5H3HA

Esterase (eaest) from exiguobacterium antarcticum
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
268
structure length
268
Chain Sequence
MGTFIQAVDGTKIYVEDIGSGQPVVMLHGWPANNNMFEYQKNRLLEEGYRYIGVDYRGYGKSDAPATGYDYTTMASDINEVIQQLKLTNVTLLGFSMGGGIALKYLLNHGESNVSKLILAGAAAPVFTQRDGYPYGMTKDEVDALIEDTKQDRPSMLKGFGEIFFAKEHPEPLQQWFHNLSVDASSHGTIQSAIALRDEDLRDGLPKITVDTLIMHGKKDQVCPFEFAEVMHENIAGSRLEVFEESGHGMFLDEREKFTETLVSYVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Esterase (EaEST) from Exiguobacterium antarcticum
rcsb
source organism Exiguobacterium antarcticum (strain b7)
molecule tags Hydrolase
molecule keywords Abhydrolase domain-containing protein
total genus 102
structure length 268
sequence length 268
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5h3hA00
1IZ8A 5ALHA 3R3YA 5AKKA 3F9CA 3IULA 1FFCA 4UBOA 3A2LA 1UKCA 4GHWA 4IQ4A 4M0EA 4I4CA 1UT6A 4H7KA 2D0DA 2Y6UA 4W9RA 4DGQA 1XQXA 4TVKA 5AM5A 5C7YA 4O08A 5FOQA 5IH7A 1DWQA 1QIMA 3A6ZA 4H7EA 2GBIA 1G4HA 1E8MA 1ORVA 3W06A 3G9XA 4B85A 4BRZA 4X6UA 3M81A 5AI5A 4LKOA 1ZI9A 3LIPA 2QJWA 4ARBA 2GBFA 4RE5A 3EBLA 1XFDA 1NU8A 3SWWA 3WKBA 4L9AA 5DTJA 1F6WA 1U4NA 4ZV7A 5K3FA 5AM3A 3AINA 4F0JA 1XZBA 4W1QA 4BZZA 1LZKA 3KWJA 1WB4A 1H22A 4AO8A 3K2IA 4B9EA 4L72A 3AILA 1MJ5A 2CKMA 4JUIA 4DLNA 4MEAA 5ALYA 4BAZA 4BCDA 4E11A 3DLTA 1EDEA 1ZGCA 4H7FA 4IHAA 2OCIA 1ACJA 1VE7A 5HF6A 1ZI8A 2QRUA 4W1PA 5JAOA 1QJ4A 2RHTA 4U2EA 4J7AA 5FXMA 5LKAA 4DMKA 1JU4A 5IVIA 3IURA 2VT6A 4CI9A 3D4LA 2EDCA 1ETHA 1XQWA 4Z49A 3VXKA 2GBCA 1AX9A 1EDBA 1W6RA 2PSJA 1QTIA 1WM1A 1QIIA 5JIBA 1DTEA 3QMWA 4Q3LA 3VVLA 4RPCA 3OG9A 4QZVA 3HEAA 3WK8A 5FRDA 5FP0A 4EBBA 3QH4A 5AOCA 1XQYA 4AZ0A 2WU4A 2VATA 2DCMA 5K5EA 4CG1A 2HRQA 4X85A 5ALZA 3ESDA 3WK6A 1KU0A 4UHCA 3ZPXA 1MT3A 5AKEA 3HC7A 1CUIA 4Q3OA 5KREA 3I2IA 1X2BA 4KEAA 5T4EA 3UUEA 4CIAA 1CUEA 5EGNA 1SCKA 5CXXA 4X95A 4I3FA 1SFRA 4GXNA 1CUVA 3V1MA 3DQZA 3O0DA 1THGA 1XRMA 2E3JA 3H2GA 2GBGA 5JALA 2XMBA 2PSEA 2BAGA 4UHDA 5AI8A 2OGTA 4AN1A 3C6ZA 1RYYA 1HL7A 3NOXA 1GQRA 2PUHA 1GPLA 2PPLA 3D3NA 5AKHA 1F0NA 2UZ0A 3ESCA 4W1RA 3GZJA 3A2MA 2QJRA 3D5EA 1IUOA 1QLWA 3WYDA 3WA6A 1ACLA 2XQFA 5KWJA 4B0PA 4JNCA 1T2NA 4XVCA 4GW3A 1QE3A 2IITA 1Q84A 3FNBA 1RWQA 2WSLA 3S2ZA 2PBLA 3FOBA 4IH4A 4K5QA 5CXUA 1IVYA 3G7NA 4PSCA 2QR5A 3K9BA 4UBLA 1L7RA 1UK6A 3DJYA 5E4TA 1Y37A 2OXEA 1W1IA 5CRIA 4BP9A 3FYUC 2XMSA 5AJHA 2K2QB 3IBTA 3EF3A 5LKRA 3B3QA 1JFRA 1WHSA 3G9TA 5A7GA 1UWCA 2WU3A 1ZI6A 1ZD3A 3EQ9A 2WHQA 2XUIA 4G4JA 1EB9A 1EDDA 5E4YA 5JD6A 2GZRA 3JYHA 4C87A 3C8HA 2EEPA 1YS2X 2XUFA 3QPAA 3K6KA 4HXGA 1FFDA 2Y6VA 1ZJ4A 4BCCA 2WUGA 5LZ7A 4KAFA 4N5HX 2ZVDA 2BFNA 4QWWA 1G66A 1A8QA 4BVKA 3F98A 2ZYIA 1ISPA 4FTWA 3HJUA 3MVEA 3ZLVA 4INZA 5KWIA 5JASA 4UBMA 4GEGA 2CBGA 3R0VA 4OD0A 4BCBA 2RIPA 5ALMA 1EXWA 4B7ZA 5AICA 3O9MA 4BYMA 3AIOA 4A23A 3IVMA 3KSRA 4H7IA 3BF8A 2FUKA 1LPSA 3V48A 1YAJA 2XUGA 4LXIA 1LZLA 3R41A 3RKSA 4WFKA 3PDCA 4J0GA 1FFAA 4B80A 5FUMA 5JZSA 3LS2A 3P2MA 1J06A 1BE0A 5FV4A 5E2IA 1C7JA 4G9EA 3R40A 2Z3WA 3C8DA 4WCVA 3T4UA 1XRPA 4N8SA 1XZAA 2EDAA 4HS9A 5CURA 2OG1A 4B9AA 4U2FA 1DX4A 5AP9A 3M3DA 3E4DA 5CH3A 4OCZA 4X92A 1LLFA 1R3DA 3UUFA 1SOMA 2WUDA 2WJ4A 3M82A 3QPDA 1A88A 3RLIA 4ZREA 1XZEA 2QXUA 4ZI5A 1E3QA 3WLAA 2WG0A 3C5VA 3PUHA 3WL8A 1DX6A 4X97A 3DL4A 3HZOA 4KE9A 1O6GA 4CIBA 5ALIA 4KE7A 2AJBA 1B6GA 3PF9A 3ZWQA 2QM0A 1R9NA 2OAGA 3CCCA 4FHZA 3E3AA 5D6OA 3DNMA 1SC9A 1TQHA 2XB6A 1H2YA 5ALQA 4Y2JA 3F97A 2ZYSA 5FPPA 2QXTA 2C0PA 3R3UA 1MNQA 1YCDA 3N2ZB 3WWOA 5JD4A 5FDFA 4TGLA 1EHYA 4X00A 4WFIA 4FWBA 4QDZA 5JAHA 2JBWA 2ZSIA 1VKHA 1JJBA 1XZJA 3MUOA 1DWPA 3WL7A 2WUFA 4P9NA 4OB6A 2JEYA 2WIGA 1EX9A 1LBTA 1P0PA 1CUZA 3SC2A 1XRRA 1S8OA 3BJMA 4LXGA 1ZD4A 5ALDA 3HRHA 4X3CA 2W6CX 1WHTA 3TGLA 3IA2A 3DKRA 2PU7A 2HA7A 3STUA 1A7UA 1ODCA 2B9VA 3D0KA 4GBGA 3C87A 5I8PA 1W4LA 1MAHA 2C58A 5K3FB 3WL6A 5HKAA 2WKWA 3LLCA 3O9VA 5JZBA 2BKLA 1DQZA 1VA5A 4LYEA 2HA4A 1ZIYA 4QEKA 5DTIA 1EH5A 1MU0A 1ZJ5A 4H0CA 3I1YA 5AK5A 4DNFA 5BWBA 3O4IA 4XJVA 3AIMA 1U65A 1EINA 1QIGA 1PJAA 2VAXA 1BN7A 1C4XA 5AM0A 3MUNA 3TRDA 1UK8A 3CN7A 1O6FA 3CCBA 1U2EA 4BP8A 5ESRA 3IUJA 4UHEA 5LYYA 4GWLA 3W05A 3WK7A 4MQLA 5LP1A 4Y2XA 1Y7HA 5LZ5A 3BWXA 2WTNA 2PKYX 4X91A 1CQWA 5A2GA 1Q83A 1XKLA 2HA6A 1HBJA 3QITA 4HXFB 2DHDA 5IVDA 3U1TA 5LZ8A 5HF9A 3L1HA 3ZV7A 3ICWA 5HFNA 2WIDA 1Y7IA 4U2GA 5CTAA 2OCLA 4B81A 4PNZA 4UHFA 3IUNA 2XMZA 1RP1A 1BS9A 3G9UA 1VZ2A 3G8YA 3CXUA 1AGYA 3VKFA 4Y2SA 1IZ7A 4QDUA 2JEZA 4NS4A 2G63A 1QO7A 1XZIA 5CMLA 2WFMA 1JJFA 1QIEA 3HYSA 1JT2A 4FLEA 4U2CA 3WYNA 1A8UA 4Y2PA 1IUNA 4KRXA 1K8QA 3AZPA 3I6YA 4BB0A 4AZ3A 2JGJA 1R50A 4C6HA 1HKHA 3EQ7A 2FX5A 3ESBA 1QOZA 1UKAA 1Q0RA 3C6YA 4AO7A 2XE4A 2G5TA 2HRRA 4B84A 1E89A 2QUBA 1DINA 4GI1A 4F5ZA 5JAPA 2CMFA 2PSDA 1QIKA 4CCYA 1CUDA 3N0TA 2QMQA 1DT5A 1JKMA 1YA8A 3O4JA 2QS9A 4BBZA 1KU6A 5EHNA 4TPKA 2DHCA 4G4GA 3ILSA 3F8SA 4EY8A 1CUBA 1UOOA 3ESAA 1XZGA 3DS8A 1ODSA 3VJKA 1E66A 2OQVA 4UFPA 1QGED 1QIDA 2YXPX 3VISA 3BIWA 4FFVA 5F4ZA 2AJ8A 4K6HA 3V1NA 4DNOA 2GYUA 2ZSHA 5AIAA 3R3VA 1CIJA 4AX4A 3FYTA 5I9IA 4S0XA 1CPYA 2BCEA 3WWEA 1EVQA 3PF8A 4PQEA 1XRQA 1DQYA 5I7UA 1ZD5A 5BOVA 5LIPA 2QUAA 5HK9A 2XI4A 4C01A 2XUAA 1X2EA 3ZI7A 4AMYA 1CUYA 1H2WA 3FBWA 2LIPA 3I2GA 2BUAA 1H2XA 5HZGA 1UKBA 5T4FA 4J0JA 3KDAA 4BVJA 3HSSA 4YPVA 4F21A 1QFMA 3C45A 4HRYA 3B5EA 4FLMA 2GZSA 3FWHA 2I78A 4Q1VA 3L1JA 5C81A 2BGRA 5H3HA 4PF1A 4LHEA 4RE6A 5DNUA 4LXHA 2XT0A 1LPBB 5EIEA 4GDMA 2WG1A 3PI6A 5DNWA 1AURA 1XLUA 4OUKX 4HAIA 2XMCA 5CT5A 4EY4A 2WUEA 1H2ZA 3R3ZA 1TCBA 3WMRA 2ONCA 1UFOA 5CT4A 4Y2TA 3AIKA 4KJXA 4PO3X 3PUIA 3WKAA 5CW2A 4G4IA 3E1GA 1BCSA 3BDIA 3C70A 1CUUA 1G42A 3V1KA 3DD5A 3E0XA 5AH0A 2Y2UA 3DL7A 3FYUA 2ZJFA 5AKZA 5AKLA 2V97A 4LIPD 4Y2VA 3KD2A 4AXBA 1WPXA 3I2HA 1R88A 1EK2A 1UOPA 4M0FA 1PV1A 2O7VA 4AO6A 3BE8A 4Y2YA 1JMYA 4QLOA 2ZJ7A 4KRYA 4OPMA 4UFOA 5ALKA 1B41A 3MGAA 3VVMA 1TAHA 2RHWA 3WWCA 1XZLA 4WY5A 3FYUB 5C8XA 4H7HA 3FLAA 4DIUA 3WZLA 2WFLA 3DCNA 1EA5A 1WB5A 2C4HA 5ALNA 5J3JA 2I3DA 3RARA 2Z8XA 3R3XA 3PE6A 4LYDA 3GFFA 2GYWA 5D3KA 5FKJA 4FOLA 3QMVA 1MTZA 3WZMA 2OGZA 4A5SA 4C88A 2ROQA 5ALRA 5IVKA 2VTVA 3H19A 4AMZA 3JWEA 1ZIXA 4JYMA 1CRLA 2WHRA 3D7RA 3ICVA 1GXSA 2XQGA 3HACA 3I1IA 3STWA 2WFLB 3TJMA 1SCIA 3C6BA 1M33A 4FKBA 1AZWA 4AB1A 3X3HA 4FMPA 3FLEA 1FJ2A 1TRHA 2JF0A 4H7JA 2DQYA 1BU8A 5AOAA 1CV2A 4H77A 1BCRA 3H0CA 2BGNA 5IKXA 3STTA 5ALUA 1AMNA 4BAUA 1GZ7A 3FCXA 3WA7A 4X90A 1CVLA 4DYHA 1QONA 3QYJA 3GROA 3RK4A 3I2KA 1GPNA 1ZOIA 2H9YA 2Z8ZA 4IO0A 5A6VA 4BZWA 4L0CA 3NGMA 4QDOA 3NUZA 1EB8A 3W9BA 5ALXA 7YASA 5E4JA 4DMCA 5EHZA 3HABA 4E46A 3BIXA 4Y2UA 3FLBA 1UZAA 1U8EA 2WILA 4AQDA 2JGLA 3IDAA 4QDXA 1QIFA 3AUKA 4YX9A 2O2GA 3G02A 1QTRA 2BJHA 2IIVA 2R11A 4J0KA 3O4GA 5EIAA 2XUOA 3DDUA 4QA9A 1ZD2P 5DNVA 4OB7A 4H35A 1WCYA 4FFWA 1E8NA 1UK9A 4E15A 4CG3A 5AM4A 2O2IA 4U2DA 3QBJA 1BEZA 2VJCA 4EY5A 3UMJA 4L3WA 3HLKA 4ITVA 1USWA 1VA4A 4BVLA 1XLVA 5A7FA 5JANA 2OCGA 1GGVA 3TEJA 3GA7A 1QIJA 2QTBA 2GYVA 1W76A 2H1IA 4RNCA 4X7BA 1YB7A 3I6MA 1XRNA 2Q0XA 5K3EA 4BE4A 5LLSA 2XMQA 3W04A 3FVRA 2IX9A 3WKCA 3WK4A 4N8DA 1P0MA 1N5RA 3OURA 2VA9A 2ES4A 4HZGA 4ZRDA 1QFSA 1TCCA 4UUQA 3M83A 1L7AA 2WFZA 2HU5A 4F60A 4MEBA 4UFNA 3WIBA 4W1SA 5A7HA 4WFJA 4ZXFA 4G8DA 3OOSA 3A70A 1CUJA 5DYYA 1R9MA 1JJIA 4OYYA 2RGUA 2WJ3A 2HA2A 1CUHA 2PVSA 5T4BA 4OB8A 4OYLA 2R8BA 4XX1A 1BEEA 5C8VA 4PW0A 2VEOA 1X70A 2X5XA 4ZV9A 2C5GA 1LPAB 4JYPA 3WL5A 5C8ZA 3STYA 3QM1A 3QVMA 5BWCA 3NWOA 4P93A 5ALWA 4A16A 1VXOA 4J03A 5LZ2A 1G5FA 6YASA 2OPHA 4OSEA 1CUFA 3Q8WA 2PM8A 4FNGA 5KBYA 2XQKA 4YK7A 3BDVA 4JH0A 2RI6A 2DFPA 4X93A 2VJAA 3DEAA 5K3CA 2NW6A 3GUUA 5ALVA 4FDMA 3PICA 1IMJA 4J0IA 1CLEA 4N5IX 3DYIA 4BATA 5D7BA 3AZQA 5AI0A 3W2TA 3H2JA 2HADA 5DJ5A 1Q0ZA 4QLAA 1IUPA 1L7QA 1D07A 4Q34A 5JARA 1GT6A 1P0QA 4V2IA 1P0IA 1GKLA 5ALFA 3HXKA 4B6GA 3G0CA 4DNPA 4B83A 2AJDA 4EHBA 3VDXA 1CUSA 2CUTA 3IUMA 5YASA 2DR0A 2J4FA 4P08A 1HLGA 5AKJA 3T52A 3B12A 5HQ3A 1ZICA 4HXEB 2Y1KA 3F67A 3WKEA 1W52X 1QZ3A 1F8UA 5ALTA 1FFBA 1XZHA 2WHPB 4UPDA 1T4MA 5JATA 5HF8A 3V1LA 4DMHA 2HDWA 2PSFA 3BL8A 2J3QA 3D2CA 2HFKA 4DMFA 4WY8A 2WQZA 2C7BA 4KE6A 4C89A 1LNSA 2WIKA 1C7IA 4H18A 3H2KA 1GKKA 5ALGA 4NMWA 4EY7A 5AI9A 4MWTA 2OGSA 5T4HA 1XZFA 5CH5A 4BTVA 3OM8A 2QOEA 4MQMA 1AKNA 2JGKA 2ZYHA 4Q82A 3SX4A 2OCKA 4QDTA 3H1AA 2XLCA 2YYSA 5LZ9A 3G0GA 1A8SA 3GBSA 2ZYRA 1TCAA 3JW8A 4RGYA 1XZMA 3OPMA 2WIJA 5DWDA 5A62A 1AQLA 1YASA 2RONA 2WG2A 2ACKA 2WLSA 4BC1A 4BTLA 3C43A 2ACEA 2XDWA 2P8SA 1AUOA 1CUXA 4OU4A 3G9ZA 4CG2A 3AJAA 5EI5A 1PFQA 5JYCA 3LP5A 4FBMA 4QNNA 1HQDA 3VJLA 1NU6A 4X6YA 3DOHA 4KAJA 4Y2QA 4HVTA 3DOIA 2HL6A 4X71A 3SK0A 4E14A 4X94A 5CT8A 2B4KA 2OLEA 4C4YA 4BE9A 5JZ9A 3QZUA 5CT9A 2HA0A 4UHHA 5HCUA 1JU3A 3IB3A 3FCYA 3WQHA 5K3BA 3QMMA 3WK5A 1MNAA 5AIBA 2FJ0A 4GLBA 2XQJA 3WWPA 4G9GA 5JD5A 1N5MA 1THTA 1HPLA 3C5WP 3FVTA 4BAGA 1MAAA 2AXEA 1UXOA 2JGMA 4FLFA 4X6XA 4EA6A 1ZGBA 1CFJA 4KAAA 4MWSA 1XZDA 2ORYA 2B20A 2PX6A 2XUQA 4B82A 4ZGBA 3H17A 2WTMA 3ED1A 4C4ZA 3OC0A 4NVRA 2CZQA 5AK3A 2C0QA 2HU7A 3V9AA 1N8SA 1FFEA 1MPXA 5ALPA 5AKIA 1LPOA 5ALLA 2BUCA 5HKBA 1CEXA 3H18A 2H7YA 5SYNA 4BDTA 4D9JA 2HA3A 2V9ZA 3I28A 4GECA 3OTQA 2CB9A 2O2HA 5DLPA 2VSQA 4ZWNA 5AM2A 2QT9A 5HF5A 3WJ1A 1OXMA 3EQ8A 1LGYA 2J4CA 5EHQA 3WKDA 5AOBA 4G1FA 5CBKA 4DNQA 1CUWA 2XMDA 3A2NA 1LPPA 3FSGD 2DHEA 2H7CA 5CH8A 1Z68A 5LZ4A 3H2HA 2JGEA 1LBSA 3F96A 4Y7DA 4IH1A 4XWGA 4UBIA 1GPKA 3D59A 2VJDA 1QO9A 5K3DA 2WM2A 4H7DA 4W63A 1VOTA 5AKYA 2QKYA 1J1IA 2OQIA 4EZIA 3G0DA 1MN6A 1CUAA 3RM3A 2JIDA 4MYDA 1LPMA 2G5PA 2QVBA 4Q05A 1BN6A 1DT3A 4DSAA 4N8EA 2V98A 2XMGA 4CCYB 3O4HA 3ANSA 2DSNA 3WJ2A 4P92A 1ORWA 5JAUA 2VF2A 1YAHA 3YASA 1WB6A 4IH9A 3PFCA 1I6WA 2XUHA 4KE8A 5EFZA 4J0HA 4MJ3A 4MYSA 3QPCA 4NZZA 4UBJA 3H1BA 4WDQA 5AI4A 5HFAA 2C5FA 2W22A 2BUBA 1H23A 3G0IA 3ZLTA 1CUGA 3FSGA 4WDRA 4DSZA 1XZCA 5D3ZA 2WIFA 2X76A 4Y2RA 3BF7A 4KACA 3I2FA 4J3JA 1YB6A 4QE3A 4UHBA 1TK3A 2I03A 4PV7A 3AFIA 1ODTC 2XUKA 2PSHA 1CQZA 4Y9SA 5ALEA 3R3WA 1KEZA 2XUPA 1MX5A 4EUSA 1NX9A 1WOMA 2DQZA 4ARAA 4ETWA 5ALOA 3WK9A 4HTAA 4EY6A 5ALSA 2ZJ6A 2XQIA 2VJBA 1XKTA 1EK1A 1K6EA 4Q3KA 3DYVA 2ECFA 3W9UA 1UOQA 4JEIA 1XLWA 4I19A 5A71A 5ISMA 1OCEA 4HRXA 3IIIA 4UBNA 1MO2A 4CCWA 3D2AA 2PL5A 5FPQA 1YA4A 3STXA 2O7RA 2H7XA 2X8BA 4J0DA 2HFJA 1XQVA 4G8BA 3LIIA 3I6ZA 5HK8A 1J2EA 1N1MA 4BC0A 3I2JA 2HA5A 1XRLA 1HDEA 5CT6A 4XIIA 1R4ZA 5EHXA 1VJ5A 2XUDA 2AJLI 5AKGA 3L1IA 1TIBA 2WHPA 3CN9A 3IUQA 2PUJA 2J3DA 3ZLUA 1UK7A 2VAVA 5SYMA 1VLQA 2RAUA 1QIHA 3EIOA 5FLKA 3KXPA 1JI3A 4PSUA 1BRTA 4K2AA 4UBKA 4K6GA 1K63A 1XROA 1W75A 3KWFA 4EB0A 1DU4A 1YS1X 1EVEA 2QZPA 3BXPA 3PFBA 4G8CA 3DKKA 4M0MA 1SCQA 4J0CA 5HQ3B 2XMRA 5K3AA 2YH2A 1MX1A 1F0PA 2B61A 2HM7A 1K5PA 2I3ZA 1MX9A 4OU5A 1DWOA 1VXRA 1OILA 2G4LA 4PSDA 1E8DA 1VE6A 5AK4A 2HU8A 4YASA 2JGIA 1XZKA 2Z5GA 2YASA 2V96A 3KOOA 2XLBA 4KYVA 2Y2VA 3HI4A 4G5XA 3BJRA 1WPRA 2WJ6A 4B0OA 2PU5A 2OAEA 1TKRA 5ALJA 5AM1A 4BDSA 4WJLA 5EIHA 5AKXA 1YR2A 3FAKA 4AN0A 2XUJA 3C6XA 2HHAA 1YSCA 3ANTA 3AZOA 2Z3ZA 1CUCA 3D2BA 1E5TA 3H04A 3Q0TA 1K4YA 2CEKA 1JMKC 2CJPA 2VT7A 4QWMA 2FJPA 4FBLA 5BV7A 2AJCA 4ROTA 1FSSA 1R1DA 3GELA 5JADA 4FNMA 2D5LA 3WWDA 5DYTA 2HIHA 5AHXA 1BROA 3G0BA 3U0VA 5AK6A 4K6KA 1CR6A 3STVA 3WI7A 1J07A 4U2BA 4MXDA 3LCRA 4DTCA 5DYWA 1EI9A 2VQ6A 3O95A 1GQSA 4KR0A 3H2IA 4C4XA 3WIOA 4CFSA 3S8YA 2JGFA 1LPNA 5IVHA 3VJMA 5AO9A 5AI6A 4BRSA 1AC5A 1VZ3A 4DM7A
chains in the Genus database with same CATH superfamily
2P1DA 2C5HA 3RRYA 3K8YA 5EY5B 5AKKA 4QJBA 5JXJA 3ZY5A 4MPPA 4A8TA 4HGQA 3RKUA 2QMHA 3VC1A 1P2TA 4L28A 5G0VA 1JR3D 4V0ME 4UULA 3D6JA 4XB6B 1N9GA 2HCFA 2PXCA 3OOJA 4W7HA 5IJXA 3A2LA 4LNAA 4L8LA 1YR3A 2WMOB 4BNFA 1LF5A 4M0EA 4I4CA 1E3DA 4E3ZA 1YK1A 1OI2A 1UT6A 1CEQA 2QTVB 4CCSA 1V8FA 2R5WA 4GKVA 3F8TA 4DGQA 5EJIA 3LC7O 3HUTA 4DR2B 5G41A 1R0WA 4QREA 1BMFD 2YIVX 1RPJA 2PGJA 3RS5A 2W43A 1UC8A 5C7YA 2M6SA 3TTXA 2O0HA 2Q6KA 3ENZA 2IV7A 2JFWA 2PZ8A 1I3CA 1EQAA 1L4EA 3P0IA 1FW8A 5FOSA 1JFVA 1XQ6A 3SXJA 3DQQA 3EDOA 5FPKA 1B8PA 1RYEA 2NZVG 4XFJA 3ER8A 1DWQA 2PT5A 1EVIA 1GEEA 2FFBA 3A6ZA 4H7EA 1OXKB 2GBIA 4JL5A 4A2QA 1E8MA 1XMXA 3DVQX 4P5DA 3WYGA 2Y0CA 2B7CA 5KCZA 5FBVB 2HCTA 2VRCA 5A6SB 4TWRA 4BRZA 4OYHA 2QU8A 2ZJ5A 1VIVA 3M81A 4LKOA 3JQBA 4YRMA 5IUKC 3RAEC 2J3MA 4DV2B 4UUPA 5K3SA 3WZ2A 3DSRA 1CNMA 1ZISA 3MN1A 5AW4A 2ZQYA 2GBFA 1U31A 1TYBE 3M6LA 3QOXA 4TX1A 4AWAA 2ZYDA 2R66A 2Z2XA 2E6KA 1BMQA 4I2VA 4BQSA 3GDFA 2BHTA 4DB2A 1DMSA 2Z8YM 3ROMA 1CX9B 4QJ5A 1JIJA 3WKBA 3ENQA 4L9AA 1PJ2A 4WACA 1MG5A 4ENUA 2C0CA 2VCHA 3OOWA 2JDIA 4NZMA 1BEUB 3SQNA 3OEHD 3N2KA 1ZESA 4F0JA 2QZ9A 3PEUA 2DULA 2KX7A 3AOEA 2KBEA 4X61A 4LNUB 3UV6A 4M49A 4NATA 4BZZA 1LZKA 1W36D 2A9KA 1AU9A 1GD1O 4CLRA 1PLKA 2CBZA 2H2FA 2WVJA 3RG8A 1ENZA 1OTHA 1DRKA 4P3NA 1XALA 2OYCA 1M7GA 2ZRDA 4JLSA 3T5MA 3N2YA 1U7DA 3PFNA 4DLNA 3ROGA 5ALYA 3JQCA 1AA9A 3GLRA 1C1DA 4RHYA 2M2IA 4MULA 4TZTA 4U7PB 3DCYA 4L8FA 4ZOQI 4O2AB 3OT1A 4B33A 3QE2A 3SR0A 1D3AA 3JQFC 3C74A 1L5GB 2FW7A 3Q0EA 1DCMA 2D5IA 1ZGCA 4UM5A 4ZPJA 1TVMA 1LNQA 4LDAA 4P5EA 1USVA 4ENQA 1ACJA 3IOEA 3IP1A 3MQFA 2EBHX 2EL7A 4L9RA 4FDLA 3TW6A 3CU5A 1Z22A 3WADA 2EWVA 1Z0ZA 3BTUA 3TFQA 2IX3A 1ZI8A 3AL3A 5ICGA 4EATA 4AWXA 2HJVA 3IBGA 5F77A 1S2LA 4D5EA 5A5EA 2E85A 5JS8A 1RXWA 1L4NA 4GAEA 2YW9A 4QJIA 3OM1A 3P45A 1HE5A 1FSPA 2L0XA 2AEEA 4B5KA 1JECA 2ZBPA 4E2FA 4WADA 5FXMA 4M9XA 1VRVA 4DDKA 4RULA 3ZJTA 4DMKA 5IVIA 4B2YA 1Q50A 1ZNZA 2PL3A 5DP2A 5GVSA 2VT6A 1HDXA 4V03A 4CGYA 3KSMA 3WLQA 4BNIA 4DBVO 5BQ3A 1WOYA 4WNIA 4M53A 3TOVA 1R9GA 4IJVA 1AS0A 3TMKA 3I64A 2D2VA 3BL5A 4Z49A 1J70A 3TG2A 4HOYA 3T4PA 4HLUA 3KOUA 2LTAA 1DDGA 3CG0A 2H0QA 1W6RA 1Y4UA 2PSJA 1KEUA 3HB0A 1QTIA 3OC6A 4FMDB 1P18A 2AYXA 2ODAA 4NS1A 4XOIA 5FH9A 1DTEA 4Q3LA 1E64A 4K6FA 1HOTA 3OG9A 2O59A 4PONA 2CY0A 1EFHA 1NLMA 2ZWMA 4I5EA 2UUCB 1S7CA 3V2HA 3BD7A 2CHUA 4JYBA 4ZVNA 4PLZA 3EMVA 1LA2A 1AXEA 3QH4A 2JVJA 1V26A 3NIDB 1KI2A 1JIVA 1A9QA 3AP1A 2JFVA 4WHMA 3OZ7A 3EH1A 1N34B 1FCJA 1XUOA 1H8ED 4AM8A 2C57A 3BJIC 1XWWA 1G18A 1W4RA 1RZUA 4AYWA 1RXSA 2ORIA 4GRIA 5DT9A 1ECJA 4TT3D 4IGAA 2VYCA 4AUKA 1PGPA 3D3WA 1N5IA 2P5SA 4X85A 2E4YA 4N82A 4CG1A 5HIAA 4Q39A 3NTVA 4M8LA 1ULHA 1E2IA 4RVCA 3I8XA 1MT3A 4UHCA 3HC7A 1CUIA 5B3AA 4Q3OA 2NTJA 3DZFA 3ESQA 3VR6H 4FU0A 4HFMA 5KREA 3ZY4A 2Y1WA 3N70A 2KLBA 5G0TA 2OENG 1ZNXA 2I1LA 3QU4A 3OPYI 4MPTA 5EJFA 5T4EA 5LOVF 4X6LA 1XKQA 1Z0DA 1ZA2A 5EGNA 4KXLA 1KAOA 5CXXA 5GM2A 1ZK2A 1L5NA 3LQ4A 2WSIA 2HDNB 3TWOA 2QMYA 2ZIXA 1KSHA 6NULA 4IM7A 1OAAA 4C0BA 2QLFA 1UKYA 2FZ4A 1IIBA 3NEPX 2Y67A 1SULA 1IQPA 2ACWA 4IZOA 1T10A 4MV5A 3IJRA 4ZZIA 3JQQA 4WA8A 3IJEB 4OATA 4HMPA 1FXWF 2QTCA 4J8PA 2ZRHA 3OECA 3QNMA 4DXHA 4UE3S 1KFKB 1Q21A 3ISVA 2A0YA 2XMBA 4BLWA 5EWJA 2PSEA 3UTDA 2BAGA 4TN1A 1FDUA 1G8YA 1ZHHA 1YBMA 3JWHA 5H02A 4YRJA 5TDHA 4B6EA 2EJCA 5D1NA 3HR8A 3ZXUB 2W2LD 1OJ7A 2YL2A 2RKOA 2ZS9A 1N6RA 3C6ZA 4X8OA 1R2QA 3IBCA 3M3HA 1JBKA 1ZLYA 2XODA 1XVLA 1GUYA 2PUHA 3KFXA 1T13A 4QUKA 3SSOA 4E7OA 2RSLA 1O4VA 1ADYA 3HVHA 1P3JA 3ZEAA 3GPDG 4JC8A 4MQFA 3W78A 5DBIA 1PNRA 4NLLA 3ESCA 3L46A 1BXRA 3GZJA 4OG2A 3THWB 5JVDF 3JZFA 4ZKDA 1CHNA 4BMZA 3ACBA 2G9ZA 4KAXA 4B6OA 2HYIC 2WJIA 3D8SA 2GCIA 3KKZA 4WINA 3IBYA 3WYDA 4YAOA 4NE9A 4U7GA 5LYJF 1ACLA 4BB9A 1U1FA 2NLOA 5L3RA 4IYRA 3RVBA 2OXFA 4NDAA 2P65A 2WJGA 5HKLA 4O4IA 3TOZA 4NP6A 1J8MF 4AJKA 3AB3A 4XVCA 2XNHA 1IY8A 1EUQA 1N0HA 1HNZB 3FRJA 1M1NB 3MRTA 2A5FA 1J99A 2IITA 4GD3Q 1RJFA 3ND7A 1UL1X 4JP3A 3RTGA 3UZUA 1Q84A 4EHJA 4F38A 3EZ2A 1BA3A 4F3NA 1RWQA 2R25B 5ECYA 4MW4A 5IJZA 4D42A 4MWGA 4K5QA 2V7BA 1PL7A 1FLNA 2F6RA 2MTBA 1AHHA 1KE2A 1NMXA 3HKCB 2I1QA 1MPTA 4RADA 5KSWB 4E1AA 4P80A 3QF7A 2QR5A 4K03A 1QVWA 2OV1A 2PJDA 3PC6A 2H1RA 3COVA 4MZXA 4M0PA 1MQSA 3MWKA 4MQ4A 1G1AA 4YQEA 3C4VA 5T3UA 3KOZA 4IVRA 1V5FA 1Y37A 2VHWA 4KQJA 1W1IA 2WV7A 5CRIA 1KZ1A 2XMSA 2YHIA 3FYUC 3O8OA 4RGVA 3FMPB 1XYYA 2AOXA 5I47A 1HK7A 4NI5A 3D6FA 5LKRA 4EP1A 3ZOKA 3B3QA 2OWEA 4CEHB 5F52A 5F5XA 4RF5A 3UXMA 1HY3A 1EG2A 3QI2A 4R9SA 1AKMA 1OA1A 2ST1A 2FK8A 1UWCA 1B0AA 1P45A 2OXCA 3H7AA 4QPCA 2WHQA 3F7OA 1LFAA 3P5BA 3BMQA 4JVOA 2GERA 5IDVA 1SXGA 2JAUA 2VJMB 1PYDA 2X1MA 4TTIA 3QV2A 4E5YA 1X1AA 5A4KA 3QFCA 3C8HA 4C87A 1N0UA 5DCYA 1X7GA 1YH3A 1Z9BA 2H18A 5B5SA 3BULA 2P79A 4K3VA 5EUQB 1XTRA 3DOEA 5F2EA 3QPAA 3FGNA 4CIVA 2Z1DA 4JJAA 5BMVB 2BCGY 4W6QA 3WLRA 5IKMA 2YBDA 2NXCA 4FCVA 4DY6A 4NOLA 1TVEA 3GGGA 4RGBA 2Q4TA 4CF3A 1P2BA 3DXFA 3OZIA 2CVOA 2ZWAA 1WDMA 3KT0A 1LEHA 3SXUA 3VPDA 2ECOA 3OCVA 5D3MA 5CD1A 4W99A 3B7GA 2WUGA 3TR5A 1ENOA 1KZGB 1JLLA 4BCCA 3O7WA 4KAFA 4N76A 3JRNA 1IOWA 4ENTA 5IASA 1E2GA 2OYSA 3NIWA 4EJSC 4DLRA 5LLDA 1GDTA 3QVSA 3B6ZA 4QWWA 4C7BA 2UUAB 1L8OA 3PRHA 3MTAA 2OQ2A 1M6WA 2QG6A 2GJAA 3C1TA 3OSUA 3SS8A 1V16A 1L5QA 2XA2A 1IRIA 2ATXA 1SKUA 1Q1EA 4QBGB 3EPRA 3LU1A 1ISPA 2F3RA 1DI0A 2CVHA 4DIBA 5EMLA 3V33A 1PLJA 4IUDS 1ESMA 3KLPX 1DO8A 3ICPA 4BNTA 5KDOA 3IUSA 4PNPA 3VNRA 2E55A 3B1ZA 3PNKA 1CULC 2QVLA 4F2DA 5LQMA 1IDOA 5ALMA 2XNDD 3NDRA 4JBIA 2QBYA 2C9OA 3QVGA 4BBJA 4B7ZA 2V6GA 1YBVA 3OT5A 4MKIA 5AQ1A 2Q5FA 3GGCA 4BYMA 1AKUA 4H59A 3LLMA 1B0PA 2ORED 4H17A 4R1TA 3AIOA 5IKEA 4GR9A 3IVMA 3WLIA 4BUZA 3RK1A 1O6CA 1T0HB 3VZCA 2WI8A 1GTRA 4IIBA 4H7IA 4HQLA 3OJFA 1KAHA 5IC6A 3E35A 3Q8KA 2Q5LA 1TT5B 1UINA 2EZTA 2FUKA 4K6OA 4TKVB 4A2PA 1YAJA 2XE6A 3VKVA 2C00A 5CA0A 1GRNA 3SEQA 3IQEA 4Q3EA 3VNUA 2YWEA 3I53A 2OILA 4R9UC 3HLTA 4RTPA 1W7AA 2CK3A 2O2ZA 1G16A 3RF6A 1ML4A 3FPGA 5I9TA 3VVCA 3RKSA 1RWOA 1AGXA 2A3NA 1DQSA 2IYRA 4C7MA 3UCEA 3WGLA 2VPYA 1L7EA 1OIXA 1C9DB 2QN7A 2BEUA 3U09A 2D6FA 4J9VA 3U4IA 4MVJI 4UTPA 3PKZA 5HXAA 3AF1A 3G2OA 3OFND 2W58A 1DIRA 1XAGA 3G2MA 3UHOA 3KUDA 4P7JA 2BYTA 4LEIA 1CJCA 1R0KA 2YHBA 3VR4A 1SUAA 4YJGB 1P4AA 1NXTA 5E2IA 3T9CA 3DF7A 1C7JA 1O8CA 1TQ8A 1ZMXA 2FEAA 2ZR9A 2Z3WA 3GY0A 3GLHA 4RFVA 3ASVA 4MLZA 4XEUA 1SR8A 1UMDA 3VOTA 3RBAA 3ME5A 3T4UA 3S1LA 5AW1A 1GSIA 5JCOC 1C4KA 5AVQA 3RVJA 4F3TA 2XSZA 2UKDA 3OM0A 4HS9A 4F84A 3VKGA 4U2FA 3OIYA 3X1YA 4N3NA 5C3UA 3WGNA 3T1NA 3E82A 3K0BA 5CH3A 5LQNA 4X92A 2OHJA 1N9KA 4HLDA 1KFJB 1P1IA 4AUEA 4J49A 1TW3A 2FPIB 4RK4A 1RVV1 2WFAA 2YV3A 2WJ4A 3O03A 2VHCA 4KGDA 4HBGA 1BDJA 2GN0A 3TTSA 2XCIA 1L4HA 1Q2XA 2BOVA 5CLIA 2ZT5A 1KYIA 1XZEA 3QEMA 4PTZA 2DERA 2X9LA 1U3FA 4F72A 5CITA 4ZI5A 1E3QA 2ZYVX 3G9QA 2AE1A 4I9NA 4MUMA 5EEHA 4UUBA 5AVSA 2J9FB 2RJNA 3DBOB 3KJNA 3BRQA 3OE7D 4BVHA 4CKEA 1RRMA 3WTCA 3JWJA 4PLPA 3SM3A 3DL4A 4KE9A 2VXCA 4CIBA 4MO9A 5LL6P 2NZJA 5JW6A 1J8YF 4TQGA 3KQKA 3ZYCA 4QGGA 1BHQ1 4EG6A 1ZEMA 4IDEA 4PE5B 3AWDA 3N8DA 2VDWA 3GYBA 2QM0A 4JJZA 2OAGA 4FHZA 4EX7A 1ZR2A 2LW7A 1KDRA 3OF3A 3RDPA 3SVTA 3GEBA 1E59A 3DNMA 1F4VA 4QRDA 1ISJA 1TQHA 3K6JA 4N7RA 2WP8J 3VV2A 3WO0A 5A4MS 2XB6A 1MH1A 3L2OB 1LVGA 2V65A 2X2OA 2QUZA 3WR5A 3DONA 2ZYSA 5FPPA 3GWGA 2PZJA 1J5XA 1GLNA 4QARA 2VDMB 1F8FA 1MNQA 2OZVA 1OFHA 4OXQA 1T8WA 2O52A 3A6LA 4Q4AA 2A57A 4ETIA 1PLLA 1T25A 1YIOA 1V1MA 2IPOA 3D9QX 1PTJA 3GB9A 4XRGA 3GAFA 1QRRA 2HWKA 1IYZA 2IU4A 4H1UA 4HGOA 4WFIA 1KE1A 3FPFA 5JPDA 3H1TA 1NRIA 2JBWA 4WPGA 4KN8A 2BRUA 4URYR 1R4NB 5THKA 3JQFA 4J1TC 3S27A 2YY5A 5A3VA 1R4MA 4GGOA 4X9XA 2G1KA 3MUOA 1JIIA 1OWPA 4I36A 4JC0A 4ZMSA 5JMWA 1Q0UA 3L1KA 4FGLA 2P35A 2QX6A 1O9HA 1RAEA 1XTJA 4L8VA 4OB6A 2IH4A 5JBNA 2JEYA 1GFZA 1LBTA 3MGGA 1JFLA 3SC2A 1RC8A 2AD5A 3BJMA 4FYYA 4B48A 2D7JA 1GSAA 2I4MA 2JIMA 3E9CA 1YONA 4GR4A 4LXGA 4YP7A 1XFAA 3HRHA 5E6SA 1Q11A 2GPWA 3NDJA 5EJ5A 5KQLA 3BXEA 2G1UA 1L5OA 1ZC3A 1E2HA 4O2AF 4RVSA 2C2YA 2X8WA 2ZRNA 3U7RA 4RHEA 3VDMA 4IR7A 5J59A 3P94A 3P19A 1S4QA 1UXKA 3STUA 3OLXA 4I2NA 1ODCA 2CNBA 3TI9A 5KQRA 2NU6B 2B9VA 2PKWA 4WCDA 3E7DA 3C87A 5TMDA 2EG5A 5IHXA 1SU8A 1UPAA 2C58A 5E1OA 2PV7A 3NGXA 4Q4HA 1T36B 2Z83A 5H3LA 2BFCA 3SX0A 3DKPA 3WL6A 2WKWA 1ZGJA 5HKAA 1OUMA 1AUXA 1SCAA 3NT5A 3UPDA 5CDFE 1H6CA 4WKPA 5KIAA 3LWBA 2BKLA 5JZBA 1G8GA 1HI9A 3GXBA 4PO9A 3L1VA 1FFSA 1M5UA 4LYEA 3HK2A 1RE0A 4M0CA 1HE8B 1RWXA 3IT1A 1V2HE 4KLNA 1DRVA 1QAOA 4LRSB 2D2FA 2QZZA 4X1YA 2HA4A 1ZIYA 4JLAA 1QX3A 4OQLA 4ZAFA 1R12A 2IQ5A 2DTDA 5CX1B 1A9ZA 1ODIA 2XEXA 4LRUA 2F8TA 1M34B 4M8IA 2C9DA 4MW7A 3FW1A 4C6TA 2V0NA 1OWLA 1U2PA 3NVAA 3O83A 5B7PA 3I01M 4F4FA 4ED9A 1ESZA 1NOJA 5AK5A 1EG7A 4CNQA 1ECCA 5KDDA 2QIPA 2IH2A 3UWMA 2OG2A 4DRXA 5MFPA 4OL0A 2F3QA 1E9FA 3ILHA 5KYNA 1O95D 4G67A 1JAZA 1EINA 2F8LA 1N3IA 1AGNA 1EP2B 1XNQB 2W93A 5HS4A 5K01A 3FROA 3GCWA 1RYHA 5KOYA 3P9PA 4GM4A 2QVCA 4DOMA 1XCPA 4W5OA 1E2LA 3AESB 1BN7A 4X84A 3EISA 5G1NA 3B1KA 5P21A 1Z6AA 1VCNA 1NVDA 2HB6A 2QN9A 4W9NC 1PZNA 4K86A 3VVBA 1SO8A 4RJKA 4I55F 1YJCA 2VNHA 4G0ZA 4JJ4A 3NORA 1PJZA 1WKVA 1KVSA 1UK8A 3CN7A 1O6FA 1OR8A 1GZSA 2DQKA 4QG7A 1B42A 1QG2A 2W71A 1U2EA 2A9JA 3Q6IA 3R77A 5EMHA 1Z3CA 1E7YA 2CJWB 4D25A 4UHEA 3EDMA 1ORTA 4RH1A 1E5QA 1YKFA 2UZ4A 1L5MA 1X6VA 3AF2A 1T5HX 3P1JA 3Q12A 2ZB3A 1MENA 3L7NA 1XELA 4UNIA 2XRZA 2ZAMA 3PNVA 3VDNB 3DZGA 4NG4A 2WJWA 4MJLA 5LZ5A 1HQKA 1JAYA 1PQUA 1OWMA 3O3CA 4KTTE 2PKYX 4OJQA 4RD6A 3QW4B 4S3MA 4WZ6A 4G1VA 3GG9A 3KR0A 4QRHA 3V80A 3UGJA 1CQWA 1QS0B 3EEQA 1XKLA 1V35A 2HA6A 4O2LA 5IN4A 3JQAB 5B1EA 2DHDA 5H0IA 2BEWA 2QPLA 2FRDC 4E5DA 5KEIA 3H8VA 2FHPA 2FB9A 3R0JA 1YZGA 4BEJA 3QEBZ 4JU8A 3ICWA 3VPSA 3DDHA 2FKNA 4HQNA 5DMHA 1RAGA 4BNDB 4HDNA 1Y7IA 3P71T 3TZCA 4DRXB 1L3CA 1H85A 4POAA 4B81A 1PJLA 4AS1A 5JFOA 3W4IA 4RWZA 2QSZA 4HQRA 1BFDA 4UD6A 1OFTA 3NDPA 2IZ7A 4HH0A 2G9QA 4Q6WA 3Q8XB 1RP1A 3B60A 4WKOA 4S1NA 1Q91A 5AXBA 1QRUA 2GPYA 4XPZA 1EJ6A 3HL4A 1O54A 2HRZA 4M2LA 3UCFA 1PVVA 4HWGA 3CX3A 5A02A 1J9GA 4BUCA 1LI7A 3CX7A 3ABQB 2N47A 5IDQA 3JR3A 2H2AA 2IYVA 1GAXA 2YWRA 2QM3A 2WHYA 2V8BA 4CI0B 3PT5A 1JDJA 1M8GA 4BO1A 4C4PA 2FFAA 5AW9A 3HXQA 2X14A 2D2EA 1NL3A 2DZDA 3ETHA 4NC9A 4NS4A 3EVBA 2R2GA 3KUUA 3P5SA 4YP0A 1MDBA 1P2UA 5G1PA 4DMGA 4N3AA 1QO7A 2GBPA 4OGWA 4CKWA 2EV9A 1RC1A 2AKAB 2GH1A 2I80A 3DTVD 4B3HA 1JR4A 4OSPA 4L6CA 5G1OA 2I6FA 4G26A 3QA3E 3QYAA 4OA8A 2VDWB 3MFYA 2EFDB 5AW2A 2QUIA 4B7XA 2ZAYA 1Z62A 1Y9ZA 2GVZC 3UXEA 3RU3A 3KVRA 3V2IA 4RELA 2R65A 1L6RA 4U2CA 4YFYA 4ZMRA 3CVJA 3G7SA 3PJEA 1A8UA 3HNRA 4Q93A 1VYTA 1Y1PA 1AUQA 1Z13A 3DZ8A 2GLXA 1K8QA 1Y80A 3P27A 2A94A 3I6YA 4HJRA 4FINA 4BB0A 3A2KA 1U5CA 4ZU1X 1I10A 1OC4A 1HKHA 2Q1WA 3W7BA 2G9NA 1P0CA 1RBYA 2O2SA 1NF3A 5ARBA 2UYGA 5ITWA 4TL9A 2WPDA 2J9XB 2JGDA 1KY5A 3JPWA 4FGSA 2ENUA 1UXJA 2POCA 1QOZA 3GARA 4KMRA 4CG0A 1IVSA 4RPKA 3ZE8A 4G25A 4LJYA 2G5TA 2QMZA 3LXMA 3SKXA 3EEYA 2QUBA 1W94A 3A6DA 4L0MA 1DBQA 1ST3A 3KAPA 3QLUA 4XIFA 2IUUA 4KBGA 4DR3B 1DV1A 1RKBA 2C4NA 2I7DA 1C9MA 2ZJYA 4GR5A 4J43A 3NKVA 3HRKA 2IHJA 4BRWA 2IY8A 4CCYA 3OOYA 2JD2A 2YRXA 2IYZA 3NKLA 3NKFA 4ITUA 4JR0A 5EZYF 4BY9E 3P2EA 2EKDA 1DT5A 2QMQA 3ZDRA 5C18A 1ND5A 4XQ9A 3QVOA 1CP3A 3UA3A 1Y42X 4R69A 3V2UA 4MV1A 4F8JA 4H3HB 4P33A 4NKRA 1L7BA 4JVSB 1BGVA 2BWJA 1KMHB 3RVSA 3GJZA 1QORA 3BMOB 4TPKA 2DHCA 1KJ8A 4N12A 2AMYA 3F8SA 3AUAA 3GRRA 4HQFA 3VKUA 2JGRA 4R2XA 1CUBA 1X7HA 4M9UA 3V34A 3ZW7A 4JB3A 4OUDB 1MJFA 4FSXA 5C37A 1K3UB 3IUBA 3IUYA 4JLKA 2OT3B 5I01A 1YDHA 1GTL1 2NUPA 1XZGA 3L40A 2GESA 2YMLA 4WK6A 4E5SA 5FI0B 1J20A 3RU7A 2GJKA 1Q6ZA 3HCOA 3ZNQA 3DE7X 2OQVA 2AFRA 4BKRA 2OC4A 4W9MC 1NVGA 2JIRA 1BC5A 3GJRA 5M04A 5HM8A 3EVZA 1NUUA 1OTXA 4K9SA 1HT3A 4I66A 1BXZA 4FYKA 3R9XB 3LUFA 4LHWA 2J0VA 4X5OA 4DCPA 1I3KA 3AVXA 1QGED 2WPNA 3B9PA 1PT7A 3S2FA 5D7NA 3BIWA 4FFVA 1L5HA 1R0SA 1FK8A 2A9VA 5EE5B 4R40A 2PGNA 3EDYA 4IDNA 2TMGA 5IPFA 5K8IA 3TG8A 4AX4A 3TO5A 2B37A 3BB3A 5I48A 1I80A 4JJIA 2QG4A 4YUXA 1LTKA 1JFTA 3DKVA 4R1UA 3ORYA 3HJHA 3ZGOA 4RV9A 1CVRA 2G5GX 3BMCB 2Z3VA 2QTLA 1JHZA 1GL9B 3QG1A 5AHRA 3VOAA 3N2LA 3PF8A 2GN8A 2ZETA 3S2GA 1E6UA 4C05A 1RLMA 4DANA 4F92B 5BOVA 1L4FA 2WYUA 2Z98A 4HNSA 3K35A 5FPYA 1L5SA 1BX3A 1OC2A 4CT0A 2P69A 2Q5CA 1OFIA 1P4GA 4ALLA 6PFKA 2G0TA 4LJ4A 5UKDA 2PZMA 4YP5A 5LA6B 4UQLA 2O7NA 3P32A 2QVYX 3ZI7A 4DLBA 3PDIB 3QHAA 4OQXA 2ICAA 3H99A 1H8HA 3MWEB 4I7EA 4Z4GA 2OBFA 3DEKA 2EBUA 4DSNA 1ESCA 1UKBA 3K9GA 3LVBA 4L5IA 2AN5A 4AKIA 1XXHE 2ZYAA 5CXQA 4YPVA 2R5NA 4F21A 3FA2A 3IO3A 3PEVA 4G09A 3NEJA 1N5LA 3FUUA 1GNSA 2X22A 4YT4A 1VPDA 3FZGA 3FKQA 2C4VA 2X1VA 3L1JA 3O2NA 2Q2OA 3SF0A 5TLSA 1G38A 4HT3B 4QUDA 1KK0A 3RGWS 5KOJA 2XKAA 1PFYA 2V74B 3HFRA 3MJDA 4PF1A 4ZDIA 2DBQA 1GR1A 1UKVY 3V42A 3ZIDA 2QAJA 3N2KB 1LTHR 1TF5A 2YNMC 1OFGA 3Q10A 3SGLA 3EAFA 3GFPA 1FUYB 4GDMA 2FUEA 4EFDA 3MELA 1X9GA 1YS9A 2ONJA 1PZGA 3PI6A 5DNWA 2DLCX 2QN8A 5JFGA 2PJRA 5MN6A 1M2NA 3PSAA 2RG1A 2AR9A 5I51A 1PQWA 1F6BA 3DEHA 1H3NA 2XMCA 1DADA 4HRVA 5CT5A 3MMNA 3E05A 4JGBA 3RRJA 4C20A 2XZPA 2VNIA 3OEHA 3TKLA 2XJ4A 2WUEA 1PVDA 4DN6A 5F98A 1V3QE 1OB5A 1FEZA 4M7WA 4X20A 1XDDA 3SU8A 1UFOA 3P2IA 4O4JB 2Z2JA 1H9CA 1NZFA 1YZNA 5CT4A 3RFUA 2ZP1A 1U7ZA 2VPWA 2P2YA 5A3QA 3N6RA 2J08A 3VTKA 3TGWA 5CW2A 4CV2A 2P41A 1IG3A 2BC9A 3JQ9C 3QE9Y 5JFTA 3H8WA 1A4IA 1DBPA 1UP4A 2I2DA 1O03A 5LMNB 1P62B 4V0RA 3ZCSA 1H65A 1K75A 2O6HA 2NU7A 1HEYA 1RJGA 3BDIA 1QHEA 1CUUA 2ODPA 3LNCA 4B76A 4P82A 4YCDA 1G8SA 5TQ2B 3RU9A 3D54D 4FT2A 3TLYA 1DPFA 1XJ0A 3FYUA 1KKUA 2CLIB 2W2PA 4YMSA 5IAKA 2FPGA 5THQA 3SHWA 2FPRA 2IELA 5AKZA 2HHHB 5AKLA 2I33A 4C0SA 2IEBA 3SXUB 4ZVVA 1VLZA 5EXPA 1E9CA 2FPPA 2XAAA 1EWYA 2NSHA 4Y2VA 4ZO9A 5TGDA 3WLKX 3BIOA 2VHYA 1G20E 5GWXA 3KJEA 2BGWA 3U4MA 4EVRA 4JLVA 4UDYX 1LC0A 3UANA 4IIHA 3FNGA 1IJEA 4Q12A 4YMIA 2BE7A 1QU3A 3P9IA 4EIWA 4BB5A 3QOFA 4MI6A 4IWYA 4MITA 1S6YA 1Y8AA 1IBRA 5KNBD 4LY3A 4BMOB 3ZGYA 2PRSA 1WO8A 3T5BA 1MKYA 4PSAA 4YRLA 3ETNA 2WVAA 1XTZA 1NYTA 3GP8A 2CLHB 1CKEA 4UNQA 3ZHQA 4DWOA 1D7OA 3LYLA 3W5DA 3GHHA 1AHPA 3U48A 4YRCA 2W6MA 1KY2A 1J56A 2W6PA 1N5DA 2XNDA 2RHWA 2FV8A 1ZW6A 2WAOA 3R8XA 4DJJA 3C3MA 2O23A 4Q18A 3VBCA 2J07A 4CJXA 3T0GA 4POOA 2BGGA 3GUVA 3NCTA 2J7PA 3IQGX 4PR3A 1FUUA 1TA4A 4TL7A 4JHXA 3GLGB 3CB4A 2OORC 4D8TA 2G40A 2XIJA 3FZYA 4Q7JB 1VL1A 4C5AA 3DCNA 4RQTA 2YN0A 3DMTC 4M89A 3BBLA 4O4LA 1NXOA 3HDJA 5D2CA 3L7DA 2BHLA 4JI8B 2I6TA 3E1KA 1U2QA 5ALNA 5J3JA 1K68A 3RC1A 3ZWDA 4M9RA 4D5GA 1Z6QA 4KFRA 3WYCA 3BE6A 3HWRA 1NVTA 2GK6A 3T7KA 4KFTA 3UHJA 5HEKA 4LF5B 2RDMA 3A6EA 3D81A 3NNSA 4JROA 3OUUA 4GYKA 3NBUA 2Z8XA 4FR0A 3RARA 3R3XA 1CW2B 4ZIRB 3IL2A 1K7SN 2C8LA 3GFFA 221PA 4GEKA 5D3KA 4RTLA 1SWVA 2ZULA 4M3NA 2H4ZA 5FKJA 5A03A 3U80A 2XE8A 4KXFB 2OGZA 2NU8A 2YINC 5ALRA 1QANA 5IVKA 3GT4A 3E7WA 1YO6A 3PDUA 1RKQA 3DZIA 1ZHFA 2WYOA 4LOLA 3QJ5A 3KR2A 2QK4A 4DG9A 4LJ7A 4N5MA 5CD9A 4Q4LA 4EOGA 3AHIA 1I5OA 4PLYA 5TVKA 1ZIXA 1NJ2A 2YX1A 3N2EA 3Q7SA 4JC5A 2JZNA 2WHRA 3ELUA 4YS6A 2QMUA 4KTVE 2W70A 1JW9B 3REFA 1WUTA 3GRUA 3ZZ0A 2B3TA 4AECA 5HIKA 2O2DA 1FBTA 3LDAA 1TIPA 1YJQA 3DLHA 2OBBA 2VQDA 1SOVA 3C6BA 3LHKA 3E6AA 1SUSA 2QNIA 3OD1A 2YOHA 1I6MA 3LT5A 1H9AA 5EESA 2UV8A 4TS4A 2PGOA 5BY2A 3EGOA 4DA6A 2ZIZA 4OQDA 1SZJG 1DHRA 2PQ2A 1CP2A 4K8RB 3BSSA 4FZRA 4P8RA 4LF7B 1ANKA 4DUGA 3EG5A 2NO4A 2GJ8A 4YH1A 3B6MA 5LBUA 4YRDA 1B14A 1A7AA 7ABPA 4A0QA 5TEVA 1OZ0A 1KO4A 3MYRA 4TUYA 4WASA 4X8HA 4NICA 3HBMA 4OP2A 1BU8A 1UZUA 5AOAA 2KBFA 2Y99A 1JR3A 2ZPAA 4ZOLF 2RGCA 1HDCA 5ALUA 5IKXA 1RJWA 1HFEL 1TJ5A 3KV1A 3MD0A 3AUFA 5HBGA 4ZQCB 3K2EA 1U8UA 1QM5A 2ZJAA 5HMLA 3GCGA 1E3IA 1GZ7A 2ZIXB 3CNOA 3FCXA 4AJPA 3WA7A 4EFKA 3DO8A 2VCEA 3U3DA 1CVLA 4OJTA 2VTDA 3QYJA 3GROA 1F0YA 1JSCA 3RK4A 3ZJUA 3I2KA 2I1VB 3CF4G 4MQ6A 3QELB 1M2WA 4DLKA 3UKOA 3U5TA 4XD2A 4MVJE 1ZN2A 1GL3A 2V55B 2I71A 3DD1A 3PUKA 4L0CA 1ZVVA 2PD3A 1XJ5A 3NWPA 1QHXA 4J6FA 3GX1A 4U7WA 4XDHA 1EB8A 1S8AA 1HRKA 5LU8A 3HCPA 5JAIA 1JHAA 1PT6A 1RWPA 5ALXA 3Q85A 3TCNA 3ZNOA 7YASA 3W79A 3B8HA 3QFSA 1NJ8A 3FD8A 4GRAA 3TVTA 3VR6D 4M8NE 1KAMA 1BZYA 1MVOA 4DMCA 2PWZA 4EG5A 4XX0A 4KB5A 1OASA 1C1DB 1HFWA 2COKA 3FZNA 4GM0A 1JRLA 4UAVA 1GCOA 2GHQA 2J3LA 2G4CA 4EA7A 1UXIA 4Y2UA 3LBHA 2QX4A 2WILA 5LXTF 4XWOA 3IDAA 2UZ1B 1OIWA 4EPXA 3FKJA 1QIFA 2NYAA 3AUKA 3EOBI 4OHOA 2DLNA 5I7FA 1SVKA 3CIOA 1V8PA 2BJHA 2IIVA 2NACA 2RGGA 3BDAA 1MO6A 1N3YA 4J0KA 3ZE0B 3S40A 4AJ2A 2O8FB 2AMLA 1JPNA 1P77A 4AG3A 1R8QA 5EIAA 3N74A 3A7EA 2JHFA 4U3JB 1B2LA 1VPLA 3OPXA 2JZCA 4XR4A 1PGOA 1VI2A 2XZLA 1CSEE 2XUOA 4TXNA 1U9JA 4YMWA 3CRW1 1NR7A 1VFNA 4P7GA 1T0JB 5D6NA 3B7PA 3K16A 4P0TA 1W88A 2VPZA 4S35A 1P7YA 2W4MA 3NDIA 4M7RA 5CG2A 4ND8A 3NOQA 5L3QA 1PTJC 3DP7A 3H11A 3I37X 3K05A 5KKAA 3H4MA 2VCYA 1DAMA 4ZVQA 3BD6A 4XAQA 4YCJA 5PGMA 1W0KD 1R0CA 3IODA 2ORWA 4R8MA 2VZEA 1BEZA 5KB3A 2VJCA 4HYYA 5M34A 4NZOA 1JFSA 1PQYA 2XA9A 1W96A 3RT1A 1HWYA 4B43A 4BN4A 1DCTA 1PFGA 4J1TA 4NJMA 5L4NA 2PCJA 2XOKD 1USWA 3EIHA 1U3VA 1T34A 4XDGA 5EP4A 4HLUC 1C0EA 1ZMBA 4ZVSA 4BVLA 1XLVA 1RI1A 1ABBA 4GX5A 5TPWB 4DKXA 4BX9A 2PGDA 4D82A 3TEJA 5JC1A 3BUSA 3M9WA 4B34A 5EHGA 2RAVA 1RWBA 5B6JA 2NUTA 1KVRA 5HIJA 3PWSA 4A8JB 4B46A 3K0AB 1ISIA 1CD5A 2BMJA 1P75A 1ZH4A 2QLBA 4NWIA 4X7BA 3UJAA 1U2DC 2VHUA 3WB0A 1IBCA 1Z34A 3L06A 1RYFA 3BSWA 3GFGA 1DAFA 3K73O 4LXUA 1RQ7A 5EQDA 2QBYB 4AY2A 3E8XA 3ASZA 5K3EA 3HV2A 5BSKA 2QL5A 4BE4A 5CK5A 1YDFA 3U44B 3QV1A 3IVGA 3CUUA 2Y92A 3HP7A 2GFIA 4DNOA 1AQNA 2RGWA 1OXBB 3ZJYA 4KIGA 1KDZA 2WSSA 4IG4A 4U0KA 3FVRA 3RVQA 1QAMA 3KS9A 4EW1A 3AONB 4LXXA 4OYRA 3I23A 3VR2D 3EDCA 1KETA 3U9TA 3ZIUA 3F4LA 3BHJA 5T8KC 4DT1A 4UMEA 2AMJA 4HSEA 2OV3A 3P2KA 3W1WA 1C9JA 4MMYB 1GILA 2IZZA 1YF3A 3PHBE 4N0DA 3DTVA 1NM5C 2HSZA 3T5TA 3V9PA 2QL6A 2WFZA 3CW9A 3HL0A 5C35A 1F7VA 1PUJA 3WGZA 4P22A 5HJ7A 2YYAA 4MEBA 4UTOA 1ULTA 4Q9IA 5F1PA 1JDSA 3T5AA 5DP1A 2XT6A 3C85A 4RVHA 4W1SA 4WFJA 1RRPA 2C9MA 3KZXA 4ZXFA 2JIBA 4YEDA 1XD8A 2QD2A 4IHJB 4K6CA 3M4JA 5JJBA 3LUCA 4HGPA 4OKNA 1CUJA 1ZK1A 4GOKA 2QM7A 1XYGA 5HK9A 1KI6A 1U7TA 2NX2A 2P11A 1JJIA 1JLHA 1IHOA 1L6IA 4WK0B 3RQSA 4BQNA 4LF6B 4OYYA 2Z5VA 3LY7A 2RGUA 3OCCA 3QPUA 3MAJA 2JLCA 4Q9DA 3SZGA 2OFWA 4UVEA 1XEWX 3DG9A 4YWJA 1ZOLA 1YRYE 2E4VA 2PVSA 3BMQB 4TMYA 4ML3A 3EMBA 1F9AA 1Z88A 3FN4A 4OB8A 4BX2A 1XIVA 1ZRHA 2HBQA 2QTVA 4OMDA 4N9QA 4OYLA 2YHSA 5JBQA 1BQEA 2PTGA 3F6CA 2J9ZB 4BLPA 2W7TA 2BGLA 2JAHA 3B78A 4MWEA 4FEYA 3M5CA 3VHLB 1VHJA 4H15A 3ZQ4A 4D3FA 1A9XB 1PO7A 4F3RA 4REOA 1BW9B 4IRMA 4KXVA 1Q1AA 3WIUA 3F1KA 4KVFA 4D1YA 4M1KA 2XSZD 1VLVA 3NHKA 1BOOA 4JJ6A 2FMUA 1J0BA 2JKVA 4ZV9A 2HJ9A 5L7WA 1CQIA 1VCIA 3LRTA 2CF6A 2GD0A 4DCTA 2GI4A 5FUWA 5C8ZA 3TBHA 1O1YA 1Z5GA 2Q29A 4OBEA 1AKQA 2I67A 1BTOA 1RM0A 4CQLA 2R8RA 1SUCA 5FBHA 3PCRB 1PR3A 1JEYA 1VJCA 3EXG1 1MD9A 3CLHA 4PFKA 1W59A 3HA2A 3IQXA 4TOIA 1U81A 3L7IA 3PQFA 1F4LA 2OMEA 2P5YA 3E22B 4FD2A 5AW8A 1EZZA 2HC9A 3KBOA 5JDIA 3WIDA 1NSFA 1YZYA 3VPXA 1S89A 4JLOA 3T38A 4NH4A 3FTPA 4UMDA 3U1BA 1T5TA 3O6VA 2HREA 3CLRC 1X3LA 4MPDA 3K9FC 2PBZA 3RB8A 2QP3A 1A2KC 2PM8A 2YQ4A 4FNGA 3AFOA 1N5OX 3ZNNA 4DV6B 1A5ZA 3M3PA 1R6DA 2H16A 3O8NA 3ZLBA 2RI6A 3GEIA 3PNLA 3O3MB 1JQEA 3K4PA 4Q66C 4PLFA 4E51A 5J43A 2DFPA 3O4FA 2VJAA 1K7XB 1XMSA 4DKJA 4RW0A 1V4NA 2NW6A 4ANFA 4NJMB 2P2ZA 2NO5A 4E2WA 4H6WA 5J4VA 1ZD9A 3BYZA 4FDMA 5ER9A 2C7PA 3OE1A 2PX8A 3L7JA 4IS3A 4K6MA 4NU0A 4ZQEA 3A4MA 3IB6A 3UENA 1SMKA 2W83A 1NE7A 2I0FA 3CPSA 2PVPA 1X74A 3NTUA 1TL7C 5DRTA 3LYHA 1ZM2A 2YFYA 4B3MB 3H2JA 1ZJWA 1HXHA 5D84A 1RYDA 2F43A 2HSGA 2B69A 2ZUWA 4QLAA 5C8YA 2HEIA 1CRWG 1Z4MA 1XJCA 1D2CA 2O20A 3HP1A 4UVGA 1IOZA 1PNTA 1L7QA 1Q74A 2EKQA 2NN3C 5JZMA 3TNYA 4Q34A 1NYRA 4JT4A 4BO3A 5JARA 1JDNA 1W2WB 4KWHA 5TB5A 2CV0A 4IG9A 4W5TA 5FLEX 1GT6A 3UJNA 2PBRA 1GPYA 3GJTA 2XNJA 1QVVA 3SZ3A 4O1MA 1ZM4A 2Z43A 4R6WA 3KKOA 1KR5A 1D4FA 1M67A 5ERYA 3E27A 5DGXA 4JXXA 1N6PA 3ZDDA 2FXIA 2HH9A 3OX1A 2NQ8A 4P35A 5EZSA 3QVVA 4MV8A 1U28C 1P0IA 4F96A 3GFRA 3EZFA 4Y1EA 5LVAA 1TQ2A 3THYB 5ALFA 3HZZA 1U9IA 5JT1A 1WSAA 4E70A 4Q16A 1PI3A 2Q3HA 3DOOA 1C4OA 4IXMA 4B7AA 4C7JA 3SYNA 3R4CA 2QG9A 1BD4A 1NATA 2QVGA 5JSUA 1PEDA 3KL4A 3PVCA 4AK9A 1NRWA 1CUSA 3LBNA 4JB2A 1T8YA 4MRPA 1ZBQA 3V4PB 1EEXB 3O2JA 5KI6A 1H3FA 4HEA6 2VUUA 1CIVA 4XI9A 1J8FA 1JWLA 5HQ3A 2ENWA 4HXEB 3EXIB 2QE7A 1T1SA 4UM9B 3WRYC 1F14A 3MJSA 4MLPA 3COJA 1A2BA 1FXUA 1V8OA 1KH1A 4C4RA 1F8UA 3V46A 1D2GA 3LO5A 5IT4A 1FFBA 2XCQA 1KNQA 5GZ3A 2Y93A 1H2AS 1XZHA 2JK1A 3OM9A 4AG6A 1JTFA 5DX0A 4CMIA 4QHSA 3TNJA 3VZQA 4BFWA 5BRJA 5F7ZA 2VBGA 3DE5X 4C3UA 3BH0A 1KR2A 4FDTA 4BLQA 1KEEB 4JUAA 5LJIA 1J49A 3QOWA 3QXCA 1M0SA 1N2CA 3K72B 4DMMA 4RUKA 3Q3HA 3VR5D 1H4QA 1M1ZA 2F1KA 3EB9A 3T1VA 3UPUA 1SURA 1K7YA 4FWTA 1TAQA 2E4WA 2PKRA 3AWIA 4H18A 1AV7A 1HE1C 4FJ0A 5B3JA 4KP7A 3ZXXA 3U60B 2CNNA 3FYDA 1OXXK 1B2RA 1I2CA 1OX4B 4REQB 4UVHA 3RHFA 4CM8A 3EWNA 1XHLA 2VTEA 4NMWA 3ASYA 4JL6A 4Y67A 4B6QA 3LWDA 2P2CA 5FQNA 1ODFA 5EPEA 2FDXA 1E3WB 2Y1OA 1JE0A 3LRPA 1QV6A 4MTCA 4QXRA 5ELLA 5C5CA 2PT7A 1RRCA 5EAIA 4JBGA 1G2QA 1WCXA 3NVMB 4MWTA 4PZZA 5ECGC 3VPAA 1C9YA 2R1VB 5F2NA 4O2BB 1WEKA 3B70A 3D6AA 1ZGHA 1M54A 2GMWA 4QOJA 4QXMA 1YNSA 3F6PA 4Z7NB 4PAQA 1JAIA 2GEJA 2OESA 4YV0A 1E2BA 1HMPA 4RZSA 5COBA 6REQB 3IR7A 3HWSA 3SX4A 1UMBB 2XLCA 4M1QA 1KA9H 4DHWA 5KPJA 5JTTA 4EQ6A 4DR7B 1XHEA 5A4FS 4CFZA 1A8SA 1FPMA 4QYIB 1II0A 4MUHA 1TK9A 4MEJA 5FUXA 5JCPA 1Y8QB 2B7BA 3FNHA 2W8ZA 4R1SA 1ZDMA 3MFQA 5H9WA 1TUIA 3RV3A 1YBAA 2OVBA 3THOA 2C7GA 4F12A 3MK31 5L4LA 3NATA 2ONYA 5FO0A 2GASA 4O25A 2CCGA 3E2MA 5DWDA 1EFKA 4BVGA 4YPOA 2P6PA 4HX2A 4XVUA 1OF1A 3MCVA 2WG2A 2ZIWB 3I73A 1CY6A 3L93A 2P68A 4X62B 1SPBS 4BTLA 3ZGZA 4OHUA 4JCOA 1T9GR 1AUOA 1JLRA 4CMBA 1RI3A 1MW9X 5C4MA 4FYJA 5SZKB 4MMZB 3EZXA 1G8HA 2Q2NA 3GGOA 4QOIA 1YCHA 2GUGA 2YVAA 3HB4X 2WTUA 1J8VA 4GOJA 3LVFO 2X1HA 1VLMA 5BVHB 2F1RA 1SAYA 3R23A 3AL2A 4ZVKA 2GPNA 3VJLA 1SG9A 1NU6A 3ZK7A 5FA8A 2QQFA 3DOHA 1UR5A 2VP6A 4KAJA 3ACCA 3ICOA 4MYUA 2R7AA 4J6EA 5FBRB 2OO3A 3VYVA 3CLSC 1U02A 4HLNA 4BOYA 4HNTA 3G0OA 3KLNA 3AFHA 3KK0A 1RYNA 4UEJA 1RD4A 3GJQA 2ZE8A 2GTIA 5HHTA 4BO4A 1K92A 3CVWA 1J2JA 5H80A 5A4IS 4RY2A 3JZIA 4QJ4A 3ULKA 4JV5B 1OWOA 3ZZTA 4ZYVA 2RHGB 1LDEA 1DNPA 3BG5A 3PU6A 4B3GA 3MXTA 3WFIA 1YCFA 3UUWA 4EGJA 4UHHA 2JLAA 5HCUA 3EXIA 3EXFB 4XZ3A 2VKTA 5CA1A 3FUWA 5H1YA 1G9SA 1Z0JA 2VEDA 1K8XB 3IAS6 4RHTA 5J2TF 3CUEF 4PCVA 3WK5A 1VYHA 2X2FA 4YRKA 4M9SA 3IXQA 1ZD1A 2FJ0A 1FP2A 1C7EA 4D3XA 5BQFA 3ZWNA 1R00A 1N5MA 1E62A 3GFOA 3Q7TA 1ODJA 2FRXA 1A7KA 3C5WP 1WUIS 4S24A 1XOIA 5D3QA 1RPNA 2XWSA 3JYPA 1J9ZA 3KLBA 4ZARA 2K6GA 1MAAA 3H9QA 3M9LA 1NVKA 3GMSA 4PC1A 3W3AA 1DE0A 4IEEA 4EG1A 2AN1A 5B57C 2IIQA 2I2AA 1Z47A 4MWSA 5JI2E 1O94C 1DIAA 4QYWA 2WJZB 4BVEA 4Z4FA 4HH4A 1EM8A 1L0BA 1TE2A 2OEPA 4F4JA 1BQ4A 3FWYA 2ORYA 1TKCA 3ZHUA 5A3RA 4R0MA 2PX6A 3RUPA 3IMKA 2AV6A 4B82A 2MSCB 1G5HA 2EFGA 3B48A 3PUJA 3TJRA 3QENA 2Q1TA 1AK9A 3JQ6A 1S2MA 4I4TA 4WAUA 1A9XA 2Y0DA 3FWKA 2Q8PA 1QVAA 2Z09A 1I2ZA 4KKVA 1H6DA 5ITVA 1JB1A 4QYSA 3NHSA 2B35A 2HU7A 1UWKA 1CU1A 1ZZGA 3E53A 4ILEA 4M8KA 5AXCA 4JB0A 1GPAA 3V9AA 4N7MA 5CLFA 5ALPA 1G8AA 2BW0A 3K9QO 1OQAA 3I04A 5EC8A 3TW8B 1D4ZA 2V59A 1W48A 1XDSA 3H8SA 2JBHA 3FCOA 3L8MA 3ND9A 2FMKA 3PX2A 4RCZA 4WGFA 2LCIA 1TIKA 3O9ZA 3R0ZA 3V8QA 5B1HA 2IVFA 2Q4DA 1ESEA 1RJ9A 5BXQC 3JCZA 4KIUA 1FNDA 4YFVA 1V48A 4XXHA 2Q21A 4BDTA 5T6MA 1FOEB 3DZDA 1TQDA 4U7FA 2A1TR 4YY3B 3ZZNA 1HR0B 4GECA 3I0MA 3OTQA 2XT9A 1O5TA 2O2HA 1LLQA 4HUQA 4JLDA 3V32A 3EMDA 2WJHA 1FYFA 3OQPA 5DLPA 1VL2A 1HE2A 3LOUA 2ZUSA 4CCAA 4DLSA 4HL6A 3G23A 5IXSA 1F8YA 4ZWNA 3DJFA 2EFCB 3E5MA 5AM2A 2QY9A 3BRSA 5I7EA 2ERYA 1K89A 2QT9A 1B3BA 1K5GA 3ZCRA 3EEBA 4JI7B 5HF5A 5KSZA 1Z63A 1IHUA 1T8PA 1UBTS 1VJGA 4J90A 3E84A 3Q2KA 1WD5A 2FF7A 1ITZA 3MWFA 5EHQA 4DARA 1JHQA 1VLHA 1BE6A 2J6BA 3RVOA 4PC6A 4DRZA 3TCKA 1K6MA 5CBKA 2M32A 1SD1A 3R4VA 2K7FA 2JNWA 3KB8A 2X9NA 4Z9YA 2BR3A 2HF9A 2FSVC 2MINB 2ZRIA 2H7CA 2XRMA 3QFFA 1DJMA 1IBLB 3PDHA 2VBIA 2I4IA 2EQ5A 3BZBA 2O8DA 2XXJA 4MGEA 4M1ZA 1FMJA 5JJ5A 5IWAB 5E9JA 4RH0A 2JGEA 4MK4A 2PLAA 4Y7DA 4YI5A 2ABWA 2Q5JA 3CKYA 9GPBA 3D6TB 3HYNA 1DOHA 3BXHA 3LPDA 1V6AA 2W8BA 4FI3C 4G65A 4IF4A 4IWNA 3O75A 4OO3A 4PHGA 4R0NA 4RFSB 2VXOA 4R2HA 1GEGA 2QTRA 4UBIA 8LDHA 4IX9A 2ONZA 3A4VA 1SXJC 4L9WA 4XWTA 1R6VA 5K03A 3HRIA 2WKPA 3QVXA 2RGAA 4JUBA 3BOSA 4DIKA 4YVFA 1QCYA 4QICA 3K09A 1M83A 3STHA 3DBHB 1XMJA 1Z7GA 2F4VB 3BCUA 1VKNA 2Y4NA 2PZBA 2HZBA 5AMXA 5CBPB 3HNPA 4L0QA 1VOTA 3VGPA 1EXDA 3O26A 2WD7A 2BCJQ 4IKEA 5LXTA 4OUDA 4JXZA 2IYUA 2BLNA 3GGDA 3I9JA 2QMOA 3TNFA 1X8LA 3ZDCA 2X1LA 4CMJA 2B6HA 1KFBB 5EEGA 3CEAA 3D64A 5BQOA 3SC4A 3LXRA 3VR5H 1JXOA 3LLSA 2R8XA 3VM6A 4ER7A 2B25A 2CLLB 2I9KA 2ZE5A 3P52A 4NCIA 4L3OA 3KKKA 4MYHA 4MYDA 2JGAA 2QVBA 1IC6A 4BO9A 1DTWA 4RDHA 3JQ7B 3UYKA 1O94D 3DBLB 1Y7PA 5JPIA 3NMUF 4MIOA 2EFJA 3FETA 4LV5B 3WRWA 2G4VA 1X9IA 1YRAA 4D0NA 4CCYB 2ZTUA 2JIZD 4LECA 4OQPA 5DMXA 5F9FA 2AQKA 2QL9A 3KO8A 1NXSA 1BWPA 1WS6A 3GCDA 4CYMA 2G76A 4J3FA 4Q02A 1DAEA 1C7QA 2BMFA 1RJEA 4QYTA 3TRIA 1I2MA 1O97C 3JARA 1YBFA 2UZ1A 1NA5A 4FC6A 8OHMA 1OH8A 5J2UB 1PT5A 2BM0A 5DHQA 1C1XB 4D74A 5DIFA 3A4NA 2IXEA 3DZHA 1VKRA 2AL7A 2OR3A 2PR2A 4BX8A 1DRJA 1Q1BA 5T5QA 2BFEB 3KYJB 3WGJA 3AI3A 1SKYE 2ZJOA 1I6WA 4LCBA 1DXQA 2RKWA 2YWCA 4FGJA 3WLSA 4ZEMA 1MF7A 3GEMA 3JAWB 3H3FA 4QXOA 4LI0A 4J0HA 4LZOA 1I7NA 3L3BA 4MJ3A 2N46A 1UJ2A 4MYSA 4NBTA 5IAJA 1RZRD 3OZUA 1IWOA 1NWHA 4Q1BA 3H1BA 4ZI7F 1X7YB 5KX5A 1I2BA 3H5WA 3EFEA 2V1UA 1VHDA 2XB4A 2NO0A 3GJYA 2O8EA 4TKVA 4OM8A 4TKZA 2DFLA 4II7A 1QFYA 1VCOA 2Z2KA 2DHQA 2KW5A 3TL2A 3KTOA 4Y2RA 1ONOA 4OQFA 4UE2A 3BF7A 4KACA 1E9EA 1IATA 4OIFA 8GPBA 4TRNA 3G5AA 1K0UA 1XPOA 2HN9A 3MNFA 4J7XA 2GBLA 3IPYA 4AW9A 1VLLA 1Z2CA 2NVOA 1YB6A 2HF8A 1FRNA 2PNFA 3OQVA 4J3JA 4QE3A 5GVRA 3V00A 2XDQB 4UHBA 1O5OA 4QUHA 5K8UA 1GAEO 1M2JA 4MOWA 1JKIA 1LX6A 4PV7A 4ZKEA 3C24A 5IKPA 3CF0A 1O0BA 4LGCA 1I7QB 2XUKA 3OTGA 1OPRA 3WOVA 2PSHA 2YOFA 2OD2A 1X0VA 3BAFA 1ACMA 3CISA 2HSEA 3CINA 1CTQA 1YWGO 1JWAB 3F3KA 3F7MA 1V43A 4Y9SA 3PXGA 1TCUA 3QLUC 1DELA 1KEZA 4FS8A 3TZHA 3WLNA 2PKQO 3RFXA 3N7AA 1II9A 5KTKA 1Y8RB 1NX9A 3MRVA 3O21A 1G63A 3OKAA 2HIMA 1GSOA 4RD3A 2V5VA 3E23A 5CP8A 2ZSFA 2NQ2C 1KIMA 5ALSA 2ZUTA 2IKQA 4WK4B 2N75A 1PUXA 3V7UA 3DLIA 2NUAA 3MCWA 3EIFA 4AS2A 1WZNA 3MOGA 4FHDA 1G98A 1UM9A 1YL7A 2RGXA 2FE4A 3DYVA 1VL5A 4BNDA 2DP4E 2DUJA 1Z82A 1Z8NA 2OO5A 4CETA 3W9UA 1L1FA 4M36A 4ZZ2A 4QHTA 1RFGE 4UDXX 4LE1A 4BECA 5CFOA 3KP1A 1PKXA 4MUGA 1I51A 3Q1LA 4I19A 4Q1AA 2Q07A 3IIEA 4L73A 1YQDA 3THXA 3Q41A 4TXHA 5A71A 1QS0A 4YECA 3UM9A 4BB6A 3AR6A 4N48A 5AD1A 4GPTA 1KBZA 1X87A 1FRQA 1QGUA 4H3VA 3R7WA 3TYXA 2GCOA 2RHJA 2H8GA 4XJSA 3ZWPA 1GAQA 2O8BA 1NLZA 3QQPA 2XF2A 3KZNA 3V1UA 1E2NA 4XGRA 2FSHA 3PIDA 2OZPA 3E5HA 3RTCA 4CCWA 4CLXA 1NUSA 3TGPA 1Y9AA 2IPNA 3LQYA 4F46A 2FFJA 3AG5A 4RTMA 2CLCX 2O7RA 2H7XA 1TM1E 4RKQA 4Y9RA 5CVCA 4Q7QA 3D1VA 3ERCA 3IP3A 3AL0C 2FZ5A 3CZPA 2C4KA 2GILA 4TYWA 2YDYA 2R6DA 2AFHA 2XWPA 3MPOA 3NJ8A 2VAWA 1TMGE 3CF2A 1KZ6A 3O94A 1E4VA 4RWEA 1M34E 4RY9A 2OFFA 1YIAA 4O4HA 4BMPB 3UC9A 2HK9A 1CR0A 4LXTA 1OB2A 2J3KA 2VK4A 2FCRA 4P3PA 1E3MA 3C15C 5GJWC 1KYQA 2XV1A 1SRQA 1XRLA 3A28A 3DHYA 4XJTA 1QB7A 2OOKA 5CT6A 5E9AA 1N36B 1UPFA 1DKRA 1TXGA 2YYYA 3DO6A 3GHYA 5I4CA 2VS1A 4R3WA 4DLYA 2PA0A 3RF7A 5K0SA 4MUNA 2B1JA 4GOXA 2DJIA 1FBNA 4KXXA 1FJGB 3LKBA 2O57A 1IIRA 4HN2A 3VNSA 3W0LB 3F8WA 5HWSA 3L92A 2A5GA 4TSRA 3U9SA 4AMUA 4ZYUA 4ERXA 3GRAA 1EFCA 5JJLA 1SUWA 3IKLA 3TDNA 4LMRA 3A9TA 3T12A 4NAHA 3LT0A 4WNAA 3H9UA 4A1FA 3PYMA 4LJAA 3TW0A 5AKGA 2ZI4A 5LBIA 1FUEA 1X14A 3CLTD 3L1IA 2F3TA 3QXXA 3IUQA 4YO7A 2PUJA 2W0MA 3UGKA 2J3DA 4HATA 2D0PB 4H1TA 4IX1A 4XA8A 4UTNA 3TBFA 4PGAA 2VAVA 4OP1A 5ABPA 1OT5A 3M1YA 3LGAA 4ZI7B 4TROA 1A5AB 3ZIAA 1XU4A 1GFWA 2QENA 3EIOA 1F2TB 2PUAA 1IY9A 2RB4A 1JNXX 4C06A 5ITZA 1JI3A 4PSUA 1L2TA 1U2GA 1XD9A 1YQUA 3NWJA 4J1QA 1QQTA 4WFQA 4NG5A 5BSHA 1DGQA 1ULSA 3EGWA 3GD5A 3GLUA 4ZYZA 3CRMA 5FUVA 3AF0A 4FYPA 5DCLA 1REQA 2PUTA 3IE0A 4I14A 1ZCJA 4I1RA 4PFQA 5JO9A 2WWWA 2R3SA 4NECA 1RI2A 1DJOA 1DU4A 2C3YA 1YS1X 4YBRA 4W8OA 5J63A 1XTIA 3PA8A 1NAHA 3G79A 3RAGA 3V4RA 2MOKA 2A1TS 5KTOA 4M4SA 5F73A 4M0MA 3BMCA 5KJFA 1OYYA 1SCQA 4P7BA 1G7RA 4J0CA 1VYVA 1UKZA 3KQWA 4G6ZA 1EM6A 2WT8A 4FMCB 2C2KA 2NVWA 1DKOA 2WSYB 3D4NA 2C2XA 1KYTA 3AEUB 1JXAA 1UQRA 3IR6A 1P7PA 4D9MA 1L5HB 2HM7A 1K5PA 3DMRA 3S2IA 3H9GA 4WXRA 4D2IA 1PU2A 2G7ZA 1WTCA 2WE8A 5TS2A 3WIEA 1U9IC 2O6LA 4CWAA 1IZYA 4FOPA 3AM4A 3ZUPA 1DZ3A 1DWOA 3VTAA 3UBTA 4PAGA 4D46A 4F11A 1FJXA 4B3RB 1VXRA 1O5IA 3ZVRA 2A7QA 3C3WA 6ADHA 1PK7A 1V5IA 4IOLA 2BBSA 4UOZA 5DW3A 2A88A 3QLVC 2G67A 3ZGVA 1OI7A 2Q1UA 5JI3E 4DZRA 3WHIA 3BKXA 1X7WB 2Q49A 2B8NA 2YASA 5F35A 4ME6A 2C96A 1M2OA 2VNSA 1LTQA 4JY7A 1XT6A 1K8YB 4KYVA 2NVBA 1QF7A 4UEOA 4EG0A 3Q7PA 1ESNA 3AM5A 2H3EA 4RD0A 1PGQA 2N1MA 4L5JA 4OQZA 4PIVA 3UEOA 4IL5A 4MCIA 5DI9A 4UVIA 5F2KA 1E58A 121PA 2HLDD 3NIGB 1YOVA 2BGTA 3EGIA 3RUIA 5JMTA 2G70A 2H0RA 3NBMA 4HUTA 5K20A 2ZUEA 1V5GA 5F7XA 1ZM7A 4CE6A 3FYCA 5ALJA 1R0XA 1AGRA 3BTOA 5EIHA 4DLUA 4P4SA 4XE5A 1YR2A 2EP8A 3U13A 1JH8A 2QE7D 4AN0A 5A4DA 2XUJA 1I5RA 4HJXA 2D0IA 2XCSB 3TL6A 2JLVA 2W11A 3ANTA 3DV0A 4BWGA 4ZT6A 2JA2A 4OOEA 4EJ6A 1T91A 3HB1A 2VQEB 3A25A 4MWOA 1YRWA 3GQBA 2O0LA 3O8DA 3D2BA 4ITRC 4MA5A 5DGIA 1Y5IA 3Q0TA 4XPIB 4KUGA 2OAP1 3S8MA 1ZVJA 2ZTLA 3H4IA 1GNQA 3ZW9A 4RKEA 1EP3B 4CKEB 5KU1A 1F51E 3DOCA 4FBLA 3ET5A 4YWHA 5EWMA 3DA8A 2X5JO 4KN9S 4MGZR 4P81A 1PUIA 2J41A 2ZOSA 1R1DA 4IWXA 3LP6A 1Z2PX 2E4UA 4Z2AA 2SBTA 4EB3A 3PKIA 1PFUA 3VH3A 4ZYWA 5JWOA 4TS1A 3SFZA 4Q15A 3W4KA 3M1IA 2HIHA 4LN1A 721PA 1BROA 3G0BA 3U0VA 2YXNA 4PYJA 4RS4A 2DPXA 2YVKA 3Q9UA 4ESHA 1UXGA 5AK6A 5IM4A 1WABA 4FGKA 4JJFA 1N1GA 2PWAA 4B3BA 3WI7A 4TS3A 4MX8A 5SZHB 4M1SA 2X9QA 1DC5A 3BZUA 3MZ0A