5H3CA

Crystal structure of arabidopsis snc1 tir domain
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
169
structure length
158
Chain Sequence
GSRRYDVFPSFRGEDVRDSFLSHLLKELRGKAITFIDDLLSAIKESRIAIVIFSKNYASSTWCLNELVEIHKCYTNLNQMVIPIFFHVDASEVKKQTGEFGKVFEETCKAKSEDEKQSWKQALAAVAVMAGYDLRKWPSEAAMIEELAEDVLRKTMTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1
publication title Crystal structure of Arabidopsis thaliana SNC1 TIR domain
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Immune system
total genus 58
structure length 158
sequence length 169
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-10-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10140 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Toll/interleukin-1 receptor homology (TIR) domain 5h3cA00
4C7MA 1FYWA 3OZIA 4LZPA 4W8HA 1O77A 4C6RA 1FYVA 1FYXA 3UB3A 4EO7A 4LQDA 4C6TB 4C6TA 3UB2A 4DOMA 1T3GA 4OM7A 4LQCA 4FZ5A 2M1XA 3UB4A 4C6SA 3H16A 2J67A 4W8GA 5FORA 5KU7A 2JS7A 2Y92A 3JRNA 5H3CA 2Z5VA
chains in the Genus database with same CATH superfamily
2I7TA 1XVUA 5F9MA 3VU9A 3W4JA 1Z25A 2V5AA 4MUMA 4A0RA 1E3IA 3A9WA 1NFRA 4I8DA 2A7XA 3RHSA 4MB0A 1QNLA 4DIKA 1ESEA 5E95A 3UFXB 1KS9A 4NCHA 4M0KA 4WCVA 5AXBA 3RS3A 2PLWA 4BUJA 1W1WA 4OQQA 4E7OA 4D9CA 2VLIA 3H3XA 1LV8A 1B0AA 2CMGA 4EHHA 9MHTA 3HZHA 3RH0A 1A4IA 4D9GA 1IZ8A 2P0AA 2WNIA 3RC3A 4O33A 3Q7RA 3PEFA 4H0NA 3ZUPA 2NQ2C 3WLEA 2GB4A 3OZGA 1M2VA 2VTEA 3V48A 2RCNA 2BONA 2FP4B 1EU1A 1SBCA 4X63A 4F1JA 5IJAA 4DLRA 5TS3A 3UQZA 3NTOA 4C88A 3BFPA 4L8WB 1SIUA 1BFUA 2XODA 4TKZA 3KZKA 5AW0A 4NBSA 1K06A 1GJRA 2WPDD 3I30X 2AOVA 4URFA 1DJLA 4W5WA 1YR8A 1FZTA 1AF7A 3D02A 3REQA 3VPHA 3WRYA 4AD8A 4NXMB 4R81A 2B2XA 1ODCA 4K81B 3WGJA 1CB0A 3HEAA 3KVVA 4JLBA 3DNPA 1XXLA 4NV0A 4UU1A 1CFZA 2JI6A 1UIMA 4NESA 5EQJB 1YU6A 4R83A 1VPTA 2FW1A 3PL1A 4JK3A 1O6BA 4KXMA 1ULTA 2O1XA 4KODA 4KUGA 3BGVA 3IT1A 1AQ6A 2O7RA 2XHEA 1E5TA 5CDFE 2G0NA 2ISCA 3O9MA 2GF0A 4LPSA 4E7PA 4KL8S 1I6KA 2W58A 1TK9A 2BEKA 3FYUB 3K31A 4E12A 1FNCA 1R18A 5ESXA 5KI6A 2JGMA 4XAQA 3VJMA 1EXDA 2Q3MA 2VYQA 3LBIA 4ON9A 4UOQA 1G3IA 4CCYB 4XM0A 3LTEA 4OJQA 3U7QB 4QU8A 1NMEA 4BCCA 5K09A 4M8KA 1AKTA 3QE3A 2WKQA 1GG9A 3STHA 5I5GA 1EH5A 2XPCA 3NDIA 3UWPA 4AULA 1N8KA 1DPFA 1L5SA 4RS3A 4L4YA 1EJBA 4IVNA 2QGNA 4NHOA 4C2TA 4B47A 4LQCA 2YTZA 4Q15A 3UAOA 1SK8A 2FW9A 3MVEA 521PA 3ZJVA 2J33A 4MLPA 3K5HA 3DJYA 3LMKA 4N39A 1DOZA 3F78A 1RAFA 2BEJA 1PJAA 2QRMA 3OF2A 2GH1A 4IWNA 4BVGA 1H2BA 2GD2A 4NYMQ 1YHZA 4INAA 1PQWA 4EKGA 3CE6A 2WJGA 4FNAA 3VX4A 1DWUA 1LJUA 4ZCRA 4N82A 4LXYA 5AW9A 1KJIA 3Q0IA 1M2OA 2X5NA 4L7VA 4N40A 2Q4BA 3GG2A 3HGTA 1M1UA 4JYAB 2NU6B 1DWOA 1G20E 1U9ZA 1YDHA 1MEJA 2D54A 1Q1EA 3GNQA 4FBGA 1JJVA 1JPUA 2IX9A 4LJAA 3OJLA 4AJ2A 1ZN7A 1V8BA 5KJCA 1ZD1A 3HXKA 2J3MA 3ONVA 3F1KA 5DK4A 3RD5A 1GCGA 3ZEIA 4JLUA 5DU2A 2BD0A 1B6TA 1UWVA 1KP2A 3DBRB 2PL3A 2FW8A 4HUTA 4MWZA 2VAXA 5KJ6A 1T0HB 3ZI0A 3WGYA 1S2OA 4FDLA 2BP7A 4DRZA 1U63A 2I54A 1O8CA 1L1QA 1UAYA 2CJYA 2C99A 1RZ3A 3AL3A 1YB2A 3GW8A 1C8VB 4FHEA 5H3CA 2OV3A 3J7AC 2VH1A 3M4XA 5K0CA 2AD1A 3NRBA 2PX8A 4XW2A 3F7TA 1L6RA 2E3JA 1RYEA 1JB9A 2VJMA 3NBZC 4U5XA 2Z9BA 1MZVA 3ICQB 2ZSJA 3T1VA 4BWVA 2P9EA 3HM9A 4WA8A 1PFQA 2W4IA 3HB9A 1BN6A 2HXSA 2Q3HA 4IIVA 3WA6A 5HA5A 4ZDJA 5JFTA 2RKBA 4IGEA 3RS8A 3V9PA 5HRAA 1X7GA 4WPGA 3AUJB 4EG0A 5F73A 5DASA 3M49A 4AO8A 3HXOA 4AKIA 3CZ4A 1HYGA 1LQ2A 2J67A 3HPQA 4L9WA 2DBYA 4MGKR 1TYCA 2CD7A 4NE7A 3B1WA 2CLKB 3R0IA 5LUBA 1RSZA 2D5CA 1L8OA 3NI2A 2FF7A 4R1NA 4LF9B 1YMUA 5E38A 2NZYA 4EW2A 4RTQA 3JVEA 1CEQA 4D98A 4OSEA 3IAM6 4YK7A 4I99A 3IYLW 2JLVA 4OD0A 2HNAA 4HWGA 1BYIA 3W0LB 4HYTA 5E6UA 4HKTA 4OLAA 1CB7A 2CF6A 3CA8A 3KWMA 3UJAA 3CPSA 1PLKA 3BB1A 5JNWA 1Z82A 4L6AA 3GT4A 3UO8B 2Z04A 1ZJ6A 3KLMX 4RZQA 1GZHB 4BCBA 3M81A 2PUGA 2PKCA 1PR2A 1OC2A 4DMFA 2Z4RA 2EP5A 3FNGA 3QFFA 1RMTA 1JKXA 1QFSA 2EEZA 2ZB8A 1DJOA 1LSSA 4RWZA 2EL7A 2C0CA 3USES 2Y92A 3GVHA 4IKOA 4C1NA 3IOMA 3MWEA 1FFCA 1E3QA 4G1VA 4ZCSA 2E4AA 4TS9A 5KYGA 1KFJB 4FOTA 5DKFA 4GMKA 4YT2A 4Y2SA 1JL3A 3IIJA 1J70A 1GADO 4WLUA 3U1BA 3KVRA 1Q1GA 2QRJA 2XQGA 2ZR8A 4EEKA 2R87A 4WKGA 2GA8A 3SS7X 3ZLTA 3SFTA 4HVLA 4OAQA 2ZDHA 3NKLA 3WVNA 2REBA 4V3CA 2E7ZA 4GI3A 4NCJA 1XMJA 5JZ9A 4CYMA 3CBQA 3QBVA 2WICA 1GNSA 3A4IA 1PFYA 3B13B 3BH6A 3FETA 1LX6A 3MWDB 2XWSA 1BWQA 2C0QA 5EA2A 2PE5A 3A2KA 1KDVA 3LOPA 4EG6A 4M55A 2PMBA 4JP1A 1I3KA 3DLBA 1IPHA 4MWGA 1I94B 4K6FA 1NWCA 1IRIA 2OCAA 2RGNA 4OI1A 1WE2A 5LA6B 1ESCA 2Z4TA 3CV3A 1WXWA 5E6SB 1HG1A 2RARA 1N3LA 3OIVA 2KBEA 3SPXA 3QKUA 2O3UA 4M22A 1RRFA 2VBGA 3UOAB 3Q8WA 2C2HA 1R6XA 3U37A 2IUUA 1Y80A 3E15A 4JB8A 2WABA 4YA6A 4ZJZA 4ZAVA 1YIAA 2X8WA 4YMTA 1D09A 2ZUDA 4TKUA 1L5LA 4BECA 5C53B 4KR2A 3VNAA 4PYNA 4AG6A 1R12A 4E08A 4YUAA 5B6JA 3T0GA 2O3SA 1P31A 4WD3A 5IJXA 1F4VA 3H16A 1EE9A 4N3BA 1FXWF 2PWPA 3PS9A 4R8KA 4R1MA 4ZRNA 3G2LA 3JASB 5AHRA 2RH5A 1EQUA 3URKA 3X1JA 4LFCB 5BVHB 5L4SA 2CXXA 4AIRA 3NT4A 4L22A 4W9NC 2FSPA 4R68A 1JSCA 2HFKA 4V03A 1X7WA 2OCDA 1V6AA 4U7HA 5LBIA 4UHHA 4PVCA 1EB9A 4RTMA 4BVLA 2A14A 1TM3E 2PPLA 3CLHA 3NANA 1HLDA 1X7YA 3QBJA 3O9VA 4XPIA 2RIPA 3RCBA 4HDOB 2FMHA 3TL3A 3AVWA 2NSJA 1D0VA 1ZN8A 3KP1A 1KWKA 3ZQ4A 1II9A 4UDNA 1IOVA 1AX9A 1QH8A 2I4LA 1ADYA 2WEKA 4LC1A 4YRDA 4C7OB 1TAUA 3IEPA 5COAA 5FOSA 3UW1A 1R6DA 6PFKA 3NO4A 4MW4A 3VXKA 1WA5A 3KT0A 2ZIFA 3ESAA 3AEUA 1KE1A 4FJ0A 5LPNA 4QGGA 1UJNA 2C95A 3HWWA 1LW7A 2AC4A 3PKIA 2ZYUX 2ONCA 3UQYS 1RXIA 1ZZEA 2E1RA 3FB4A 5LD2C 3V8VA 4IO0A 1PV2A 2Q6LA 2QB5A 3GEBA 4MKXA 2D5LA 4OQEA 1US8B 3WO1A 2WFMA 1YR2A 4IUBS 5LVAA 3JQQA 5CT4A 2Z1DA 2Q5QA 3T7AA 3THXA 1E7QA 3VVLA 1DX6A 2QG4A 5FPYA 4ZYLA 3PJDA 1ZH0A 4D3YA 1IHPA 4EEZA 2X0NA 5B1IA 4YCBA 2DRIA 3TEFA 2ZRHA 3JARB 2ZYIA 5DOZA 1UFVA 5DRYA 5HDBB 2J0EA 3DMYA 3PDIB 5CM2Z 1UOOA 4YUVA 2WOOA 3UT6A 3ZXXA 5J2TB 2CUZA 3V4VB 1Y8QB 5T41A 1VJRA 3ZWBA 4A2WA 3IULA 4EKEA 3F6YA 2O3QA 1M1XB 4K2HA 3DXFA 4YRCA 5HZKA 1ISPA 4QDOA 1VC2A 4PQFA 1DIRA 1N0VC 3D1VA 4LY3A 4EUNA 3LUGA 2B4YA 2QEQA 3AW9A 3P45A 4LK3A 5EHXA 1W7AA 3O0TA 5BSMA 3ENKA 3VKHA 5CYOA 5E9WA 4DKJA 3X44A 2P0YA 2QBYB 2HA7A 3KHUA 5KJEA 4PG6A 2EP7A 1XCBA 4KWCA 5TC4A 2CBGA 2QNBA 4TYWA 4A8PA 2W71A 2KMLA 4DXDA 1XZPA 3UK0A 1EZ4A 1GP2A 4PLPA 3USCS 4EG7A 7REQA 5LXTB 2JATA 4HSEA 2P91A 5GZ3A 2G88A 3OFNA 4DRXB 2OL4A 5LMNB 5AUNB 2PIAA 4Q4DA 3CJTA 1W88A 3D5QA 3LKZA 3BGWA 3IQZA 3NBMA 2VDPB 1FDTA 1N2CE 3EHDA 3LYAA 3W4KA 4Q9IA 4JI8B 1AKYA 5HTKA 4E3WA 4PX3A 3KB1A 2V3CC 4WNAB 2PL5A 3ZV4A 2BTQB 2FZVA 4CUJA 2N47A 2IH4A 2H2IA 1FLVA 1B0PA 1U7ZA 2IQ5A 4KXLA 3OA2A 4XA8A 3F6BX 3I6IA 2JJMA 3RREA 3DVRX 2G06A 2CJFA 3GJ6A 1NA5A 3GT7A 3KJQA 1AA6A 3V4RA 3HN6A 3OURA 1H0SA 4JCCA 1X0VA 3OTGA 3QIVA 3T38A 4P38A 3W4IA 3O47A 3ZE9A 4KO1S 3TLKA 1CLUA 2XZTA 4C3ZA 1T9CA 1L7EA 1D1PA 1XCMA 3EFOA 3QP9A 2CXTA 2G5GX 4MIOA 5THQA 2EKPA 3TZCA 1ZFNA 3IODA 2Q9CA 4W99A 2D8MA 3DKPA 4D45A 4ZHSA 1KAGA 3KXKA 3K0AB 3W9BA 1L9KA 1GGJA 3L43A 3N2EA 5KTNA 4JQOA 1SHTX 5F3WB 4HOYA 4HSGA 3KHSA 1S1MA 5DYNA 1GGFA 5BPFA 1QP4A 2QMOA 4IHJF 2FWMX 5D85A 4BVJA 5JU6A 1DEXA 2BVNA 2Z09A 1SCQA 2EKDA 4R1QA 1N8NA 4O4IB 3ZD6A 5IBQA 3H05A 4BNXA 3T3PB 3CRVA 2PGOA 5C9ZA 1ONBA 2BGTA 3JQ8A 1JQBA 4XQ0A 4V2UA 2ZQ5A 2DX7A 1V43A 1YJAA 3PHCA 3VMFA 3ZHYA 5NLLA 3X2FA 2FPXA 3B53X 2Q9AA 5E7MA 3U44B 3K70B 4XDGA 3LCRA 3NWOA 3KLNA 1P2GA 4ZHQA 2DWOA 2Q9BA 2GRAA 3X1ZA 1AUOA 5CITA 5FBKA 4NNOA 2JLRA 2PRYA 4UUOA 3UMFA 3CUWA 4B87A 4FDMA 2X7HA 2GYUA 3A6JA 4IW3B 1IY1A 4GHWA 4KQ2A 1L0BA 3EMVA 4DMLA 5EQDA 2IW3A 3OZWA 4JUBA 2Y93A 2QRNA 3BFVA 1PO7A 3CTPA 4MVJM 9LDTA 3RVKA 2RHTA 4QPCA 1B23P 1BEEA 3NDRA 3S3TA 1L1FA 4A8JB 1HYHA 3FGNA 5IYZF 5JC1A 2UVQA 3D4PA 1EFDN 3ECCA 4DCTA 3QLUA 3GQBA 1MQ9A 5MDHA 1KQPA 1TW3A 3FIUA 4O8CA 1WKBA 4RULA 5LBTA 4P5EA 3OQBA 1GSHA 1NW7A 2XWJI 4WXHA 1HNWB 2P9TA 1TTTA 2P2CA 4TLBA 1RQ2A 1S4QA 1LPPA 3GEDA 5EJ6A 4O2BF 1JQLB 3OFND 3QVTA 2VTVA 4HWTA 2FE1A 3W7AA 4EJ2A 3GA7A 1LRLA 2H0QA 5E4FA 3R8CA 4H7PA 4PFJA 3TI9A 4DCGA 3AZQA 3P2YA 4DV3B 1SUCA 4NRDA 5DGTA 4DHEA 1M5RA 4L08A 1D5CA 2R6R1 2R4QA 4CFYA 4D9NA 5JISA 4OLHA 3COWA 3RSLA 4BUCA 3D2AA 2XB8A 1ZNWA 3AFGA 2BM1A 3TPCA 4Q1VA 5GVSA 3KQMA 1QUEA 2BFCA 2XYQA 2YIMA 2EP8A 4TS3A 4W82A 2GCOB 4KN9S 3LW7A 3EZYA 4YJGA 2JAQA 2XT0A 4JODA 1YVDA 2OV4A 3U7RA 2J7PA 3MMNA 4LMPA 2DOKA 1IXKA 2PD6A 3QPCA 5CH3A 4DPLA 4QAQA 3ZY5A 1XTBA 2A0FA 2Y9MB 3DBIA 3H1PA 4EY4A 2C88A 2OBYA 3ROKA 1PD1A 1RQLA 2ISQA 1KO7A 1VE5A 1R66A 2A5FA 1R4MA 3PPWA 1NC3A 4KGDA 4QUJA 4UTNA 5CDHA 4J0JA 3EPKA 4KC0A 3TUJC 3HWSA 1V1JA 4I4TB 3WGIA 3C24A 4DV5B 2G36A 4E1AA 3A2NA 3CQ9A 3KYCA 3Q88A 1Y9ZA 1GNTA 4HDNA 5BNIA 2QM0A 3QF4B 3QVLA 4F21A 1NP6A 4FHCA 2FQ1A 3U7GA 1E2FA 3TI7A 4CKEB 1TJ3A 2VP5A 2HPZA 4OKSA 4ITUA 2XBLA 2HSJA 3A6GA 4PYLA 4QYTA 1PWXA 3D7KA 3I01M 5ALHA 2ZRGA 1QIGA 2MTBA 3ZGLA 2C96A 2RHRA 2HEIA 1B1AA 2FOIA 3N86A 4WKNA 1DTSA 4LHYA 3QEAZ 5FKJA 1CT9A 4ZTBA 2FVYA 3OLWA 4LHVA 4RADA 5B3LA 4WLEA 1PZXA 3N87A 3UH0A 3V3KA 1IB6A 4CV1A 4M54A 3DEJA 1ZCZA 5BO5A 3WZLA 4CEIA 1EWYA 3S28A 2ZRJA 4ZIRA 3U62A 2FZCA 1N2SA 1TU3A 2O6LA 1ZGZA 1TO1E 3OCUA 5IJWA 1MO4A 4WN9A 4LEIA 1P0IA 2V54A 1VJ0A 1TEXA 2SNIE 1Y42X 3QSGA 4N6GA 5L7YA 4WDQA 5L3QB 1NDQA 3HA2A 1MOQA 4YC7A 4EB6B 1PT6A 2HMSA 3D8UA 3OAAA 3FSGA 2XB9A 4LZZA 5AI0A 4C04A 4UTRA 2DYKA 3M89A 3OBBA 4PYOA 1O95C 3R77A 2QR5A 1RAIA 4RY2A 4MSUA 1SVUA 3B78A 4N5HX 3T7EA 2DWPA 1PWZA 5J5VA 2B1QA 3MPOA 1XJQA 3L7YA 2D5AA 4MCHA 5HJEA 2I6SA 3O4IA 1I3NA 3KQSA 1U9CA 3DFFA 4A0QA 3AERB 1IJBA 1AKNA 4KNVA 1L3IA 5LQRA 5D84A 4CMIA 4FE4A 2BL4A 3H7IA 4BBAA 1H6CA 3M2PA 3QPAA 4Q48A 1U2EA 3VH2A 3PXGA 1WIWA 2P5TB 4PG5A 4FCVA 1D2RA 2WWIA 2VRBA 1ZISA 4XARA 4H1WA 3GLIB 4LYDA 5G0TA 3DWEX 1NXTA 3GHYA 3TD6A 3UVEA 4Q9NA 4FIZA 1POWA 3VBEA 2VF8A 5A4AA 4XFDA 3O8BA 2G1AA 3JYNA 4PPQA 1XAJA 3PNMA 4KUHA 3K09C 5HIJA 5KYVA 3B3JA 4MQ5A 4AJOA 1XTQA 1F4PA 2J7PD 3THWA 3VYVA 2G1PA 1OIWA 1XPJA 2KSQA 4FEGA 2Y1WA 4ESOA 1G8PA 1XQXA 4DREA 1UXIA 2PA0A 1A4UA 1Z4LA 2C5HA 2NP7A 2QUHA 4MRVA 4JELA 5AESA 3HR8A 3D1JA 1GUAA 3GCDA 2AX3A 3WAGA 4MHOA 1KL7A 1Y4UA 4QFMA 4RY0A 5FR1A 1HQYE 2Y67A 2ANBA 4CMHA 3ZNPA 3NTXA 1P9WA 4RDIA 1JR2A 2EXXA 3RTEA 3CYFA 3P9NA 2EFCB 2CE2X 3I3SR 4JSTA 5TV2A 4NBWA 4XTCS 5C1DA 3C6MA 4YCLA 2C2BA 1JGTA 2FPKA 2GZHA 2VT3A 4YPVA 4KO8A 4GUAA 4I50F 4N8EA 5TJHA 4Z0NA 2B8EA 4C2AA 5LQCA 4HX5A 2QN2A 5IZCA 4A8HA 1Y4ZA 3L1JA 2ZJOA 2AN9A 4AFNA 2AYYA 2GD0A 3R5SA 5JSZB 4ZT2A 1TYBE 1JIIA 2G5CA 4CM9A 3DEIA 3G02A 2IPOA 3IJ5A 4UMDA 5FLYA 4WCFB 4WNYA 4HDAA 2O5EA 3N74A 3FRHA 3KKLA 3BE5A 3LQFA 4Q34A 5ENVA 4EG3A 2BR3A 1E79A 3DEAA 5AUQA 3I8SA 4LHXA 3TZBA 5L3SB 1BG6A 1XDDA 3UPDA 4XWAA 3AU8A 4X8LA 5ECGC 3L7DA 1R3DA 3AESB 1LTKA 4ML3A 2JIDA 4O5OA 3HSSA 4BVHA 1WB5A 4PX5A 4ZPXA 4RETA 4KQKA 2XEDA 4C0KA 1Y1QA 3P97A 1EPUA 4N48A 5GV7A 5EIEA 2Z2IA 3Q85A 4BLVA 3OAAD 1A69A 3FSGD 4LRUA 4FGWA 2PXHA 1QKJA 4P92A 2C84A 3MCTA 2FPUA 1N4AA 1P62B 3KB2A 4HEA6 4TVKA 1N36B 1Q0RA 1Q50A 4MROA 4D8UA 5JJKA 3RVLA 3EZ9A 3SMVA 2R79A 1FNBA 1U0FA 2FW7A 3MCWA 3Q6MA 1YRAA 4G5FA 4ZEMA 1KFBB 1V5WA 4NYIQ 3HRKA 4RVNA 2V5VA 1VE3A 1N6HA 3E1SA 1Q7RA 2Q7DA 2NO4A 5K8UA 5TQJA 1NUSA 3EXAA 3H0KA 4QPJC 1DCMA 2WSYB 1QH1A 3BF7A 4XGNA 5K45A 5FI0B 4EATA 1Z8DA 2ZYRA 3KR1A 3TR0A 1WXHA 4HPWA 1T5HX 5I7FA 2W11A 4R1PA 2DVMA 3P9PA 1EP2B 1I3OA 4C4XA 2B92A 4LSGA 2LCFA 3F6SA 1BRMA 5KSWB 1OTHA 2O0LA 2BGRA 1KOFA 3G9UA 4PZZA 5DGXA 3F71A 4N5LA 5IKOA 3B1FA 4JGBA 3RKUA 3C74A 2FPWA 1IOWA 3OOWA 2AK3A 4JYBA 4CG2A 3GLFB 2XWQA 3ZOKA 1NR7A 1ZD5A 3GEEA 2FLVA 3G2QA 1P4AA 2HU5A 4PGGA 5E4TA 3SZGA 3GJSA 4FDUA 4E5VA 4F45A 2FUKA 1WXIA 5CPBA 2ZYDA 4KOEC 4NQRA 1T9BA 3N07A 1W5AA 5J5AA 2HA5A 4AZ3A 3TF5A 1EFHA 3JSXA 1EGHA 3ZDZB 4EVRA 2HH9A 1JKJA 3GGSA 2D2FA 1H4SA 1QYRA 1J33A 1VZ3A 4OHWA 1Y0BA 1LVHA 2F4VB 2ZRMA 1KSJA 3I72A 4DOMA 4F9EA 5C8ZA 5KTSA 1ZJYA 5F5LA 1ORWA 1OFUA 4AK9A 5IT9A 4KDFA 2IHVA 1F4LA 3R09A 4ZICA 5DE3A 4V0RA 3PGVA 4HH3C 2CW5A 2KLBA 4MNTA 3KVOA 3K4PA 1XRJA 1QGUA 3PFGA 2ZK7A 3LG2A 3IUSA 3EOBI 1EVZA 2H06A 3TQRA 3UHPA 3F5FA 1K6IA 1VDMA 3HJNA 1DKLA 6YASA 2YHAA 5EKDA 4GPZA 1TKRA 4M0DA 5J40A 4HLNA 3CVVA 2C5FA 4I7EA 4Q3LA 1NBOA 1A98A 1ECGA 2IKSA 3CISA 1QPBA 4O4LB 3WLAA 1KI6B 2VPZA 3KSMA 1A72A 1IG0A 2P9JA 3O2QB 3SM9A 4CM9D 2NV0A 2AJDA 1OXXK 3ND7A 1IPFA 5FBQB 2CXSA 4G01B 1E79D 2JZOA 3RRZA 2BT4A 2OQRA 1IHDA 2QZZA 2J3LA 2VSNA 1EAYA 1MB3A 1K6XA 4FWIB 4IZIA 4RGVA 3UK2A 2UKDA 1OXUA 1J0DA 4Z0HO 2X3YA 4X66B 2BC9A 1LPMA 3ICWA 1B2LA 2Z2XA 2PY6A 3DH0A 3AEZA 4M0EA 1UMKA 3Q1LA 2YS7A 4MA5A 4HLCA 2FSSA 3QNUA 3RSCA 2BLLA 3PD1A 3QF7A 1C0PA 3E23A 4FW9A 4P33A 1E7SA 2PU7A 3QBDA 3KYIB 1DBWA 3Q0TA 4UATA 5JXIA 5FBLB 4J0DA 3BQNB 1AQYA 4E07A 2VATA 3SLRA 1NATA 1XFAA 1XN1A 1Z75A 4B2IA 1FVHA 2CFOA 4KQHA 4WZAB 1XA3A 3O75A 3OFSA 2RGGA 3F1LA 1DKPA 2Q3JA 3WB0A 4AW9A 3BXFA 3OO1A 1OZFA 1QG6A 1S01A 1T0PA 4JGGA 1ECBA 2XZDA 3MHPA 4P5PA 4S1WA 2A92A 3VI3B 4D56A 2FG7C 4Q12A 5F12A 2YY6A 3QVGA 3TNJA 3BYZA 1QVRA 5DWVA 3JS5A 1GT6A 3DBLA 4IIJF 3TMAA 1C3OA 4WERA 4DCCA 4FBLA 2WTMA 2UVPB 4FDVA 3L8EA 5IMSA 2CCJA 3DA8A 3K0CC 1EXWA 3SU8A 4OXIA 5BMVA 5JJBA 3BH0A 1ZJWA 1SKUA 2ZBRA 2NUAA 2O57A 1PR1A 2OCXA 3TLEA 1WNTA 1ODIA 2PGXA 2Y0BA 3N0WA 4G9EA 2D1TA 1BX3A 1EWRA 1RLJA 1Z26A 1OMOA 4BJ1A 4EPRA 1SEPA 2WIJA 1B4DA 1ONOA 1VRVA 2A9FA 2KI5A 3DDWA 2K6GA 3ZX5A 4F92B 3I61A 2KPOA 4K9KA 4FUQA 5EG5A 1NRXA 3TLCA 3WKAA 1M76A 5DN9A 3B1YA 3ERCA 2ZBFA 3CX6A 1VG1A 1L4HA 4B6PA 4P3NA 3TX6A 3AR5A 1CG6A 1OLXA 4JI6B 2I4OA 5BMOA 3EPPA 2H92A 3SG0A 2I65A 3HU3A 3KQLA 1UDRA 4XVQA 3GJ3A 1HSZA 3L6CA 3TQCA 1RRKA 4DVGA 1GEGA 1MO2A 1LD3A 3I5MA 4IOJA 2W8ZA 2ZWMA 3CUVA 2BCJQ 3T61A 4B3FX 2E5WA 1HZZC 1VBKA 2I3AA 3CZCA 3LYUA 2XQJA 4JENA 4C4RA 1N5KA 3LUAA 5EHIA 2G1UA 3I9OA 4EHLA 2XCSB 2VNKA 2GEFA 1G7TA 1NQXA 3B85A 3DKVA 1TE2A 2CXUA 3KCQA 4HI0E 3NOXA 2PUCA 4YIHA 1D7OA 1ZUIA 3MSXA 1CIVA 1SMKA 2G1JA 1NBMA 2AXEA 1FFWA 2W2PA 2ET6A 5K3DA 1A7UA 4EF6A 4G86A 5MN6A 2ZJ4A 2H48A 1PJ8A 5G0VA 2A5LA 2WJWA 1M8GA 1ZKDA 3NJ4A 1FEZA 2NU8A 2GXSA 4MR9A 2WSIA 2C2OA 2PH1A 5D1HA 1QH0A 3NVDA 3TRDA 3TXAA 3S1LA 2QU7A 1GFIA 1FX0A 1WEKA 3QUBA 2F3SA 4WKCA 4B75A 1N9GA 2D2XA 4J29A 3W2TA 4OK6A 4CKCA 1OA0A 3HKCA 2QPTA 3DLHA 1QHGA 4WUTA 5JPCA 3IA7A 3RC9A 4ZK6A 1UZAA 3S2FA 1AK2A 5EIBC 4KDCA 2ZR9A 1F2DA 2AQIA 3RKRA 2CBXA 5IU6A 2SKCA 3RAFC 1EFLA 2E49A 3QEKA 4IZOA 3RT7A 1VB3A 2JEZA 2OOSA 4JYMA 4CT0A 2GLXA 16PKA 3OY2A 1R74A 2D0IA 4ENTA 1SQSA 1QHNA 3UXEA 2GCNA 2JS7A 5D2CA 1CUVA 4X91A 1OI3A 5F23A 3D8BA 1SBNE 1HOXA 1I7SB 3IUPA 4DV7B 3N7UA 2FR8A 2IY7A 2J4CA 3EGXA 2JCYA 1P1JA 1S3IA 3W2HA 4BAUA 4Q7JB 3CLUC 5JNLA 5LJIA 3HRHA 3V32A 3QK7A 2COUA 2Y2VA 1C3EA 5ALXA 3DOCA 4G5SA 1QYDA 4MUBA 5A1TA 5IUKC 1D1QA 1QYCA 4DWOA 1MC4A 1VLMA 2X0JA 2Y71A 1YCFA 2ZIAA 3ANLA 2CDRA 1Z7YA 2K2WA 2CNLA 1QFJA 3EHEA 2IDMA 1PDOA 3FM9A 3NWEA 3PCRB 5C4GB 1USWA 5DXAA 2X7JA 4HTFB 4YAEA 3U4AA 2Q6VA 2Z43A 3L8ZA 3CEAA 2Z8YM 4JR0A 3PFCA 1OZGA 1QRAA 4DUGA 1YA6A 5EFZA 3SX4A 1U1DA 5LLTA 2G09A 1RT9A 5ALNA 1CIJA 4OXXA 3GVXA 1GHTA 3NP9A 3LZ6A 4PQGA 5L45A 2CXNA 3I92A 2OQIA 2OGSA 4CEJA 2AOUA 1HTBA 1M0EA 2WFZA 2IHBA 4HQOA 3SBEA 4BKQA 4N8SA 1F9AA 3TIGA 3QNWA 2NW6A 2WTBA 1QTQA 1S2NA 4UNRA 3U26A 3P32A 3A7DA 2BDUA 2AN4A 3F8TA 2PZBA 1T34A 1XZLA 2Q6KA 4O3MA 3DE1X 3IBYA 4XVRA 4K9QA 4KQWA 1N5JA 4O2AB 5C18A 5BUZA 1T2DA 2C8VA 2GLUA 4KLRA 2NACA 3GLGB 5DSZA 4DTCA 4WBNF 4OAOA 1JJAA 4CF6A 1OE0A 2X4LA 4R3WA 3RF7A 2ZAGA 2CLIB 3TINA 1T25A 1TFRA 1ORTA 2IZOA 4FONA 4DNPA 2WSSA 2YFHA 1Z2AA 4UQLA 1J5PA 1NBMD 5C1OA 4YJ2F 4XGRA 1YT5A 3UKDA 4BO1A 3IE2A 3PD0A 3RWMB 4RGYA 1JDJA 1KHHA 2ORYA 1GLGA 1I4DD 1Y7LA 1GTSA 1GZ5A 3QPVA 2FVXA 4DAOA 5DMXA 4YYEA 1M8FA 3CR3C 5ALTA 3IHLA 4ZCQA 3M6FA 4B3JA 2DBZA 4BO9A 1XVVA 1HE5A 2EQ5A 2A5GA 5A9RA 3PX7A 1KO5A 4LOJA 4HQRA 5EZYB 3FVRA 4BMPB 3C3YA 4RH0A 4K26A 4D8YA 3C98A 1JEQA 1P9RA 1TJNA 1UK7A 3VHXB 4IJUA 4YMLA 1XROA 4LDZA 1UKBA 1KAMA 1CUWA 1WTCA 1SCDA 3JWJA 5AJUA 3EQ9A 4D9IA 5FAKA 1FU8A 3D43A 3IUJA 5KQLA 1M72A 3W7VA 3RIEA 1DJQA 1P1RA 2F43A 4BFLA 1M1YB 1BE0A 3D6VA 1P33A 1RQXA 1D2EA 5LYJF 2F8LA 2XIQA 4LJ8A 3FLBA 4JY7A 2CZQA 5BSTA 3RK0A 1KEPA 1JE0A 3E03A 2UYCA 3LVFO 1K7FB 1RKXA 5KQMA 3Q2IA 4RC9A 3LL4A 2B1IA 1PVOA 5FH9A 1BRTA 1I8TA 2VP3A 1DPGA 2B36A 2I03A 3D7SA 3BEOA 1UXGA 3EXHA 3N0XA 2JK0A 4KXUA 4X6LA 3PX2A 2M6SA 5LFAA 1Q11A 4FWBA 4KW7A 4F38A 1N5OX 2IKQA 1YL5A 2OD7A 3K8YA 3E22A 5K0SA 3E7DA 5LP6B 1UT6A 3JVVA 4LCBA 3FPAA 1XD9A 1ZOLA 2XQVA 2D5BA 1XEXA 2I2BA 2ZEJA 5A4IS 3EISA 3PUYA 1A50B 3CW8X 4MJXA 3ZZMA 1K8RA 3V1NA 4DUGD 5K20A 3ZZUA 2Q8PA 3WDKA 2YIJA 3L92A 4KUEA 1H9BA 1SOAA 4TVOA 2VXCA 5HBGA 2WDZA 4U6NA 4W9NA 3I5XA 1C3XA 1D2MA 1PWEA 2ZI9A 1OYWA 3OEYA 4Q9DA 4MA4A 1DRJA 4ARAA 2W48A 3OT1B 2IBTA 1BQEA 2BFBA 2ZUCA 4KH0A 1EUYA 3VKWA 1ZW1A 1BFDA 3U0BA 4CI0B 1A9YA 3GEPA 4Y7DA 1IVYA 1YJ5A 3ESQA 4LECA 3S1AA 1IN1A 2XNCA 3HCDA 3O8NA 2EFHB 1M6HA 2H52A 3MJHA 4PLFA 1Z2CA 3U9LA 9ATCA 3V4SA 1SCAA 2DE0X 3SKXA 4W5HA 4OB7A 2VT6A 3AETA 4ANFA 3R7NA 2OCKA 1QVZA 5K3CA 4ENSA 5A6VA 3IEMA 3OECA 3O1IC 2ZIZA 4DA7A 1W4AA 3A3OA 4LV6A 4B8ZA 4MLDA 2EZ4A 2NUPA 4YY3B 3H18A 1KKLA 2GKGA 4ZTUB 2WSSD 3SDBA 3T95A 3ZXYA 1I7DA 3PYMA 4DM3A 5JCOC 3FJOA 3T8YA 1U81A 1J8MF 4CKZA 4PLGA 2VXYA 3N1UA 3VSBA 3NS7A 1EGAA 1QP7A 3LK7A 2R7AA 4MUYA 2F1JA 4FINA 5ILGA 3W1EA 5AKGA 4DWWA 1JS1X 2P79A 2ZYAA 3L0YA 2H6EA 1SKAA 5T57A 2EYUA 1D0SA 3G6KA 3QITA 1C2YA 2IHKA 2VPYA 5DYYA 3FLMA 3VJKA 3EVCA 4X1IB 3R0QA 2QP9X 5EUCA 2HQBA 3T9CA 3K8ZA 4M7OA 4BN4A 4FFNA 3PJRA 5KNBA 2QXUA 2P4HX 3GCGA 3OWOA 1R16A 1ARZA 1KR5A 3T99A 3B6ZA 4ISBA 2OAP1 2V0NA 4KLAA 3TQSA 2IZ1A 2WQ7A 4G0QA 3LOQA 5IC6A 1ZICA 3SX2A 3A6FA 3L7KA 3RQSA 2A0YA 1BO6A 4DWJA 4DZRA 4V0ME 3ZGNA 2R1VB 5ARDA 2P2DA 2I7DA 4R2JA 2JKVA 4DA9A 3BMQB 2XAUA 3GLUA 4O2AF 2CB0A 4IDDA 2BFOA 4ZRMA 2I2DA 3TW8A 2O8BA 3BMCA 2DG2A 3I8XA 1XZJA 1UJ5A 3CUTA 2I8CA 5KWIA 3F73A 5FNZA 3BE6A 2Q6IA 5DX1A 3HJTA 4OEHA 4PC6A 4CUZA 3ULKA 1LSUA 2FFAA 3B2EA 4FD3A 5IF3A 3AXTA 1SVLA 3DMNA 2A30A 2I8LA 2QMUA 3DJFA 4X7MA 2FQQA 1X14A 2NUBA 3B6JA 3ETGA 1DS6A 1V4BA 1YVUA 3VR5D 4OHCA 2BMVA 1YUBA 3EGDB 3M6UA 3KLPX 4GC5A 1TCAA 4TLLB 4B48A 4MVJA 3Q8KA 4AZTA 1Q44A 2EERA 3D3JA 3OE7A 4C6SA 4HD8A 4A5OA 2XDWA 2NAFA 3GEHA 4D4HA 2CVHA 1GNRA 5IBRA 2VRCA 5A9SB 1I6MA 2GPSA 5FUQA 3ND8A 4B82A 3RUAA 4BS9A 4UUQA 1GVHA 3RBAA 2E2WA 2HTFA 1QRDA 3GX1A 1P0FA 1T6BY 2D3WA 2HHCA 2RGXA 5TGDA 5BYAA 3M4YA 4CKWA 4INZA 4CETA 1G21B 4HNAA 1NG1A 3TKLA 3UWMA 1FE8A 2BFDA 4X60A 2P3OA 4OTZA 2WUWE 4MUFA 4EGQA 1M0TA 4TRRA 1S89A 3WYBA 2FWRA 4P93A 5CP8A 3R3SA 4X94A 3ME5A 1IULA 1OTXA 2RGYA 1WOYA 3KJEA 4AUKA 1WZUA 2YNMC 3IXMA 1RQ7A 4N6OA 1PJLA 3BSYA 2R8EA 3MINA 2HOQA 2XRMA 2W2VA 3EF0A 3FWKA 3ADOA 4W1PA 3S40A 1XU4A 3L0OA 2Y99A 3RE1A 3ZWVA 1O87A 4YJDA 4QQFA 1Y82A 3EWAA 4BJ3A 4NENB 2AZ4A 5ESWA 4OHZA 3ND5A 3D0RA 2NO6A 2G77B 1ZMBA 1CR0A 4IF4A 4K9MA 2PD4A 3ML1A 4JROA 4CLRA 4TXMA 2BGNA 3IV9A 1EFPB 2QL7A 3AVUA 1HDEA 4I3HA 2IU4A 2O7QA 3OPYA 4WN3A 4QOGA 4A1FA 1U99A 2V55B 1YDGA 4GD3Q 1JZQA 4H4DA 4F11A 2D59A 3R5HA 3MGBA 3WI7A 4OREX 4EEXA 5KNBD 4F84A 1Y4AE 3RBVA 4IIXA 1Z0DA 1U5BB 2BHNA 2FX2A 2IXEA 3VC2A 1G5TA 2XGSA 1TEHA 3NIDB 1SY7A 2BJHA 2G83A 2XCLA 4LOIA 1CEYA 3SKYA 2D0DA 2Q5OA 2XWPA 3MCUA 4LE2A 1G5FA 3PR2B 1ETUA 1Z5NA 3WNCA 3NDBB 3HU5A 3K4HA 1ADCA 4AMGA 2OORC 1RIFA 3LPAA 2UYGA 1JIUA 1OWPA 4G23A 4IDGA 4PYMA 4E33A 2VP2A 1I4EB 1QYWA 3I01A 4I1UA 3VNSA 4B6SA 3E5NA 4HFMA 5FPPA 4C7VA 1Z0AA 2NYVA 3QY0A 2LKCA 3S2ZA 3KIPA 1T2AA 4EIWA 2P9QA 3N0RA 2OAGA 2ECOA 2XVAA 4I55F 1T8TA 1QAQA 5IMBA 3QWFA 4KMOA 1F20A 1L4MA 2O4UX 4ILKA 3W04A 4ZMRA 4JBXA 1RR6A 2CKDA 2NU9A 3GLTA 4E1BA 1CHDA 1AA9A 5T6MA 3GN1A 1XAHA 4RLFA 1N6OA 1U7PA 4LK2A 3W8NA 4HCJA 3A11A 2XDYA 3MXOA 3TAUA 2CKMA 4MVJD 1F60A 4MPJA 2MSWA 3OE7D 1K8QA 4FQ5A 4L5AA 4Y1GA 5FPSA 1FTGA 5I7UA 4MK4A 3S81A 1G5QA 4FQ8A 3W77A 2Q3FA 1DADA 4D44A 2QTRA 2VRCD 4FYHA 1RS0A 3AK4A 4FX5A 2JAOA 2XMGA 1X1QA 2KLHA 3NALA 2IYOA 2I6XA 4JH0A 3UJ3X 1TZJA 3MCZA 4IS2A 1QIJA 1JDNA 3G79A 4CMKA 4DJ5X 3RFXA 3P52A 3ZCRA 4MUHA 3QEOA 1PL0A 4ZEVA 4PBTA 1EGQA 3RRXA 1ZH2A 4Q7EA 5IH7A 2MMGA 2VF7A 3L4KA 3P27A 4TV8A 1T9KA 2JHPA 1MOZA 2FFHA 2YXPX 4RCVA 2WMDA 2C03A 5K3OA 1N5DA 4QUAA 2UUPA 1UAGA 1H65A 2R1UA 4I0WB 4UASA 3UMVA 5CYGA 5EGSA 2N75A 1P2UA 1H23A 1XR3A 2OMKA 4JLSA 4U7WA 4ZO4A 3QFTA 1X80A 1MLDA 5FPTA 3R7LA 2V7BA 1IG3A 5IKPA 1Z08A 4MS3A 1RJ9A 1NURA 1P8AA 3ZI4A 2NPIA 3GB9A 5AK0A 4JHLA 2AT1A 1E8MA 1FOEB 1GU7A 4DTIA 4CQLA 1M5UA 3BGSA 4ACAA 4AN1A 2X42A 1MUUA 1GZ6A 1OHHA 3CSUA 4LJ9A 4ENPA 2XCOA 2G08A 3GA0A 2BKEA 1V7QA 2IK8A 3BS4A 4L9RA 4K3UA 1ICEA 2H4XA 2YWJA 3KUUA 2YXLA 2XB4A 1ZK3A 1GV0A 3H2SA 4PLZA 2FZLA 1CKEA 2QUZA 1KZYC 4AYTA 5BSEA 3PT5A 1GRVA 1W5TA 3AGQA 3KO8A 3P0HA 4NDNE 3M83A 3B9QA 4URYR 3UAXA 5JMWA 2FPPB 3DMPA 3BB3A 4CQJA 3M3HA 5KDDA 4P22A 1YWGO 3ADKA 1CJVC 1YB1A 1IAQA 4TQUS 2O0KA 4IQGA 4AZ0B 1Y89A 2WUGA 3AOEC 1YZGA 3D2CA 3NR2A 1WW2A 3E3AA 3ADCA 2ZJ3A 1GL7A 1DAFA 3ZE0B 3E61A 1FMFA 1FP4A 4H3SA 1BHQ1 4DLNA 1DRKA 1O5TA 4P0PB 4OXQA 4G24A 3EWSA 5LKAA 3KTAA 1BDJA 1KDPA 4TZTA 4XQCA 5H80A 1U6KA 3NBQA 1WF6A 4YXFA 4S1TA 3O1JC 4BL5A 4F6LA 3C5VA 4M2LA 5A05A 3PXDA 3GXBA 1OYVA 2GEJA 5IXSA 3SYMA 1QKKA 3JAKA 3O82A 1G5RA 1XJCA 3KSZO 1F2TB 1Y5IA 4FFRA 4IDPA 2WSLA 1XT6A 1J2RA 2FWIA 4U8GA 1WW8A 5I9TA 1BD4A 2X23A 3IE1A 1Z7BA 4M38A 4BNZA 3C7DB 4F91B 3H17A 4ZXPA 3G0GA 5TQ0A 2Z8XA 3E1GA 4U7DA 3TLJA 1NW6A 4AC9A 7AT1A 1ABBA 1EEHA 1VIDA 4QZVA 4CEJB 4HNRA 4M0LA 5DX0A 4DVJA 3IMKA 2DJ5A 3QENA 1RBQA 1AKVA 1MAUA 1QFXA 3L6EA 1YOBA 4DQUA 2JJ2A 2F3TA 3INTA 2LTAA 4LHSA 2HBQA 1E6KA 2PLNA 3CB2A 3PRKE 3PFNA 2BDEA 4RU1A 3KQWA 1J0AA 4YIKA 4D5EA 4AS3A 3KE9A 3OTIA 5AKZA 4B4VA 4XX1A 2B8TA 1PQ4A 1ODKA 2FPGB 2QP4A 3JRXA 3K9LA 3KDSE 3PP8A 1WZIA 1KTIA 4EG5A 4X6YA 4JZKA 4DQXA 3N0TA 4DLAA 5IDQA 3TRFA 1NVFA 4QGSA 2AFIB 4W5TA 4FTWA 1SZCA 4GPBA 1KH1A 1L4UA 3P5BA 4R05A 4R8VA 4J8PA 4TRNA 1H8EA 1RTTA 4BNJA 3OQIA 3VJLA 1V6CA 4M9QA 1DZIA 4X84A 1E9VA 1QDEA 3VPSA 2GKOA 3EBOA 4D6XA 2YV2A 3D3WB 2ZJYA 3FDZA 3N53A 4LXUA 3IL2A 2OK7A 4DR5B 4GGOA 3IRUA 2AN1A 3DE2X 1IBKB 3CS3A 3GJ7A 1LI5A 3BJMA 3F74A 1OASA 5D6NA 1PU2A 3UKJA 4QQKA 1IM2A 1Y9AA 3QYFA 1GTVA 1PKEA 3PVZA 2RGAA 4NJEB 1E3DA 2GBFA 4DJJA 4G5XA 5D8DA 5HF8A 4FXOA 4X1YB 2QLMA 4ZYUA 1R27A 3O3OB 4LMRA 2B7CA 4CMGA 2PUEA 3R9WA 2DERA 3PUIA 3CX8A 5SY9A 3SOZA 4EF4A 1R7RA 3I12A 5KB3A 4JVOA 1E59A 1NBEA 4U7TB 3SFZA 4D3FA 3I6BA 2DPYA 3FOFC 1EG7A 1EVLA 4YUYA 1VA5A 3GRRA 3RRBA 3LM8A 4MUKA 4WHMA 4ER0A 1UL1X 2QAIA 4XM1A 3EF1A 4OM8A 3AM4A 5LL6P 4L73A 5A0TA 3TKAA 2IS1A 2P9ZA 3BCRA 1OH8A 4AURA 2G4CA 2ORWA 1G5HA 2BKUA 1TKCA 3PPXA 1V5EA 3EZ2A 3HYLA 4RFSA 4ZQHA 3V97A 2B20A 3BQ9A 3Q3IA 1VJDA 2IYRA 3E9ZA 3E27A 2GF9A 2O48X 1P2SA 1Z5PA 1CF9A 1O4WA 3I1IA 3IT3A 3KKOA 4B3XA 2I2AA 1S9DA 2HHJA 1P1FA 2RK6A 4AROA 1TAQA 2HF7A 2OXTA 1I1OA 5CA0F 5JW6A 1XHFA 1CULC 4M53A 3TL2A 4ZOQI 1ZOPA 1ZU5A 1DHRA 2GMWA 4CNQA 1I36A 1ZLYA 3DFIA 3K9CA 4I1PA 3VZDA 1JEAA 4B85A 2H1RA 2Q2OA 4X1OA 1J7JA 1RCTE 1PTJA 3BJZA 3D5EA 1YF3A 1CUUA 1E1CA 1QS0B 2GAOA 2XOEA 3ZCSA 2F59A 1E62A 5FRDA 3C45A 3ANYB 4QRIA 4LY0A 1OIXA 3AIOA 3K6JA 3G8BA 2PSJA 3A36A 4TMXA 4Q9HA 5D3MA 4P34A 3EDYA 4OHMA 2L69A 2QSUA 5KO2A 4PN7A 4NTZA 2I7VA 4QASA 2WTUA 4V0SA 4B4UA 2OC4A 2XQIA 3WADA 3CEHA 1DBVO 2CVPA 4XUCA 4YX9A 3KXLA 3ZU5A 5BN4A 1ENPA 5GQSA 1EFCA 5CB4A 1E3WB 4YAWA 3DZIA 1XJ0A 1BMTA 3MN1A 1KEUA 3BHJA 1B6GA 2EIHA 2P40A 3LOUA 4JDPA 4MQEA 1G64A 4CLDA 1ADJA 3DONA 5B4VA 5JC8A 2L18A 5KYYB 5EMHA 4XKJA 4I8IA 5TMPA 3QVWA 1H8ED 2YYAA 3WHIA 3QU2A 4M1MA 3MUOA 4TQ9A 1LRJA 5IDVA 1XQ9A 4RH3A 1U02A 1E5VA 4CIDA 4ZYZA 4H1VA 1OH6A 2B98A 1FP2A 2IY8A 2H85A 4X8HA 2GX6A 4P5DA 4G0ZA 3LU1A 3ANMA 5F5NA 1Y5NA 3DZBA 1VLQA 4HAWA 2LCQA 2JZNA 4NDAA 1YAJA 4BNTA 1NP3A 2PLFA 2BFAA 5CK5A 2FKAA 4R1TA 4FMCB 1W5SA 1INLA 4PO9A 3L06A 4I5IA 5ALFA 1OF1A 1SIWA 3IUQA 2G67A 3H8WA 1UC4B 2HREA 4YJ3B 3C3JA 3HUTA 3RI3A 2A9JA 2P8SA 4JJGA 5EQFA 3S0JA 4BX3A 4DMHA 2VHTA 4J9VA 3BDAA 3GMIA 5BNWA 2AJTA 2JBHA 3AEQB 3KLOA 4U2CA 2C2YA 4IHKA 3U60B 3V1TC 2WJZB 4TRMA 5KX5B 4D8WA 1HRDA 4LNAA 4AUMA 1I5OA 5NULA 5JCJA 1OX6A 1DTWA 1ZWKA 1CUXA 2CCKA 2ZAMA 3FSEA 4QWWA 5DYTA 5TR9A 3EPRA 4HQNA 4OA5A 3PUVA 1PJQA 1D8TA 1FB5A 3I9LA 1WHSA 3OZIA 3FZGA 4EBBA 5KPJA 3HZOA 4QELA 3PIIA 2WD8A 4CV2A 4CEHB 4XJTA 3TOXA 4GLOA 1Z6ZA 3BWMA 3K05A 4AI6A 1TQ2A 2Z5LA 4FVTA 1GTL1 3I9JA 4N7BA 1QF9A 4UUNA 1RXWA 2ZQZA 2XE4A 2FSHA 4X3CA 4Q39A 1M8KA 3P19A 2HF2A 3L18A 5BN5A 4GEKA 3KL4A 3BZUA 5B64A 3A1UA 4MV1A 1JG7A 1ANKA 4E5DA 3R7SA 1JLLA 4IH9A 1Y3AA 5HK9A 1LPSA 2ABWA 2QN1A 2BKXA 3CU5A 3GYBA 5HILA 1W1IA 1RVV1 1JSXA 4MGIR 1UBSB 4EYOA 4QDTA 3ZDCA 3OSUA 1I1NA 3SXUB 4QVKA 1AMUA 1NBAA 3OWHA 3WXBA 4US0R 3GFTA 5GINE 5CJPA 1CY8A 1BVHA 3H9EO 1Z88A 4BN0A 1UM9A 3OM0A 5F78A 3GDWA 2PKWA 2ZUVA 1CZRA 4O0MA 3UAYA 3ADBA 1KY3A 4FGSA 1RZUA 1YS4A 3G49A 2SBTA 3FMFA 3ICPA 3JD4A 3MOSA 3THSA 1VJTA 1T36A 3N2GA 1XPRA 4P3OA 4FZ5A 1S8NA 1TA4A 2QENA 5HP4A 2AMVA 4DBVO 5A3RA 2CXOA 3B6IA 3EG5A 4DBLE 2AQKA 1I13A 2I4RA 3IIKA 4UE2A 4FEAA 4BKPA 4L4SA 5A5FA 5JRDS 4W1SA 2WJYA 5WRFA 1MBZA 4PHTA 4AKTA 1DKOA 5HJ7A 2OXCA 2ZE5A 1KQFA 2C2GA 2Y4NA 2ZE8A 1R8JA 4OAPA 4REQA 4MGHA 3VMMA 1PZMA 3WL5A 2WR8A 5D7BA 3C6YA 2HT1A 1D2CA 3HN7A 1V9SA 3QHQA 2QPOA 3CIFA 3PXAA 4GYJA 1JMKC 1AG9A 3FPHA 1E0SA 3DD5A 3MTJA 4HBZA 1UBUS 4BBZA 4DG5A 2XVZA 4XD7A 5HF6A 2RGRA 4MRPA 2QD5A 2IDZA 4KAFA 3HO1A 3GLFE 5GGXA 1T9GR 5DLDA 3KOOA 3WRVA 2PYZA 1G8AA 1KGSA 2AZTA 2B9EA 2VHUA 2AKAB 4YDQA 3WGGA 5LB2A 1F8GA 2A88A 1C81A 4XYBA 1PGPA 3IELA 3MD9A 3UT5B 1F3LA 4F4FA 3CCFA 4WBNB 4B3SB 2H08A 2ZRCA 1EDOA 4YT8A 5JNTA 4D3SA 2Q0QA 4ALJA 4IJ6A 1I4OA 3F9CA 4GBMA 4DS3A 4GVLA 4KMMA 2DPMA 1JEJA 5GJVC 1KTVA 3QELA 5HQ3B 2O8CB 2Q6OA 3W5VA 5JCJD 1DZ3A 2D06A 2ZIWB 1LBTA 4F4CA 2ZRPA 4MMXB 1N6LA 2FCRA 3BFJA 4HMOA 4CMAA 3G9QA 4ZZ1A 1JAYA 3X1WA 4E4YA 2O8FA 3ZBTA 3MOGA 4AJPA 4ND3A 1JLMA 3PENA 5HGJA 2FWNA 3CHYA 5FI1B 5B6IA 1R9NA 1UDXA 4QDUA 3MNFA 4PG8A 1ZL2A 1WQ1R 2EG9A 2G7MC 1ULUA 2A5JA 3HV2A 2OBLA 4Q4HB 4RDHA 2DM6A 3SSNA 1E7RA 4ZVMA 1H2WA 4C22A 2QYOA 5BSHA 1X1TA 3E3MA 1G55A 2CY0A 2WJPA 4RV9A 3N8KA 3IDAA 3INNA 4IM7A 4AX4A 3MJSA 3IT0A 2BGUA 2PT5A 4J4HA 4JLPA 4LGMA 4EUEA 5ALGA 2Q1UA 3DR5A 1CY7A 3PDUA 1SC9A 3G2OA 1HTTA 3ZU2A 1U2DC 3ESXA 4H59A 1FTSA 4TKVA 2QVBA 2G9QA 4BNKA 1N3BA 4PVDA 3O0DA 2ZBQA 5FV4A 4MIYA 2OMEA 1UJMA 4URWR 3T5BA 2QTBA 4LISA 4WGFA 4KE8A 1U0LA 3ZHBA 4RQTA 3TRJA 1KWGA 2PMFA 3NPAA 4HNHA 1CV2A 1GNPA 2TYSB 1JWBB 1BH2A 1GLNA 1K97A 2JVIA 1IOZA 3L7BA 5M29A 4NE2A 3RJ9A 4ZYXA 3FROA 1PK9A 1KZ7B 1P4HA 4ABTA 3BA1A 3BD9A 4KFSA 4YNBA 2QJRA 1U6JA 5ER9A 2YHBA 3FVVA 2Z2KA 2NO7A 3BK2A 2NVUA 3LQ4A 1JHPA 1JEDA 3LCCA 1Y1RA 3MMZA 4E2FA 4H18A 4BASA 4RTSA 4CMEC 1FUKA 2GZMA 1QJ4A 1UT8A 1VB5A 1T1JA 3FGOA 4XD7D 1F6WA 5CDGA 2V6GA 4Q3DA 2QN7A 2CXHA 2K87A 4AO6A 2CHVA 4DG9A 4EARA 3NGLA 4YRKA 1H4VB 3K2EA 1C0EA 1FYVA 2J45A 1M0SA 3MF4A 2IDKA 1UMCB 1U0BB 3RSZA 3OTWA 1Q6ZA 4H31A 4N65A 4NZPA 4TS4A 2ZULA 3P0JA 4D74A 3LCUA 2IY9A 4QWMA 4DSZA 2WG0A 3BKWA 5I9BA 3VZPA 3ZCVA 5AW8A 2GAIA 2V9CA 3DAHA 3DL7A 4FPXA 5HPYB 4JLMA 2HJSA 1Y5MA 2VQ6A 3IB6A 4DNFA 2P8JA 3HBNA 2IP4A 2ZZMA 1T9DA 1WR8A 1X0XA 2PZMA 3HXPA 1Y4SA 4RY9A 4EHKA 3F3YA 4TPKA 4MLCA 1TLLA 4MDYA 3EGEA 5BV2P 4Q5IA 2REQA 3A6DA 4IBOA 2X9QA 3TW0A 4F5YA 4KACA 4DC1A 3DL0A 2I22A 3FFAA 1W30A 3HKDA 4B33A 4MR7B 4DCOA 4E0BA 3HR7A 1AVTA 2GXAA 1T1IA 4DM7A 1OD6A 1PYDA 2OKCA 4X93A 2PZLA 3FRJA 3H2HA 1QZTA 4QYXA 4UVHA 3SC4A 1AY0A 1IBRA 4W7SA 3AWDA 2YFYA 4QG3A 4Z9YA 2ZBUA 2PMDA 1TQ6A 1XZGA 1JF8A 4G0NA 3F8WA 1CUZA 2I9KA 3RYFA 4TYPA 2I29A 2VQ3A 2HNKA 2WSMA 3ES9A 3PLRA 3T54A 2DCUA 3WWYA 2AOXA 2PX3A 1G59A 2CLEB 2F3QA 3ZD9A 3GNLA 4RK4A 2Q7XA 3PHBE 1AN9A 3VHQA 3KS9A 1JPVA 2ZXEA 1ZESA 4V0KA 2H17A 1W73A 2K7ZA 5KCMA 2QJFA 4QBHA 1XZDA 2JFOA 5EZSA 3K5IA 2J0UB 4HWOA 5I9SA 3WIEA 1WO8A 3CLUD 4MCIA 4MQBA 4P0TA 1ZM9A 4CTMA 4ZA2A 2XTAA 1FDVA 1W48A 2ZWVA 4QRDA 1DXOA 2FUCA 4RZ3A 5G0UA 1H05A 4D99A 3I62A 3RSHA 3ELYA 5H59A 1CS4C 2ID4A 8MHTA 4MARA 4YQEA 3I4LA 1PGNA 2PM8A 1E94E 2H2WA 2XI4A 2Q3DA 4FCCA 1L5HA 2J0SA 1ACLA 4MIKA 5ITZB 1VFNA 2Q29A 4H7HA 4LNHA 3ED5A 4UOZA 2IF0A 3FI0A 2QAGA 1XEAA 3ZY3A 4JHXA 2IVFA 4HN2A 2B1JA 1QTRA 1Y9EA 4E15A 2FDXA 5GZ6A 1JRLA 3LZDA 2ZSHA 2B4AA 3H6HA 3LHIA 5ALJA 5HK8A 5FTMA 2YVUA 3W1WA 4MULA 1HEUA 2ORIA 3KOWA 3EIEA 1QZUA 2Q99A 4MEJA 3SN6A 3KWFA 4DR3B 1B93A 1V3VA 3AY0A 1JNYA 2JHFA 2R8BA 4JGIA 4YONB 2FYTA 3U3XA 4BB0A 3QE4A 4DZTA 5D7NA 2XDQA 1PJ4A 4W63A 3DAPA 4ETWA 4HDRA 5GV8A 5EJ7A 1GNVA 3ELUA 1DJMA 4G2NA 5IC4A 3AM1A 2ILVA 4B3DA 4B6FA 2ZRAA 5H3LA 2ZPUA 1COWA 1GVNB 3SIRA 2OXEA 4GX2A 2ZKIA 5D5HA 2OPHA 4RO0A 4QJ3A 3M6MD 4N49A 5BR8B 3VYUB 5FO0A 1NG9A 4RE5A 2ODPA 3DCIA 4N12A 1N8SA 3M8KA 2VN8A 1QGYA 3KHKA 3M5DA 3A9TA 1TQ8A 4CCSA 3JVIA 5BUSA 1E8NA 1BWSA 4A73A 4P0QB 5COBA 5L4NA 1EWVA 2EJBA 2WHPA 2JFNA 4H7DA 1VL2A 4ZVOA 4PQRA 1E2DA 5H4HA 2AFRA 4RVSA 4ID9A 1GXSB 1ZMXA 3C4JA 3RSSA 3PVSA 2V7XA 2HFJA 1O08A 1RKUA 2WW8A 5JD3A 3EY4A 3DNFA 1F8FA 1LI4A 4GU5A 4I36A 2ZRLA 3A05A 3VPGA 2ZATA 4UBJA 3VNQA 2HM7A 1VZ2A 2F55A 3T3NA 2CNDA 4K86A 4YJHB 3RC7A 5AOBA 3QX8A 2EKQA 5HQJA 5F3DA 4C7XA 2E18A 1YCDA 1ULSA 2C2MA 1NMZA 1T5IA 4WZZA 3EFEA 1UFQA 1UPAA 3EWIA 5EE5B 3SBOA 3WQSB 3AUAA 3TPZA 6ADHA 1NYQA 2CUNA 5JLJA 2BRUC 1E9CA 4XH9B 3BWDD 4KK4A 1D8AA 5CVCA 3AP3A 4XB1A 3E7PA 3WYNA 1T3SA 3WGUA 4MGEA 2X0DA 4Z4FA 1ST3A 2A86A 3H2KA 3VDNB 4H4CA 1SQFA 2Q3CA 2VNSA 1BE6A 1MW9X 3LECA 1GPUA 4A92A 1X42A 3GN2A 5EJIA 3GUVA 2CMHA 3C5CA 1CRLA 1KYTA 1U3WA 3FWNA 3MS7A 4GBGA 4JUFA 4WY2A 4KYUA 1EBUA 2IS2A 3EGWA 4PIMA 1M1YE 1OYYA 3FR8A 5EL0A 4QDKA 3LUBA 1ML4A 1VA4A 2P0EA 3IIIA 3BKXA 4FSHA 1E7WA 1D4ZA 1Q1NA 1Q3KA 2XW6A 1TMGE 1GPAA 2ATIA 3KJHA 3FUXA 3M1AA 1B6SA 4YAFA 2P6RA 1G0OA 3CN7A 4KWTA 4H7JA 4ARUA 1DFGA 3N05A 2FPSA 1HX7A 2QTVB 1PLLA 1M2HA 4EI9A 3R9XA 1LF5A 5C8VA 5E7IA 2ZS8A 3L4BC 2FSUA 4MKFA 5CNKA 5AQEA 2FUNB 1FDSA 1T4CA 2D4HA 3K9FC 1EIZA 3CLSC 3CZQA 3DVQX 1U2GA 2QL5A 4UE6A 4GNRA 2OHXA 2NV2B 1ENZA 3QKSA 4N1AA 2EW8A 2RK4A 8ADHA 5J59A 4JXZA 1VYUA 4FFLA 2I71A 5EI5A 3HA3A 3QU5A 2OXFA 1JJBA 3CO0S 2HNBA 4WK0B 1AN0A 1KJWA 1U0HC 3BL8A 1OFTA 1GQYA 3FDJA 4PQYA 4C4YA 1COWD 3S4YA 3LBHA 1QLHA 1DIHA 1T5TA 1ESNA 1S96A 2GJ8A 3HA5A 5CJJA 1CJSA 1O9HA 2D1RA 2ZYHA 5E1DA 5FL3A 5FXMA 5GAJA 2G9NA 3TJRA 4BVAA 2KE5A 4PBSA 1BMFA 3WHKA 1IK6A 3OTQA 3C70A 2FJUA 2J9FA 4GQIA 4KDEA 5ETJA 5CG2A 3GDGA 2J5RA 4CQNA 2GK4A 3IT2A 5BQPA 4M9XA 5YASA 3VZRA 2CDCA 1ES9A 4H17A 2WY2D 4TL9A 2XMSA 1J07A 1DG9A 1B74A 2QAJA 1RPJA 4K2AA 4JQCA 1KVUA 1DC6A 2ZJ2A 2OV6A 2Q0HA 3GVIA 1RWOA 1VRCA 3R3YA 3H4IA 3AHCA 3VC3A 2Z0MA 2TECE 3RNLA 4D0LB 1QHFA 5T4BA 3GDOA 1FW8A 1H1TA 4BMZA 4JLJA 1VM6A 3Q3EA 5BP7A 4FX2A 4XWWA 4MJ3A 1NVDA 4HJXA 4RZSA 1U8CB 2LW7A 4IRUB 1NYTA 3COPA 4CI9A 5F1PA 5K8VA 2QYSA 3TD9A 4M83A 1N0HA 5EFOA 3DG9A 3SVTA 5G3YA 1XMIA 1BW9A 1K2WA 1J6UA 2E85A 2ZWPA 4E5YA 5BV8A 2RGCA 4U00A 1M2VB 2BM8A 4Y0NA 2NZ8A 1TIPA 3QW2A 3O3MB 2OORA 3BMOA 4JVNA 3UCEA 1DAOA 4JUIA 2O9JA 2DB3A 4WMLA 3HBFA 3A6LA 4Z99A 3ZKWA 1A96A 2XQKA 5CGZA 4CR7A 1PF7E 1TKBA 3T5AA 3SR3A 1X6VA 3DGFC 1YGPA 2QRLA 2Z1MA 4J2OA 1IAVA 2DPXA 3SYTA 5I4KA 1Z36A 3QNMA 3LX4A 2E5LB 5DCWA 4IWYA 4UM9D 5BN1A 1YE5A 2BFNA 3E9DA 2ONYA 3EZXA 2H51A 3CRW1 4R16A 5TB5A 3TNFA 3ZWXA 4DMUB 4X7RA 3GC6A 1CR1A 2XCUA 3LRXA 1AU9A 4ZOAA 3TNLA 5EE0A 4B6QA 2PCLA 1P5RA 3QVKA 1WXEA 1HE4A 1RU3A 3DOEA 1TQ4A 2CLLB 4MVJG 1GGKA 4Q0MA 1U7HA 3IOYA 1H2YA 4M0CA 1JFLA 1NMQA 1AB5A 1UOEA 2ZRQA 5E1OA 3H2ZA 5F1YA 3SBXA 1CUYA 1SVSA 2C5AA 1WCIB 4IOLA 3P9QA 3KOZA 1UQTA 4E88A 1EHYA 3GFGA 4DNXA 2CWWA 4H7FA 4UM5A 4QOSA 3UZUA 4BLSA 1CHNA 4UHDA 4UAJA 4ER5A 1JR3E 4FM9A 4Q9AA 2QLNA 2Z3ZA 1CRPA 1V1RA 3PT9A 4FCTA 4TLEA 1OXSC 3HJBA 3SJAA 2WLTA 3EUAA 5K4HA 3DKKA 1NVXQ 2OV8A 5FNVA 2FMIA 4D3XA 1WPGA 2FW0A 3FYUC 6REQA 5IH3A 3U6BA 4ITVA 1NW4A 1XZKA 2A9RA 2PKEA 3GFPA 3FCAA 3HU2A 3EC1A 2YJ4A 1EFVA 4FYPA 5LZ5A 1CYEA 2PYDA 4BFYA 1C7RA 3NJ8A 3MRXA 1M2KA 3AF3A 4JMPA 4P58A 1N1MA 1EVQA 2QD2A 3AHGA 1EFUA 1Z47A 3IAS6 2WMOB 4H1TA 4EHAA 5JT1A 1PX0A 3CVJA 4ZCLA 4B81A 3OX2A 2A9QA 1BMFD 1UJBA 1E0KA 3FIJA 4G5RA 1G21E 4NEGA 1L7MA 4P36A 4KR6A 2W2NA 1FS6A 3H5IA 4X62B 3G0DA 3QWAA 3SF8A 1T3HA 1M2OB 4O4JF 1OV6A 1YFZA 2PS0A 2XUKA 1GKUB 2IJGX 1T24A 2P62A 1UBGA 4KIWA 3RVPA 3WV4A 3VU8A 3GJXC 1RE0A 1MCZA 1BIFA 2QX7A 1UC9A 3I0MA 3DWGA 1TTHA 3GGPA 3LWNA 4FGUA 4WZ6A 4PAWA 1R50A 4BP3A 4RZ2A 2COEA 4GXRA 5CVDA 3K15A 2D74A 2VP4A 1DV1A 3HC7A 3CZ9A 1SUWA 3PU6A 4QO8A 2DR3A 3VX3A 1HQKA 4RJ2A 3WE7A 3PLAE 2WDPA 3PRHA 1ZH4A 5IXYA 2BP7B 4RD2A 3W9YA 5JLAA 1JG4A 4KIJA 4EJMA 4PO8A 1QE5A 4R5HA 2PXXA 3AHHA 4Q1CA 4REOA 1C14A 1V96A 1UXHA 3H2GA 1XHEA 1Z29A 3QH4A 2GAFA 4XB2A 1OBHA 4G5GA 4ZVLA 3ROQA 3MB5A 1E2KA 1W59A 2VJMB 2ZP1A 3T4PA 3H42B 4WXPA 4MQ6A 3RABA 1KAOA 1YK1A 1ZC4A 1NV9A 4U2FA 4C89A 1N2HA 1H1LB 2PJDA 4YCNA 1QIIA 1ZBDA 2V58A 4IIYA 4CIVA 3DWIA 2ZCJA 1N6IA 2OECA 4BAZA 3P2KA 4MS1A 5AI9A 1K3TA 1PLJA 2WYWA 4UNPA 4WKBA 2VT7A 3N9IA 1XMOB 5CMLA 4JLWA 2DWQA 2PRJA 5IM4F 3D2BA 1UK6A 1DC5A 3SHOA 1RWMA 1QV6A 2DWUA 2JCBA 3ZBPA 5KQGA 3THYB 1H0KA 3I64A 3COSA 4XYLA 2JLYA 3TNDA 2CEKA 4GOMD 2FK8A 4GKVA 1TUGA 4LMBA 4URZR 3WS7A 3ZW8A 4KIFA 1P73A 1X38A 2YV3A 5AKKA 5CYFA 2ZSUA 4BMOB 5JJIA 1O97D 2R2AA 4UHKA 1I0LA 2GLTA 3HCOA 4XUEA 5DEIA 1CZLA 4GR5A 3KWLA 5E6UB 2BDTA 1I4LD 3SXPA 3I2KA 1I9GA 4OM7A 4LI0A 4MUGA 3MJCA 4MI1A 1JVBA 3EXEA 2M1XA 4J90A 3K20A 3UFBA 1MC8A 2R47A 2YBDA 3LY5A 4FKMA 3AB7A 3DW1X 1RMYA 2JCSA 2P75A 4ZEXA 3ZHQA 3R6DA 1TOAA 2OWDA 5BYJA 2AI1A 1Y37A 4L8YA 3LE8A 4KBFA 5CLGA 1LV7A 3MWEB 2J3EA 2Y1GA 4RL4A 1AZSC 2FU5C 5IF9A 5JS6A 1P5JA 4X54A 1RJEA 3HDTA 4GNKA 5LIPA 2N42A 2WZDA 1UK8A 2Y0EA 2YS6A 3VR3A 4C2UA 5JYEA 4N03A 5JS2A 1U7XA 3V8MA 2NYRA 5F7JA 1RACA 2HSZA 1FP1D 3HA7A 2XADA 4MUXA 3O1LA 3QSYA 2WJHA 3HBAA 4Y2HA 2ATEA 3PNSA 2UXBB 2XYPA 3KYDA 1GUBA 1KK1A 2W5UA 3CMMA 4HRAA 5LOVF 4EHJA 4UE3S 3UAGA 2FX3A 3R5XA 1A5TA 3P2IA 3GJ4A 2E48A 3TQIA 4LWOA 3LX6A 4EI8A 5TDHA 1OAKA 1N6PA 1DEKA 2GM9A 2O23A 3A8TA 5EPOA 4JN6B 1OB2A 3V7YA 1J9EA 1TT7A 2QX6A 3G2JA 4GLFA 3CSDA 2X8JA 2GPTA 4YUWA 4MI9A 2ZREA 2PS1A 4OQLA 3O93A 2AR0A 3BVPA 4H1HA 4D8TA 2FR1A 2O7VA 1JHMA 1P0MA 2GN9A 2BLNA 1N2CA 4J9UE 3JSAA 4O59O 5TEVA 3RB8A 3L0PA 4BOYA 3LGSA 1XMVA 2GTPA 1ZD9A 2AXPA 2ZBDA 2H4ZA 3HCAA 3OM9A 1E2QA 4A0FA 2WU8A 4TKUB 1QHYA 4BTLA 2NZWA 4GXNA 4Y1RB 5JAQA 1AGPA 1SQGA 3HFGA 3RVQA 3LHDA 1IMJA 1G5IA 1FS5A 3DVLA 3LDAA 3ONNA 3CN9A 3MYRA 1Z0ZA 1CD5A 3DQPA 2ZRKA 3I0NA 4OU4A 4G8CA 4YP9A 2VNHA 1R0SA 3D8HA 4RSRA 2IU6A 5AJZA 4DL9A 4NEHB 5CB8A 4LY6A 1V16A 3B12A 4GBED 3EG9A 4MRSA 4X9XA 3RUEA 1X7WB 1HDGO 4WASA 5SZIA 4BQSA 4D6PA 3PYXA 2VBIA 1P1HA 2IYPA 2XD9A 4XPIB 2QDXA 1ZUNB 5JAUA 2X6TA 3DBOB 4D6YA 1L7RA 3IPXA 2O5CA 3C3AA 2JGDA 1C1DA 4BZWA 4B74A 2ZJBA 4BB5A 1XRPA 4BNLA 3ZHRA 2VEDA 1E9RA 1AC5A 3AEUB 3RRMA 4IQFA 2YWFA 2OBXA 4CJXA 4XYEA 4KPFC 1KC1A 1MENA 1I80A 2B6NA 2ZJAA 4M87A 3WWDA 1E8DA 3F4BA 5JVDA 1XDGA 2AK2A 5BUCA 1F5SA 3JYOA 2W8BA 2QJOA 3UV6A 1FMJA 2AH5A 4P31A 3KXPA 3SC2B 3C3KA 4J1TC 3UJ6A 4BBJA 4X92A 3THXB 2PT7A 1E9DA 2G1KA 3DR3A 4KGVA 1YRQA 3BHIA 5IDWA 4WECA 4JQYA 5AVVA 2GM4A 2BY4A 5IVHA 2HWXA 1PJTA 1ZSVA 1VJGA 3OMLA 121PA 1V5FA 2O52A 4BQPA 2HYIC 3GUZA 3VR3D 3NNNA 4MTLA 2EHDA 2R96A 2AEEA 2P3LA 5LP1A 2WMYA 3GJQA 3JAWB 1K3UB 3QYJA 4RJIA 1LNQA 1DDOA 1MAWA 4EDFA 1U0TA 3U2QA 2XTNA 4WH0A 5EXEA 3FG9A 3H8VA 1TVKB 5DYIA 3OCYA 4HZUA 1WW3A 1OX4A 4S12A 3OESA 1HFWA 3K30A 1I14A 3F3SA 1KDRA 2AFIE 1B0ZA 1UMBA 5MFPA 1RPTA 2X58A 1XD2A 3L9XA 3Q10A 4XDHA 3U7IA 4CXMA 4OHFA 3ZV5A 1UJ2A 2QF7A 3O4RA 5LZ2A 1ND5A 2BM0A 1OFHA 3EXIA 4LDNA 3TOVA 3OA0A 1LUAA 3ZN2A 1CE8A 7MHTA 2GSDA 3WBFA 3M6WA 4XGQA 1GPDG 2NIPA 1IN6A 4DV4B 3MTIA 7REQB 4IDOA 1PAUA 4DDWA 1G1MA 1U2PA 1G5PA 1BQ3A 2VZ0A 4P4SA 4OXYA 1U2RA 1XRNA 1W88B 4V3BA 2Q2NA 3OLZA 2ZUEA 3R3XA 4I14A 4S0XA 2QVZX 4K6KA 5AP9A 4KYIB 1UP6A 1QPGA 1E3SA 3UTDA 2VRWA 1OILA 1ODLA 2APJA 1ZINA 4HXGA 2JZCA 4JR2A 3U6KA 3MHTA 4QVIA 3U16A 5EPUA 2FXVA 1KQOA 1NTRA 4CPDA 2UZAA 3F9RA 2R6CA 3KPUA 4G25A 3VH3A 5JROA 3UIEA 3G5MA 1HGXA 3ICEA 3QVXA 4MAAA 2W6MA 3NDJA 4IIBA 5ARBA 1RQGA 2WQZA 3CR7A 4DMKA 4ECEA 2L2QA 4B2YA 4Q18A 2EJCA 4M4SA 4CG0A 5I6DA 2Z6AA 3D4BA 3JQFC 1TDJA 1UFRA 2VHJA 3WJ1A 5K8TA 3EFOB 3V8QA 1NVEA 1ZJ5A 1L5MA 1R37A 3K0SA 4PFKA 4PLCA 5KPDA 3I2JA 5AM2A 1O6CA 3C2QA 3VA7A 4G0XA 2FHSA 2PLRA 3BXXA 5JDIC 5AM4A 3T5CA 1JDSA 2E1PA 2XMCA 5EJ9A 1UK9A 2VJDA 4E09A 4HXFB 1ECLA 2B61A 2JLQA 3AIKA 1Z4QA 1V8ZA 2WT8A 4TV9A 4OMUA 4OXRA 2QZ9A 5AFSA 1L7QA 3KCNA 4PRKA 1KYYA 3S7TA 1ZL0A 3RLIA 1Z62A 4KP7A 3C3WA 1MPTA 1GD1O 1KY4A 1W4RA 3DFUA 3G6WA 1L7PA 4W1RA 2HUNA 3GYGA 3AR2A 2AEFA 1F1JA 4ZHQB 3SOPA 3WLTA 4II2A 2HGZA 2GYWA 1G7CA 1N2EA 4OMFG 4ZV7A 2BI8A 1EFAA 4WXRA 1QIDA 1YKSA 2NSLA 3OLVA 4ATNA 1NRJB 4D46A 4R3NA 1M1ZA 1P2BA 1W9HA 1Y1TA 4OHRA 4Q7LA 4FSDA 4NC9A 3TKYA 2OHJA 1RM4A 4G1MB 2PHZA 2WTEA 3OZVA 1IVSA 2ODEA 1II8A 3CPHA 1FK8A 3ND9A 1U3TA 4KXNA 3K70C 3HZRA 4BQIA 5K4GA 1KH3A 2V65A 3DVAB 2UVDA 2Q4DA 3HP1A 2Q1SA 2Y1LA 1WKCA 2EJUA 2ODBA 3R0XA 4PCUA 3Q87B 2QR3A 5C4IA 5FORA 3TMKA 1W29A 3DUWA 3SHTA 2QJTA 3HXQA 3WGOA 1R0ZA 3WDMA 2AG1A 3PC6A 1Q0HA 2OXRA 2XBMA 1IN5A 1E5LA 1B8UA 1H22A 2AMFA 2IIPA 2O2EA 3W5IA 3DEYX 3JCZA 2O8DA 2VDWB 1KYQA 4BYMA 2YIDA 4KHZA 1T6ZA 4A8JC 5H8WA 1DAMA 3B7WA 3SF0A 2YV5A 5K8JB 1DAHA 5BVGB 1R4ZA 5HKOA 3D31A 2FWAA 4I9HA 4L51A 1EMDA 4MUEA 2BCEA 4RIFA 3HVHA 4ZOLA 4W5RA 5DLYA 4DA6A 3FMIA 1I6LA 4FYXA 1KO8A 4JL6A 5REQA 3STTA 3AVXA 2JH8A 1QRSA 5L7TA 5B7NA 1ACJA 2RGUA 3LUJA 4EA7A 4R8MA 4BZXA 3KTOA 2C97A 3ZJ5A 2P6UA 5IVPA 1YCGA 5I01A 3DDHA 1GGNA 2OGTA 3P1JA 5HRCA 3E2PA 3DPSA 3T34A 1AGNA 3IAHA 3HACA 3OKFA 5JG7A 5K3FA 2GYVA 2HCFA 3B82A 3GRKA 3QUTA 1Z68A 5C52B 5CX1A 1IVNA 1GRNA 4MRMB 3GGDA 4TTTS 2V4UA 1PG0A 4I08A 3ZHTA 1R4MB 4B3TB 3TTUA 3WZ2A 3KQOA 2VJNA 3KOYA 3PWZA 1K86A 1DG1G 3ONDA 4RHEA 3GRAA 3INGA 4HY3A 4PW0A 2XEXA 2OSVA 3W9SA 4QYIA 3OZSA 4ZU3A 1HLGA 1IRXA 2R84A 3UN1A 4XWYA 4Z9BA 4UVEA 2DHQA 3KQUA 4HBGA 5BXQC 1M0WA 4TUYA 2FFRA 4Z3DA 3SSOA 4AQDA 4LDRA 1UADA 1OH5A 2DQSA 3U4CA 2VTBB 4NY1A 4FYVA 4CMJA 1S6YA 3L7IA 4PIVA 1KJQA 4RSHA 4QDXA 6ABPA 5EUMA 2QA5A 3ETCA 3PTAA 3BIJA 2G80A 1ZGCA 5JAZA 2NXNA 3HDQA 3UEOA 1H8HD 3ZQUA 2ONZA 3DDSA 3LXUX 1WG8A 4JXJA 4DLZA 3IALA 1VBNA 1BKYA 4J0GA 4QJ4A 4WAUA 5KYXA 3OCWA 4ZQEA 2LPMA 3UMRA 4DR6B 2WWXA 2ZT7A 2A0XA 3ZCUA 3RAEC 4CEIB 2RH8A 3SK0A 1HYEA 4ZIRB 3IKMB 3WK4A 4G67A 4EHNA 3F5QA 1XTKA 3AV0B 1CDOA 1T0JB 3U3ZA 1DARA 3LF2A 1O03A 4WN9B 5ENZA 4X8MA 4NYJQ 4KV7A 5CIQA 2K4MA 1EM8A 2QHXA 4WXYB 5JQGF 5ALUA 4OB6A 3AVYA 1MXHA 5FOTA 4GF5A 1O4VA 1WU7A 2EW1A 3TZHA 3VNVA 3HCWA 1NP7A 1DBRA 1K4YA 1XKXA 2C4WA 4O1HA 3T5GA 5BRJA 1HDXA 5ICGA 3UPTA 2IS6A 4LGVA 4EGSA 1XDUA 2YWRA 1EUCA 4EA9A 2B7LA 4YDHB 3QVJA 4D9EA 2OHHA 4DMMA 4MW5A 3F0TA 4HWRA 3SC2A 1UIRA 3LP6A 4B7AA 1BXGA 4HUQB 2QW1A 2YJNA 1S8FA 2QKYA 2P7IA 3B7GA 1P9NA 4L3WA 1N7GA 4Y0VA 1XRRA 1UDAA 4TN1A 3ILYA 4TL7A 3KEFA 4YO7A 3NASA 1YBVA 4EFLA 5EJMA 3G5AA 1R4NA 5D86A 4JBWA 5SYNA 1HBJA 2XZOA 1CY6A 4CMIB 1S8AA 2IEGA 2W4MA 4DN6A 1N5MA 4IDFA 5KZMB 2VXOA 3D6JA 1WZNA 3EVNA 1Q0ZA 4HEQA 4IV0A 1CQIA 1DG3A 2DJIA 4JBLA 4RXMA 3G7SA 4YDRA 5J63A 1HQDA 4A0SA 1IK4A 1XTTA 2A35A 1NT2A 5DBEX 3MPUA 1KJ9A 2WC1A 1L5KA 4F9FA 1UR5A 1GDDA 4OQDA 1XMPA 5AHWA 5C8YA 3T06B 9GPBA 1AS2A 4J16C 3WGZA 3AHFA 1ZITA 5DGDA 5DGIA 4AG3A 3SXJA 1CY4A 2NO9A 2IPXA 4AL4A 2YW9A 3IS3A 5JATA 4HWKA 2WF9A 1MC5A 3IUEA 3O6VA 1CR6A 1VDZA 3FUTA 5DLEA 2DEUA 3UPUA 1OAOC 3GJ8A 4O2RA 1BYUA 1J8VA 2WFAA 5KS2A 1S0UA 2A78A 1ULZA 3EODA 1FNSA 4L85A 3UAWA 1Z9BA 1RHJA 1XA0A 1YS9A 3M6LA 2GPAA 5AW7A 3DPUA 1I2DA 3LA6A 4ZEOA 3SHFA 4HFRA 1C9JA 1KP9A 1R6UA 5HYVA 2C3YA 4M1QA 4TT3A 1XTPA 2WYUA 1F48A 4D57A 1KI1A 1G16A 1TNDA 1ZRHA 2P6OA 4JMLA 5U4QA 2WU0A 2VDMB 4KWEA 3PA8A 2BUBA 1GZ7A 2J8ZA 2OYSA 1VGQA 2ZI4A 2GFIA 3SC3A 5CA1F 2GF2A 2W2KA 1ZRNA 3H9JA 2JJ8A 1YD7A 4RZIA 1I7PA 2VFAA 2O1SA 4EVSA 3ROGA 1NJ1A 3BSFA 2B30A 4P08A 3R2JA 5JZMA 1PR6A 2YWHA 3HVJA 4KN6A 4C4TA 2FA9A 5BOSA 4UDYX 1CEEA 3A6KA 4L76A 3W5AA 2JGJA 3TM4A 4R8RA 2OM6A 3FZYA 4KQJA 4OJMX 4R2XA 1FDIA 1PNTA 3L8CA 2X4IA 5HHTA 3D6UA 1Q0QA 4UDOA 4BFVA 4EMBA 3E8XA 2FN3A 1CCWA 3ILXA 1CU1A 2VJYA 2WVAA 3KC2A 3MQ2A 5HIIA 5JPIA 3UXMA 5UKDA 4JAVC 4KZPA 4JNKA 5EJ4A 2IZ6A 3E2IA 3HYTA 4WCFC 1USKA 1XRQA 1KNQA 2H4JA 2H2GA 2JLBA 4IY1A 4LHWA 3HJUA 5EMMA 4N0PA 4PU0A 3VH1A 1ISSA 3PLNA 1JV2B 1KIMA 2WI8A 4C4AA 3JQBA 3ENQA 3LQ1A 4DIEA 5IFKA 4D1YA 4G0VA 2O8EA 3ESZA 4UDXX 3JQ9C 3DF7A 5HRUA 1TT5A 1Z56C 4B3CA 4BNDA 1PUIA 3C8MA 4JXXA 1P1KA 1QH1B 5DJ5A 1SN7A 3WL4A 4BLTA 3LRTA 1C80A 5K03A 1JYFA 2XVMA 4ERNA 2VDOB 1PI3A 4FQ7A 1ORRA 2VIIA 2F67A 2C57A 4CDRA 2PRKA 4IILA 2AX4A 3O4GA 2VYCA 2I5PO 2AG0A 4RYLA 5AKLA 1RNLA 2XNJA 3BZBA 4DBLC 4QT0A 2PKXA 1P3DA 4BTEA 4MYRA 1U8TA 3DCJA 1YZNA 2VTDA 3ABQB 3A70A 3OUTA 5CYPA 1CUJA 4B09A 4BXOB 2QZSA 2HJGA 4HRVA 1L9XA 5IARA 2HA2A 3S2EA 2BRUA 4RTLA 3NTQA 3GLRA 1G8FA 4AZ3B 3ZIDA 1T26A 1XTUA 4FFVA 3B2QA 1UPBA 1JKJB 1TYAE 2F1OA 5FEMA 4ADSG 2BGKA 3TIXB 4E46A 1ABFA 4FFSA 1H9AA 2PZAA 4Q7MB 2Q6TA 2ZM5A 3AR3A 3VVMA 3H1TA 5JSFA 4V39A 1SA0A 4JJEA 4LJ4A 3STYA 1LB1B 4C7JA 5SYMA 4ICIA 4ZU6X 3L6BA 1TZMA 1RJGA 1I0ZA 3IPYA 3VHRA 3LW8A 4D92A 2IIVA 3NHRA 2YWGA 4ZZ2A 4B32A 4TM8A 3V1LA 4FR2A 4Z8YA 4C9BA 4M8SA 1YVRA 3BWYA 1RLOA 1GQQA 1QGUB 2Z6VA 4I1YA 1I4WA 4TT3D 5D3KA 2JFYA 3VOBA 5A06A 2ZJ8A 4HADA 2XE6A 4GMXA 2AVNA 4AJ4A 4D81A 4A4DA 1F17A 2R7KA 3L4BA 4M9ZA 5E9QA 4RF4A 3EGIA 1PV4A 3M70A 1WDKA 4RVCA