV B;  2RU4 A;  2IW3 A;  3LTM A;  1LUJ A;  2QK2 A;  5CL5 A;  4UQI A;  4P6Z B;  3QGB A;  1EE4 A;  4P6Z G;  2JKT B;  1JDH A;  3QGC A;  4IMI A;  4DB8 A;  3C5W A;  4Y5J A;  4I0Y A;  1PJM B;  4L4I A;  3JY1 A;  1JPW A;  1WA5 C;  4FZA A;  3EG5 B;  4I8M A;  4RZP A;  4FDD A;  5BZ1 A;  3K64 A;  4V3Q A;  4CT7 B;  3TPM A;  2BKU B;  4JW3 C;  3UKZ B;  2RU4 B;  5K9S A;  1UPL A;  4V3O A;  4DJS A;  2IE3 A;  3UKX B;  4UQI B;  3ZIP A;  5HHG E;  5CL3 A;  3OBV A;  3KND A;  1QGK A;  2XA7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...