5H35A

Crystal structures of the tric trimeric intracellular cation channel orthologue from sulfolobus solfataricus
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
219
structure length
219
Chain Sequence
VKLVESGGGLVKPGGSLKLSCAASGFGFTIYDMSWVRQTPEKRLEWVAYMSSGRGNTYYPDTVKGRFTISRDNAKNTLYLQMSSLKSEDTAMYYCTRGAFYYGYGFAYWGQGTLVTVSAAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab Heavy Chain
publication title Crystal structures of the TRIC trimeric intracellular cation channel orthologues
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/membrane protein
total genus 44
structure length 219
sequence length 219
chains with identical sequence F, H
ec nomenclature
pdb deposition date 2016-10-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5h35A02
1H8OA 2HA1A 1SQ2N 1XF5B 2IPUK 2VQ1A 4QRQB 5ENWA 3KPRE 1NGQL 3E2HC 2DB8A 3RWEA 4PLKD 2VLKA 3RL1A 1LK3L 1XGYL 4PJAE 3EO1B 3T4AA 1WTLA 4CADB 2ERJC 5A2FA 3RWIA 4RRPA 2J1KA 1J7VR 5F7KC 3TJEL 1KTDA 5JHDB 3AY4C 3S5LA 1D9KA 3VFPA 1RU9L 1NBZA 4GOSA 1EO8L 1JF6A 5E6ZA 3HUJB 1P4LA 1F58H 5TJWK 4ODUA 2EDDA 1BJ8A 2OX5A 2PYEB 2NY0B 3AB0C 4FZEH 5I1GL 1ZLUK 1MFAH 3CX2A 1UACH 5D7IA 1YEKH 3VXMD 3WIIH 3QFDB 4KJWC 5C0JB 1I3RA 3ARBC 4F2MB 2E9JA 2UYLA 4L1DA 5IW1A 4F15B 2VAAB 4XPBH 1FIGL 1FGVH 5C6WH 4PGCB 5I8OH 4G9FD 3MV9B 3MCLH 1TTGA 3WN5B 1VFAA 4Y1AE 3WV0A 1OGTB 3OAYH 2A0LD 4PY7B 2ARJB 5E9DB 5TE4H 1R3LB 1BOGA 3D3VB 4FFYH 3PP3H 4PJGB 2VZVA 4EI5B 5TE7H 3EHBC 5EC2B 1G9MC 3EO0B 3MV8B 4ZFOA 1LEIA 3UTSE 3RU8H 4IS6B 3GSWB 2VXUH 4MB3A 4YHLH 3V6BR 3UJJL 2CKBA 4HHAB 4N0YH 3L3DA 4MAYC 3FT4A 3MLTA 3MXVH 2XZQL 4YAQA 2OZ4L 4P2OD 4EUPB 3AGVA 3C6LC 2PNDA 3DX7B 5H37G 1B6DA 2XWJB 3IFLH 2FHCA 5FA3B 3VXMA 4DVRL 3MTRA 4TNWK 3T8XA 4K71B 5C3TA 5IGXL 2D0FA 2W60B 5FCSH 2NCMA 4AEHH 1QBLL 1JMZA 2AW2A 4KH2A 1GZQA 4YE4H 5DSCA 4G9FA 5AAWA 1U6AL 2CKNA 2VQ1B 5ENWB 1QSFE 2D7QA 4IMKC 1KIPB 3RWEB 4P9HL 2DLEA 3ME0A 1NCDL 4HG4J 1FAIL 1A6WL 1F97A 1I1AA 4J7RA 3P0YH 1M6OA 3OAZK 3EFDH 5TE6H 3SCMC 1K85A 2FYYB 2J8UF 4F9LA 3SE9L 3BT2H 4YFLI 1YQVL 3RZWA 5GISH 3TYGL 4YHNA 1ZS8B 3FONA 4L4TB 2QHLA 1NBZB 4P2OA 3CU1A 5CEZH 2Q1EA 4LSRL 1P4LB 4Y5XA 3WKNA 1IC1A 3TESA 1KCLA 4KDWA 1RZ8B 5HPMA 1A7RL 2P5ED 3SQBA 4YHYB 2JELH 2AJVL 3DGGB 5DD1L 5ICZA 5J06A 1QR1A 1RZFL 2NY6B 4NOFA 5F7YC 3EDDA 3QIWB 1PKQB 4WV1B 3CFBB 4XTRC 3TIEB 2BNRA 3BKML 4Q6IC 4PGDA 5GRXG 4NCC2 1II4E 4U6VL 4RMTA 4Z7QF 3GMMA 1S7WA 3WUWB 5F72S 5DVNA 3V6ZB 4PB9L 1RV6X 4MNQD 1BOGB 2WQ8A 4R7DB 3V5DA 4OFPA 1LP9F 4HAGA 5T1MA 1QFWL 1U3ZA 4NO5A 5D2LB 4L5FL 3I02A 1LEIB 4KJQD 3G6JA 2IPTL 2NX5B 3SE4A 2CKBB 1HWGB 4J3UA 3N06B 2ZNXA 2P5EA 5BO1H 3MLTB 1CF8L 3FMGH 3BAEL 4M43L 4YAQB 5IG7A 1GGBH 4MDIB 3RNQB 4Y8AA 4HV8B 1FL6A 4XNQA 3KJ4B 4DZBA 2OL3A 1WIOA 1YEIL 3BKCH 3T8XB 1LVEA 4Q2ZA 5EOTA 4MS8C 1BF8A 4NNPL 3SGEI 1YPZA 1MCWM 3ZE2E 2UZIL 5F7MC 5IB1A 3M17A 3VFTA 1T0MA 1T89C 2E6QA 4MNQA 4AH2B 2PO6D 3MLUH 1E4JA 1IEAA 1I1AB 4FP8H 3U46A 1U8HB 1S7QB 4O2EB 3TPUA 4PS4L 3T3PF 4H8WC 1DQMH 3SBWA 1VENA 1WAAA 3V6FA 1I9RL 3MLRH 2I26N 1KJ2A 2BJMH 1U8PB 3FB6A 1T04A 1U2HA 1U8OA 4OF6A 1HH9A 5GGQH 4YHNB 3H42H 5FHAL 5D8JL 2Q7YA 3BDXA 3V79C 4DAGL 2F15A 4Y5XB 2DQHH 4ZFGL 1YC8A 4V2BA 4X5WB 5DJYB 2OTUB 3RI5F 5HPMB 4LHUD 2IPKB 5FO9A 2OP4L 3RWDB 3O6KL 2ZG1A 1QR1B 4LLAA 2AK1L 4OQTA 4P46B 4YXKH 5FYJD 2NY0C 5J7CC 4LIQH 1QRNE 2C1PB 5CILL 2BNRB 4PGDB 4P2QE 2PO6A 4LPYA 4CDGC 4ODVH 4DVBB 4XP6L 1QPPA 1OWWA 4NO0A 3U0TA 4F15C 4ODSL 1MJ7L 3BJ91 4B5EA 2P7TA 5HYEA 4NO5B 1GC1H 1FJ1A 4LSTH 4TSCL 4EI5C 3FO1A 4CU6A 1B2WL 4EIGB 4LHUA 3QQ4A 3DPBA 1FORL 1OOAA 4OZHE 3QUZB 4BSVB 5CZVH 4XNQB 1YMME 3PDOB 4M3KB 2ITCA 2VABB 4WGVB 1C5CL 4IDLA 5CKAA 2E9WA 3WXWH 5IF0B 1YPZB 5BQ7A 1IC7L 3MOAH 4L3EB 1DUZA 3ARED 4JDZA 2OXHA 3S35L 3ZYZA 2OR7A 4XWGL 3VFTB 3EJZD 4FG6D 4K71C 2F58L 4N9GA 4UOW1 5T1DL 4G3YL 5H94A 1T0MB 2P47B 3KPMA 5FGRA 3EGSB 3V95A 3H3PL 1MAJA 4E0RA 3EYQD 5EU3B 2BNQB 2HLAB 3H9SA 4OLUH 1KEGL 1F90H 3MV01 5CJXA 1RUQL 1ZOXA 1HH9B 2F8VA 5KANI 2H41A 4M7LH 5BMFH 2EDWA 4WJ5A 1JVKA 3A6CL 1HHGA 4P23D 1R0AH 4PIRF 4G8IA 2Q8BL 3MO1A 5CLWA 4FXLA 3D25A 1MFDH 1MI5D 3S36X 2VXQL 4C83B 5CGYC 3K1KC 4MGXA 3AREA 1OL0A 5A43C 4LRIA 4HIJB 4WW1A 2X4PA 2XICA 4YHYC 5GRUH 1PEZA 1RZ7H 5B21A 1JGLL 5JMOC 1LO4H 5C0CB 5T1KB 2OMBA 3OGCA 4H26B 2EDOA 4ALAH 2NY6C 1UH3A 1JNHA 4LMQI 5IB5A 3QIWC 2VKWA 4XC3L 5KSAB 4WV1C 2Y06H 4GW1A 5CEYB 3O3UN 4WCYH 3KGRA 1OD9A 3HFMH 3RI5K 1SYVA 4YWGL 1FJ1B 4UDUA 5DJAB 4LF3B 2Y07L 3HNSH 1HSAB 3FO1B 1CT8A 1L7IH 1CTNA 2V5SA 4JY6B 5JIIA 2R29L 4OUOA 3N9GH 3RJQB 4PJDF 3QQ9C 2ED7A 3H9HA 3A67L 4TQEH 5HBBA 3DV4A 5DURB 4KHXL 5FKAA 5J6GA 4KUCD 1B4JH 1U8IA 1GGCL 4PJIA 1X4XA 2B4CH 3BRDA 3KJ4C 3TT3H 3KG5A 1DUZB 1XGTB 3OKNA 4JDZB 4N1CA 4OZIB 4XNYH 5DLML 3RWHA 5FYKD 4IRSD 4OZGE 3RAJH 1UB6B 3KPMB 3BQUB 4M6OH 2DLFL 4LP4A 1QTYT 5KW9L 4GG6E 4D94A 4M8VA 2D03H 12E8L 4H1LH 3QAZB 3H9SB 4PJXB 4LSUH 5EPMA 4LRNL 1Y0LA 2XWTB 1I1AC 1RULH 4F8TA 4JHWL 4RDQG 1OP3K 3WCYA 1EGJH 2HN7A 2JB6B 1ZLVK 4YXLL 1QSZA 3OL2A 3MO1B 4JPIA 2E9IA 3HMWL 1VKXB 2AKRB 1CDHA 4QY8A 4GG8A 4GW4B 4TTGA 2ATPA 3K46A 3TYFB 4XHJD 1CXKA 1MHPL 4Q9RH 4Y5XC 1W0VA 5IHBA 3GIZL 5DR5L 4IRSA 4R4FH 4Y5YA 4D0BA 2A6KA 3THMH 2IH1A 4QRRD 1UYWL 5IROA 5GGVY 2NYYC 1T5XA 3SGEH 4GRMA 5CSZA 4JZJB 5TH2B 2JIXD 1JNHB 4P46C 4QHNB 4MSWA 4JFFB 4YR6B 4GXUN 4YHOH 5SWSA 2CLRB 4QRPE 6FABH 3QWRD 4LSDA 2LAAA 5D6CA 4HKJA 2OYPA 2BRRL 4PP2A 1NL0H 5JXED 4PJEF 3EOYG 4HK3N 3Q5TA 4UDUB 4KJYB 2B1AH 1U92A 3U9UB 5IEHB 4PTUB 3QNZB 2M1KA 4U0RB 4R7NB 4K07A 25C8L 3H9HB 2C3XA 1WGOA 1UGNA 2BMKA 5J56B 3QDME 3P9LB 4UV4H 4MDJB 3KYMA 3ZYJA 4QRRA 1QSEE 5J6GB 5I2IB 2VL5B 1J10A 5AYQA 4Y4KD 2VDQH 4ETQA 3OKNB 2JIXA 3PDGA 5JW4M 4AT6A 5BS0E 5DVKA 3KPOB 3KHQA 4KMTH 2XY2A 4KI5E 4MLIA 3QWRA 1LWRA 2OK0L 5I75B 1A7NH 2QSVA 4PJBF 4KVNH 3VXUA 4EKXA 5D7JD 1LMKA 2I25N 4X6FA 3CIQA 1NMBL 3LH2L 1KV3A 3RX8A 4GRWH 3CSBA 4N5ED 1NLBH 2EO1A 1P2CB 5C9JB 5LGHH 1Y0LB 1E4WL 1WBXA 3LQZB 2YBRA 1RHFA 3SBWC 3HZYB 5HI5C 4HD9A 4ZTPH 4G8FB 4OCNC 5CSBA 3L1OH 3WS3B 1KC5H 2ZUWA 3GNML 4QY8B 4Z7VA 3VFMA 3BOVA 5ERWA 4PYGA 1CLYH 4LLUA 1F6AA 1I8MA 1W0VB 4ZYKB 3LEYL 1N8ZB 2EDBA 1B0RB 5SX5K 4OV5A 4Y5YB 3DO3A 1IC5L 1ZWIA 2IH1B 3TVMD 2F74A 3B5TA 4R90H 1YEDA 1T5XB 3GRWH 1VESA 4GRMB 4AENB 3MRLB 3QDHA 1F5WA 3BEWA 3TLRA 2HYMA 5IFJA 5GRJL 1YNKH 4MSWB 5D7JA 5D1XD 4JN2B 1YEJL 4HLZG 5D72L 3DYOA 1MCHA 4UT7H 3AM8A 3S97C 2ZUXA 3BE1H 5JNYB 5KSAC 3O11A 1U8MA 15C8H 1EFXD 1QUNA 1CD1A 2BOBA 1FCCA 2HJLA 5CP7A 5F7DB 2QQNH 5CIPH 1HXMB 1KJMA 2ICEA 4HS3A 3KLDA 4MD5A 3HG1E 3RVWD 4CN6A 4TVPE 4IRZH 5E00B 2OI9B 2DQUH 3B9KB 5F3HA 3SE3A 3TVMA 4A2MA 2BXYA 3EYVA 1H3TA 1HCVA 2V9TA 4OB5H 5DRXA 1FFRA 5D7IF 4AT6B 1FNEB 4C56E 5D1XA 3EUUA 4X4YA 3MNWA 4GMTH 2EEAA 1DDHB 2FHBA 3O0RH 3OKKA 3S98A 3VGBA 5C8JB 1JZ2A 4F7CA 3RHWF 1L9NA 2YA0A 3ZKXB 4G8EB 5KJRL 1KN2H 1IC4H 1RK1A 2DI9A 4OCWL 3SGJA 1UKTA 2W65B 2CR3A 5I8EA 2EYRB 4NOBA 1VFOA 1U3HA 1CR9H 1A14L 1UXSB 1A7OH 4GT7A 4QCIB 5GS0D 3GB7A 2ZCHH 3QAZC 1YQ2A 4S1RH 1YEFL 5K59F 1UWGL 5A2IH 2ZOKA 4EDWL 1M7DA 3VFMB 1VEOA 1BGXH 5I6XB 5D2NB 5F96L 3A6BH 4LLUB 3JV6A 4O4YH 1I8MB 4ZUTA 3AAZA 2VDML 4KZEH 2EYSA 4DQOH 3QRFM 3VGAB 1Q38A 4M61A 3KXFD 4XMKL 4K9EL 2DDQH 4QTHA 2ED9A 1Q8MA 1Q9OB 2DQIL 4CJ1A 1OM3H 3GFUA 4S1SL 5CEXB 3BEWB 3P9MA 5DD5L 5IFJB 1BBJA 4IHOB 4LRIC 5INDA 4FQLL 2ZCLL 4L29B 3QI9D 4ZFZA 5ID1A 4A2LA 4LSSH 2R15A 4JZJC 4N0CD 1QHPA 4NC2B 3V4VL 3SHSA 4HWZB 5AWNL 3VXTA 2ADJA 1SEQH 3WL9B 2EC9U 3P73A 5T3XE 1VGEL 1A3RL 4DGYH 2EC9T 4YDKH 1JHLH 2BOBB 3K8MA 4J8RA 4P9ML 4GFTB 4PRBA 1FBIL 1TPXC 3CFJB 4XXCA 2ICEB 7CGTA 1Q1JL 3UTTD 1RJLB 3GKZA 4LFHG 4MD5B 2Q8AH 3VFRA 1AGCA 1WEJL 1RIUL 4JFDB 3T0AA 2DKSA 4FQCH 2I9LA 2EYTA 4GXVH 3T2PA 3N1MC 4U0RC 4MXVF 3L3HA 1EEZB 1KIQA 4LL9A 3ULVH 3C5SA 3H0TA 3QRGH 5C0RL 4NM4H 4X4YB 1QFUH 1U36A 3W0WB 2JLLA 2EDEA 5I16A 3OKKB 2ADGB 4F7CB 3QPQD 2B7DT 5AYUH 1RK1B 5IBLC 5DZNA 3FT2A 1KBGH 2VSCA 2JCCA 5I75C 4PB0H 3MYZA 3EOBA 3MLPA 4UQ2B 4JO3L 1REIA 1NFDA 3D2UD 1BP3B 3GB7B 3LZFH 3TWCH 2OS7A 5BV7H 1J0HA 3G6JF 1OAYH 1CG9A 4N68A 1G9ML 1VFBB 3UROR 4JFPA 5CCKH 1A5FH 5KAQF 1WK0A 4PJCA 4FQIL 2H26A 2ESVD 4ZUTB 4WO4D 3ESVF 1J11A 1QA9A 3KWWA 3QPXH 3LRSA 3IFPA 4UILL 3VWJB 4J6RL 3T3ME 3UBXG 5J6HB 3RHWK 1DQJA 1O0VA 4OKDA 2D7TL 5D5MA 2FIRT 3TJHD 3P9MB 1FO0B 4Y5YC 1QZ1A 3L3KA 1MCJA 4ZFZB 1S78D 2BFVL 5I1KL 3ULUD 1YNTA 4Y4HD 2GSIB 5GSVA 4D9QD 4JO4L 1Y18B 4OBRA 2YC1A 4LLVA 2YR3A 1XF4A 1BIIB 3P73B 2EXYC 4JPVL 3S6CA 1S7SA 3WJJC 4XCFL 2OQJA 2YMXL 4OFYD 3FN9A 5LBSH 3EZ8A 1WAAF 1NCWL 2HVJA 4OCXH 5FCUH 5HI3D 1N2RB 4C58B 2LTQB 2Y1VA 3V9FA 4HUWA 3T0VA 2W9LA 1GOHA 5JW4N 4PJHE 3VFRB 1DQDL 4PPTA 4JG1L 4ZUSA 3OKOA 4KJPD 4BFIA 5JA9A 2BY2A 1KPRB 2UWEB 5I1EH 4RNRB 3MJ7A 4YX2H 1PX4A 4MJ6A 5BXFB 5JW3H 3VI3E 3VFGH 2OI9C 1MAKA 3C5SB 2HJFA 3H0TB 3B9KC 3T0XA 3LQMA 3RDTD 1MHEB 4Y4HA 3K3QA 5F7EH 3C8KA 3Q3GA 4H25B 2NXZD 4X9FA 2UZXB 1IGJB 3BZ4B 3FQTB 4YHKH 2CIIA 4OFYA 2IMNA 2NZ9C 5KBNC 3CZFA 4XWOC 3RTQB 3WHE1 3BGMB 2W07A 3EDJA 1X5ZA 4F37F 3J7HA 3ZKXC 5HYJA 4ODXB 5ITFA 1X6NA 1QO3B 3F6IA 3MRMB 2J6EL 3BP5B 3WSQH 3E1F1 1CG9B 3VG0H 3MLVH 1ZANL 3QDJE 4JFPB 1T22B 4OUUA 4PJCB 5D71L 1CL7L 1NCNA 3ZKMD 2EDFA 2C3HA 3INUL 4X0KA 5IMOB 5E4EB 2EKSA 5DK0A 5ALCL 5L8LB 4QKXB 1T2QL 1A8JH 3LRSB 2MQ0A 2WBJB 2GTZA 3IFPB 4TUKL 3RDTA 3TH3T 4JKPH 2GJ6D 4MA1C 5D5MB 3GM0A 4EI6B 4NJ9H 3VGAC 1YNTB 2W9EL 4I0PB 4LCWB 4YGVA 3UYRH 1IEBB 3ALXA 4JDVA 4I2XA 1UKQA 3CVHH 2EDJA 5HHXH 1QKZL 1MH5B 3B2VH 3H7BB 4ZAKD 5K9KA 5L88L 3T0WA 1S9YA 3VFVA 5L2KA 5JQ6L 3QEUB 4JGMA 1X6LA 4NM8L 3R1GL 4HUMB 4P4KA 1NUGA 5J57B 4PRIE 4CBPA 3WNNA 3LKSA 2X4UA 5A1AA 5IEKA 4BFIB 5GGVH 3I9GH 1D5XB 4APQD 3QHZL 1G7HB 5JHLL 2AEPL 2XRAL 4FTVE 5TF1L 2Z8SA 4X4XA 4E42B 4WY7L 5ECJE 2A1WH 2Q86A 3TVMC 1A6AA 3PF2A 1EAPA 3ZSSA 5JLZA 4CMMB 1T3FA 1N64L 2G60H 1BVKB 1HQRB 32C2A 2EEBA 4KGJA 1CE1L 1FSKB 4P5TD 2CIIB 4WIQA 3CZFB 5F88B 5C09D 4X98A 5B38A 2DOCA 2VSDA 1MFEH 3BXNA 2XA3A 5HYJB 4N8PA 1IFHH 5DMJB 5DRWA 1EEQA 3U4BL 3NBNA 8CGTA 5KS9A 4WUKH 2IG2L 3DBXA 4H1LB 5IJVB 1U3HC 3TBTA 3DUUB 1X5LA 4Z0XB 4APQA 2JB5H 4OUUB 3VRIB 2QADC 4EOWL 1G9EA 3B9VA 4X0KB 3G6AB 2CMRL 3REVA 1J1PH 2F54E 3B4NA 3STLA 2V2XA 3CCHB 1GGTA 3KPPB 43CAB 2XT1B 5I1IL 5DHVH 3OHXA 1ZLWH 4FFWD 4PJIF 3KDMA 3VWJC 1JBJA 1KTLA 5CSGA 3MRNB 4ZPTB 4P5TA 4LGSB 1CGSH 5MI0B 3VGHA 3KLHD 2Z91B 5C09A 2XTJD 1A0QL 1JGEA 3VD4A 2EXWD 3MXWL 2WLYA 4L4VA 4WI8A 2IAND 3K4DA 3MRDA 4U7KA 1RJZA 1RUKH 3CMOH 2BSSB 2P8MB 1NDGA 5EZIH 1BZQK 1U58B 3FTGA 4ZOAA 2VIRB 2N4IA 4P4KB 4Q6YA 4YDIL 2LTQC 2QBWA 4BA8A 3PQYE 1VB9A 4XVTH 4KUCF 3LS4H 4OGZA 1CVRA 5DC9B 4XPGL 5EBLB 1GC1C 1A02N 4H0HB 2BDNH 1A6AB 1EAPB 1K9TA 5JLZB 5AZ2H 3CD4A 3UZQA 3CX5J 5DMYA 4UNVA 1U8LA 3CLFL 4G42A 2BCKA 3SDYL 4CAGA 4X7SH 5FK9A 1IGTB 3NAAH 4R0LA 1JRHH 5HPOA 3ZHKA 3ARRA 5C0BD 5IVZA 5KVDH 3OKDA 3VWKA 1YDPB 5DRWB 4Y16D 3RTQC 1TVHA 4I4WB 1RUML 4NZUH 5DUMH 5KS9B 4O2FB 4HUNB 4GRWB 2FJGA 1U9KA 4JAMB 5DJCA 1UM6H 2G5RA 4K7PH 5EWIL 1TMCB 2MNUA 1JFQL 1A6PA 2VTFA 4K3JL 3REVB 5DHYA 4PJ5A 2DYPD 4ZFOL 4M62H 5AD0A 2D31A 2YPLE 3PGDA 3CFKA 5DMIL 2CKBL 3RPIA 1BEYL 5E4EC 3KDMB 3V5KB 3U6RA 2WBJC 3HI6H 5E2UH 1KTLB 1Q94B 3IDIB 4JHBA 4CVZA 1IT9H 1CLOH 4XZUB 4UIMA 3EOAB 4RX4A 1N0XL 2B1HL 1J8HE 5C0BA 4E5XB 4R2GB 2OR9H 1NCUA 3WO3B 2YD8A 4Y16A 3ULVD 5C08D 3EJYD 5HGAB 3MOQA 4RFEA 1RJZB 1J1OL 1INQA 1NDGB 5F1SA 5H37H 5E2TH 2J3SA 3QHFH 4NRYA 3TA3D 3QBTB 5FV2A 5DK2A 3Q1SH 2NY3B 1AI1L 5D7KD 4Z7OF 3PNWB 4XT1C 4LPXA 3ARDB 4HH8A 3EDKA 2HP4A 3P2TA 3ULSA 1CLCA 2DYPA 4Z7VF 1JI1A 5IHZB 4LPVA 5CIPB 1BECA 1X3DA 2FJFA 2EIDA 4IMLB 2VUYA 4CVUA 4MCZA 3DXAD 4V1DA 5E1AA 3G5YB 3X11B 3STZA 1R5WA 3MA9H 1ZVHA 4RGOL 5I1HH 4W4OC 1R5IB 3FQXA 4G42B 1LO5B 4J1UA 5C08A 1JTPA 2HT3D 3WFEH 3IFNH 4R0LB 3GSVA 1RK0B 3G5ZB 4AK1A 4IBLT 3P30H 5HHPA 2B2XH 2B4CC 4G80A 3FQNB 3TA3A 1XZ0A 5DWUH 3JWOH 4GSDL 5IT2L 2X5PA 1YUHA 3P0VH 1OHQA 5D93B 5FYLL 1BJ1H 2R1YA 2EDNA 2A6IA 3MRIA 5B4MD 1UM5L 2HWZH 3TFKC 3BYYA 5IK3B 1A7QH 5C0GA 2ADIB 3P4MB 4BH7B 4UBDC 2D4FA 3OWEA 5D7LB 3RY5A 1RHHB 3CDGB 2J8UE 2YD2A 2X1XR 1KF9B 1PX3A 1FDLL 4Q7DA 3CFKB 1FC2D 3M45A 4OTXL 2VUOA 2NPLX 2R4RH 3QDGD 4CVZB 2AGJL 5TPWH 3RWFB 5EOQL 5KZCB 2DM7A 4K3EH 4KRPC 2R9HD 4MX7A 3OAYK 3MYJA 3MREA 4KWUA 5MI0C 3IS1X 3ZTJG 1MFCL 3FB8A 2G75A 4XBPB 2XZCL 2UV3A 3OX8A 1FHGA 4NRYB 3L7FB 5EZLB 2CGRL 4N8VG 5DK2B 3VXPA 2X70B 3FO9A 4DW2H 1QOKA 4Z7QE 1MIEL 2X9XA 4DGIH 1ND0A 3FT3A 1AO7B 1UEMA 2WM0A 5CD5C 4MD4B 5DJ0A 5C92A 1HXYB 5E2JA 1F6FB 1S7XB 1LP9E 4P4KC 4XMPL 4Y1AD 2RJMA 2CPCA 2V7NB 4MCZB 3SDCA 4ELMB 5K9QG 4V1DB 3QDGA 3SDXA 3IKCB 3TC9A 3I2CL 5E1AB 5I30H 3SGKA 1JGUH 2DM3A 2Z93B 1R5WB 3G5XA 4Q0XH 4QTIH 1A6ZA 1C5DA 2EIBA 3O9WB 4NQED 1PG7L 4QHMB 3MODH 3FQXB 3TNNB 3UTSD 4AYFA 2FATL 5A2KH 3RZCB 5IFAH 3RL2A 1Q0YH 3BGFB 2E7LA 4QRSA 1RY7B 2GJZA 4OQTL 1MELA 1JMXA 4G6JL 5FDWB 3BZEA 2CDFB 4G80B 3LVEA 4KQ4H 2HRPL 1P84K 5KVFH 2W1NA 1N7ML 2CLZA 5EOCJ 4K8RH 1CWVA 2CDGB 3VU2A 2R1YB 4ORZC 3MRIB 4B0MM 3U7YH 3VMNA 2EE3A 1WLHA 3QUMH 1XF3B 2WSKA 3CFIC 3QEGH 4UDTB 3N1FC 3V7MA 3IVKA 1Q9KA 2VYRE 4LCIL 3T3PE 1CGTA 1CLZH 5HDLA 4F7TA 5BV7B 5I19H 4NP4L 1FPTL 1YZZA 3OF6D 3FO2A 4GJTB 2PW1B 4NQEA 4WI2A 2VZTA 5B8CB 2NY7L 2XA8H 1BZ9B 1FP5A 2FIKA 4Y88A 3DHMA 1OTTC 4X6CE 4J4PA 4DGVL 5FYJL 2CIKA 4MX7B 3PHOB 4S2SA 5FGBA 4XCNB 4M6NL 4U1KB 3MREB 1I7ZA 1L4IA 4WVRA 1GIGL 4BELD 5TDNB 1QR4A 3SY0A 2FDBP 1PYWB 1OARH 1TVBA 3L3GB 2G75B 1J8KA 4PJ9B 2VE6A 2JCCF 4KKCC 4L8CA 4PREA 4MJIE 4R2GC 2H9GB 5CLTA 4NWTH 1NFDF 1PY9A 1ED3A 2FZ3B 4S0TD 1M7IB 3FT3B 2VDKL 4Y19D 1JWSA 3MRQA 1PSKL 1L6XA 3OF6A 5CFHA 1HN1A 2CH8A 1TZHB 2N1KA 3KPSE 4PJCF 3DTXA 3B6SA 4JLRA 4RMQA 5HGGS 4ZUUA 5HHVL 2QR0A 4OFKA 3AFLA 1PG7W 1WBYB 3KNBB 5E99L 2P24A 4M03A 1O7VA 5JW5A 2GSGA 2IADA 2V2TA 3DARA 4I48B 3F65A 3OXSB 3HRPA 4LAQH 1C5DB 1JCKA 3I3DA 2R0KL 5DFTA 4Q58C 5MP6L 3VH8A 4P99A 4ERSH 2Z92B 3S37H 3I75B 1PQZA 3X3FH 4ONGH 3RL2B 1VGKA 3V5HB 5HYSB 4G6ML 4HWBH 5CUSH 4KK6D 3HC0A 3V6OA 3ZYOA 3IDNB 4C57C 2HTKC 3GSOA 3ALPA 4LVNB 4R0LC 4Y19A 2XKNA 5FM4A 3VWKC 3QEQA 5MEQB 5D93C 2X4QA 2IAMB 4OLXL 5I1LA 1J88A 2WLZA 3QUKA 3RGVD 3NIFF 1NC4D 1KCVH 4YFLF 3QJHB 2K1MA 5C6TL 1WWAX 1I3GL 1EA9C 3ARXA 3ROOA 1OCWH 3UX9B 3ULUF 1PFCA 1D7FA 3BJLA 3MOBH 3WDJA 3WS6A 1V8HA 1TETL 3I6KA 1BFVL 3MRPB 3LQAL 5GGSA 4S2SB 1BFOB 4LKCB 3KPNB 1UM4L 1SJHA 1WWWX 1YYML 2HFFA 2W0PA 4B41A 5I1CH 1TVBB 3VXRB 1K4DA 3HR5A 2LU7A 2XKUA 1LEGB 1VFUA 4JY4A 1WZKA 1ED3B 2YPVL 2HLFD 1QRND 4OKVA 3CVHB 1MPAH 4TRPL 5J1AA 3RP1A 2HT4C 3MRQB 2BSTB 3KR3H 3BPLB 2H8PB 3DTXB 4R26H 3FFCD 5EZJB 5EU6B 5CBEB 3BYTA 3BN9C 3HA0A 3QYCA 4U1NA 5DGRA 5CMAA 5JW5B 4QOKE 2IADB 2P5WD 3IDGB 4D9RE 5I9QB 4J23A 3GI8H 4PJDE 4EN3B 3VH8B 4ZO7A 4ONHB 3ARTA 3WUWG 5HGBA 1VGKB 3NABH 3GMNA 2Y25A 3O9WC 1WCQA 5DQ9A 4RFOH 4KU1A 1F58L 1FV1A 2A77H 4NGHL 3RZCC 1MCWW 2IC2A 3ULVC 1YMMD 3GSOB 3MA7A 1ULVA 2ZUVA 3C09B 2RQ8A 4NQCD 2FEEL 2AERT 2GK0A 3I84A 5IB3A 3MRGA 1J12A 1UACL 2XKNB 4IRJB 3DX8A 4KKBC 2BY0A 3GMLB 4FFVC 3WIIL 2B20A 5I18H 3FFCA 1NMAH 5FB8A 2FH8A 5JPMB 1WZ1L 4XPBL 5IIEB 1FGVL 1UJ3B 1AQDB 1XGQB 5I8OL 2P5WA 2VH5H 3MCLL 1WC7A 4PGEA 1ES0B 5TE4L 5BV7C 4FFYL 1OGAE 2Z31B 3ROOB 1HH6B 1FYHB 2FX8H 5TE7L 5FECB 3PL6B 1RQ5A 5HHQA 5IP4A 1FFQA 1U93B 3RU8L 4BK4A 4YHLL 2VXUL 2Y5EA 5B8CC 5DHVB 3PWUA 2XKSA 3MNVA 5DO2C 4N0YL 4AJ0A 3IF1B 1A6TA 2RFXA 3MXVL 3NIGF 4NQCA 5C07D 4XNMA 2R8SH 3KAAA 1K4DB 1UCTA 2IGFH 4KK5C 1KELH 3BESR 3FHAA 1K4CA 3UBXI 4WFFE 1XAUA 5E5MB 4ZS7L 2IQAA 4N9OB 2FWOB 3IU3B 4AEHL 3GZKA 4YE4L 5C0EB 4F33A 2Z8WC 1IL1A 3GUTB 5IMMB 2AK4D 1C8PA 3QWQB 4PJEE 3T09A 4NCDA 2ZUUA 1EMTH 4JKWA 4U1MB 3P0YL 1T1YB 1NCBH 2BX5A 2D4DA 5KTEH 1L0QA 3EFDL 3SDCC 5DC0A 4M4RA 5TE6L 3HZMA 5GIRB 1TCRA 5TDOB 3L3IA 5GISL 3SGKC 3OQ3B 5MENE 2D7PA 4JO2H 2EDTA 5C07A 5CEZL 4Z7UA 4ZD3H 2V5MA 1OAQH 2XG5A 3KYOB 1ZA6A 4EBQH 4ZQKA 3MA7B 4JZOA 2DS4A 1N6QH 1X5IA 5HYQB 4ISVB 2KUTA 3DX8B 2G2RA 1JK8A 2D0GA 4PJBE 2VAJA 4LVNC 2AK4A 5FB8B 1ORQB 3V0WH 4DK6A 3LKRA 2EDLA 2O61B 1OAUH 1ZEAH 1A6UH 3QXDB 5E9DE 5CD3B 4LAJH 1IM9A 1BD2D 1C7TA 3QG6B 2IAMC 3FB5A 4PGEB 3VFWA 3MV8E 3R8BB 3OMZA 4HLZH 1I7RB 1F2QA 4HZAA 1V3KA 1A64A 4P23B 3WLWD 2VZSA 5HHQB 2FJHA 4CRPA 3SDAD 3L3OA 5DTFA 2FO1A 5BO1L 5DFWH 3FQRB 1RIVH 4J4PC 1I8KA 2RFXB 3FMGL 3GKWH 4PP1C 4MXQC 1GGBL 4HPOH 1S9XA 4KPHH 1K4CB 4HUVB 3BKCL 3QG7H 1EHLH 1AKJD 5HVGB 5ABDE 4D9LH 4WWKA 1BD2A 3CJJA 4RSVA 3DROA 5F7NC 3H8NA 1JPTH 1IL1B 5IV2A 2VLKE 4XPFH 2AS5M 3HI1B 3DUSB 4UOJA 3MLUL 3I6GA 1QVOB 3UO1H 3BPLC 1KXVC 1T80A 4MJ2A 1DQML 1IGYA 1JV5A 4PGJA 3AVEA 3MLRL 3SDAA 2BJML 1FYTB 5GGQL 2VLRA 5CBAA 3H42L 4LPWA 5LWYH 1AR1C 3JV4B 3V7AE 3OKLA 5I9QC 2ZKHH 5HHNA 1FG2B 2DQHL 1KIRA 4EN3C 3V4PL 1DBMH 4OZ4B 5FO7B 4A6YH 5D7IE 5EBMB 1MAMH 1ZA6B 4FXGA 3ZKSD 5EIIA 3MMEA 5GJTH 2DTSA 1FFOB 1QSED 2A83A 3V6OC 3ZO0A 2FEDD 4RISL 1K6QH 1JK8B 1CTOA 5DD3H 4YXKL 5ICXA 4LIQL 5IJKC 3LKRB 1A3LH 4JREB 1NDMA 4IRJC 5KSBA 1IM9B 1GPOH 5I71B 4MMZC 3O3BB 3VFWB 4G9DA 2BNUB 1YY8B 2Q7NA 5K59E 1MLCB 4LP5A 1UJ3C 4JY5H 3EIFA 3NTCH 3DSFL 2CRYA 3O3DA 1AFVH 2FJHB 1NC2D 4LSTL 4KZDH 1ZT7B 3RX7A 1BX2B 2XYCA 2Z31C 4XP4H 5DTFB 3VXME 3PL6C 3ULVF 3WS6C 2Z0BA 1RJCA 4QO1A 1S9XB 4HXBH 1M71A 5CZVL 4M7KL 5F6IB 1UC6A 4G9FE 1S8DB 4I3SH 3B9DA 4KKLD 4U6TA 3WXWL 5K9JL 3MOAL 4WWKB 4YBLB 1I4FA 4X7DC 2GHWB 2VLME 5F7FA 3QCUH 5IV2B 5E8PB 3T08A 1GVIA 5I73B 3FZUD 5CJOH 5C86A 4Y4FD 1JV5B 5C0AD 3W9EA 2N7BA 4OLUL 1F90L 3O2DH 4WI7A 2M26A 4WU7A 4ZMAT 5GZOC 2VLRB 5CBAB 5KN5A 4M7LL 5BMFL 4JPWH 1MJUL 4MXVE 4YPJA 3SKNA 3JWDH 3EJJX 5HHNB 3DV6A 3DX9A 5C0ND 3DOSA 4LLMA 4O58H 4FXGB 5T1LD 1MFDL 3OJDA 3BX7C 1NKRA 3ARQA 4JFZL 2Z8VC 3N1QC 3SKUD 2BNRE 1F4WH 2O5XL 4NRXA 3RY6C 3DX6B 1KLFA 4POYA 3Q48A 1FNHA 4WNQB 4RIRB 4LLWA 5ICXB 5GRUL 2QJDA 1RZ7L 2HRLA 1LO4L 5L9DH 5KSBB 4ALAL 3QUXB 6CGTA 3ILQC 2Y06L 5C0AA 3QUMB 4U1LA 2NY2B 4OGAC 4FABH 1XCTA 3G6JE 3SDXF 3BISA 2R0WH 2X4RB 5EFIA 2P5EE 4QXUH 1FN4A 3HNSL 1S5IH 2IQ9H 1KCUH 1L7IL 2NR6C 2XN9D 5T1LA 1E6JH 3O6FD 4ZO9A 2WV3A 3SQOH 1YEGL 4OI7A 2ZJSL 4O02H 1NGYA 4ODHH 3DYMA 1XEDA 3AS1A 3VD7A 3QIBD 1IKNA 2B4CL 5BW7A 3TO2B 4MNQE 4XNYL 1ZT1B 3D5OF 5EO1B 5MEPA 3IXAB 4ONFL 2C4XA 2DBLH 1AD9B 3MRJB 1OP5K 3RAJL 1WAAE 4M6OL 1MCKA 3L6FA 4NQDB 4GKZB 5C3LD 4OCRH 2D03L 3FB7B 3W9EB 1IMHC 4DK3A 1P6AB 3L95A 1JPST 4Y8DC 2XN9A 1DSFH 4HGMA 3O6FA 2F53D 3D39D 1EGJL 1EHNA 4UOW0 2V7HA 4G5ZH 2GK2A 1INEH 1CFSA 3IDYB 5ISZB 3RQ3A 3CFDA 4AEFA 5IM7B 1F11B 4WEBH 1KNOA 4Q9RL 1T4KA 1BVZA 3OTTA 4LGPB 1XR8A 4LDEB 4JM4H 1ZGLA 1J0YA 5E1HB 3LN9A 4MNGB 3JTTA 4JFED 5E4IA 4XGZA 2ZSVB 4GKNA 2VN7A 3K8LA 3BP4A 4GRLB 4YHOL 6FABL 3JWOC 4IOFC 4JREC 5DA0B 5I71C 2F53A 1NL0L 1FFPB 3D39A 4H0IA 4W81A 4ZNCD 1FN4B 3QXUA 2B1AL 4PFEA 4FNLH 3O4LB 5E6ID 5EO9A 5EA0H 1EVTC 2D3VA 1EJOH 5FYJE 2OZ4A 5J3HD 5JR1H 2CD0A 1E28A 2VO5A 4DTGH 2AABH 2MPAH 4KROD 2WINB 2FGZA 1UB5A 3H3BC 1MWAA 3FO0H 3QDAA 4UV4L 1ETZA 3VD9A 2X4SB 4LBEB 2Y7QA 5JMRA 4OBSA 1KCKA 5IR1A 2WWKT 2OLDA 4G6FB 4JFEA 1FRGL 3QI9B 3GSXB 5F6IC 1TJHH 5MEPB 2YKLH 1ERNA 4KMTL 3FQUB 4WWKC 4YBLC 3LMJL 1GZPA 2FECI 3T4YB 1A7NL 1DBJH 2DN7A 3W11D 5E24E 1AHWA 5L6YH 4KVNL 1EUTA 1OD7A 5DGQA 2AEWA 2NY1B 4W6YB 2WIMA 4J3XA 4G8GD 5DD0H 2V2WB 4RZCA 5I73C 3IDMB 3FN3A 3BW9A 4MB4A 4NNXA 3WHXA 5LGHL 5IUSA 4OD1H 3WD5H 4ZTPL 2DMCA 3PP4H 2FBOJ 4UINL 1CFSB 3L1OL 4WFHD 1V7MH 1KC5L 2NXYD 3MRFA 4JJ5B 4QT5B 1RVFH 1MHCB 1XR9A 4KI1A 2B8OT 5BJTB 5KVEH 1NUDA 4MCYA 3I50H 1DVFD 1LDSA 3DJ9A 4C55A 5FOBA 4F58H 4R90L 2NW3A 4NKIH 1PGRB 3BP4B 1DBKL 4G8GA 3C6SB 1CFTB 4UT7L 4K8RC 2HH0H 4M1CC 3D2UB 3BE1L 3QUXC 2I07A 2HMID 2EIZB 2VR9A 3GMPA 2NY2C 4XVUD 1JYWA 1JPGB 2CXKA 2QQNL 5ACZB 2X1OA 4WO4B 1CK0H 4MLSA 4IRZL 4PJIE 5A3IC 2DQUL 4JKMA 3O41B 1FL5B 2OM5A 4ELKB 4ZPVB 2H6PA 4HULB 1ZTXH 4OB5L 5EU7C 5I1AA 4KMQA 5KSVA 1UCBH 4QHLA 1VA9A 1LE9A 2R2CA 4RQQA 4GMTL 5F3BA 3O0RL 5GGUB 5EUOB 3OB0H 5E2VL 2BHYA 4ZDHA 1C5BH 3RVUD 2ICCA 4NQXB 1KN2L 1IC4L 2ENSA 5IB4A 4ZUVA 1A9EA 1JNLL 1CR9L 4FQQA 4GBXD 1A7OL 1Z0NA 2ZCHL 1DR9A 1CDGA 4S1RL 4U6HB 4ESKA 1NKOA 4PRID 4V2CB 3MRFB 2H2PC 1TZGL 5FYKE 4X6BA 1BGXL 1SJEA 2IH3A 4JRXD 3A6BL 2A9MH 4O4YL 3MUHL 3IDYC 4DQOL 5T5FH 2NXZB 4KDVA 2C4FT 2NW3B 1OM3L 1AD0A 5SWSE 1BQHB 3CSYA 3RVXD 1A4JA 5GS3A 2PR4H 3U0PB 2PXYD 3C5ZA 4LSSL 2DIBA 2VB5A 4ZUWA 1KCSH 5JOPD 4PJFA 2LU4A 4GAYA 4GAJH 1H15A 1ZLWK 4NQTA 1SEQL 5DRNB 4GBXA 4GRLC 4L8SA 3WJLC 4YDKL 1JHLL 3PV6A 1P7HL 3HLAA 3HC4L 4Z7WA 5DEFA 3TIDB 3TN0B 4PGZA 5IW3A 3QUYB 1D5BA 1Y6KR 1CFBA 5F70A 3LKPB 3VMPA 2Q8AL 1OB1B 3FAXA 4JRXA 4QRRE 5CZXC 5M95B 4Z7UF 2YD3A 4TUJA 2GJ6B 2R39A 3ARZA 4FQCL 1PJ9A 4YBQD 3T0DA 3UPAA 2E6JA 4GXVL 2F54D 2VLJD 3JSSA 1NFIB 4N0UA 1I1RA 3ULVL 3IDXH 4IM8A 5JA8B 3QRGL 4JFQB 4NM4L 1BQLH 2PXYA 4FFZH 4NDMA 5E56A 5TFSH 1QFUL 3VXUE 4ZFFB 3J8F7 1IKNC 4OCYH 2Y9RT 2WUBH 5T33H 3B9EA 1U3JA 3BVNA 5D1ZD 2AV1A 3LOWA 1KB5A 5FEBA 3F7YA 4ZAKB 5AYUL 3SDDD 5D70L 3BH8A 4Z7OE 4PG2C 2J4WH 4TUOB 4PB0L 4ZUVB 3GMOA 4HCRA 5FDYA 2NY1C 4AIZA 3LZFL 4FQXD 4Z7VE 3TWCL 2GTWA 2ZPKH 1FVEA 2RCSL 2C7UA 3BUTA 2YPKB 1OAYL 4LNRA 3GSQA 1F3JB 4PLJD 4J3WA 2VLJA 3V52H 4NZRH 4JANA 1A5FL 5CCKL 3O2DA 1AGEA 4HWNA 3TZVD 3C9NA 3L5JA 5HYFA 3T1WA 4E41D 3BO8A 4MWFB 1AIFA 4Z5RB 1OVZA 4HKBA 3QSKB 1P7QD 4A6YB 5JO5A 4HJ0D 1IGMH 1JZ6A 3CH1A 4PRAA 4OFDA 3GBLA 4NFDA 1ZLSH 5I1DA 5GS2D 1RPQA 3C5ZB 4HF5H 3UBXA 4PJFB 5JPNA 1H15B 5H2BA 4K23H 4X4ZA 4ZSOA 1MREL 5HHOD 3ZTJH 4JJHA 3FFDA 4LCCA 5LBSL 1OTUD 1T1WA 4OCXL 4U1JA 4MAUL 3HLAB 5FCUL 2BVQA 1AY1L 2NNAA 5ICYA 3U2SB 1T21B 5I17B 3PWPD 3ARFD 3TZVA 3QP3A 4TUJB 1WF5A 4M6AA 4FZ8H 4E41A 2YZ8A 1C08A 5C0FA 4MVBC 3WO4B 2FGWH 2IBZY 4OLVH 4YX2L 1P7QA 2X41A 4O5LH 5JW3L 3RIFK 2JJTA 3VFGL 5IESH 5FGCE 4I3RH 1YN7B 3V4UH 5ESVA 2ATKA 4NNYB 5F7EL 1MVUB 3JBG7 1IVLA 3MLWH 5I15H 4WDIB 3RWJA 3BVNB 2AV1B 5I76B 4Z0BL 1XIWD 5HHOA 4U49A 1ORSB 3BH8B 5DS8B 4QRTA 1BLNA 1AHWC 5B39G 4PBWD 3PWPA 4LCYB 4AIZB 3MJ6A 3ARFA 5BRZB 5CWSA 1ZSDA 5E7FA 3VG0L 3MLVL 4PV8A 1CDUA 5BVJA 3C8HA 1R3JA 2DQCH 4RGNB 1E6OH 1CFQA 1FLTX 2GT9A 5DJ8B 1IQDA 3C9NB 4WHDA 5D1QD 3KYNA 1MIMH 3BO8B 4JKPL 4HKBB 4HIHB 5CHNB 2P8PB 1FZJA 3T0EB 1SBSL 5GZND 5JO5B 4PRAB 4LIQE 4WUUB 1XIWA 4S1DD 1YEEH 2NY5H 1IGIH 4X8JB 3GK8H 4NYLA 5FA4B 3UYRL 4H20H 3BSZH 1YN6A 4KXZI 1E0OB 1T2JA 3CVHL 3IETA 1TQBB 3L5WA 5HHXL 5DJ2B 3B2VL 5SX4I 1MVFA 3NMEA 2AEQH 2YD6A 2NNAB 2KKQA 1KULA 1D6VH 4UTBH 5E08H 3UTQA 3KPRA 1TNNA 5D1QA 3BI9X 1JGDA 3TN0C 1KFAH 3QUYC 5C0FB 1LEKA 3GGWA 3I9GL 4GAFB 3W81A 3O6LL 4PR5B 3X12B 2A1WL 2ARJQ 3K7UA 5BZDB 2EECA 3TM6A 2W0LA 3LSOA 1UQSB 1ZVSA 2G60L 4NO2B 3GSUA 5HVHB 2A74B 3OXRB 5LCVH 5F89B 2JCCE 5C2UB 1EPFA 1URLA 4YDVB 3C8DA 4JG0H 1FVCB 1NFDE 1MCIA 3HPJA 4LLQA 4YHMH 3P77A 3IDJA 3U48A 3CFEA 1SMAA 1MFEL 4JRYA 1F02I 2ICWB 3REWB 1IFHL 2O5ZH 1CD9B 4PJCE 3HZVB 2Q20A 4KKAD 3V0AC 3KS0J 4WUKL 1W72H 1KOAA 3CX5K 5BZWB 4HH9B 5BVJB 1BZ7A 2JB5L 1PDKA 3TO4D 4S1QH 1Z9MA 3MCG1 4UI2A 1G6VK 2KQNA 3KYNB 4ZXBD 1J1PL 5SV3A 3WHE0 4ZS6C 3LV3A 1WFUA 3O8XB 3D9AH 4KV5E 2KBGA 4UB0H 4UT9H 3C87A 7FABH 1CGVA 1CGSL 3FOLA 2BC4B 3D69B 3M1BB 1YN6B 2A6DA 2MWCA 3G04B 3L5WB 3C5ZC 4XBGB 1CDJA 4BH8A 1NEUA 2ESVE 1MJJB 1RUKL 3CMOL 5EZIL 1QEWB 3QEHA 2ZZUT 5GSRB 4OM0H 3NIFE 4UMGA 1PLGL 2HKHH 2UVEA 3GBMH 3KPRB 3JVGA 5IKCA 1WCBA 1G7IA 1JGDB 4ZXBA 3HB3D 3TBYA 3OZ9H 4JDTH 3T65B 3CUPA 5E7BA 4FS0A 1BAFH 3ULUE 4XVTL 4QHUA 3LS4L 2VDLH 4PJAB 2V5RA 4HQQH 4RDQF 2Y6SD 5MHSD 2BVOA 3EYOA 2BDNL 1MCNA 3VFUA 3WO4C 1UZ8B 1NGPH 4OZFG 5SWZD 4R3SB 4LVOC 1EEYA 1ZVSB 4FQ2H 1T0NA 1Q9LA 4H0GA 3RVXC 4LEXH 2BRQA 1NEZA 1DANT 3MV7D 4TVSa 4X7SL 2YD4A 2ZOLB 4CVXA 4G7YH 2IEPA 4LLQB 3LEVH 1JRHL 1UWXH 3RNKB 3P77B 3IDJB 4OLZH 4P0DA 3CFEB 4KK9C 5KVDL 5E70A 1FZOB 3OKMA 3DRTA 4NZUL 5DUML 1QHOA 4P48A 4X6EB 2ITDB 3VFNB 4M48H 5DDHA 1UM6L 1BZ7B 4K7PL 1JUFB 3MRKA 3P4OB 2Y5TA 3VCLB 5DYOA 1A9BB 5SWZA 3UJTH 2AXGA 4RGNC 4TVPH 3FJTA 4DUWA 1SVCP 4P57B 5B3JF 4ORGB 1UH4A 4HGWA 1G7MA 1YMHA 3HI6L 3JWDC 4OD2A 5E2UL 4LGRB 1IT9L 1CLOL 1D5IH 3MV7A 5DJDA 3T0EC 4I2XE 3HMXH 3SE8H 1F4HA 1IKFH 2A6DB 1KENH 3EOTH 4QXGH 3D18B 4KJWD 4XCEB 3ARBD 2OJZL 5L2KE 2CRMA 1Q9WB 1MCOH 3L9RA 3BRFA 2X4OA 5E8EA 1NGQH 5HJ3A 3NCJL 3VXSD 2DL2A 4XH2A 3MJ9H 4POZC 5E2TL 1CIUA 3QHFL 1TQBC 4LKXA 1QSFB 5D7SH 1NBYB 1OAKH 2IBZX 3EHBD 1A4KA 1KSRA 3WNLA 3TJEH 3BZFB 5DMGC 5LGJA 1RU9H 3HE7A 2CQVA 3K4AA 4MAYD 3A6OA 3F12A 3VFUB 4NHCH 3C6LD 2VZ1A 5JUEL 5HGHA 1Q9LB 1A1OB 1IBGH 2VLLB 3NIGE 5I1GH 5I1HL 3X3GH 3F62A 3ARBA 5IVOA 1X9QA 1F4YH 4F7MA 3WFEL 2KZ1B 5GGRY 5HVHC 3V8OA 3VXSA 2KZWA 3V0VB 3P30L 2B2XL 2RIKA 4KXZH 4XX1E 5DWUL 3JWOL 1ROWA 5ESQA 1HI6A 3OKMB 3P0VL 5SX4H 3NCYP 4I1NB 5T3XH 1QRKA 5E8OA 2P4AB 2EEDA 2DJUA 5JDSB 4P2RD 3SCMD 5KG9B 1A7QL 5C71A 1JNNH 4MAYA 5E94A 5F21B 1EVUA 5DYOB 2EZ0C 2X7LA 5I66A 2ZP0T 4GQ9L 3UCRA 2VXVH 3VXQA 3DSNA 4QOKD 3EDEA 1W8OA 5DC4B 1GH7A 3RA7H 4D9RD 5C09E 4N90E 2R4RL 5TPWL 3U83A 3MGOB 4PRPD 4DVRH 3O8XC 3C2AL 4Y2OA 4L4VE 4KTYA 4Z9KB 4MB5A 2Q6WA 4K3EL 3CPLB 4NFCA 3MFFB 1CDYA 4XTRD 3Q6GL 4HWEH 2DIAA 2GKIA 5HJ3B 4XH2B 3QZWA 1A2YB 3WFBL 4P9HH 5T3ZD 1AGDA 3ZHLA 4LKXB 4P2RA 3HKFA 3SCMA 3SJVD 2KDGA 4BFBD 4DGIL 1XF2A 3RGVB 4OV6F 2DLGA 1FZKA 3FCTA 3QFJD 5HVFB 1T66C 2J8HA 1U2CA 4XAWH 4N8VA 2Z4QA 3CC5B 4LSRH 5D6DA 3T77B 2XTJE 1HHJA 1FFNA 5I30L 3ARUA 4PRPA 2IFFH 4UIKH 1MCSA 3IAQA 2IANE 1CI5A 5HGHB 2XTLA 4QTIL 1WT5A 1B3JA 3RVVC 4MS8D 3MODL 5ESAA 4M8QA 1RAMA 5IFAL 1Q0YL 4CU7A 1VPOH 1ONQA 1MUJA 3RUGA 2JKXA 5E8NA 1DN0A 3LY6A 4LMQE 4OJFL 4PJFF 4NRZB 1MCRA 4KQ4L 3IJYB 3SJVA 4H88H 3VD3A 5KVFL 2PYFA 1B6UA 2J6EA 1V3JA 4K8RL 4P2QB 2H3NA 2ARWA 5KAQG 5E2WH 5E8OB 2E9BA 4Z7WF 4WRLA 2CUMA 3QUML 3QFJA 4LPTA 4PJ5E 4I3GA 1OPGH 4KTEH 3UTZA 2JK5B 3QEGL 2KH2B 2MHAA 4YHZH 1G6RH 4JFYA 1IGFH 5I19L 5I66B 4FMKA 1QYGH 4NQSB 2BHZA 1R5VA 1CF8H 2PCPA 3BAEH 1AGFA 4X4MA 43C9B 1MCFA 5C0BE 2XA8L 5DHXB 1IJ9A 5IW6A 5AZEH 3GJEA 4OZHB 3FN0H 2Q6WB 4JM2B 3L3JB 2DWDA 3EBAA 1IAII 2PYED 2NY0D 4GH7B 4LLYB 1YMMB 4M7JH 4IOIA 3OJMB 1T89A 2XNAB 2AJZA 4L3CA 1OARL 3P0GB 2I5YH 1JZ7A 1XF5A 1D6EB 1YNLL 4HDIB 4X9HA 4QRQA 4NO3A 2XQBH 4HS6B 3VA2C 3ARGA 4NWTL 1GSMA 4P3CH 3R0NA 1P84J 1QBAA 1RJYB 3G08B 4OZGA 3UPRB 1EK3A 1KLGB 1B0GB 3IJHB 3MV9D 3KYAA 1XT5A 3VDBA 1I9RH 3FCTB 4V1DE 5E9DD 1MFBH 1JWUB 3D3VD 2QTEA 4EDXB 3JVGC 4EI5D 3MUJA 5JHDA 2HFGH 3GJFH 3MV8D 1ZA3B 3HUJA 4FQHB 3ULVE 2QLVB 5C08E 1WSST 1GYAA 4LAQL 2PYEA 1EX0A 1MEXH 2Z9TA 4ERSL 3S37L 1I8LC 4JFOA 5D7KE 5CUSL 1U8QB 3BPCB 4KMLB 3R06A 1V7NL 1CIDA 3QFDA 5C0JA 4IJ3C 1Z9OA 4YC2B 1JJUA 2VAAA 3FKUS 2KQMA 1CXIA 4TNWF 4PGCA 1AP2B 4W68A 3WN5A 2V17H 4XP5H 3BP7B 4PY7A 4AQ1B 3DXAE 1R3LA 4EI5A 2ZSWB 4HBCH 4X99B 1F4XH 3S3PA 1XMWA 3EO0A 1S9VB 2I60H 3VFOB 3O4OB 3IRPX 3ZDYF 1Z3GH 3GSWA 4JKLA 3ZDXF 1HOCB 3QCVH 4WHYG 1FORH 5I1JL 1HIMH 1AGFB 5F9OH 1OCWL 5CGYD 3MOBL 2XWJA 1QFPA 1C5CH 2HVKB 2YRPA 4NUGH 5FA3A 4U4BA 1T6VN 3FRPG 1PY4A 1FNSH 4WU5B 1WICA 2LABA 4IOIB 2AJZB 1ZHNA 3S35H 2F58H 4LVHB 2C3GA 5I1CL 1TLKA 2NY6D 1NGZA 3QIWD 4NN5B 5F8RC 1KPUA 4NO3B 1KIPA 3ARGB 3W5MA 5GRVK 2PW2B 4OZGB 4DWHA 1AXIB 1EO5A 1MPAL 4GG6B 1MRDH 1SYSB 4YFDB 3QDGE 2R2HB 4HUKB 3SDXE 2FYYA 1ZHKB 3KR3L 1ZLUH 3WFHB 1I3UA 3D0VB 1FH5L 3JWNC 2EH8H 1T20B 1ZS8A 2VN4A 4L4TA 4CDHA 2Q8BH 4D0CB 2DWEA 3QQ9D 5LQBH 2NX5D 2P46B 1RZ8A 3HE7C 1IQWH 3GI8L 3DGGA 1FE8L 1Q0XH 4L8DB 4JFOB 4YHIB 3NABL 3QIWA 3R06B 1PKQA 1F2XK 4RFOL 4WV1A 2A77L 2A2QT 3CFBA 3D0LA 3TIEA 4PRHA 1GCFA 3WUWA 1KEMH 3V6ZA 4R7DA 5I18L 3I6LD 5EOCL 4QRPB 1HINH 1NMAL 2EIEA 2VLMD 3NH7H 4I18B 1HYSC 1I1AD 5D2LA 1U0QA 2QQLH 4NQEE 2AJYL 3HI5H 5IBUG 5J4MA 2VH5L 2NX5A 1W72B 3BP6A 3EYUH 1P69B 1S3KL 3LKQA 2I9TB 4UNTA 3RNQA 4MDIA 2FX8L 4LQFL 2VISA 4HV8A 4KAQH 1BBDL 3GSRB 4RMWA 1MWAL 5JORA 1W8NA 4OAWB 1GGCH 1WZMA 1RZIB 3KPLA 3QDMB 2NYYD 4I0KA 1ZHNB 2H2SC 1BM3H 1QSEB 3BIKB 4P3DB 5DJ6B 3OV6A 3BUYB 4JM2C 4P46D 1BOYA 1NGZB 2R8SL 4N8CH 1DQTA 1KPUB 3HMXA 2BNRD 2DLFH 5BS0B 5AUMB 1J18A 4AH2A 1S9WA 2JJVA 4KK8C 5EUKB 5FYLD 1QFWM 1U8HA 1S7QA 4O2EA 3TT1L 2ZG3A 2VZOA 1U8PA 1L6ZA 2VRAA 5GJSH 5EO0B 1V05A 1DBAL 2YD5A 1X5XA 5HY9B 3SPVA 3DECA 5H35B 3DIFB 4XMLH 3ZZ1A 2DWEB 2P8LB 4M4PA 1EMTL 1T7ZA 4X5WA 4LDOB 1XCQB 1NC2B 2OTUA 5DJYA 3OAUH 3RKDC 3E3QE 1NCBL 2FX9L 1X7QB 5KTEL 5D6DC 4LLDB 2IPKA 3V6OE 1Z5LB 1B9ZA 3RWDA 3QH3B 2HTLC 2NLJB 4HBQA 4JO2L 1KB9J 4P46A 1CZ8H 1WT5C 2VWEC 1LGVA 1IAIH 2C1PA 2Q76A 1KLUB 3D0LB 4Y19E 4ZD3L 3R8QA 3K4ZA 2RR3A 1OAQL 4PRHB 3OPZH 4EBQL 1I9EA 1S7UB 3QEQE 4DVBA 1U41A 2EKJA 1N6QL 5EH1A 1C16B 3QXTA 2N56A 4YC2C 4N1HB 4U1HB 2BRRH 3KPQA 5HVWA 1OAUL 2BNQD 5AG8A 4MXWH 5EZOH 3HE6A 1A6UL 5HI5D 2PTTB 4Y4FB 3BP6B 1AE6L 3TBSB 1A1NB 4GXUM 4NC0B 4YH6A 3LKQB 1S7VB 4PJ7A 2E7CA 3O4OC 4BSVA 3QUZA 2VISB 1FNAA 4U3XA 3DO7B 3HG1B 3PDOA 2VABA 5JORB 1GOGA 4XP1H 5F97E 4MNHB 1X44A 5DZLA 1R24B 3KPLB 5IF0A 3L5HA 3UDWC 3F7VA 1V5JA 4L3EA 4EXPX 1RIVL 2VITB 3GKWL 4JCMA 3MUGB 3HHRB 4GUPB 2PETA 4HPOL 4KPHL 3Q0HA 3HZKB 4ZOCA 4C56B 2CK0H 1S9WB 1AC6A 3QG7L 5C0CD 4LVHC 5T1KD 1EHLL 3EGSA 5FF6B 3WEXB 4UV7H 3LH2H 1EBPA 1JHTB 5EU3A 2NY5C 5KSAD 4D9LL 1XFPA 2BNQA 1WWCA 4NN5C 5DEGA 1KTKE 2HLAA 1JPSH 4NO0D 2G9HB 1G7LB 1MOEA 1IM3B 2WIIB 3ARGC 4XPHH 1JPTL 1L9MA 2X1PA 2YN3A 5F1NB 5LAXB 3SPVB 5L8KB 1P4BH 3UO1L 4AM0B 3U0WH 5JIHA 3T04D 4NZJA 2H45A 3DMMA 1H3XA 1J5OH 3WIHH 3CXDH 2FCBA 1FO0H 2C1OA 4C83A 3JXAA 3B5HA 1YECH 4JB9H 1MCLA 3NZ8A 4HIJA 5IMKB 2X89D 2ZKHL 4HIEB 5DURD 5HGDB 4DN3L 2Q87A 5TQ0H 1FG9C 2Q76B 4X80L 4BSWA 1DBML 3PXHA 1MAML 5T1KA 5C0CA 2FX7H 4H26A 2GITB 5GJTL 3FFCE 5KSAA 3BWUC 3U7AA 1T1ZB 2DJSA 4HUUB 5D72H 1K6QL 1QFHA 5CEYA 5CINH 3G6DH 2DQDH 2GUOB 5DD3L 2P5WE 3KPQB 3WN5C 4RCAA 1A3LL 3HE6B 3N85H 4ODBD 1JHKH 4JR9L 4HC1H 2ZG2A 4ZOEA 3H9SD 3ARWA 5DJAA 5IWLA 3LCYA 4LF3A 2O93L 1HSAA 3VXNB 5F1KC 4I18C 4JY6A 4PJ7B 4NSKB 2J5LB 1RZKL 4GAGH 3NTCL 4XRCA 1AFVL 2X89A 1FVDA 4KZDL 4NQCE 4YIQA 4C54A 4G6AC 5GRVL 1YEHH 3F7VB 4XP4L 3RVTD 2DQFB 4OIIH 1XGTA 1J0ZA 4OZIA 2CXGA 4HXBL 1LQSR 3U4EB 1GHFH 1W0YT 1UB6A 4EEEA 3BQUA 2JJWA 3QISA 1T03H 1OLZA 4I3SL 3NFNB 2E7BA 5FAAA 5DEGB 4BJLA 1KB5L 4PGBA 4PJXA 3QCUL 4KI5C 1Y6NR 1I1YB 1KGCD 2XWTA 2F8XC 3MROB 3IKKA 1I9IL 2QQKH 4HCRL 4R4NC 4XI5C 4WTZG 5CJOL 4CNIB 2JB6A 1S7TB 4M9OA 2W0FB 4XCYA 3DMMB 3MJ8B 4NPYB 1NGXA 2AKRA 5DFVC 1VKXA 5C07E 5IQ9B 4GW4A 5E6IB 4D8PB 3O2DL 2C1OB 4Z7UE 2UUDH 4CN4A 3TYFA 3QDJA 1R3KB 4RA0C 1F42A 3GJFA 3L7EB 4JPWL 1FNFA 5IVXF 3NZ8B 3JWDL 1T5WB 4I9WD 4M1DH 4YPGB 4BSWB 4O58L 5TH2A 4JZJA 3W82A 2W92A 4QHNA 2AK4E 4JFFA 3O81A 4HPYH 4YR6A 5DVOA 5E8DL 3TBVB 2CLRA 5F7HA 5IBLD 1JN6B 4F7PB 2IJ0C 3VJ6A 2CRZA 1KIUA 5L9DL 2BK8A 1KXQE 4KJYA 1BREA 3U9UA 5IEHA 3BH9B 4PTUA 4Z78A 3QNZA 1RIUH 4R7NA 1NANH 2R0WL 5DMKA 4CJ0A 1I7UB 2DMBA 1DEDA 1G6RB 1H3WM 4FQ1H 4PJHB 4HAFA 4XRCB 4QXUL 5IHLB 3QA3B 3P9LA 1ACYH 1FVDB 4MDJA 1SMOA 2CLVB 4YIQB 5I2IA 1P7KB 2VL5A 1S5IL 2IQ9L 1KCUL 4HFUH 3ESUF 2MCPH 1E6JL 1IAIM 3WNKA 2BOCB 3RUGF 4FTVA 3WUZA 3KPOA 1QG3A 3P4NA 2P42B 4O02L 3TGXA 3WDIA 5LGKA 4KKNA 1XGRB 1DVFB 1BJMA 3QJFB 4MQXC 1BD2E 1INDH 3B9AA 3VGGA 2EXYD 2SEBB 1WBZB 4PGBB 5SWSD 5EN2B 2P43B 1BIHA 3O3EB 1P2CA 5C9JA 4NKMB 2D9QB 3QO1B 2DBLL 3PGCA 3LQZA 3HZYA 4OLWH 3MBEB 3QT2A 4G8FA 4XCYB 2VLRE 4JO1H 3WS3A 5FOJA 4EQ3A 1NGXB 1NBQA 4ENEC 4EQ2A 3QDJB 4ZYKA 1I8IB 1CBVH 1DSFL 3GJFB 1N8ZA 2DRUA 1B0RA 3PHQB 1NAMH 4J3TA 3B9KD 2K7PA 4R97B 4PUBL 1INEL 4XNXH 4AENA 3MRLA 2OCFD 4F3FA 2DQJH 1R3HA 2FO4B 4WEBL 1K8DB 4QXTA 3WJJA 3RKPA 4JN2A 2NZ9D 4PRNB 4XWOD 4JM4L 2AI0H 4PD4J 2O26U 5JNYA 3VXUD 4JCLA 3VJ6B 1UG9A 1CN4A 1MY7A 3N50A 4OIAA 4UUJB 2XQYG 5F7DA 1LNUB 2R0LH 1HXMA 4JN1H 4Z78B 3HE6C 1NGWA 1BPVA 1RZGB 5DMKB 5HI4C 3HUJF 4I77H 2ICES 5E00A 2OBGA 5GS1B 1G0YR 3S36H 4MD0B 4CW1B 3B9KA 3H9YA 4PRIB 2C5DC 3U4AA 4M02A 3QUZC 4FNLL 4ODTH 2AJUL 1AXSA 5EA0L 1EJOL 4K55A 5EU7E 4CMHB 5JR1L 1FNEA 1DE4B 2PF6A 5CEZD 3HNTH 3ELAT 4FTVB 1JYNA 3P4NB 4DTGL 2AABL 2MPAL 4W6XB 4UTAH 1DDHA 4DJMA 2NY4B 3FO0L 4MHHG 1A47A 5C8JA 1HQ4B 4G8EA 4F80A 1VACB 2HT2C 2E7MA 3MACL 2HG5A 3OG4B 4NQVB 2W65A 1TJHL 4HIIA 4HUXB 4WEUD 2YKLL 4YZFF 4PJGF 2EYRA 2WANA 3PGCB 5DD6B 1UXSA 5E6YA 4YUEH 5SX5H 1WFNA 4QCIA 5F44A 2QQQA 1DBJL 4X7TB 5L6YL 3BRGC 4P9HC 4XP9H 2DICA 5D71H 1VHPA 5DD0L 1BQHG 1MCPH 1BVLB 5D2NA 5EG6C 2E7HA 1T2QH 4JFDD 4OD1L 3DMMC 3WD5L 4Z77A 4BSJA 3PP4L 1Q9OA 3OJ2C 1V7ML 5CEXA 4QWWC 4F3FB 4DOHE 1R3HB 3D6GA 4IHOA 5I0DA 1UJTA 2VOTA 4L29A 4QXTB 4K94H 2Y36H 1K5NB 1N3NA 3OR6B 3I50L 3W0WD 4HWZA 1TFHA 3QIUB 3PUCA 4OF0A 4F58L 3NVQA 3WL9A 1FAKT 1QLRB 5C0AE 1A21A 3IGAB 3WMSA 5L88H 5L2JB 1OP9A 1PAMA 3LB6C 4KDTA 2FH6A 4W4NA 3W2DH 2AVGA 1IEHA 3F8UB 1U3HD 3CFJA 4Z8FH 1PEWA 1J87A 1NGWB 1NCCH 1RJLA 2RB8A 3MFGB 1F8TH 2QADD 1O5DT 2HH0L 5IWLC 4UT6L 4JFDA 1L7TH 4FQXB 4NC1E 1QFOA 3Q2CA 1EEZA 3LS5H 3HPLA 5JIKA 3PQYB 1AXSB 4PV9A 3VXOB 5B38G 3VWJD 1CK0L 1TZIB 3BGAA 2F5AH 4DUXA 4MJ5A 2VNCA 3W0WA 4JVWA 2ADGA 4LOUC 3W5NA 4HLJA 3PWLA 1NMCB 1ZTXL 1NAKH 2HG5B 3BQUC 1UCBL 4HIIB 3OKYA 4NT6B 4M93B 4OZFH 1XGUA 2ZWLT 3JV0A 4UQ2A 5D2LF 3MNZB 1UZ6F 2ZUTA 2XOTA 4U1SA 2XN9E 3NZHL 1VFBA 2EDHA 3MBEC 1ZT4B 3X13B 3HRZB 4L1HA 1S7RB 3VWJA 4Z77B 5J6HA 2W9DH 4M1GL 3RVTC 4LEOB 3WIHA 4BUGA 3PJSB 1SVZA 1FO0A 2YPLB 1RSFA 2A9ML 3C2SA 5C7XH 1T83A 2GSIA 3F6LA 1N3NB 3RBSA 3NCMA 1E4KC 1Y18A 1A0QH 5T5FL 1OW0A 3JTSA 3MXWH 3CLEH 3F58H 5D4QA 1BIIA 1J8HB 4QYOB 1FNGA 5F1IB 3LPFA 3VD5A 3RTQD 1N2RA 5KANG 2F53E 3BEVB 3MUZ1 3D39E 1KCSL 2C3VB 3GO1H 4GAJL 5ACLA 2DQGH 2F19H 4HC1A 3IRZA 1KPRA 4JE4B 2UWEA 5T5NF 1AQKH 5DRZB 4RNRA 2CUHA 5FHBL 3HPLB 1J86A 3CNKA 4GS7B 5BXFA 4PV9B 5GS1C 1N5YL 2DD8H 4QRUB 1JZ5A 2WBJD 5IHUL 1MHEA 4M6MH 5FGSA 3PABB 5B3JE 4JFEE 3CFCH 4H25A 4MJ5B 2ADFH 2KPNA 3GI9H 1DLFH 4BFGA 1IGJA 3SDYH 1GAFH 3IXTB 3PWLB 3BZ4A 3FQTA 3IDXL 3RTQA 3P9WB 1WVZA 3BGMA 4B53A 3DVNB 5MEOB 1BQLL 5TFSL 1XGUB 4FFZL 4UNUA 3RGHA 1ZAGA 3NN8B 3OG6B 4OCYL 1SJXA 4ODXA 2WUBL 5J89A 5T33L 1RFDH 3D85B 1QO3A 3MRMA 3BP5A 4PLOB 4LVEA 4U1SB 1HYRC 4WTXA 2A6JB 1EEUA 1T22A 4PJ7F 3SGDH 3PWVB 5IMOA 2X4TB 5E5RB 2WBJA 4KTDH 1TNMA 4LCUB 1ZK9A 1YPZF 2J8UB 3V52L 4EI6A 4NZRL 5DQJB 1PG7X 3HAEB 4O00A 1N0XH 4TTDC 4I0PA 1UVQA 4XVSL 1JRHI 4LCWA 1IEBA 3JTSB 3ORJA 4X6CA 4MZ3A 4G8GE 1IGML 1FNGB 1MH5A 3U82B 1DL7H 2BP3A 3S88L 3H7BA 4R96B 3QIUC 1ZLSL 1KCRH 5TGBB 2LVCA 3QEUA 4HF5L 5HYJD 3U79A 3UP1A 3TFKD 2IF7A 3WE6B 3X14B 2DL9A 2FECL 3V2AR 4UBDD 4WFHE 1T0PB 2VC2L 3ARPA 2OTWB 5LVEA 1MCBA 5I8CA 1D5XA 1G7HA 4FQJH 3TO4B 4U1IA 3WFDH 1LP9B 5AEAA 4E42A 4W4OA 4D0DB 5DJXA 3E0GA 4CMMA 1BVKA 1HQRA 3UJIH 2D2OA 1MY5A 2WNGA 4KRPD 2FGWL 4XNUH 4OLVL 4O5LL 3IB4A 5IESL 5F88A 3MRBB 2A73A 4I3RL 2CSPA 3V4UL 3T1FB 1I85C 5T3ZL 1NMCC 4O51A 3MLWL 5I15L 3LEXB 1HDMA 4GKSB 1MHHA 3MLXH 1CD0A 1UEYA 3ROLB 1AGBB 2OMNA 4H1LA 4F8QA 5IJVA 5CD5D 5L2KD 4LU5H 3DUUA 4K7FB 2R23A 4Z0XA 5DEZA 3CDFA 4HKXA 3VRIA 4P4KD 1IRAY 3RJDA 3WDHA 1ZMYA 3C60B 3G6AA 3LKNB 1EGJA 5I6XC 3CCHA 43CAA 3KPPA 1CICB 5D2NC 3RWCA 4CL7A 4OZIF 3O2WH 2AXFB 4NJAH 3WNPA 3MRNA 4ZPTA 5K9OB 2OL3H 1U8NA 1UVQB 4WENB 4JFHD 1MIML 2H32H 2Z91A 2V5TA 3DRQB 1N59B 4OSUH 4MQ7B 4X6CB 4I13B 4HMDA 3WLBB 1A6VL 4WI4A 4PJXF 3BD5A 4PJFE 2BSSA 2P8MA 5BVPL 2NY5L 1HZHH 1IGIL 1U58A 4H8WL 1X5AA 3GK8L 1MIEH 3GHBH 4H20L 2VIRA 4MJIB 5F8QC 3BSZL 4KDTC 3E2HB 4K2UH 4Z7WE 3F7PC 2YSSB 1KJ2H 5I8CB 4HFWB 4JRXE 1DQLH 4GW5B 4UQ3A 5JOFB 1F3DH 3ZT6A 4U1IB 5EBLA 2ERJB 2LFGA 4R4BB 3I2CH 3KPSB 1DLHB 2E27H 3VMOA 1D6VL 1ZKAA 4UTBL 5E08L 5DJXB 1MNUL 4N0UE 3HC3H 4GS7C 2PN5A 1KFAL 1OTTD 4MA8L 4WFED 4MA3B 1IGTA 5JOPE 2A73B 1QLFB 1BJ1J 4N90D 2VMFA 4KKCD 1C12B 4PG9B 4OGYH 4R2GD 4O51B 1N7MH 1M05B 4L4VD 1YDPA 5LCVL 1HDMB 2ZUQB 1MHHB 3S9DB 4I4WA 5DUPH 5FUOH 4O2FA 2Z8RA 4JG0L 4JAMA 2R23B 5C70A 3MRRB 2GFBA 4HKXB 1P1ZA 1CD8A 4YHML 4GKOA 3NCEB 4HK0B 3GIVB 1ZHLB 3B8SA 2VLJE 3C08H 1RUAH 2O5ZL 2R4SL 1JPFB 3WIFB 3RWCB 2VDOH 4RAUB 4U0QB 3V5KA 2FB4H 4FHBD 1Q94A 4S1QL 3IDIA 2DMKA 5B39B 4XZUA 4DGVH 1U8NB 5GXBB 4QXWA 3ZE0F 2MQCA 5FYJH 1NAMB 3C6LB 1OGAA 3EOAA 5C9KA 3MQIA 1GGUA 2WWMC 4LSQL 3TCLA 2QKIA 2GIYA 3CU7A 4E5XA 4HX1B 3GRWA 3D9AL 1T83C 3VG9B 3ECBB 4WHYH 4UB0L 1MLBB 2HTKD 4UT9L 5HGAA 1YY9D 5LJYH 1AXTL 2P45B 4CGTA 1OW0C 5A16B 4ZSOE 4BK5A 4U6YB 2R1XB 3HTLX 3VWKD 3PNWA 4WHTB 1VSCA 3ARDA 1V3LA 1TJIH 4XAKD 1ADQH 2K7QA 2OJEB 4UQ3B 1CFVH 3LD8B 5IHZA 5CIPA 4AEIL 4EVNB 4IMLA 4E41E 3ZDYE 4OM0L 2HKHL 4PJ5D 3X11A 3G5YA 5TDPB 3ZDXE 2VXSH 5C0DA 1EH9A 4WI9A 4JDTL 3IS0X 5CJBA 1D5ZA 1H3GA 1BAFL 3TP4A 1R5IA 2VDLL 4G6MH 1LO5A 4JQIL 4PJ8B 1I7TB 5KZCD 3EYFB 4PJDB 3ZKNC 4JFXB 4ZO6A 4RX4D 3ZL4H 4YHPB 1RK0A 1NGPL 3G5ZA 5MENA 1V3MA 5HHOE 3FQNA 4FQ2L 5D96B 4LEXL 2A9NH 1N4XH 4PTTB 1NJ9A 1K8IB 1P6FA 5EORL 1Y6MR 3GJFK 5ITBH 2HT4D 3PWPE 2HFEA 3NA9H 4G7YL 2GFBB 1P1ZB 3LEVL 1KJVA 3BN3B 4OZFA 5IK3A 1F13A 2ADIA 3P4MA 1T1XA 4BH7A 3QWOA 3BHBA 5CJQH 5D7LA 3DYPA 4FXKB 1WITA 3BN9D 1RHHA 2OSLA 3CDGA 3PWJA 1UXWB 1OF2B 3C60C 1RIHH 4M48L 1I3GH 5ANMA 4F57H 1N26A 4V1DD 1FLRH 3RWFA 1QQDA 4DKFH 1CICC 1CE6B 2FLBT 1OGAB 3LQAH 5CZKA 3O9WD 3TCLB 3UJTL 2QKIB 3LHPH 4TVPL 5E03A 1H3PL 4NKOB 4HT1H 3TV3H 1H8NA 3U36B 3UAJC 4I0PC 3RZCD 2E8YA 3FOMA 4XBPA 1WWBX 1D5IL 4U7MA 1I1FB 3HMXL 3L7FA 3FQWB 5EZLA 3SE8L 4H5SB 5IOPB 2X70A 4KKBD 4FFVD 2W0KA 3EOTL 1KENL 4QXGL 3T2OA 4Y2DA 1AO7A 3BWAB 4MD4A 1MCOL 3PXJA 2BERA 3SKOB 1HXYA 3DETC 1S7XA 1CGUA 5F7UA 3MJ9L 1QPXA 2BVEA 4YO0A 4ELMA 2V7NA 4P5KA 3HS0B 3ZTNH 3IKCA 5D7SL 1OAKL 4PJEB 5C0DB 2Z93A 4NCC1 5L0QB 5IQ7H 1D5ZB 3O9WA 1I9JH 1DZBA 4QHMA 3TNNA 4GLRI 2DI8A 2VDPH 1J0IA 3RZCA 5FYKH 4QLRA 5DO2D 5HXMA 4Z76B 4NGHH 4NHCL 5MENB 5FDWA 4P59H 3UC0H 2CDFA 4KK5D 1MRCH 1FSKC 3TNMB 1IBGL 3VE0A 2X05A 3TEUA 3X3GL 2FSEB 1NJ9B 2CDGA 4AL8H 5ADOH 4PJ9D 2NW2B 4JRYE 1F4YL 3B83A 2HFEB 2YEZB 1XF3A 3LPWA 1KJVB 5HTSA 4OZFB 3W9DB 3EDFA 5FUCC 2ZUQC 3K2UL 3PIQB 2PUQT 1T1XB 4UDTA 3QWOB 2X4NB 1WZ1H 3BHBB 5KSUB 2R1WA 4PJBB 3NACH 2OSLB 3PWJB 3UPCA 2NZIA 1LO3L 3EZJB 4NHUB 5T3XL 4XNZB 2PW1A 5ANMB 1OSZB 3MGTB 3SDCD 3EKCA 1XGPB 4TNVF 3GMRB 5B8CA 1QQDB 1BZ9A 5HHMB 1JNNL 1HCFX 3SKMB 5TQ2H 4LASH 1IAOB 3PHOA 2VXVL 3S4SB 4XCNA 4U1KA 5TDNA 4WI6A 4XBEH 3RA7L 3PP3K 1IILE 1PYWA 3L3GA 3FOMB 1SJVA 4PJ9A 4WFGE 3VI4F 3OJVC 2H9GA 1DUYB 3VG9C 4ZS7H 1OTSC 2RHEA 4HEPG 1Z9LA 2FZ3A 1M7IA 1MJ8H 1G7JB 4Y2DB 3B3IB 4HWEL 4NWUH 1TZHA 5DZOA 4ZODA 5EBWA 2WMPA 4HW6A 2IAMD 4YO0B 1U3YA 3W39A 4P5KB 1P5UA 4HIXH 1FGNH 2DQEH 1WBYA 3KNBA 2VLKB 3VW3H 3VGFA 3RL1B 2VXTL 3LD8C 4I48A 5JZ7C 3T4AB 3OXSA 2BXZA 1G9NH 2NQCA 3MZTA 5ALBL 3RWIB 1NUNB 1HKFA 1KTDB 2Z92A 3I75A 4XAWL 1D9KB 4UAOB 3D1MC 3S5LB 3VFPB 4ZNEA 5HYSA 3V5HA 4BQ9A 4MYWB 3AUVA 3ZE1F 4J4PD 3G5VA 4PP1D 4X7EC 4MXQD 4ODUB 2IFFL 4UIKL 3IDNA 2L7JA 4PJ8C 1PVHA 3VE0B 1H5BA 3SKJH 1OSPH 5D7IB 3VXRD 3ABZA 1VPOL 5D96C 1WFTA 3STBA 1I3RB 1OQOA 2UYLB 1LDPL 5MEQA 5IW1B 2IAMA 1GGIH 2R1WB 4MHHI 4H88L 1VFAB 5LXGH 2UWEF 4AY0A 3WXVH 5E2WL 3GSNH 5EU6D 3QJHA 5MHSE 4YQXH 5FXCH 1OPGL 4KTEL 5SWZE 4OQ1A 4AIXA 5DT1H 4ZFOB 4YHZL 1G6RL 3BPOB 1MCEA 1IGFL 2O5YH 3GBNH 1AR1D 1QYGL 3MRPA 1BFOA 3WFZA 3L3DB 4LKCA 1B0WA 3MV7E 4EN3D 3KPNA 1X4YA 3FT4B 5HD8C 5I8KH 2APBA 1UFUA 3GDBA 3VXRA 4BYHA 3VXMB 4JHAL 5AZEL 2YOCA 1LEGA 2H32A 3FN0L 3BDBA 1J0JA 1GZQB 3N1PC 4K94C 4M7JL 4HEME 3CVHA 5DSCB 2YA1A 4G9FB 4IRJD 4TNVK 2BSTA 2ORBH 2I5YL 2NY3C 4OF7A 5EBWB 3UYPA 2H8PA 3QEQD 5EZJA 1X5JA 5EU6A 4BQ8A 3ARDC 1AJ7H 2XWBA 2XQBL 3VGEA 3W39B 5CBEA 4NZTH 4P3CL 2E8ZA 2FHFA 2MSPA 1M6OB 1KUMA 1DFBH 5D5MF 3IDGA 3IU4L 2XZAH 1MFBL 4EN3A 4M5ZH 3FONB 1QD0A 2Z31D 4ONHA 3X17A 3WBDA 4P2OB 1W0WA 2VJXA 5L0QC 2HFGL 3PL6D 3G5VB 4HSQA 3V4PH 4FMFA 1MQKH 4URTB 4X6CF 5BOPA 1H5BB 4Z18A 3CK0H 5ICZB 1YY9C 4LARH 1MEXL 1PKOA 2DIJA 4RISH 3VXSE 5IJKA 4OD3H 2YRLA 4KVCH 2JF1A 4IRJA 3GMLA 2N7AA 4Q9CA 1TITA 5GS0H 2X6MA 5JPMA 2AQ2A 4QHKI 2R2BA 3GMMB 5IIEA 1S7WB 2RBLA 1UJ3A 1AQDA 1XGQA 2V17L 1JE6A 5ID0A 4XP5L 4YDJA 3IYLW 1ES0A 1F6LL 1YYLL 1UWEH 2CR6A 3V5DB 3DHJA 5T1MB 3LN4A 5IFHH 2Z31A 2QSCH 1HH6A 3DSFH 5FECA 5GZOD 2VDNH 4HBCL 3I02B 1F4XL 3PL6A 2I60L 3G6JB 4XNZC 3UXFA 1U93A 1Z3GL 2JJSC 3NPSB 5ADPH 2P5EB 5DHVA 3QCTL 4XPAH 4GLRH 3QCVL 4JQXA 3B43A 5IVXE 5IG7B 1HIML 3IF1A 3RFZC 1FL6B 4DZBB 4M7KH 2OL3B 2G5BA 5F9OL 4QGYA 1CS6A 3QXAA 3S34L 4NUGL 4Q2ZB 5EOTB 2H32B 5K9JH 1FNSL 5E5MA 2FWOA 3IU3A 5IB1B 2BVYA 3M17B 1P5VA 5C0EA 4OCSH 4QHKJ 4P2RE 1T7WA 2X2YA 3ILQD 3GUTA 5IMMA 4MNQB 5GRYA 2XWBB 4Y2DC 2EICA 1IEAB 4OGAD 3FRPA 3U46B 3NOIA 3TPUB 1ADQA 4JVPA 1G7PA 4U1MA 3V6FB 4CN1A 4HMEA 1T1YA 2APXA 1KJ2B 1MRDL 4AMKH 3FB6B 1T04B 1U8OB 3PGFH 1UA6H 5GIRA 4PRPE 5TDOA 2EH8L 3BMWA 2Q7YB 1MJUH 1W0WB 2NR6D 4FA8A 4QEGA 3MLYH 2VWEE 5LQBL 3RY6A 4HXAH 1D9KC 4UAOC 2MKWA 5FO9B 3KYOA 1IQWL 3BGFC 4JFZH 3RUGE 2O5XH 4FZEL 5CJ5A 1MFAL 1Q0XL 5T3ZE 4ISVA 1TJGH 5HYQA 4EIZC 1YEKL 3BKYH 3SJVE 3CVIH 2GW5A 2PO6B 1ORQA 2O61A 4KHTH 2R2BB 3QFJE 3QXDA 5CD3A 2AXHA 2UUDK 3KLAA 4NO0B 3DI2B 3L5XH 3QG6A 1KEML 4YDJB 5ID0B 2AQ3A 3U0TB 2COQA 1JF5A 4TN9A 1I7RA 3LN4B 4PLKC 2P7TB 3CGTA 3QNYA 4RWYH 3LPGA 2APVA 1FNLA 4OCLC 1HINL 3NH7L 4P23A 5TF0A 5DXWA 1RD6A 1KB9K 2QQLL 4X4ME 3MBXH 1XH3A 3HI5L 4LHUB 3VDCA 3T0BA 3EYUL 3QQ4B 1MI5A 1FYTD 5DVLA 1E27A 4IIQA 3FQRA 2BVUA 3BPOC 1JGVH 1YEGH 3ULUH 2ZJSH 1F00I 2G5BB 3QXAB 2ITCB 4KAQL 3IFLL 4LK4A 4HUVA 5I74B 1FC1A 4L8BA 8FABA 5BQ7B 4PJ9C 3ZDZF 5KS9F 5HDOA 3ZT5A 1BM3L 4N9GB 4GRWF 1U91A 5H94B 4ONFH 4N8CL 3HI1A 4IOFD 4E0RB 2J88H 3DUSA 4ZG1A 1IM9D 1QVOA 2A0LC 1IZJA 1EHXA 4U31A 1G7PB 4LSVH 5JHDE 2X9WA 1UENA 1EAJA 1SM3H 2OXGA 4KY1H 3BT2L 3HUJE 5GJSL