5H3HA

Esterase (eaest) from exiguobacterium antarcticum
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
268
structure length
268
Chain Sequence
MGTFIQAVDGTKIYVEDIGSGQPVVMLHGWPANNNMFEYQKNRLLEEGYRYIGVDYRGYGKSDAPATGYDYTTMASDINEVIQQLKLTNVTLLGFSMGGGIALKYLLNHGESNVSKLILAGAAAPVFTQRDGYPYGMTKDEVDALIEDTKQDRPSMLKGFGEIFFAKEHPEPLQQWFHNLSVDASSHGTIQSAIALRDEDLRDGLPKITVDTLIMHGKKDQVCPFEFAEVMHENIAGSRLEVFEESGHGMFLDEREKFTETLVSYVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Esterase (EaEST) from Exiguobacterium antarcticum
rcsb
source organism Exiguobacterium antarcticum (strain b7)
molecule tags Hydrolase
molecule keywords Abhydrolase domain-containing protein
total genus 102
structure length 268
sequence length 268
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5h3hA00
4WY8A 2HA0A 3JWEA 2OXEA 4QDUA 1E66A 4B6GA 3WZMA 1XKLA 2OQIA 2XQKA 2AJCA 4G4GA 3VDXA 4I4CA 3TGLA 3I2KA 1NU8A 2QR5A 2H7CA 2B9VA 3MUOA 4XX1A 4FMPA 3H2JA 4PF1A 1WHTA 2CBGA 4UHBA 1YB6A 3WK8A 2JGFA 1S8OA 4UBLA 1W1IA 2HDWA 1XZKA 1WHSA 3VJKA 2WFMA 2Z5GA 4CCYB 5CT9A 3C43A 5DWDA 1TKRA 3NUZA 4B7ZA 2PSFA 1CQZA 5ALIA 3GBSA 1OCEA 4G1FA 4HXGA 4AN0A 2Y1KA 3D4LA 2ECFA 5K3AA 1MX9A 1VZ3A 4RGYA 4UFPA 1VA5A 1BN7A 1AKNA 2WUFA 2XMDA 2V9ZA 5D7BA 3SK0A 1OILA 2H7YA 1EHYA 1H2WA 3FCYA 2QZPA 3I28A 2I78A 1DWOA 4N5HX 3C8DA 1UK8A 2PU7A 5F4ZA 4KYVA 2GYUA 1QIMA 5DTIA 4H7IA 3HSSA 3PUIA 1XROA 4Y2YA 4K2AA 4C4YA 3WWEA 3F98A 5K3FA 5LZ8A 4AO7A 5C7YA 3DNMA 4B82A 5AKYA 1CUEA 2WKWA 3FVTA 3HABA 2HRQA 3AINA 1UZAA 3G9UA 2VT6A 4X6UA 4HRYA 2QXUA 4UHCA 3GROA 1HLGA 4QZVA 4AQDA 4GI1A 1YSCA 1C7IA 1CUUA 4G4IA 4P9NA 4K6HA 1VXRA 1EH5A 4U2FA 4EHBA 1CUYA 2OG1A 2WSLA 5A7GA 1EVQA 5AKHA 4BCCA 5FRDA 5EGNA 5IVIA 3CCCA 4H35A 3KXPA 1QFMA 3AIMA 1P0QA 5ESRA 1ODSA 5JIBA 4FLFA 5ALHA 3N0TA 4N5IX 4RNCA 7YASA 2FX5A 1MX5A 3D59A 5ALNA 4INZA 1YAJA 4ZGBA 2J3QA 4BRZA 4Q3KA 3TEJA 4BP8A 1A7UA 1R4ZA 2PUJA 1BEEA 1H2XA 3IA2A 1ZD4A 4JUIA 1F0NA 5CTAA 3C6ZA 4UHDA 3V1MA 1XRMA 1MAHA 3M82A 1LZKA 5IVKA 4M0FA 4A23A 2BGRA 5LZ2A 3OPMA 5CT8A 1E8NA 1CQWA 2XUAA 2ACEA 4H7KA 5EIHA 3OURA 5ALWA 2Z8XA 2HRRA 5HFNA 4F60A 1H2YA 5AK3A 3AIOA 1DQZA 2QMQA 4FFWA 2XQFA 4XIIA 3AFIA 5JARA 2XLCA 4J0IA 2PPLA 3HXKA 3VJLA 1GKKA 5AIAA 3IUNA 2Z3WA 1TRHA 2V96A 3FLEA 4V2IA 3AJAA 1WM1A 2VSQA 1AZWA 4M0EA 2XUOA 4J0KA 4QEKA 2J4FA 1ORVA 3V48A 5JALA 1UOOA 5AI4A 3I1IA 4K5QA 1EDBA 4MYSA 2O2HA 2ZYIA 1XLWA 3H2GA 4B84A 2WUEA 4H77A 4Y2UA 1QO7A 4CCYA 1ZOIA 4UBKA 1EDDA 2XUJA 1J06A 1YAHA 2RHWA 1YS1X 4F0JA 4G9GA 2WFZA 3VKFA 1AX9A 4B80A 4DLNA 3D0KA 1CUDA 5ALJA 1JU4A 3RM3A 1ETHA 1UXOA 3HLKA 3FYUA 5ALRA 2NW6A 1QOZA 4QE3A 5CRIA 4BAUA 1X70A 2QKYA 3FVRA 3IVMA 4W1SA 3V9AA 1SC9A 5J3JA 1MX1A 1ZJ4A 4ZWNA 3W2TA 4Q3OA 3BDIA 2AJ8A 2QJWA 1J07A 2VATA 2WLSA 1P0IA 1BRTA 2O2IA 1C4XA 3WWOA 1USWA 2ZSHA 4KE7A 2DHEA 5JD5A 1THGA 3WL5A 4FBLA 3LS2A 2HA5A 4QLAA 1EK1A 4Y2TA 2ZVDA 3A6ZA 3H04A 4ROTA 4B0PA 4LKOA 3AZPA 1GGVA 1YA4A 1L7RA 1VA4A 2RGUA 3WWPA 1CUBA 3ANTA 1WOMA 3FLAA 1N5MA 3RLIA 1HDEA 5ALUA 3C6YA 5HZGA 5EFZA 3STUA 4C89A 3QZUA 4Q3LA 2GZSA 2QXTA 2WHQA 4Y2PA 3O4JA 2XMRA 3IDAA 3WYDA 5HCUA 5LZ5A 1P0PA 4W63A 5JYCA 5K5EA 3UUFA 1ZJ5A 5A7HA 4QA9A 3KD2A 4GXNA 1IUNA 1EINA 4N8EA 5AKEA 5LLSA 1QTRA 4J0GA 3W9UA 3QPAA 4C6HA 2JIDA 4WDRA 1XQYA 1R50A 4LXIA 1MNQA 1X2BA 3DJYA 2K2QB 4IH4A 4BZWA 3D2CA 3WK9A 3CXUA 2EDCA 3LP5A 3ZPXA 5ALPA 3WKBA 3I6YA 2LIPA 2WQZA 4B85A 5LKRA 1BE0A 1EDEA 2X5XA 3WQHA 5EIEA 4H7HA 4BVKA 3FBWA 3BE8A 1T4MA 4DM7A 2BUAA 1Q0RA 1DWQA 3T52A 2OAEA 1CUFA 1DT5A 1X2EA 3AUKA 5D6OA 1QO9A 2FJPA 3R3VA 2C5GA 2FJ0A 1DWPA 2VTVA 4DTCA 3ESAA 1HPLA 3PF8A 4NVRA 1XRRA 2AXEA 5T4BA 4Y2JA 1E3QA 3DL7A 3ZWQA 1AC5A 3O4IA 4DNFA 3WZLA 1K4YA 1N8SA 1U8EA 3EF3A 4E15A 1MJ5A 3F97A 3V1NA 1J2EA 4X93A 3AZQA 1XQWA 1L7AA 1PV1A 4YK7A 3G0BA 3DYVA 2C0QA 4UHFA 1W75A 2QS9A 3QVMA 5ALLA 2ZJ7A 4PSCA 4Y7DA 2PU5A 5ALGA 3HZOA 3R3WA 5CT6A 3AZOA 1H2ZA 1CUZA 3QMWA 2PM8A 4B81A 2RHTA 5CXUA 4BC0A 3QMMA 1C7JA 2XMSA 4FHZA 1Q83A 5CT5A 3FSGD 1EX9A 2GBFA 2XQJA 1QIGA 2B20A 4HTAA 4KAFA 1OXMA 1H23A 3O4GA 4NZZA 1Y37A 1WB6A 2WTMA 4M0MA 5EHXA 1CFJA 1TAHA 2GZRA 4KAJA 5HK9A 1RP1A 2BFNA 2V97A 3L1JA 1M33A 1CVLA 1QZ3A 5A6VA 1BROA 5FV4A 2O7VA 3WL8A 2QTBA 2DHCA 1GQRA 2YASA 4DMHA 2WIDA 1LBTA 3EQ7A 3V1LA 2WIKA 4U2CA 4X00A 1GQSA 3FYUC 4YPVA 5EHQA 2OLEA 3EIOA 2DCMA 2XUDA 2YYSA 1LPSA 2BKLA 1FSSA 4FBMA 3ZLTA 3N2ZB 1W52X 1XRQA 4G8CA 2DQZA 1GXSA 5LP1A 1YB7A 3R3UA 4X90A 5HF5A 1QIKA 1O6FA 5FKJA 4GDMA 5AKLA 1XZCA 4E14A 5JAPA 2WUDA 4X94A 3PUHA 3I6MA 4X6YA 3H2HA 2D5LA 1B6GA 1FFEA 3D7RA 2WIJA 5CURA 2VAXA 5K3FB 2CB9A 5SYMA 2XUGA 4UBMA 3OG9A 4B9AA 5AIBA 3B5EA 3QITA 4QDTA 1ZD3A 1EXWA 4WFJA 2XQGA 5T4FA 1SCKA 3BDVA 2Y6UA 4CIBA 3ANSA 1ZD2P 1BCSA 2WJ3A 5HK8A 5E4JA 5LZ7A 2O2GA 5CW2A 5HKBA 2OGZA 4EBBA 3DS8A 2IITA 3BL8A 3R41A 4UHEA 4BATA 3WYNA 4U2BA 3DOIA 5YASA 1QONA 1MN6A 3G8YA 4KE8A 4BP9A 1G4HA 3E4DA 3DOHA 5AM5A 2WG2A 2I3DA 4KEAA 5ALVA 1EVEA 3VVLA 3HACA 1ODTC 1IUPA 4W1QA 4P08A 3DKRA 5EI5A 4EUSA 3EQ8A 4WY5A 2CUTA 3H1BA 4CCWA 5K3BA 4KRXA 4FNMA 5KREA 5AM2A 3S2ZA 2WJ6A 5DYWA 3GELA 3KWFA 4G4JA 1KU0A 5AP9A 4AB1A 5LZ9A 1O6GA 3HJUA 1AGYA 3ZV7A 1UKCA 3GA7A 1LZLA 3H2KA 3SX4A 1F8UA 4ARBA 2XMBA 3R40A 2QT9A 4OSEA 2WFLB 2PSHA 2QOEA 4J0CA 2I3ZA 3E1GA 3FWHA 4DMFA 4HXEB 4FLMA 3B3QA 5IH7A 2Y2VA 1VE6A 2EDAA 5AM1A 3A2NA 5AJHA 5AM0A 4X3CA 3E0XA 5KWJA 1YS2X 4ZI5A 4AO8A 4H7EA 1HKHA 3G9TA 2Z3ZA 3BIXA 3G9XA 5AKZA 4DNQA 5A71A 3JYHA 3CN7A 3CCBA 1UKBA 1DX6A 1JJFA 2FUKA 2XMCA 4PSUA 2WIFA 3WL6A 5DYTA 1A8QA 3C87A 4RE6A 3IUQA 3IIIA 4H7FA 4IHAA 5AKXA 1E8DA 5JADA 2W22A 2QM0A 2OCGA 3WA6A 3F67A 3H2IA 4TGLA 2WU3A 5CH3A 4BDTA 5ALZA 3PE6A 2B4KA 1E5TA 3Q0TA 1LPOA 3I2FA 4L0CA 1CIJA 3D2AA 1Q84A 5I9IA 4ZV7A 3IUMA 1N1MA 1IUOA 5JZSA 4PSDA 3PFBA 4UBIA 1VLQA 2AJDA 1R88A 4WFKA 4JEIA 1D07A 1XZFA 2G5PA 5AM3A 4LYDA 1LGYA 1G5FA 5HQ3B 3K2IA 2IX9A 2AJBA 3DKKA 5JAOA 2QUBA 1MAAA 3WK4A 3H17A 1EK2A 4BBZA 1BCRA 4QDXA 2OCIA 2WHPA 3G0DA 3STXA 1DX4A 1XZBA 4EY6A 4BYMA 4OU5A 3VXKA 5JASA 4C87A 2WHPB 3T4UA 3K6KA 2QJRA 2C7BA 5AICA 3W05A 3GUUA 2XMQA 5JATA 3E3AA 4J3JA 1LBSA 2XUFA 3WKEA 4FKBA 1IZ8A 4EY4A 1UOPA 4BTVA 3BJMA 1AQLA 4H0CA 5FPQA 4AMZA 3K9BA 1CUAA 4BB0A 2G63A 1CUGA 3WK5A 1TK3A 3R3ZA 1YA8A 1CUIA 3HYSA 2JGJA 1JT2A 4EZIA 2OGTA 4D9JA 2G5TA 2C58A 3C6BA 3GFFA 3PF9A 4NMWA 2DFPA 5BWCA 3O9MA 4L3WA 4CG1A 5C81A 1P0MA 5ALOA 3KWJA 4BVLA 5AOAA 3QPCA 4KAAA 5AKGA 5AK6A 4GECA 5AM4A 1IMJA 5ALXA 3PFCA 1BN6A 2PKYX 2BUCA 5BV7A 1JU3A 4KE9A 5AKIA 2GBGA 4JH0A 1GPNA 4X91A 1QTIA 2W6CX 3C8HA 3VJMA 1AMNA 3OOSA 2VAVA 4AN1A 2VJDA 1WPRA 4QDZA 4LHEA 4XWGA 1Z68A 4FLEA 5FXMA 3FSGA 1JFRA 3R0VA 3WKAA 1MNAA 2WIGA 3WIBA 5HQ3A 3D5EA 1ZD5A 1YR2A 3DCNA 3G0IA 3DYIA 6YASA 1RWQA 2RONA 1K6EA 4LYEA 4BCDA 2XUQA 4HS9A 4GWLA 3LIIA 2VA9A 4BCBA 4DNPA 2HA3A 1UT6A 2PSJA 3U0VA 4LIPD 4FNGA 1ORWA 1CUWA 1TCBA 2JGIA 4G8BA 4YASA 2XQIA 5JZ9A 3TRDA 5ALYA 5LKAA 3W9BA 5ISMA 4U2GA 4X71A 4ZREA 3DEAA 4DMKA 2HA7A 4KACA 3PDCA 2RIPA 1ODCA 5E4TA 5IVHA 5CBKA 1CRLA 3F96A 1LLFA 3WKDA 2CEKA 5EIAA 4HAIA 1ZI9A 4PV7A 4J7AA 2VEOA 1N5RA 1MTZA 3WK6A 5DNUA 2WM2A 4EB0A 4EY7A 3I6ZA 2J3DA 3A2LA 4OCZA 4P93A 1ZI6A 4QLOA 2HU5A 4UFNA 5AI8A 2QUAA 3FLBA 4G8DA 5AKKA 1TQHA 3D3NA 3BXPA 4FWBA 2HADA 1AUOA 1LNSA 4MQLA 1QGED 4XJVA 1XZAA 4UBNA 4OB8A 1H22A 4X92A 3C6XA 3WIOA 5LZ4A 2GBIA 1UOQA 3H0CA 1JMKC 2B61A 4H18A 1XZJA 4O08A 4OYYA 2JEZA 4NS4A 5AI6A 1BU8A 1XRLA 1FJ2A 1SOMA 4BAZA 3ZLUA 2JGMA 4ARAA 1GZ7A 3G02A 4QWMA 1NX9A 2XLBA 4IH1A 3IBTA 2VT7A 3WJ2A 4C01A 4C88A 3GZJA 5D3KA 1W6RA 3WMRA 3VVMA 4Y2SA 1XRNA 4U2EA 1KU6A 5CH5A 1LPNA 5AI5A 4MXDA 2JGKA 3ESCA 2RI6A 2H7XA 2Q0XA 4DYHA 2XI4A 2X8BA 3QMVA 3H1AA 2XE4A 4C4ZA 5ALQA 4H7JA 2XMZA 1BEZA 5ALDA 5I7UA 4MEBA 1NU6A 5T4EA 2ROQA 2BCEA 2OGSA 3PI6A 5FPPA 1JJIA 2ZYHA 5KBYA 3DD5A 5ALKA 4BTLA 1QIEA 3M81A 4CI9A 4BE4A 1U2EA 1JMYA 4WJLA 1XQXA 3Q8WA 1EB8A 3OM8A 3AIKA 2CMFA 3I2HA 4CFSA 2HA4A 3L1HA 4MEAA 4BVJA 5DLPA 3BF8A 4YX9A 5LIPA 1WCYA 2WILA 1G42A 5IKXA 5H3HA 4ZXFA 3FYTA 4Q34A 1JJBA 3HC7A 4A5SA 2VJBA 2PX6A 1A8SA 3MUNA 3U1TA 4Z49A 2WFLA 1LPPA 1DINA 5DNVA 1EA5A 4F5ZA 1Y7HA 5E4YA 2OQVA 1WB5A 1CUVA 5FP0A 3C5WP 3MGAA 3VISA 4UUQA 3KDAA 3F8SA 2XT0A 4EY5A 2VJAA 5HF6A 2QVBA 4GW3A 1IVYA 3STWA 4QWWA 5D3ZA 4ETWA 4XVCA 1T2NA 2GYWA 1E8MA 5C8XA 3QH4A 1K63A 1XLUA 1A88A 2BJHA 3NWOA 2HL6A 1TCCA 2JGLA 2XDWA 2YH2A 4Q05A 2VF2A 4GBGA 3WLAA 1CR6A 4DMCA 1KEZA 3WL7A 2WHRA 1R9MA 5A7FA 4X7BA 3QM1A 1SFRA 4KJXA 4QDOA 3ICWA 5JD4A 4HVTA 5K3DA 3DLTA 3I1YA 1JI3A 1VE7A 3RK4A 3ESBA 4PO3X 2D0DA 2PSEA 5EHZA 1UK9A 4DSZA 2BAGA 5AK4A 4WFIA 3C5VA 4AZ0A 4JYPA 4CIAA 1HL7A 2R11A 3DL4A 1ZI8A 1ACJA 2BGNA 2H9YA 5CT4A 3C70A 5I8PA 4J03A 2WU4A 4E46A 4OU4A 5A2GA 3C45A 5E2IA 5HF8A 4J0JA 4K6KA 1R3DA 2IIVA 2J4CA 2ORYA 1GT6A 4MWSA 1DQYA 5HF9A 1VXOA 4DIUA 5DYYA 1XFDA 4IO0A 4OYLA 4MQMA 5ALSA 2ZJ6A 5AOBA 4AO6A 3QPDA 3W04A 1UK6A 1PJAA 4CG3A 3MVEA 4WCVA 3R3XA 3BF7A 1A8UA 2V98A 5CXXA 4GLBA 3W06A 4X6XA 4MJ3A 4BRSA 1VKHA 3B12A 4BZZA 3X3HA 1W4LA 1AURA 5DJ5A 4UHHA 5FUMA 1XZDA 1EI9A 5AO9A 4OPMA 4AXBA 3IULA 1U4NA 1TCAA 2ZYSA 3IB3A 4HXFB 4J0HA 1GPKA 1CUSA 1XQVA 3SWWA 5AHXA 5BWBA 5HKAA 2PL5A 5KWIA 2ONCA 4RE5A 3QBJA 1K5PA 5ALTA 3FAKA 4W1PA 4PW0A 2OCKA 3LLCA 4W9RA 2DHDA 4BC1A 3HRHA 2HHAA 4L72A 4RPCA 3O4HA 1UK7A 1UFOA 3M3DA 4S0XA 5JZBA 3UMJA 4OD0A 5EHNA 1Q0ZA 4LXGA 1ZGBA 2H1IA 3R3YA 3I2IA 5K3EA 1YASA 2XUKA 1FFBA 2P8SA 4PNZA 2HFKA 4U2DA 1PFQA 5JD6A 4GEGA 2OAGA 3ZLVA 1ZGCA 4OB7A 4Y9SA 4B9EA 1YCDA 4KE6A 2QRUA 1U65A 5AOCA 2OCLA 1G66A 1IZ7A 3LIPA 2ACKA 1K8QA 5FDFA 4B83A 1LPBB 4DNOA 4E11A 3ICVA 3WWDA 2JGEA 3BWXA 4F21A 5ALEA 4Y2QA 3V1KA 4Q1VA 4JYMA 2PSDA 4L9AA 1EB9A 2R8BA 5K3CA 3S8YA 2HFJA 2VJCA 2RAUA 3H19A 4N8SA 5DNWA 3O9VA 2C0PA 1J1IA 4UPDA 4QNNA 2UZ0A 3ZI7A 3KSRA 5ALMA 5SYNA 4FTWA 1QIDA 3RARA 4G9EA 1QJ4A 3M83A 4EA6A 3EQ9A 3G0GA 1L7QA 3OC0A 2ZSIA 5FLKA 5LYYA 4PQEA 2Y2UA 4AMYA 3F9CA 4OB6A 2XUPA 1VJ5A 4X85A 1XZLA 3NGMA 1THTA 3G9ZA 2X76A 3DQZA 2JEYA 1XZMA 1LPAB 3D2BA 5DTJA 1XZGA 3AILA 3STVA 4J0DA 2PVSA 1ZIYA 1MT3A 1XZIA 2HA6A 3IURA 1VOTA 2C5FA 4Y2RA 3P2MA 3STYA 5AH0A 5ALFA 1RYYA 4BAGA 4HRXA 2E3JA 3QYJA 2I03A 1FFDA 2XUIA 1QE3A 4UBOA 5BOVA 1FFCA 4DSAA 5JANA 4BE9A 4I19A 4P92A 1QIFA 1B41A 3WA7A 1XZHA 3NOXA 2ES4A 5C8ZA 1CUCA 1R9NA 5C8VA 3WKCA 4TPKA 1CEXA 2GBCA 2Y6VA 3KOOA 3HI4A 4B0OA 1W76A 3SC2A 2JBWA 1QIJA 1VZ2A 2GYVA 1HBJA 1SCQA 1SCIA 2PUHA 1XKTA 4W1RA 2AJLI 1LPMA 1R1DA 2HA2A 5CMLA 2JF0A 3FCXA 2C4HA 1QIHA 4N8DA 1MU0A 3JW8A 3A2MA 2HU7A 1GPLA 4AZ3A 3YASA 1CUJA 1E89A 3IUJA 3G7NA 3G0CA 1MO2A 2HM7A 1DTEA 2EEPA 1XZEA 4FOLA 3ILSA 4AX4A 5AI9A 2BUBA 1ISPA 2DQYA 1XLVA 2WTNA 1UKAA 1DT3A 3FOBA 3CN9A 3A70A 1F0PA 4X95A 4WDQA 1CV2A 3WI7A 2Z8ZA 2VQ6A 2WUGA 1QIIA 2CJPA 4EY8A 1QLWA 5FOQA 4JNCA 4MYDA 4ZV9A 1JKMA 2HIHA 3DDUA 2WG0A 1ZIXA 3HEAA 4IH9A 4I3FA 3EBLA 2PBLA 2O7RA 5JAHA 3RKSA 3FYUB 2ZYRA 1CUXA 4FDMA 3H18A 3LCRA 4X97A 4IQ4A 3ESDA 3PICA 1WPXA 3WJ1A 3I2GA 2CZQA 1FFAA 5IVDA 3FNBA 5CH8A 2WG1A 5A62A 4ITVA 1CUHA 4H7DA 3BJRA 4DGQA 1XRPA 4TVKA 1MPXA 1CLEA 3OTQA 4UFOA 1ZICA 2XB6A 5AKJA 2ZJFA 4CG2A 4BDSA 4KR0A 1WB4A 5JAUA 1TIBA 5AK5A 4LXHA 2XMGA 3I2JA 1DU4A 2CKMA 5HFAA 2XUHA 2YXPX 2DR0A 3TJMA 4K6GA 1BS9A 3BIWA 3STTA 4ZRDA 5AI0A 4Y2VA 1UWCA 3WWCA 1Y7IA 4KRYA 1I6WA 3L1IA 1CPYA 3O95A 4G5XA 1F6WA 4OUKX 4UBJA 3WK7A 4FFVA 3O0DA 4Y2XA 2DSNA 1QFSA 4A16A 2G4LA 1HQDA 2OPHA 3UUEA 2WJ4A 4Q82A 4C4XA 3ED1A 1GKLA 2HU8A 1ACLA 4HZGA 4GHWA 5T4HA 4MWTA
chains in the Genus database with same CATH superfamily
1IVNA 1N2IA 1XMVA 2WA1A 3M5DA 2XXAB 3JASA 3K6RA 2AQKA 1THMA 3SJAA 4HAXA 5FJIA 4F8YA 4FFPA 2EJVA 2CFRA 4QYIA 5IC4A 3LOPA 2OZLA 4EUHA 5KDOA 1BTOA 1E66A 1P4JA 1Q0PA 1UQUA 3PI7A 4LRQA 4ZODA 1N2CA 5F98A 4Z9BA 4GF5A 3TBFA 2XB2A 2WTEA 4G4GA 3UPUA 1JZQA 4B6PA 4RKYA 4PG6A 2A2ZA 4LDZA 2UUBB 2FPKA 3X0DA 1NBMD 4UULA 4B3MB 4IWXA 1GAXA 2A92A 4MIYA 3H86A 4YRPA 2PJZA 2IVZA 4KYUA 1R74A 1IY8A 5HUHA 3AFOA 5A4JA 3TRIA 1QYDA 5DP1A 3B1FA 2EJUA 3CNOA 1OTHA 1Z8HA 3P94A 1PJRA 3PRJA 1C1DB 4QUGA 4X61A 2OY0A 3G8AA 4XYEA 3TQIA 1V8BA 3CJRA 3OOYA 1U7WA 2CZCA 2HK6A 4MZXA 1KR5A 5E3IA 3RI3A 3ZGYA 1QMPA 4DA9A 5LMCA 4TMZA 3CLSD 4I3GA 4D8VA 3RSCA 1EFCA 4BNFA 1RIIA 4ZI3A 4Q9DA 4P58A 1DDOA 4UBLA 3LBIA 4KYIB 1VMEA 1JL3A 4CODB 1DV2A 4YROA 2CVOA 1NF8A 2F2TA 3H13A 1XZKA 3A9RA 1H65A 3L7LA 1T25A 1XK7A 2C4WA 3C3MA 1MAWA 4GKBA 3I61A 5CT9A 3BMQA 2G9RA 4D26A 2IXAA 3C3XA 3C43A 4TMFA 2VN8A 5H16A 2YQ5A 1BQ3A 3S5JA 4A92A 2O7NA 1R6UA 4PBRA 4IAOA 1YACA 3V46A 4V3BA 3KAQA 5AOVA 4PZ0A 2V3WA 4G1FA 5B1YA 3NHRA 4BO1A 1K4MA 4FDTA 4AG3A 5TIIA 4K2HA 2ZR9A 1F12A 2HK7A 5ELLA 1P81A 1A5TA 4MQEA 4DSOA 3K9FC 1E64A 1JFFB 4DA8A 4WOJA 1B8UA 3ITDA 1M9NA 4G0NA 4O8ZA 4P4TA 3CZ9A 3VV3A 3W8NA 1GEGA 2FW8A 4AX8A 3BXEA 2YZ7A 3MWEB 2CV0A 1PYGA 2BLLA 1ZLXA 5CR9A 5FAKA 1ZL0A 4JJIA 2XMDA 3SK0A 2PJRA 2XVZA 4NECA 1R27A 1HLPA 4CN8A 1LDGA 3A3OA 3D4BA 3NKFA 3QEMB 3PB3A 3L41A 4YMLA 2BKEA 1ZLYA 3K94A 1SKQA 2FRDC 4CM1A 1J97A 3GFBA 1L7BA 2XNJA 3LHDA 4GDFA 1GTRA 5THKA 1SCUA 3F46A 4Z6KA 1DWOA 2GGSA 4U8HA 1H3NA 4EGFA 2GZDA 4OA5A 2JCVA 4TTTS 3VGPA 3WGIA 4DANA 3C8DA 3ABQB 1XEAA 1UK8A 3OLWA 4ZQCB 1H0SA 2PBZA 3N53A 1IRXA 3B3GA 5J4LA 1Z2EA 4KH0A 1YBFA 3LX6A 4ZCPA 5HMMA 4CKXA 1BQEA 4DNXA 1I4OA 4XDGA 3PTAA 3B6EA 2J45A 1KMQA 121PA 1UMCB 2P91A 2FSFA 4H7IA 4G86A 3DEFA 4HDMB 4MVXA 3CPJB 1JJVA 1JU9A 1QCYA 4UREA 3VDRA 3PUIA 1MH9A 4BX3A 2DFKB 2H06A 2XVXA 2I8CA 4B3CA 2R6R1 1GGMA 4EHIA 2A0KA 3ZQUA 3NWPA 4CJXA 3P19A 1M2OA 5GZ1A 4TN5A 3CLUD 2VJMA 2J3MA 2XHEA 3D6UA 1YOBA 3A6PC 1C41A 5LZ8A 4IVNA 4AO7A 4CQJA 1AQJA 1FVXA 2HDOA 5EG5A 5ESDA 5MGNA 1TUBB 1NVTA 2WKWA 1RS0A 1TIPA 3HABA 3R5TA 5IBPA 3G9UA 2WZCA 1KQNA 1XNRB 5LBUA 4ER0A 4BLVA 3JX9A 2JAQA 4HRYA 4O4JA 1ZJJA 4JP2A 3UXHA 5AVZA 2QXUA 4J6EA 4UHCA 2ZZMA 2R4TA 2G25A 4RH0A 4NF2A 1UIMA 2SCUB 1XWIA 3KQSA 4AQDA 3RAFC 1V5WA 1YZKA 4KPFC 4DV5B 1C7IA 1CUUA 4R16A 4DLUA 1EM8A 1EH5A 1VXRA 1D9XA 3HR8A 5BORA 1QRSA 1TPYA 2J0UA 4BLUA 4IMJB 3Q7IA 4PRKA 5FBRB 1X7HA 4F2HA 4L8FA 4HUQB 4M36A 2NTJA 3ZE8A 2OG1A 4WESB 4OHRA 2ZTMA 5H8WA 3H3XA 2CXNA 4K26A 2YHAA 1P1JA 4FYJA 4FDLA 2F9FA 5EQDA 4AYWA 3K0SA 1EBBA 2AMFA 1V6CA 1ZX1A 2B6HA 1UXGA 3CCCA 4E4TA 1Q21A 3A0UA 4DAOA 3OZGA 3MQ2A 4DS3A 3SIXA 2F7SA 2OHIA 1QFMA 4HCJA 3AIMA 4BNWA 1B6SA 3JAKA 5ESRA 2C96A 2ZM5A 2WF6A 2R1TA 3BB3A 1FBNA 5M3BA 2A5LA 3ICEA 1C50A 1I3CA 1G7TA 3HR4A 1ML4A 4BV2A 4FLFA 2I91A 4N5IX 4OL0A 3TTTA 2G28A 3TOSA 1AGNA 3L6DA 2B8NA 1CTQA 4TSRA 1DSSG 3D59A 3F5QA 5ALNA 3ASUA 1J9ZA 4LTDA 4EGQA 4G25A 3LG2A 1A2KC 4ZGBA 2QTNA 2C7PA 1FP2A 1CY0A 1S2IA 3CY6A 4BJ3A 5HRCA 3HZRA 2P62A 4HPWA 4PHCA 5E0KB 4UNIA 5DYGA 5K9ZA 3LT2A 4RJ2A 1DC5A 1H5QA 1M72A 3E2PA 3RROA 3RSHA 1I9GA 1A7UA 5KTPA 5F5NA 3ELDA 1UT8A 1QAOA 4QARA 1EUZA 1DIGA 1G0OA 4Y2GA 2XGSA 4Q66C 3IEUA 3MILA 1NLUA 1R4ZA 4C7VA 1Y80A 3WJAA 5KYXB 4ZO8A 3AV3A 1H2XA 3CT4A 3GEPA 1PGPA 3IBSA 1GNLA 3GCGA 3HO8A 1OWOA 3QVVA 4KFRA 1XRMA 1Q1ZA 3PIIA 2O0KA 4M88A 1LZKA 2CC2A 4IZ6A 4I1PA 2JRCA 4A23A 2P5UA 3ZQ6A 2FWBA 3GJQA 5LZ2A 3OPMA 4OHKA 3R8CA 2A5YB 1I1OA 1ZNQO 2V7XA 3E7WA 3PCXA 3VU8A 1MDFA 1XPJA 4GYWA 2I80A 2IX3A 4JWTA 4BU1A 3VKUA 4C2AA 4EHHA 1KF0A 2Q1XA 1KI3A 3C74A 5PNTA 3FOFC 4H27A 4MW5A 4BQEA 1VJDA 1JRLA 3HCBA 2HLHA 4EI2A 2IBMA 1OC2A 2MDTA 3R5JA 2A1UA 4OK3A 1RP7A 1C9MA 2HRRA 3BRWA 3Q15C 3AHFA 3GI1A 3U6KA 1H2YA 2O9JA 3PL1A 1V3QE 5CDFE 5LIRA 4Z9AA 2TECE 1KHHA 2WABA 1XPRA 2I0FA 3ZNPA 2D1FA 1WXWA 1QK4A 3GCZA 3JQPA 4FFWA 4URYR 5CTJA 3FKJA 1UMBA 2P2CA 4JYBA 2FWJA 3PNOA 3DFKA 1WZCA 1KSHA 5BR8B 4OP2A 4ZVLA 3VR4H 1U0BB 1ACMA 2PV7A 3OQPA 1NN1A 5FFNA 3VJLA 1RACA 3C6MA 2EFHB 1JEYA 3LZ6A 5AIAA 1YU6A 1LLDA 1ODIA 1X8XA 2OO5C 4Q3CA 4LC0A 3Q98A 4QATA 4RVHA 4PZAA 2V96A 4D5GA 4F6RA 4MKHA 4NYIR 2UYYA 1Y3FE 3QG5A 1H6CA 1CS0A 1PZMA 3LBNA 1WM1A 2QSUA 1JR4A 1MPTA 1TAGA 4S35A 4EAAA 4XDYA 4UOQA 3EHDA 1G6KA 3RF6A 4C03A 1YZLA 4QEKA 1P39A 4PXYA 3JRNA 4H1HA 2B7CA 3TZQA 3NOQA 3V48A 3FBGA 3AYXB 1UIRA 4F4UA 1Z3CA 3I1FA 4KH1A 2WV9A 2IHZA 5DCUA 4TTVA 2GM4A 5CM2Z 5I9NA 3L0OA 2XTAA 1FJXA 1XLWA 1YD7A 5TGTA 4YJGA 4LOIA 4RJLA 3JARB 3TLKA 1PNTA 1USIA 2P2ZA 4GQIA 4IOKA 1NXOA 4YYEA 4B84A 5JNLA 4UNNA 1YMVA 2WUEA 3VSEA 1QO7A 4CCYA 4U7TB 1BGXT 5DDIP 2C5BA 4M7WA 3LPLA 2XCIA 3OESA 3BGVA 2P6NA 2FPXA 1U02A 5CA0F 2DPYA 5TB5A 2RHWA 4O1MA 4YT5A 4MPPA 4M1TA 2BFDA 1ZVJA 1XDGA 4ESEA 2PRZA 4F71A 3DO8A 1U0SY 1YS1X 4F0JA 1CVIA 2GLUA 4KIFA 3I45A 4R7ZA 1EFVB 4JJ6A 2YBDA 5HBRA 5CPBA 1DARA 4I14A 4A6EA 4ASUD 2JFUA 3R0QA 5DM2A 4B80A 3MWKA 4G84A 4B3IA 4KP7A 1GAJA 2QIOA 1YE3A 2YIJA 3V5NA 3FPJA 4MIOA 4B79A 2CXXA 1QV6A 3JQCA 1TUBA 2GFIA 4O4LF 3H5OA 2E1RA 3EAQA 2GXAA 5EWLB 4EG1A 3NETA 3UAOA 3E70C 5DM4A 4WUVA 5CUQA 3UANA 1QFXA 4XGRA 1U8ZA 3R20A 2QU7A 4RTKA 4QXPA 2AFRA 1SCAA 1SNYA 3HJAA 4H0FA 4X54A 3ZCUA 4ZFNA 5BWNA 4HQFA 3L4JA 1FTNA 1SIOA 1RPZA 5A9SA 2DB3A 2VA8A 3FIUA 3FVRA 4I1SA 5BQ3A 4PAWA 5CA0B 3BE5A 1O4WA 3CUEF 2P2GA 3BRSA 2WTAA 3ENWA 4HGQA 2W6IA 4N7RA 4P7JA 3P5BA 4L50A 3V9AA 1XVLA 5J3JA 2J0UB 3QLVA 4RTPA 1ZJ4A 4MR7B 5TQ0A 1NOIA 2VWGA 2H7VA 3C5HA 2RBGA 3T38A 1PV2A 4YY3B 2P1ZA 3DUFA 3W5AA 2AJ8A 3BMNA 1L5WA 4GMGA 2EBHX 4GSYA 4R68A 3HEMA 4UU7A 3RJ9A 4FI3F 1I6MA 4GMHA 2WLSA 1T4CB 1P0IA 1ZD8A 2PX5A 3JD1A 1TB4A 4MYCA 3WWZA 4LJ6A 1YZYA 4R1SA 5FI3A 3NPMA 5FBWB 4BNUA 4EG7A 4OX9B 2PGLA 1USWA 2SBTA 3JQ8B 2ZSHA 1GUYA 1HT0A 1U2DC 5E7JA 3TTXA 2C9DA 2R66A 5HKOA 4JI0B 1MFPA 3O4FA 5DGTA 4R9RA 4NENA 4YCBA 1H5UA 3UH1A 3CXRA 2DYKA 4KQJA 5AHKA 3ENNA 3RAEC 2E4YA 3PHCA 5AJWA 3GDHA 4HDNB 4FBLA 3DKIA 4CDRA 1WD7A 1CR2A 3KR1A 5IEBA 3VFDA 1IOWA 5K2OA 3V4OA 4S04A 2QJTA 3TSCA 2OBBA 4QLAA 4ML3A 5CAEA 1KYYA 4UVIA 4MQEB 1KMIY 1R0BA 4QXAA 1YQXA 3R6DA 1E1CA 4BGEA 2BSXA 1N0VC 5FI1B 4TL7A 4QO8A 1ZUD1 1T2AA 2FEAA 5DX0A 2PL1A 4G97A 3LCUA 4XW2A 2RGUA 4MVJI 2QVLA 1NA5A 1RXYA 4Q1BA 3WWPA 5KTRA 3SQWA 1KYVA 3IUPA 1XCGB 4Q5IA 4N7MA 2R7LA 3ZWWA 4ER5A 3FLAA 1VDZA 1JZTA 4D4LA 3RSLA 3HBLA 5ALUA 1PJSA 1YDGA 1OXBB 2L2QA 2ZWAA 3OMLA 3IP5A 5EFZA 3DMYA 4QXOA 3WNCA 2PZGA 4C89A 2C2KA 4P33A 2YWCA 4CRWB 5AVJA 4A4DA 2WJWA 3OLXA 4HGYA 5IM4F 3MTQA 4KVAA 3AIIA 1YKFA 1ZY2A 2POCA 1TC1A 2QGFA 4XE5A 5KVQA 3SEFA 4MYUA 1R4NA 4O29A 4I9GA 4J0FA 4FE7A 1P60A 3AFNA 2KMLA 2YWGA 1FFGA 3A4IA 3P9KA 5F1YA 3WYDA 2IH2A 2EL9A 1T8RA 4OOEA 4FP9A 4LQLA 4Y98A 4ZJYA 4Z0HO 1GD1O 2GSDA 3VO1A 1B23P 5JYCA 1P91A 1NVVR 3BD6A 4YQEA 1Z0FA 2XAAA 3IAM1 2X41A 2I67A 3WMXA 2WP8J 1ECLA 3D3KA 3V2IA 5KSWB 4CEIA 4QA9A 2ZDQA 1X92A 1TLFA 4UOEA 4ZXPA 5I01A 1GUBA 4Y0VA 1EX6A 4A73A 4DABA 4BQQA 1Z73A 1XFAA 4BFVA 4KAXA 4BB5A 5E7MA 2C5EA 4KRFA 3ZW9A 4QPPA 1EFTA 2CUKA 3WZ2A 5E0OA 3GLGB 3L8HA 2GFQA 3C1UA 2JIDA 3BX1A 5FQNA 3CUKA 3LY5A 2OO5A 5KAPA 4DSNA 5AUQA 4FB4A 4OXXA 1JZSA 3F3MA 3SICE 3GEHA 1U9ZA 3IJPA 1X1DA 2R1TB 2VDWB 4Q4JB 4Y30A 2GDZA 4EHDA 6NULA 1IN7A 4EELA 1W4RA 3N0VA 5L40A 5KO2A 2BHSA 1H93A 3LP5A 3VR6H 1ZCAA 1C0KA 1KZ4A 1M1NB 3ORSA 3T1YB 2IGTA 1QDEA 3VUEA 2BFPA 3I2YX 2HZ7A 4MPDA 3CF0A 3L4SO 4F5EA 3OTOB 3GJ5A 4ZO6A 1EJ0A 1R0XA 1O8BA 4EHAA 3P0JA 4F9FA 1J0BA 1BE0A 4XM0A 3WQHA 4H60A 3EC7A 5EXDA 1ZKMA 3UJ8A 2C8VA 4JELA 4BVKA 3BE8A 2HUPA 4HUQA 1GUZA 4DM7A 4LFAB 4X65B 1N1DA 1V9SA 5DBHX 1QUEA 3T52A 4ZEVA 4B3GA 1A1SA 2HWXA 3NPAA 3PHGA 4G65A 3ZY4A 2CLDX 5D51S 2FA9A 2ZIAA 4PGHA 1MC8A 2UVPA 3H5TA 5H59A 1WJGA 4FFMA 5D6OA 5EZ6B 5J9FA 2GXUA 4ACBA 4OJQA 3A3YA 4EQ6B 4EMSA 1UJNA 4HYYA 1OLUB 5B55A 2BP7B 1KZ7B 2AG5A 1WXGA 4LYJA 4O4JB 1TA0A 1E6EA 2EZTA 2ST1A 1XHLA 1HT1E 1HPLA 3DA8A 3DDCA 3ESAA 4KIWA 4DCCA 4UCXA 4YI3A 2BHRA 5K0FA 2QR3A 4S1NA 3GVIA 5T4BA 3ET5A 3HPRA 1JFTA 1DRUA 5FWXB 4RKWA 5CBPB 3A1FA 2PZBA 1ZC3A 3U4DA 1BFDA 2WSBA 5CLHA 3VYWA 5HRUA 1YRAA 1N5LA 4MDHA 1FFWA 4O4IA 3ZIUA 5B30A 4DLBA 1ONSA 4RADA 1MRZA 3F0TA 1MJ5A 3DTVB 4K8OA 3F97A 4ND6A 3IQWA 4M3NA 1U7XA 3FCOA 4GVXA 4HLDA 3R9IA 3V1NA 2H1OA 1J8VA 1QH1A 5F2EA 1Z4QA 3U3XA 2X6TA 3K9LA 1YBAA 5J1SB 3A6HA 4TVBA 4YRSA 3DBRA 2ZE8A 1PV1A 2DPLA 2NSJA 3DYVA 3F3YA 3G0BA 1W75A 1AQ6A 2RB4A 3PTZA 2J0VA 3HBFA 5H82A 5IHPA 4MRVA 1IJBA 3VDMA 1J49A 1PTKA 1T2DA 3NH6A 1G3RA 2ZJ7A 1JECA 3OJFA 1M2NA 1C9JA 3SLKA 1VJGA 1Z4KA 1XELA 4S2UA 4Y7DA 3ZS8A 1OASA 2A78A 2XWSA 5ALGA 3QVWA 2HV8A 4LDJA 3R3WA 2WK1A 2WW8A 3EVAA 3EIFA 3EXFA 1H2ZA 3IKMB 2ZRMA 2ID8A 4HX5A 2OXCA 2LP4Y 1XJ0A 5J5AA 3QMWA 2E6UX 4X1IB 3MAAC 1APBA 5B5SA 2OD7A 4IG4A 3RSZA 5K20A 3DAHA 1EWVA 2OWDA 3FUVA 3HY6A 3IP7A 4QOSA 5C32A 3M6XA 4BC0A 4ZPXA 3QMMA 4TMWA 1NI4B 2VDUE 4DJFC 2E6KA 1AUQA 4IIFA 1T6NA 3RPEA 2QLTA 4B3HA 3FSGD 4DEYA 5HUJA 1W73A 3DE2X 4JLVA 4E1AA 4AMVA 1Y6GA 2GAAA 3A10A 4X62B 5TRTA 2GEBA 1D4FA 4U9IS 1HOXA 3O4GA 2YRWA 1RHJA 3PUZA 1VPVA 1JLKA 2NU9A 3OZUA 3TSOA 2V6MA 1ELOA 4N03A 2H3EA 2TRSB 2WTMA 3W5UA 5EHXA 1SK8A 1CFJA 4A5OA 2NXWA 3COYA 4BO8A 2X2PA 3M4ZA 1JHAA 1DLJA 2JKZA 2OILA 2BFNA 4GVPA 4KAJA 4UNPA 1TQ6A 4I1YA 4BKOA 4TLMB 3BQNB 5LUBA 3VYUB 4CZ2A 1HXHA 1TUEA 3L1JA 4CLEA 3ECAA 1T0JB 3QELA 4JJ4A 2C5HA 4NMLA 5EXTA 4C29A 1PW7A 1S3IA 2HSGA 4KN6A 3B60A 3TNJA 2QRVA 1PJZA 3WLFA 3QPUA 2EQBA 3AF6A 1FTWA 3DEIA 3G2NA 4L8GA 3AI3A 4JA2A 2O7VA 4O59O 3OOHA 1D2HA 1T0IA 2IEAA 1KY4A 2QTBA 4GZ3A 4PPFA 3R76A 4LOJA 1WQ4A 3WL8A 1BSVA 4RL4A 1U3UA 1DFHA 1CRZA 1GQRA 1NRIA 1CLUA 1PQUA 1K66A 4DMHA 3TECE 1DHRA 3F5DA 4DMUB 3FI0A 3AM3A 3B1YA 4BZXA 1O97C 3BXFA 3TRKA 1VJ0A 4LYFA 2WIKA 3S70A 3NHAA 3FSEA 4OHBA 1PV4A 2RG7A 4ZMRA 1BG6A 1IN5A 1ZQ9A 4E2YA 5JMWA 3NV7A 2CJWB 3CUYA 1DBQA 3GP3A 3HB0A 2Q1YA 3BWBA 4XM2A 4MRRA 1JIIA 2FV8A 2D54A 1LPSA 2YYSA 4X1KB 1DEXA 3AUSA 4C05A 5I7OA 1FSSA 1NY5A 3QY9A 4KQ2A 1OX4A 3PHJA 2CXQA 3ADPA 4FBMA 4QUHA 1XYVA 1Y3BE 1V9CA 2A4KA 4GOLD 3QWHA 5EKDA 1W52X 2FDRA 3C4QA 1ZGAA 4A8JA 2KM1A 4F92B 2G4VA 4FD3A 4KQ6A 4YLGA 4M7RA 1CEEA 4NBWA 4MMYB 1KZ9A 4RLQA 4DWVA 2LE0A 4OBXA 4N3NA 4XM1A 1FRQA 1NBAA 2ZQ5A 3ANXA 3UG6A 2C42A 1Z0ZA 1YB7A 3UT5B 4DKJA 1QRAA 2Z58A 3LQQA 1D3AA 3OCWA 4V02A 2JPDA 4K6CA 3R3UA 3RRJA 4X90A 4E70A 3NM6B 4OGFA 4DLYA 3GW8A 4S1VA 1ZOPA 3TPFA 3RS5A 3ZQJA 1BMFD 1JQAA 3A9SA 2PS3A 2I2CA 4OQYA 4E14A 2JVJA 3D8SA 2NU7A 2AQ8A 1NMQA 3I6MA 3KQHA 1Z5PA 1IY2A 4G5HA 4BVEA 4C0LA 1Q7BA 4R5HA 1WBDA 1ILWA 4D6PA 2YVQA 4ECEA 1MB4A 3O8OB 3VOBA 3H2HA 2GEJA 2D5LA 4MCAA 4PYJA 1LF0A 2CBZA 4F7DA 3QUCA 3M6AA 2WIJA 1Z5VA 2IT1A 1M8GA 3DB1A 4OGWA 2SECE 1GFSA 3UXYA 4NBVA 2GPSA 3I4FA 2GS9A 5CURA 4B31A 3IKVA 5K3FB 5ADHA 3PQCA 3U7JA 2CB9A 4EFDA 5LD2C 2ZUDA 1HLDA 5LQKA 4UBMA 2WVAA 3UMVA 3OG9A 4B32A 3LRPA 1E0JA 4YMVA 4KO4S 1RRVA 2YBEA 1MFZA 4MWOA 4X20A 3EVTA 3GO4A 1ZMBA 4MVWA 4YJHA 2GKSA 8AT1A 1O95D 4HDSB 4GGMX 3AVQA 4O25A 5CIYA 2X1HA 3RKUA 1H0KA 4OSOA 1DS6A 1XJCA 1FTQA 2RGNC 3BDVA 4UM5A 2ORED 1JDBB 1XJWA 1FRNA 4LZJA 4M4SA 1ZH2A 4Z54A 1ANKA 1BW9A 2J08A 4TV9F 5F7ZA 4FXPA 5A5VA 4MGZR 1HEYA 1ZD2P 1GR0A 5SZIA 1Q1GA 4CQMB 5DBOA 1VJRA 1V0JA 4K3VA 3KZCA 5LZ7A 3WISA 2O2GA 5CW2A 1P19A 4S1TA 3KOZA 1UXKA 3MTDA 2Y8EA 3T3GA 1V3TA 3AR9A 1CT9A 4MCHA 3NVDA 2E49A 2QAGC 2OGZA 4O33A 4I4IA 4JYAB 3I53A 4QC2A 1H2RS 1FUKA 1LH0A 3PPIA 1VKJA 3RAGA 3M4XA 2XJ9A 2C3MA 1AB6A 4G23A 3WHLA 1EE1A 2Q3HA 4J49A 4L51A 1JHYA 4UHEA 3CHYA 3OZSA 2VK4A 2P41A 3HY3A 4JLKA 1UWLA 1Z6AA 2HIGA 2X15A 2AXPA 3KHKA 4ZVTA 5AVYA 1WWKA 1TVKB 3EODA 3DOIA 4KE8A 1E2LA 4C6SA 3NKVA 2GBLC 2VOJA 3QK7A 1NVKA 4BP9A 2Q1TA 1IM8A 4FB5A 3NU1A 2V7BA 4BVHA 4EITA 4NI5A 4PHFA 4JQYA 2ECOA 3DOHA 3E4DA 1JGTA 1YE8A 221PA 2ZCJA 3WOHA 2DUUA 2NP7A 3PNKA 3FHTA 2RGEA 1HKUA 3KKNA 4KEAA 4EQ6A 3OIFA 2QP4A 3GN2A 3F5FA 4BEJA 3QEAZ 4Z1MA 1E3WB 3WLOA 5AJUA 4LNAA 3AMVA 3LBAA 4GLOA 3BCRA 3ZXSA 3BK7A 3Q2KA 4P08A 3DKRA 2ZVJA 3W5HA 2Z6AA 1JJAA 2CUTA 3KPWA 1M2JA 2WZDA 3OUUA 4XTRA 1Z3IX 5GAJA 2VFAA 5IH3A 2LCQA 2H11A 4FNMA 2ZI6A 3TLZA 3S2ZA 1S2NA 3FOCA 1N4DA 4JX9A 2WJ6A 4HY3A 3A6KA 5ENVA 5DYWA 2Y1CA 2RHMA 3V97A 3UMRA 4G4JA 5JS8A 3T95A 3QJGA 1RPNA 3JYQA 3Q6IA 5ENDA 4AB1A 1O6GA 4W9NA 3C4JA 2IEBA 1W93A 4M83A 5IBRA 2B8EA 4I8XA 1UKCA 1YZFA 3ZV7A 1GRQA 3GA7A 2ZBDA 2C2MA 1SIWA 2V54A 1T5HX 2VDWA 4Q4JA 3Q12A 5E9JA 4QJ4A 2AZMA 1VB5A 4NDZA 4N3BA 3REFA 3H2KA 1OX5A 1KAGA 2G1KA 4R0VA 3SX4A 3UMFA 4MWZA 4KNVA 3C7TA 4Q02A 1GU1A 3S1AA 4C4AA 1L7OA 5HKLA 5BN3A 1U11A 2HF9A 3OE4A 2ZR0A 3HWRA 3QOFA 2D5CA 3FWHA 4S0ZA 4DMFA 2V6GA 2XWJI 4HH0A 4PLHA 3TWOA 3EVEA 4CIYA 3GGPA 4IDGA 3RQSA 4RA9B 1IN8A 2TMKA 1R00A 4JLMA 2Q49A 4RDHA 1U1FA 3PC8C 4GI5A 3A6FA 4CEIB 4W99A 1X39A 3WQBA 1RAAA 2FQYA 3COZA 2C92A 2OP1A 1TTPB 2YJGA 1NF2A 2PWZA 3I8OA 3OWHA 2MIIA 4H6XA 3RO7A 5KWJA 1YS2X 2MSWA 1EFPB 2E0IA 1Y48E 2WMNB 2VHZA 4ZI5A 1UODA 1DBVO 2PV0A 5TJ9A 4DYDA 5TT1A 2O1SA 1P62B 3ETNA 3FPEA 3REQB 4E4YA 2GILA 2V7PA 3HU2A 3BIXA 1NG9A 1GKUB 4RDIA 3THRA 4MUEA 1E3IA 1SRQA 4IDHA 2DF8A 3G9XA 5AKZA 5ITWA 1LK5A 5A71A 1Z34A 1JDTA 1R18A 3K09A 4RSMA 5JMPA 4ND2A 1VE1A 2H4JA 1RSZA 4ZOQI 2LCIA 4PZDA 5J2TB 1UKBA 3PLRA 1TJ5A 3IESA 1IEQA 3NDBB 2FI1A 5K09A 3C5EA 3AEQA 4Z53A 4M9SA 2XMCA 3GFOA 4G36A 3MWDA 2XB9A 5FWDA 5BNWA 4YUWA 4ZVSA 1A8QA 1H2FA 2JFBA 2OEPA 1U3CA 3MELA 3NHWA 5MFPA 4WLVA 2H17A 3HHPA 3NR2A 4EZEA 4NU0A 421PA 4KGZA 2NPFA 1I1HA 4IHAA 3ZZTA 3GJ8A 4IJVA 1S9DA 2RHDA 2W22A 2ZS7A 5LLDA 3W5BA 2QSYA 5U4XA 3WA6A 1D4AA 4JODA 4X8OA 3F67A 3JWIA 1NVXQ 4ARUA 5I51A 3H2IA 2I2AA 3EW7A 4C6RA 3S0JA 3ISVA 5JC1A 1A8IA 2WA2A 4J2TA 5COAA 2DPHA 3KLPX 3PWSA 4MUIA 1MUUA 4JT9A 1LPOA 2YXNA 4REMA 4DUZB 3D2AA 1Q84A 3ANMA 4HX2A 5I9IA 2R5NA 3TMAA 1N1MA 2HWKA 4JI3B 1KK0A 2B0CA 2HK9A 3PEUA 2UXBB 3GEGA 3UVEA 3FTFA 3A1WA 3GLKA 4CLOB 5JMOA 2F4NA 2GVZC 4DZZA 5F9MA 3BXHA 2XRMA 4GQAA 4Y1RB 2A3RA 3AU9A 1R8XA 1C3OB 3D0RA 4RPIA 4TVOA 4F8JA 3KT3A 2IDKA 2EWWA 3OZBA 2NXEA 4RZ2A 3ANNA 3QSGA 3V4LA 3ESXA 2GF9A 5IAAA 4U39A 3BXZA 5IT9A 2AX3A 4QM7A 3K70D 1SG0A 2WWRA 2OCDA 3EEIA 3UM9A 1LFDB 4MS3B 2RBEA 1DAFA 3UXEA 3QSYA 1KIFA 2DY1A 5BWOA 4QELA 2AW3A 2Q6LA 4GE0A 3FFXA 4CQLB 2I5PO 5KVSA 2BWJA 1UPTA 2QUBA 5BW5A 2GPJA 2Q0SA 2UUAB 3H17A 2IKSA 1B8NA 4OBEA 1BCRA 4QDXA 2OCIA 4DLAA 4O8CA 2JGNA 4BEWA 4DR4B 1MG0A 1X1AA 2PZMA 2EP8A 3CZQA 4BPBA 3PPVA 4J7UA 3S1LA 4UXJA 4MA0A 4E32A 1DX4A 5C5IA 1WP9A 3EEQA 2HQSA 3SM9A 2BZ1A 2COUA 3SC3A 5FWAA 3U3RA 2IEDA 1PNVA 4FZRA 5KC8A 5L6LB 2FQWA 2V03A 2WKQA 4PXSA 5EPUA 2DWPA 1M0SA 1S2GA 3Q2OA 5HBGA 5FR1A 3ND8A 3PNQA 3PFHA 3ZOZA 4RV9A 1S3FA 1V8OA 2C7VA 3CNBA 5JE8A 3T4UA 1PRYA 3K6KA 1V71A 1LSUA 4ADSG 4XWWA 2QJRA 2FW6A 3TZEA 1NW4A 1YI0A 2P9CA 3PQ4A 4HWSA 3WDMA 3KJQA 5AJTA 5LQMA 4LFBB 2PXHA 4OEHA 4Q7JB 2QI9F 5B1EA 3TKLA 1A5ZA 2NU8B 1NF3A 3DLCA 1VIVA 3TTYA 1OIXA 1OI7A 3E3AA 3N6RA 4KQ9A 3EPKA 1UBNA 4IQ0A 4QECA 2X3UA 3MS7A 3FTQA 1T0BA 3C4VA 1H1DA 2YN2A 2UVDA 4EY4A 4YRKA 4FE3A 4RMNA 1Z45A 5BPFA 4GMFA 1AQLA 4X84A 3TTWA 3OHPA 1JDSA 3DZCA 2A0XA 3M34A 5D3MB 3RSFA 4YV7A 3P2EA 1C30B 1YK1A 2B35A 2QX9A 2DBRA 2FSHA 2XXBA 3IAS6 4JXJA 4E30A 3K1YA 4XSHA 1Y1PA 2J33A 4IUBS 5LA6A 4YP6A 2REOA 2G63A 2J1LA 4E07A 3EN0A 4RSGA 5CM8B 4Y18A 1FS4A 3NBKA 1UBFA 2OVBA 2QYSA 1OPRA 4RNDB 3S81A 1LBIA 4R51A 3O21A 4B7AA 3ZXYA 4RTJA 3DDOA 4WZAB 3R7DA 1BXGA 1EFDN 1JT2A 4UOZA 5JDIA 2G5TA 1GTL1 2AL7A 3ELYA 3N75A 3ICCA 1E9VA 1F0YA 1Z5ZA 3GFFA 4H3HB 3MJCA 5IM5A 1I6LA 3FW1A 1N6LA 2XNHA 1RYNA 4NXMB 3OQVA 5FNVB 4GR9A 1SO8A 4RAOA 3KSZO 2IOFK 3KVNA 2AC2A 2F6RA 4O2BB 4UU0A 1DELA 1BXKA 1CNFA 5ULLA 3TM5A 4HQ0A 5C81A 3TB6A 3VR6A 3O3CA 3PNVA 5JSHA 3OCJA 1A7AA 3SKVA 2DTXA 1T9ZA 2ZJ8A 1QM5A 2X0FA 1JH9A 3OCXA 2QQ0A 2Y1EA 1EK5A 3CGWA 4G5FA 2F9LA 4J3NA 3NEYA 4LMPA 1S02A 1ST2A 5EA2A 1KJ8A 5JXWA 1S4MA 3UH0A 4KKVA 2Q7DA 4GP9A 5AM4A 3P97A 2W71A 1PKEA 2B4RO 1XG5A 4IXMA 1QHYA 1P2TA 1WDTA 3HVIA 1UL1X 3H8WA 1G7CA 2GMWA 4RTOA 3Q11A 4TSFD 1HZZA 3I0NA 2BUCA 3E03A 4MPTA 1A4UA 1IH8A 3TLCA 5FBVB 3NRCA 3P8ZA 4AUMA 3HB5X 1ULSA 3IT1A 3NIDB 4HUJA 1Z39A 2POQX 6ABPA 5BR4A 4FGLA 2XKAA 3ZNQA 2FDCA 4F72A 4EHKA 3L4BA 4Z3KA 5U9CA 2Q3CA 2WWIA 3AWIA 4LPSA 1AMOA 4RIGA 1OBFO 4U4AA 5I5GA 4ERNA 3L01A 3ACCA 1E9BA 4FYPA 1GPNA 3LC1O 1JDNA 4LX0A 3L8EA 4LXTA 4KQFA 3QW4B 2VYVA 5JO9A 2PTHA 2OD2A 2VZ0A 3DZFA 4MVCA 3MCUA 1JYFA 4YBRA 5EWLA 4EUNA 4BXOB 3QVUA 3LK7A 1P7WA 2QTVA 1B0UA 1GAEO 1V7ZA 3OIGA 2PKRA 1AMNA 3DH0A 4L8LA 1NW6A 1D0IA 2APJA 3OOSA 1DXOA 3DPIA 4KW7A 2VJDA 4TKLA 2UAGA 1OTXA 4LHEA 4XWGA 3SOPA 4BKMA 2V65A 2AI1A 4MVJF 1ZUNA 2MMCA 3KCNA 2BFFA 2BT4A 3LD9A 4WT7A 1UKVY 1WBJB 3ES9A 4BWGA 1MB2A 4DJDC 1UPFA 3LC0A 3U7QA 1S6YA 1AKTA 1XOIA 3ED5A 4I66A 3WIBA 3WX0A 1E5QA 2BOVA 2D00A 2EKQA 5ELXA 2G82A 1YJBA 1T3HA 3OM1A 5G4LA 5J63A 3RSGA 2N42A 2EJBA 5L3ZA 3G0IA 3VR2D 1YA6A 3PUXA 4XSVA 1JPUA 3H0EA 3TIFA 3H9JA 3ZDZB 1KKUA 1K6EA 4L9WA 1PJ2A 2B4TO 4DEXA 4DXDA 1FDSA 1H9AA 3OD1A 4ENUA 2W5UA 4BVFA 1DCFA 2II6A 1QGOA 2XUQA 3EQZA 3FOAA 1VCIA 2BY4A 2WBLC 2ZROA 3LIIA 4XWAA 2G8LA 3N2GB 4XDHA 5EWJB 3HJTA 4BCBA 2P2LA 4IEEA 1TXGA 3FCEA 4V0ME 2FEPA 3Q7EA 2CLIB 5CNMA 1P9WA 1D9ZA 1VJ1A 2BI7A 2NQ2C 3H1PA 1ORWA 4LIPD 1L4GA 5DBFA 3LSYA 4HK4A 4UEKA 3SZRA 3NBAA 5B3AA 3VZDA 5H70A 4URXR 4L6CA 4DADA 621PA 2VTKA 2YNMA 5GMOA 3TMYA 3FUCA 4P38A 4M9RA 4IHJA 2YMQA 1Q3HA 5LKAA 1GYQA 2W2TA 1IM5A 3PFGA 5F2NA 5DRTA 2AKYA 3ELUA 1UEXC 5KNDD 1GDDA 3VYRB 2EFCB 4X71A 2YOHA 4BMNA 1GILA 4R7GA 1HZJA 3NMUF 3LVBA 3EVDA 4ZREA 3VV2A 4EW6A 1UMBB 3DEAA 2JIQA 5BV8A 3JD4A 1ID1A 1XXHE 2R6GA 1CZHA 4DMKA 2IJGX 1C4OA 2HA7A 1KDVA 3GPCA 3OSUA 2PH7A 2FH5B 1HYBA 3TIIA 1VMDA 3AVPA 4RSRA 2DLCX 4OGGA 5IG2A 1D7OA 4MWBA 3BGSA 2AHOA 2C9ZA 4ND1A 4S3MA 1FYDA 1CRLA 5DIZA 2V7GA 2IZ0A 3AB8A 2IYPA 4QU9A 1Z9BA 1NQXA 1TO6A 3IQFA 2O1EA 4UVDA 3JQBA 4K05A 1MLDA 2CNWA 2BF4A 4QYWA 4R9NA 1A9PA 2VQDA 4XARA 1WZ2A 1TO2E 1MQ9A 3EF0A 2I3AA 2A9QA 3GD5A 3H1TA 3UTCA 4BO5A 4BX8A 4DRXA 1ZI9A 4KREA 1FBTA 2VCEA 4LI3X 3DFMA 2W6JD 2IODA 2VDNB 1NM5C 2ANCA 3T35A 4ZYVA 5FOTA 5TS3A 4L22A 4ALJA 2EZ9A 4E7OA 2BONA 2OBFA 3FA2A 1KJZA 1EVKA 4OK5A 4RO0A 4TKVA 4DUGD 3UIEA 3KEOA 4A82A 4OCZA 1UP4A 5GJCA 3UW1A 1K7CA 1X80A 1VTKA 1I0LA 1HQYE 1YGYA 3A32A 3IR5A 1ZI6A 5EZYA 3DLAA 5A3SA 5T6MA 3SVZA 1YGPA 4BYGA 4RK4A 2Z9BA 4QLOA 5DM1A 4EB3A 3OO1A 2HU5A 3LXXA 1ZIDA 3O2SB 4P1ZA 4UFNA 4D4IA 2GD2A 3N7TA 4G8DA 3NBYC 5EKTA 4Z4FA 3ZWKA 1RFGE 5CLIA 4ZHQA 5L4SA 4EGCB 1Z4MA 1W0KA 3G1UA 4RDCA 1VBKA 2R65A 4FOOA 1U8AA 1KOLA 4XVRA 3Q4GA 4MV7A 2I3GA 3TZCA 3EPJA 1N2ZA 2YWXA 3ZJVA 1H22A 1IPFA 4X92A 5CG1A 1GQOA 4R9SA 4HD8A 1USGA 821PA 2H00A 1RJEA 1O94A 1V3UA 4R2WA 1RLOA 1NZDA 2WYVA 3FDIA 2XX3A 3QVOA 1WD5A 3U62A 3AO0B 4Q7QA 3BK2A 1KY2A 3DMTC 4K86A 4IOMA 3PQ5A 1JWAB 4MVJM 5L3SB 4H18A 2UUPA 1GZ5A 2HRDA 2HXYA 3CO5A 1L5HA 2JEZA 1IHXA 1OB5A 3EGVA 2IYFA 1E2HA 1JV2B 3BMOA 1CJKC 1BU8A 1A2BA 1BHSA 1I4WA 4AWAA 2C2ZA 1HETA 3TNYA 4ARAA 5HIMA 3QOYA 1KQOA 2SHKA 2QN1A 4QWMA 1C7QA 1NX9A 2VK8A 1MC5A 1V11B 4LZOA 5F9HA 1N33B 4JJ7A 2GCIA 2ZJ0A 3T5CA 1Y82A 2P5TB 4ROSA 1VL8A 2FG6C 2QLFA 3RQIA 3BD8A 4I8DA 3ZIAA 2IFTA 2BF7A 1Z6YA 3LV8A 1KSGA 3WJ2A 4D4JA 4ZYLA 3GMDA 3KSMA 1E6KA 1K6IA 4QQRA 3GFVA 1TO1E 4C04A 1NDQA 4N40A 3FYCA 3FYDA 4O1IA 5FL3A 3VVMA 2NYUA 2FWRA 3MBIA 4GUDA 3OQJA 2CW5A 1GVNB 1RAHA 3GRKA 4Y1RA 3LHIA 3INGA 3GRRA 2G1JA 4U2EA 3OLCX 3ENVA 5CCDA 1YB4A 2OWEA 3ROKA 3SHFA 1E0SA 5EP1A 2E4ZA 2YIDA 3GDWA 3L4BC 2ODEA 5AI5A 1GM5A 2CGEA 3ZTWA 1Y6RA 3EVBA 1LBHA 2X1LA 2HMAA 2DEUA 2RGDA 4JUBA 2VJPA 3H1AA 2GEKA 4JZKA 1XT6A 2J5QA 5ALQA 2PXAA 4H7JA 2XMZA 4HP8A 5CXSA 1BCRB 3E7FA 3H6HA 1JTFA 5ALDA 3RHTA 1K9VF 1VE3A 3SYTA 6CHYA 5I7UA 1ULHA 2HLDD 3AEKB 1HNWB 1L7EA 3TN7A 4S05A 3HDYA 1W6UA 2ROQA 1LRJA 2BCEA 4P4LA 4E5PA 5IYZB 3HMQA 2FRXA 3RBAA 3IERA 3K35A 3SHTA 1IVSA 1KI8A 1VKRA 3E6AA 5BYBA 2X19A 4CGZA 1QIEA 4WQMA 4DTIA 4W5WA 1U3VA 4LWPA 1RRCA 4R9VA 1JF8A 1NRJB 3Q72A 1X7ZB 3V8VA 1RQPA 4JA0A 1AKEA 1NYTA 3N8HA 5CFOA 3RTEA 1VYHA 4F4JA 4MAAA 2J32A 3X1JA 5J23A 1TZKA 2X9QA 1QK3A 3H5RA 1ISRA 1FK8A 4GRAA 3OM8A 4D8TA 2CMFA 5KQGA 1COWA 1OHHD 4LYAA 4U00A 1CF9A 4XEUA 5JH7B 4LF8B 5IU6A 2J85A 1DIRA 3U7FB 1GTG1 3ASYA 4FMDF 5DLPA 3ETDA 3VAZA 2XBLA 4FCCA 1PNQA 1J2YA 1PG0A 2DTEA 4NZNA 1XTPA 4CG0A 1L4YA 4YX9A 3D3WA 1FU4A 3KOUA 3NP7A 4F97A 5AVWA 1BDBA 1CERA 1JBKA 2AK2A 3L04A 1OU4A 2XECA 1Z4OA 5H3HA 3DM9B 5EZQA 1E1LA 4QEDA 4DQXA 1PVOA 3P9NA 3R1IA 4ENSA 3W7VA 1OBVA 1XTZA 3GRPA 4Q34A 5CNKA 4IO1A 5GPBA 3K71B 1CHNA 4TQAA 3UHJA 1JJBA 2HOQA 1ZOSA 2Z04A 4CLRB 4NTZA 5EIOA 3TOZA 4YRNA 4B74A 1IG0A 3BFJA 1OWPA 2PX6A 4CUZA 4EPWA 3PNBA 2VXYA 3MLAA 1P4SA 2P3LA 1W5BA 3KYBA 3VHXA 2WUVA 1X0VA 1XKQA 1FU7A 3C7CB 1IWBB 5LOVF 1YK0A 3K1ZA 4JVLA 4M1WA 3ON5A 3G49A 1S0UA 5LMUB 1WHSB 3F3SA 4GM0A 4QQ8A 3IL2A 1KMHA 3QFHA 5F23A 3JQ7B 1WY7A 2PKWA 3CM0A 2QB5A 1W2HA 1IN6A 2FZCA 2WINI 2ID9A 3KUXA 4QBGB 3DNPA 2ZULA 5E4YA 1SUAA 2ZIEA 3LUHA 1WB5A 2B36A 3FZYA 5FP0A 4HNAB 1EK0A 1G9TA 3FMGA 4MRMA 3ZU2A 1Q1QA 1BD3A 2JFYA 2Q8PA 3VISA 1ZGGA 3OJEA 3VH4A 2ZIXA 5JJBA 4W6ZA 1WHTB 3BGDA 1EWKA 3IDSA 2WYIA 2VJAA 3DV0A 4E1BA 4LF4B 4EIWA 1LNZA 1ST3A 3HFGA 1JDVA 4GPIB 4GW3A 1IVYA 2I76A 2ZJ5A 4ZDKA 1F2UB 3T7TA 3P9RA 4QBFA 2JCXA 1UMDA 5D3ZA 1KORA 2VZEA 3L05A 5KQMA 3ITEA 1WU8A 4B46A 3SS7X 1TTQB 1ZEMA 3F7NA 2GZ3A 3N0WA 1PT9A 1ZW6A 3GGCA 1E8MA 3PGKA 4UJ3A 4CF6A 1JHZA 3QH4A 4EPRA 5B2ZA 3SE0A 1JSLA 1T5SA 1EFUA 1XLUA 4AYTA 3H05A 2H48A 1SHLA 4IX1A 4C4TA 4RL6A 2HL6A 3H8VA 2JGLA 3QBVA 3A1NA 2P3OA 3LVRE 3KTDA 3OI7A 4HYEA 2UZ3A 4GBGA 4L57A 2OOSA 1YIDA 1CR6A 2C2HA 1HOTA 2IEZA 4FSDA 4JJZA 3VPFA 3AERB 3WL7A 2AYYA 1ABFA 1S4QA 2IPAB 1VLJA 1NW8A 2X4LA 2YS7A 2XD4A 2XMPA 1CYDA 2AOTB 1RE1A 4N5NA 1XU7A 5KJ6A 4IEFB 4RKRA 3HBJA 3E5NA 1G8YA 4G85A 5AHRA 4QT4A 1HMPA 3HDTA 5CDFA 4JASB 4KL8S 4BMPB 4F4DA 5F2OA 5H3CA 3FWNA 4RJTA 1T5OA 2LRHA 4E5YA 2PSEA 4K9KA 1AKYA 4P4SB 1UK9A 3V7YA 3SHWA 4K0RA 4FFSA 4DSZA 1ZR2A 4FNOA 3ZWYA 3EYWA 1NC3A 2Y68A 2GCPA 1I3OA 1XCJA 3G1TA 4JOBA 3H7IA 2BAGA 3QE4A 4E21A 4AKTA 1EP3B 5AK4A 1RRFA 4IIXA 4BWYA 1Z7GA 4TKUB 1Y4DE 3VSDA 4YV1A 2QZSA 1KPHA 2GCEA 2NLOA 3GEDA 3S29A 4D8YA 3HYNA 4CIAA 1HL7A 4KPUA 5KYUB 3TUJC 3DJFA 1JQBA 2X5OA 4N3CA 3WYGA 3F4BA 5BVGA 2XVAA 4GOXA 2ZB8A 2VQFB 3C70A 1F7UA 3HTXA 3TR5A 1JHRA 1V1RA 2D1YA 3GNQA 5CYGA 2ZWVA 4OU4A 2B1IA 5ILGA 3TQQA 1IEXA 3C1TA 3HNOA 3H7AA 1ZMTA 4UM8B 2UU9B 2GK3A 2KJQA 1A95A 1RWNA 3DZGA 4J0JA 4N7JA 3MT0A 4P32A 4RMGA 1MABB 4TTRA 5TS2A 5AD1A 1E7RA 5CD9A 1ZSYA 2AJTA 2J4CA 3AONB 2FWAA 1AO0A 2C9MA 5L4LA 3L8FA 5F3RA 1V5FA 1X1RA 4US0R 2J41A 1XD9A 3R8FA 3KNZA 2ZRDA 1I3NA 3H4IA 4DLWA 2DULA 4L02A 1OH8A 3KQYA 4GLFA 1GG5A 1QB8A 3QWFA 5HMLA 2DHRA 2H0QA 2P0YA 1PBTA 4XEHA 3B9PA 3P45A 5E1BA 2ZJ6A 5AOBA 2OL4A 4AO6A 3QPDA 1DIAA 5K01A 3GLRA 1PJAA 4WK2B 4OYRA 4R05A 1IEWA 2PLWA 3ZHTA 3BTOA 2PFSA 1BA3A 1R10A 1RPAA 1TJ3A 3CRVA 3CX4A 3BFKA 1W5FA 4GLBA 5CVCA 4X6XA 4EJ6A 4CLRA 4BRSA 2ZM6B 3GZNA 1H3FA 1U99A 3W8FA 5K4GA 3IKLA 4XGIA 3X3HA 3A4LA 1PNOA 5IFLA 1VIYA 1RQRA 1K8ZB 4TXLA 5IXYA 2V7WA 5I9SA 1B8PA 1XDUA 1Y1SA 4UAVA 5KNBH 2V1UA 4QM6A 2AOUA 2Z98A 3GR6A 3IULA 5J2TA 1UM9B 2AZTA 1AZLA 2J31A 2PG3A 1JDJA 2EKBA 4FC7A 2Y67A 3IPAA 4DMGA 4LISA 4LHWA 4I4TA 2QYHA 1I5RA 1TCAA 4J0HA 3KJFA 1NJ5A 1QJCA 1E5VA 2C8JA 3BHNA 1FS5A 2E4VA 4TQ9A 3ST7A 5CCXA 4XCXA 1PJLA 2EJTA 4ABTA 3VO2A 1GPKA 4KQWA 1JKJB 1K7FB 2RHLA 1J9GA 3JSXA 3ZIDA 1KEEB 3CWZA 3E27A 5HKAA 5KWIA 2ONCA 4JI7B 3QBJA 1ZNZA 1O96B 5L3QA 1WE2A 4CM9D 1PN3A 2JIPA 4AZ0B 5JW6A 4JLPA 2XGJA 1O95C 2P9GA 4QL3A 3GT0A 4W9RA 4KDCA 4C7KA 4LG1A 5BQPA 3LC2O 2FQQA 4DMMA 1A96A 2Q7XA 1KP2A 3ITKA 1GKYA 5H1YA 3ZDRA 4MWDA 2R00A 2W43A 5JZBA 2CLHB 1Q2UA 1UJ6A 2AIRA 4OD0A 2V5UA 3S1AB 3UMJA 5A5EA 4DUPA 1M8KA 2GUWA 3THOA 1X13A 3KAJA 2UZIR 3I2IA 1SBTA 2YWDA 4GI7A 4LDNA 5AXCA 1YASA 1AXGA 2EZUA 3OPYI 4NPHA 5IMBA 4G0PA 3VVCA 1E2QA 2FZWA 4PNZA 5G0SA 3D8BA 3QLVC 3CUVA 1BHQ1 1QBGA 5EMNA 4E33A 5LFAA 4O6VA 4AJKA 3SI7A 5JD6A 3OE1A 1Q0QA 4DT1A 1O7JA 4A26A 3RU7A 1UDAA 5JCJA 2ETXA 1UF9A 1QHHA 1M5RA 2GAIA 2PSSA 2YVKA 4JBLA 4R84A 2FPGB 3U4HA 1IQPA 3QXSA 4P0QB 1TRKA 3MT9A 3RNLA 1NONA 2QRUA 4GMDA 4FMCF 2HPAA 4YGYA 2WI8A 2QTGA 5AOCA 3IUBA 4G81A 3KQKA 4RM2A 1W1UA 1RHUA 1CXZA 5KWSA 4WERA 2LCFA 1K8QA 1YULA 1NI4A 1EBUA 3HB4X 1O87A 1GSAA 1I80A 2NGRA 4DNOA 4WBNB 5BW4A 3ICVA 5K8CA 1JR3E 5TARA 3UMSA 4DL9A 3U60B 1FUUA 1HE5A 1YQDA 3FGOA 3RUIA 4IRMA 1NVAA 3H2YA 3QVKA 3TKYA 2WVHA 4BRUA 4DLLA 4C7JA 1AD2A 5TY0A 5ALEA 1JQLB 1SUDA 4Y2QA 3E9DA 2R87A 3BFPA 4MX8A 4ZP1A 4AG5A 5EN4A 2NXNA 3IR7A 3C3EA 4LECA 3CZ5A 4M8NE 4RGBA 5DVZA 1QGUA 3T5TA 4DQVA 2CJFA 4DR6B 2QLNA 4N47A 3SS8A 4MRMB 2ZDHA 4C1BA 2ZRNA 2XCOA 3JQ9A 4MS4B 1DGQA 4H6VA 2FWNA 4D56A 1WUKS 3RTGA 1KRHA 3UK7A 2R8BA 1DO2A 1W36D 2XR1A 2IKQA 3OY2A 4B45A 3P20A 4J1SA 4DZRA 1A0OA 4FT4A 3JVVA 1YDFA 1IJKA 4OXYA 3GFSA 4RHTA 4QRDA 4XD7D 2C4TA 5DM0A 2VHXA 5A05A 5CGZA 1JIVA 2Z2KA 1Z0SA 2KS6A 4HAOA 4DA6A 3H19A 3EVCA 1QK5A 1DIOB 1PO7A 1DV1A 1P1IA 1R0CA 1T3ZA 2WJPA 3PKJA 4YRDA 3TZHA 5AT1A 1UEJA 1S8NA 2DPXA 2NZWA 3GJ6A 2Q29A 4MKRA 4V0QA 4QNNA 3G6WA 1XLTC 2Z9DA 3O5AA 3ZI7A 5SYNA 2IS1A 2P9HA 3FSRA 4N6OA 2M6LA 1VHDA 4IL5A 4BFUA 3KG2A 2X40A 3UK2A 2O5CA 3ZZ0A 5KYYA 1R8SA 3RARA 2P6OA 2WMOB 2FZ4A 4ND4A 2QRZA 2N1BA 4XYLA 1ENPA 2QMYA 2QW8A 2G06A 4GXQA 4D3DA 1V37A 1VKOA 2OG2A 2YHIA 4X63A 1Z7YA 1DKOA 2Q4DA 5EJEA 1NWCA 4I4TF 3I30X 5MHTA 2D4AA 4HEA6 3O3MB 3O4RA 5LB4A 1WDMA 4P53A 3L4KA 3QIAA 1OAOC 3KOXA 9ATCA 1FS6A 3AR7A 3ZXXA 1Y7TA 2C2YA 2QUZA 5LYYA 4E5MA 4HH1A 3D3EA 2ZJ1A 4DB4A 3NX4A 3IEVA 1EE2A 3EBOA 4XUGB 3CRRA 4IHQA 3LDFA 5JNWA 3HKEA 2NQTA 5HJ2A 3KDPA 4X85A 5J4HA 3OQNA 1BWQA 1XZLA 2QRQA 1QHXA 1PQWA 1X7ZA 4L0MA 2I4MA 5IMSA 3LVQE 3SQXA 1UC4B 4MW7A 2C83A 3ZBTA 3DAFA 5F3DA 5LXTB 3OZAA 3TLMA 3DQZA 5FBQB 2PNJA 3FBTA 2O59A 1UBCA 4JI6B 4M0PA 1V4VA 2GTIA 3TD9A 1XZQA 2Y27A 4F8EA 5BSWA 4MGYR 4FGWA 4ID9A 4RH3A 3T4XA 1VCHA 3BMCA 4HR7A 4RA6A 4XIYA 3D2BA 1NUSA 2X9GA 1PZNA 4EM6A 1Y8AA 4F4IA 2H31A 4GT1A 2O5RA 1U1GA 4RQUA 1C9NA 1RQXA 2DR2A 3A8TA 3GVCA 4JB2A 4LWQA 2CDBA 1O0BA 3W79A 1F6DA 1RBQA 4HZUA 1VC2A 1GFZA 1TZBA 1Z15A 5KYWB 3MCTA 2PWYA 4CTNA 3OEED 3KDSE 4M0CA 5IUJC 2R85A 1EUCA 5AJZA 3ZE9A 1EXNA 1H8ED 5HIIA 2HR1A 1T4DA 4PVDA 4EA7A 1IATA 1RRPA 2NZYA 5JYEA 1J7KA 2AF3C 2C5FA 2AKEA 2VT3A 2FKAA 3B6KA 4YJGB 5G1OA 3ZJ4A 2G7ZA 3WHPA 4Z2AA 2RKOA 4UHKA 4KQ1A 3TFQA 1LK0A 3RODA 1JLLA 2ZSEA 3RRMA 1B73A 3WRYA 1FPQA 1EKXA 1ZL2A 4LVOA 4I46A 1JPVA 3OZIA 1PJ3A 3QVTA 4HRXA 4H3SA 5TF0A 2I03A 1U2PA 5IYZF 1KO1A 1U9YA 4FKZA 1M1XB 1T8UA 2KE5A 2VNAA 4Z0PA 1WUJS 2RHBA 5JANA 3IAUA 4PIPA 5TVGA 4MDEA 2BJVA 3JU3A 5T67A 4ODIA 2OFOA 1EUYA 3A1EA 3OLVA 4P92A 1RDFA 3GUYA 2A57A 1ZMRA 1B41A 1J8FA 5JQGF 1R37A 1EJ6A 3OP1A 2BGJA 3U48A 2ES4A 4JBGA 3N8NA 1O6ZA 2D0PB 2BSQA 1NT2A 5C8VA 2BFCB 1E99A 3RWBA 3EUEA 4RHUA 4KMOA 4R83A 4HWTA 2A7XA 2RAVA 2WJJA 1E18A 2Q5QA 5ITVA 1VSQA 5I9MA 4W8GA 3LTEA 5L45A 3EGEA 2Y76A 5KEIA 1NFFA 1IHDA 2E18A 3LJKA 4IQ8A 5FQOA 3SC2A 4QG3A 2CSXA 2X58A 3L7KA 3T5DA 4LUCA 4DT1B 2X0DA 2ASVA 1ORTA 4MI3A 2HBYA 4NHOA 1SCQA 4M1YA 2QK4A 5KYGA 1T2UA 1SCIA 5DLQC 2PKQO 4L4XA 2P7IA 3NHZA 4I50F 1CQJA 1SOWA 2AJLI 5EUQB 5KKCA 2D7JA 3OECA 1YMUA 2WMDA 3HCRA 4GBMA 4D9EA 1LPMA 5GIPE 4BN0A 3UPTA 2XRZA 1RRGA 5BNTA 1X3SA 5DT9A 1I33A 5CMLA 3VPAA 2EZ4A 1Y3CE 1Y5IA 4OHVA 2JF0A 2J5BA 1G5RA 2BBTA 2HPZA 3K4PA 4NCNA 1L7MA 3M8KA 5IK2A 4U7DA 3D02A 3RJ5A 4YRGA 3RBZA 1HRDA 2AUMA 3ZHUA 5JAIA 1MT0A 3PX3A 1Q0SA 3A2MA 2G76A 5C3UA 5K05A 5C31A 3RS9A 2GJKA 1YF3A 3KJZA 4PONA 4DCJA 1MOQA 3L07A 2WSMA 4IMRA 2G36A 4MQBA 1TE2A 3IUJA 3MIZA 2JZCA 1QC5A 3G7NA 3UMMA 1JAYA 2CLFB 3IPLA 3J7TA 2OM2A 5DX8A 3RWOA 3IOEA 3JV7A 3ILSA 4FOLA 4Q3BA 4AX4A 1V8PA 5AI9A 2O2JA 4U63A 4HN9A 4E12A 5C3MA 4B5LA 3B6MA 2ZE6A 2DAPA 4MA5A 1W4BA 3HP7A 3LLSA 2CK3A 3QLUA 1ZM4A 1K3UB 2IPMA 3A06A 4XOUA 3U2QA 4D82A 3PVZA 2PH5A 1JEQA 5SYAA 4ZVUA 3CN9A 3EX7C 3TZ6A 2X42A 3A70A 2XT6A 3MCAA 3NQ41 4TV9B 1RADA 2QWXA 3KJIA 4E31A 4YUYA 4RTNA 3WI7A 2XTMA 3TZLA 2QXYA 3OM0A 1JR6A 4MB0A 5JSFA 1Y81A 2EKDA 2MSKA 3PQ3A 3B3AA 3EW9A 4WJZA 3OEYA 3NANA 1P5FA 1Y6FA 1N0IA 3KYCA 4LJLA 3GL9A 1BVRA 4XUEA 2OYRA 1RKBA 3GDGA 5EFOA 1DBRA 1YV9A 4PEVA 3WGJA 1LI5A 2AOVA 5JWHA 3AF5A 1X74A 1ZD9A 2H1VA 4IUCS 4MYDA 1W34A 2H9IA 4J75A 1S8FA 3INYA 3OJOA 3CKLA 4ZV9A 1EEHA 2MINB 3ZQKA 1ZIXA 3HYTA 4AKSA 1B16A 5C8YB 1CC1S 4PAMA 4I3FA 3N2KA 4YV0A 5K0LA 1TAUA 3T7DA 3Q87B 1MRSA 1OKKD 4UZSA 1OWLA 5K8IA 2BC9A 3NBMA 3RKSA 3UB4A 1UKYA 1K3TA 1X86B 1X15A 4BNLA 2ZYRA 4FDMA 2IWRA 3THWB 1LD3A 3CINA 1Q0TA 3S8EA 1V2GA 2EBUA 2P77A 1MRNA 2ZP1A 2BKAA 2RGWA 4IQ4A 2JFQA 5G0UA 1ZWLA 4KHPB 2NP6A 3R2JA 2FPOA 1WPXA 1LBQA 3WJ1A 1LKZA 5A02A 2SKDA 5BV2P 4LJ8A 4I8IA 3I2GA 2GASA 2XEDA 3W5DA 4TMXA 1B00A 1CS0B 2AMVA 3ZCRA 3UFBA 3G7UA 4MTCA 4JQOA 4DM3A 3IVAA 2FQXA 1EFVA 4FUTA 4J7XA 4OREX 3BA6A 1XRJA 4OXRA 3S44A 1XTKA 1TM1E 1LVGA 2BFDB 1OAKA 4NU6A 5A62A 3BAFA 3ONNA 1QF7A 4JBHA 4B2LA 3DBLA 4H7DA 3EY4A 3EXHB 4FS3A 2PZ8A 3NDPA 1XI2A 4URFA 4HQLA 3ZG6A 1K98A 4CMKA 1CEYA 2H1HA 1D6MA 1PFVA 4IIGA 3FGZA 1XRPA 3KXLA 5FPYA 5KUTA 2AWOA 1EQAA 2UYQA 2FHPA 3N0RA 4MITA 4RXTA 1M1YE 5U4QA 4BO9A 1NW7A 4DIFA 1C3OA 3TDKA 5IT4A 3AEQB 3FR8A 3ZHOA 1L6IA 4QICA 5J47A 1DCMA 4DDUA 4MQ4A 1OGIA 4EUEA 5ESWA 3FHCB 1JP7A 5BURA 3W2EA 1JSXA 1MC1A 1P9RA 1W4CA 3I05A 2M2IA 2FP4A 3D4NA 3EE6A 3FFAA 1ICEA 4PYLA 4JGIA 1WB4A 2GFHA 3GIDA 3O93A 3RK0A 5JAUA 1MIOA 3UJBA 4QNRA 1SHKA 2BMVA 3QTTA 2IHTA 2J30A 2FEOA 1F17A 3T5AA 1JA1A 3VU3A 3PGA1 1PE0A 2ADMA 2WJIA 3REQA 3I76A 1RJDA 2UUCB 5JY6A 2QRLA 3N8DA 3I2JA 4AKGA 3EULA 2YQZA 1DU4A 1GL6A 1XTIA 1U3GA 2FEMA 2IYTA 2P9QA 2YXPX 2DJ5A 2XCUA 3TGWA 4PCVA 4C3VA 3BYZA 1HA3A 1VBMA 3JQEA 1UP6A 4XJSA 1GPDG 5CB0A 2PFGA 1S3SA 4WHMA 3I01A 5AI0A 4PLFA 1RXWA 1N77A 3RRNA 1Z74A 2FZVA 3A1CA 3WWCA 2QG9A 1C14A 4KRYA 4JXZA 3LZCA 4LJRA 4AECA 1XQ9A 4DQ0A 1VECA 1I6WA 3IAEA 3K0EA 2H1SA 1RXEA 4AS2A 1M34A 1FF9A 1E2UA