5H3QA

Crystal structure of trka kinase with ligand
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
312
structure length
302
Chain Sequence
SGLQGHIIENPQYFSDACVHHIKRRDIVLKWELGEGAFGKVFLAECHNKMLVAVKALKEARQDFQREAELLTMLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCLVGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKDVHARLQALAQAPPVYLDVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords High affinity nerve growth factor receptor
publication title The juxtamembrane region of TrkA kinase is critical for inhibitor selectivity
pubmed doi rcsb
source organism Homo sapiens
total genus 95
structure length 302
sequence length 312
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2016-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5h3qA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5h3qA01
2ZB1A 4O0YA 4QQ5A 5TKDA 5HLWA 3W8QA 5A9UA 4WBBB 2KTYA 3RP9A 5FM3A 4FTCA 3BHTA 4BIBA 1PMUA 4EHGA 5AFVA 2ZMDA 3C1XA 5E8XA 3OP5A 5AP0A 5H2UA 3FKLA 3AT2A 4DEEA 4QQTA 4GU9A 5I9WA 2YISA 4ZTRA 2BILB 4E4MA 1U46A 2YDKA 4CKRA 3PJ3A 1QPCA 4DA5A 2H8HA 4NWMA 2X81A 2W05A 3V6RA 3ANQA 3FMMA 2UZLA 4RJ4A 4TPTA 3C0IA 4XNEA 1UWHA 3W8LA 3KREA 2E9UA 4L6QA 2PVMA 4R5SA 4EOSA 3RGFA 5ETAA 2QOLA 4EYMA 4IZYA 2IZTA 1ZZ2A 4IWOA 4AA0A 4QYFA 3U87A 4X6QC 2F2UA 4RX9A 1TKIA 4RVLA 4ZS0A 1R39A 4E8AA 5HX6A 4EK5A 4QOXA 4YZDA 3PWYA 3BEGA 4ZTMA 2BUJA 2ITYA 5J1VA 3ORIA 3A60A 3QUEA 5CAVA 3MPTA 2O5KA 4PTGA 3O8TA 4CXAA 4U43A 2QG7A 5EKOA 2R3GA 2WIPA 4HPUE 2PULA 1IASA 3R73A 3GI3A 2YZAA 3QCSA 3D5XA 4UWBA 3FQEA 4R1YA 3RVGA 4AUAA 4L7SA 5HX8A 4DH5A 4WUAA 3LJ2A 4R1VA 3BELA 5BMSA 2C3JA 4IB0A 5EDPA 4EC9A 4PL3A 1VR2A 3FLSA 4HYHA 2WTKB 4QMSA 4J98A 1LEWA 1OIUA 5DMZA 4IM3A 4IFGA 4ONAA 1YQJA 2BIYA 5E1SA 3SW7A 3Q5ZA 5DEWA 3TN8A 4UBAA 1YHVA 4RZVA 3W2PA 4EHVA 4XOZA 3W18A 3L9LA 3S4QA 4DFUA 1R1WA 4LV5A 2ITNA 2W1FA 4K6ZA 4YTFA 4JG6A 2R3OA 3BKBA 3MIAA 4OTGA 4FKRA 4W4YA 4BKYA 1LPUA 4MXAA 4C3PA 1J3HA 4YLKA 3REPA 1VYWA 4O7TA 3QWKA 2V5QA 2YM6A 4WG3A 2QOBA 4E5BA 2O64A 3FQHA 3QZIA 3KMWA 4LOOA 4P2KA 1NW1A 3BYOA 3ZSGA 1QMZA 1PHKA 2EU9A 5DRDA 2W96B 3EZRA 3VIDA 2CKPA 3A7FA 2G2IA 4FTUA 5JGBA 1VEBA 4UEUA 2C68A 3OZ6A 3RINA 2XNMA 3FPQA 2YM4A 4BCKA 5DNRA 2P2HA 4NKSA 5JN2A 3E7VA 3DNDA 2OWBA 4FKOA 3QZHA 2PVLA 4F6UA 1IAJA 3Q04A 3D2IA 1U54A 3KXXA 4GCJA 4QTBA 4TNBA 1BYGA 4AZSA 4E6AA 4EZ7A 4GFGA 5A14A 2FSOX 3D4QA 3HP2A 5BVDA 1ZOGA 2B9HA 2XP2A 5DRBA 3P08A 4BDAA 1OECA 5I5ZA 2WPAA 3G9NA 3NUYA 5A6NA 3WE4A 4E5WA 2CLQA 4RVKA 4ACMA 3ALOA 3K5VA 1OBGA 3OVVA 4GU6A 5JZNA 3F88A 4GT4A 5KUPA 4IQ6A 4EOLA 3II5A 3RPVA 1KE8A 3DAJA 5M07A 3KCFA 4GG5A 3JR1A 5DR6A 4BZNA 1UKHA 3HL7A 2GNGA 2QOHA 2W06A 4OTRA 4GRBA 2G15A 1RW8A 3F61A 5J95A 3SC1A 3OCGA 1Z5MA 3OT3A 3H0YA 2VTPA 4FYNA 1REKA 4YLLA 5IEXA 3BGPA 3FZRA 3QUDA 3F5PA 4FYOA 5HE2A 4BWKA 2BR1A 2C5YA 1XJDA 4M3QA 4FNYA 2AC3A 5DI1A 4ZTLA 2C6IA 3NGAA 2IZSA 4D2WA 2FUMA 5AJQA 5I9UA 3WZEA 1FMOE 5G6VA 2VUWA 3W16A 2OIDA 3DKCA 2VTSA 4G3EA 4GIIA 2C69A 4FKTA 3AGLA 4O96A 4AW0A 4BB4A 4S31A 5EYKA 1YWRA 4M69A 5A4CA 4FTRA 5AV3A 5IQGA 3EQHA 3I6WA 5GINE 3BCEA 3EQBA 5IA0A 4EH3A 5EQYA 4I5CA 4IVCA 2W9FB 5JT2A 1YI6A 5BVWA 2PZIA 2BPMA 3KXNA 4J8NA 4LL5A 2GS6A 3DKGA 4LRJA 5H8EA 5CU0A 3ZOSA 2Z02A 2YDIA 3FMLA 1Q8ZA 2C4GA 3C7QA 5HLNA 5IEYA 3OUKA 4Z55A 3O7LB 5C8NA 4B8MA 2PY3A 3I1AA 3LHJA 4EOJA 3VS0A 3WIGA 3WARA 1VYZA 3PVBA 3V8TA 4H3BA 5AAEA 1Q24A 4C4IA 2PL0A 4CMTA 2C6OA 4A4LA 1OITA 4GV1A 3QFVA 5KMKA 4UMRA 3NW5A 2VRXA 1Y8YA 4IE9A 5DOSA 2C6TA 5AR4A 3Q9YA 1YHSA 3QRIA 4I5PA 4BCQA 5D10A 5FTOA 3E64A 3NUAA 3AD4A 1KSWA 3PYYA 2CMWA 2IVVA 3T3UA 4BDKA 1M52A 3IGGA 4KIPA 5AV0A 3Q2MA 1W84A 5L6OA 3V01A 4DT9A 2R9SA 4OR5A 2ITUA 5D11A 5KNJA 3NIZA 3EMGA 2V7OA 3NEWA 2O63A 4H3PA 3CD8A 2PUUA 4BTFA 2R3QA 1ZLTA 3PSBA 4Y8DA 4WT6A 4X6RA 3R01A 5HU9A 3Q4ZA 2WMRA 2O65A 2VU3A 3QHRA 5H8BA 3R2YA 4ZMEA 1SNUA 3CR0A 3RCDA 2W4JA 3TI1A 4RX8A 4IVBA 2WEIA 3I79A 5CX9A 4XG2A 3R21A 2QHMA 1HCLA 3FI3A 2EB3A 2QURA 3CXWA 5I3OA 4AE9A 5KMOA 5HIBA 2WMAA 2WQNA 3FZPA 2OJ9A 1Y6AA 5HKMA 4CZUA 4D2RA 4K8AA 4RT7A 4CQEA 3P78A 1WZYA 4L8MA 2XBAA 3LCOA 3SKCA 4LI5A 3C5UA 4RIXA 4JQ7A 1ZMUA 5EH0A 4BBEA 4FODA 1FQ1B 3EL8A 4KS8A 4EHZA 3E8NA 2Z2WA 3R7GA 3ZBFA 4YHJA 4GS6A 5DN3A 4OBQA 4BIDA 3Q32A 5JFXA 5KBQA 4CD0A 4FKWA 2PVYA 2PVKA 3TM0A 5C27A 5E8UA 3R7IA 5LMKC 3CKWA 2BRHA 3FC1X 4XHKB 4D4SA 4DEIA 3DTCA 4EOKA 4CG9A 4BF2A 2V7AA 4BRXA 3FAAA 5BVEA 1JKLA 1TQPA 4RIYB 4E1ZA 4AE6A 4J96A 2OZAB 3RM6A 5FQDC 5JKGA 2C1AA 2HK5A 4C61A 2XCKA 2YM3A 5AUTA 5M4IA 3OF0A 3PA4A 5FRIA 4H1MA 4L67A 4O82A 1ZMWA 1YOJA 2OO8X 4XUFA 2CDZA 4G6OA 4ZY6A 4J97A 1ZRZA 2JKKA 4IAFA 3GB2A 5B7VA 4CTCA 1JKTA 3PE2A 3SV0A 4AQCA 5AAFA 5B2LA 2Y4PA 4N70A 4PP9A 2YITA 4ENXA 1UA2A 4M14A 4AGWA 4ANQA 3LFAA 2PUNA 4DBNA 3PPZA 1OGUA 3UJGA 2NO3A 4FEXA 2NRUA 4IX4A 3COMA 1FVVA 3BGQA 3CGFA 5L4QA 3VVHA 4C58A 3U9CA 4YJSA 3TDVA 5JQ5A 2UUEA 2IPXA 2X4ZA 3BV2A 1NVQA 3QTQA 4DEBA 4DEGA 3PXRA 4FZ7A 5AADA 4NUSA 4CEGA 4OBPA 3TNWA 4D2SA 3D7ZA 3A2CA 1SVHA 4YMJA 3BX5A 3C4EA 2O2UA 4NFMA 1BL6A 3E88A 1IA8A 4EWQA 1MUOA 3G90X 4L46A 4BDCA 4CLJA 4ZLYA 3I6UA 5M44A 1OPJA 2ONLC 3R9NA 3ZUUA 4IJ9A 1FVRA 2H9VA 2OZOA 4F6SA 5CVFA 5TE0A 3VF8A 5IEVA 1JSVA 5CXHA 1JNKA 3QALE 4DCEA 4RIOA 4GVAA 4TYIA 4DG3E 4F7NA 2ZDTA 4ITIA 1BLXA 4LGDA 2GS7A 2H96A 2C5OA 3SA0A 2RIOA 2DWBA 4O6LA 3DJ6A 3OHTA 3QA0A 3VJOA 5CASA 5I9XA 4BFMA 4FSYA 5C26A 3D5UA 3OG7A 3RBWA 4O38A 1M2PA 3EZVA 3SRVB 4FIGA 4W4VA 4ANLA 4F0GA 4FTQA 4MXYA 3LZBA 5IQBA 3C0HA 3E3BX 3K2LA 4GIHA 3ZRLA 1O9UA 4IM0A 3EQFA 1RDQE 3NUXA 3MPAA 4CVAA 2B55A 3H9FA 2FSLX 3HV5A 5L8JA 2F7ZE 2FSMX 5IZFA 4YPDA 3F6XA 2GQRA 4IZ5A 4WBOA 5IA5A 3VC4A 3V5JA 3AGMA 2CCIA 3GC0A 3PE1A 3PIXA 3QRJA 4FK3A 1BI7A 3D94A 4M8TA 3RAHA 4C4FA 3CSVA 3OXTA 3Q3BA 5AMNA 3FLQA 4DFNA 4ZLOA 2R3LA 2JKOA 1OL1A 5IISA 3OWPA 4FI1A 4DLIA 4HW7A 3H3CA 2XEYA 5AUUA 2WU7A 3LFBA 3PXFA 3QQJA 4X3JA 2J50A 3TTJA 4G3GA 3LE6A 4XG4A 4ZP5A 4OAVB 4C57A 2WOUA 3LXKA 3NYOA 2CHLA 5C4KA 5JFVA 4Q5HA 3OCTA 5ITAA 4OTPA 1W8CA 4QMOA 3N4VA 5EHYA 5JMSA 5IDNA 2JBPA 5HTBA 1L8TA 2XIXA 2XZSA 3C13A 3Q52A 4NU1A 4O2ZA 4IWPA 3RZFA 3KRXA 1XH7A 4D9TA 2WTCA 3OCSA 4OTDA 3OS3A 3LCKA 4E7WA 3BYSA 3ZEWA 3AG9A 4FL1A 3BI6A 5BPYA 2CNUA 2Z7RA 4MK0A 3CKXA 3PVGA 5CYIA 2R7IA 3CTJA 3PJ2A 4M67A 5AP5A 3RAKA 4DG0E 4NM7A 4GH2A 3V3VA 2UW7A 3AXWA 1PXNA 4RIYA 5B2KA 4A06A 1JQHA 5JZJA 3DBFA 4BCNA 1TQMA 4TRLA 2OU7A 5HQ0A 5LJJA 4EORA 1CMKE 2VAGA 5EOBA 4QNYA 3PIZA 3RAWA 4FT7A 2UVYA 2W1HA 2P0CA 3RPSA 3AMAA 3PRFA 1XBCA 2VTNA 5LCKA 4HGTA 3OWLA 3WF7A 3FZTA 2F4JA 3LXNA 4BDGA 3HECA 4CMOA 1RJBA 2WMWA 3KRLA 4G2FA 3S95A 5DWRA 1PXIA 5HO8A 5CSHA 2P2IA 4IAKA 4E6DA 4JQEA 5DIAA 2R7BA 3VULA 3NDMA 5HTCA 2UW6A 3LFCA 1WCCA 3HP5A 4CKJA 3ORNA 3ZXZA 2PHKA 5HD4A 1R78A 2YM5A 4HGSA 3ERKA 4I24A 1OUYA 4EH4A 4QQJA 3KMMA 1FGIA 2XJ2A 1YDRE 4CYIA 4IAYA 5CNNA 5DEYA 3PIYA 3VQHA 4A9UA 1B39A 3GOPA 3FYKX 3H10A 4RIWB 4JL9A 3DQWA 3ORXA 4I93A 2W1EA 4D0WA 3TV6A 2V0DA 2QOOA 4QRCA 4FTAA 4EKKA 3G0EA 3IW7A 4H1JA 4FIIA 5FDPA 3QUPA 4O21A 4YTIA 2G9XA 2XK4A 2ZYBA 4FKPA 4NT4A 3TNHA 3TV4A 4Z7HA 3QQHA 3W2QA 4ZOGA 1YXTA 3O96A 4QYEA 4CTBA 1OIRA 5IUHA 3POZA 2W7XA 5AIRA 3IO7A 4ZSGA 3R9OA 3SQQA 3VBQA 4JDKA 4BDHA 5IQDA 4WG5A 3W32A 5C8KA 2B9JA 3NCGA 3RPOA 2BAKA 1Q41A 2XNPA 5AUWA 5FTGA 1PKDA 5L2IA 3AD5A 5KKRB 4RVTA 1H0VA 2Y0AA 1M2QA 4JG7A 4UXQA 2BKZA 4XH6A 4GYGA 3KN5A 3UP2A 4YHTA 3AC5A 1ZAOA 3MA3A 1NY3A 1PXPA 3VHEA 2OJIA 3ACJA 2XKFA 3SRVA 4Z3VA 2CGWA 2YJSA 4L43A 3IK3A 2WQMA 3LQ3A 2BKKA 2ZM4A 5D1JA 5EI2A 4UV0A 4ACGA 4MHAA 4ZTSA 3RHKA 3MYGA 4DEDA 3PVUA 1H1QA 4MXXA 2KULA 5D41A 3W2RA 4I92A 4AA4A 2XK7A 3VS6A 3KEXA 4FSUA 2B4SB 3BPRA 3RNIA 4GJ2A 3VNTA 5HCZA 2HZIA 4DFZE 4JRNA 3EH9A 3KFAA 3OFMA 2YAAA 1H27A 3DA6A 3BGZA 2V22A 5CT0A 1BUHA 3CTQA 2RFSA 2Z60A 3I7CA 4O0XA 2LGCA 1R0PA 4WRSA 4E4LA 1OKZA 4E4NA 1JKKA 4F65A 5J79A 4I6FA 1JAMA 3AC2A 4AN2A 2X39A 4Y46A 3D7TB 3LM5A 4FV8A 4CLIA 4A9TA 4XBUA 5AV4A 3ROCA 1APME 5E9EA 4QTDA 4AZWA 4DCAA 4FSNA 3QGWA 4O6EA 4D1XA 4FTOA 1HOWA 1JBPE 1WVYA 3AC8A 5GJDA 5GZ8A 4FV4A 4YJRA 2WEVA 2PE0A 3CBLA 3UODA 3UOHA 5LVMA 3PY1A 1Q3WA 1ZY4A 1GNGA 2BROA 3O7LD 3HRFA 3E62A 3P0MA 4L3LA 1JOWB 2BDJA 5I4NA 1EH4A 5KZIA 3FL5A 4S2ZA 5TF9A 2VTAA 5DG5A 1QPJA 5EW8A 4O0TA 1ATPE 2YACA 3D83A 5F95A 4FSRA 5IMXA 2VWUA 1Q62A 4D28A 4YU2A 1PMEA 3MV5A 4E73A 4KIQA 5AUXA 4D58A 2UW4A 5A54A 1YWNA 1XO2B 1H1WA 3D15A 2C47A 1O6KA 2XA4A 3UQCA 2IZRA 2X0GA 2XYUA 3RNYA 2X9FA 3W33A 4Y83A 4F1MA 3RK5A 3O2MA 3F2NA 3PXZA 4R7HA 4X2NA 4KSPA 3D0EA 4C02A 4BN1A 1AGWA 2YCQA 2BAJA 1WFCA 4JXFA 4DTAA 1NVRA 1M17A 2VTHA 3M11A 4NL0A 5KBRA 3WE8A 3UO4A 1GIJA 2I0HA 2CNQA 4S33A 2IVTA 3ORZA 3CIKA 5JRSA 3E7OA 5KO1A 4EOOA 3SD0A 1ZY5A 3QL8A 2YABA 3E8CA 4FNZA 3FZSA 2W5HA 3P5KA 3ZO4A 3SG9A 4G5JA 2XNNA 3MJ1A 4LYNA 3BV3A 4X2JA 4GVJA 2UW9A 5B0XA 3KK8A 5CY3A 1Q8YA 2C3LA 1OL7A 4FX3A 4J95A 2RF9A 3ZONA 4X3FB 3ZCLA 2JGZA 4F63A 3HMOA 5CSXA 4RFZA 5AUVA 4ARKA 3R8MA 3PSCA 4WG4A 3HMPA 2OF2A 2VWBA 3RAIA 5IQAA 3WZJA 3VS4A 4OLIA 5LXMA 4OT6A 3H9OA 1URCA 5G1XA 5HVKA 3QRUA 4G34A 4E3CA 5A4EA 2BMCA 4QMQA 4MH7A 3R83A 2B1PA 4BC6A 3F2RA 4UALA 4O91A 3EOCA 5I9VA 1W83A 4N57A 5DR2A 3VUIA 2ESMA 2ZV9A 4I41A 4CG8A 4FSTA 3HZTA 3IECA 1H8FA 3K3IA 4QYYA 4IDTA 5AIKA 3D14A 3FSKA 3TKUA 3TJDA 2NNWB 1PF8A 2Z7QA 2Y7JA 2ITTA 4JBVA 3A7HA 1UNHA 3GFEA 4O2PA 4AACA 2CLXA 3HV7A 4H36A 3THBA 3OD6X 5EM8A 4GUEA 4MNEB 3I5ZA 4CRSA 1DI9A 2QG5A 5I9YA 2W1GA 5AAGA 3TKIA 3EQRA 4XRLA 2SRCA 4FGRA 3JY0A 4NZWB 5E91A 3V8SA 3KN6A 1KE9A 3DCVA 2QVSE 4RG0A 4ZZOA 2J0LA 5CAQA 3FHIA 2YEXA 4YNEA 1MRVA 4BDDA 4M15A 4BGHA 4EC8A 3DFAA 3QD2B 1K9AA 4ZEGA 3GCPA 1GY3A 3K5UA 2BZIB 3NWWA 2GNFA 3G9LX 1URWA 4TYHB 3VHKA 4FTKA 5DVRA 3FBVA 3R9DA 4D2PA 2BRBA 4FTLA 5FTQA 2BTRA 4BZDA 4DGOA 2P4IA 2ACXA 3OW3A 5HOAA 1XBBA 3RWPA 3UZPA 5IU2A 4UMTA 5LVOA 4FEUA 1SNXA 3ORPA 2X4FA 1PRYA 4GK4A 1CTPE 3AC4A 4EK8A 3BLQA 3QXPA 5HG7A 2EUFB 4IAIA 3RI1A 3ZU7A 2XYNA 5BVKA 2VWXA 4LL0A 4R6VA 4Y5QA 5TO8A 3F7ZA 4D5HA 2ZDUA 2JDVA 3NPCA 1FBNA 4QMYA 4KA3A 3R8LA 4YNOA 3QYZA 3UOLA 2EB2A 3BIZA 1CKIA 1H07A 3U4UA 4ACHA 5M55A 3DFCB 4KABA 5M4UA 3FZ1A 3A7JA 4M0YA 3LKMA 4HCUA 4DGLC 4JOAA 4GK3A 5HE3A 2XRWA 1IRKA 3TZMA 2V55A 2PU8A 1WBTA 4NJDA 3HAMA 1UNGA 2PMNX 1OI9A 2R3IA 3NYVA 2UVXA 3HDMA 4QTAA 4M13A 4EEVA 5JFSA 4GK2A 3EKNA 2GU8A 4WSQA 4D1SA 2X2MA 1Q97A 4ORKA 2QC6A 4AFJA 5ANKA 5AP1A 1WMKA 5M53A 4OUCA 4NSTA 1P5EA 3M42A 4F7JA 1Q61A 3KU2A 5AP2A 4TTHB 5AR7A 5L6WL 2BDFA 5T6KA 2ZB0A 2E9PA 4IX5A 1W7HA 2OKRA 3LFSA 4RZWA 3UC3A 4GKHA 3UQFA 4YZCA 2PVHA 4YUQA 2WOTA 3FQSA 4FIFA 5CSWA 3OWKA 3ZLXA 2ITOA 2VTLA 4DTBA 5JEBA 3F9NA 4U3YA 3EQDA 2W1ZA 3EN7A 4K33A 4TNDA 4PNKA 4AZVA 1XH9A 3ZSHA 4I4FA 5LMAA 4BYIA 4FZAB 5HBEA 5J87A 4KIOA 5GJGA 4QD6A 1KV2A 3R0TA 4IANA 4PMSA 4AZEA 1XH8A 3PPJA 3QCXA 2QU6A 3OOGA 4ZIMA 1Q5KA 5E8SA 3NYXA 4EONA 2RSVA 1F3MC 4WD5A 1BI8A 2CKEA 4A4OA 3ID6C 4A4XA 2ZOQA 3CP9A 2G01A 3ZS5A 4EUUA 2QHNA 4K1BA 2WHBA 2JBOA 3NUSA 4XG7A 3CS9A 2R4BA 5AUZA 4C4GA 4ERWA 5C01A 3RMFA 3FL4A 3OXIA 4IFCA 5JK3A 4C59A 4L42A 1IR3A 3P79A 4BWPA 3UPZA 3TZ9A 1H00A 3TNQB 4LV8A 3A4OX 2ZJWA 3VS5A 3RALA 1PW2A 2Q0NA 2P55A 2VN9A 1XKKA 2VX1A 2X7GA 1DAWA 1NT2A 2ETKA 4A9SA 4XV3A 3VS7A 4CV8A 1DM2A 2JAMA 4GJ3A 4B6LA 3NIEA 2WQEA 5IQIA 2X8EA 3AOXA 3KF7A 2VTOA 4GT5A 1ZOHA 4F08A 3PZEA 3QF9A 4CFFA 2PZ5A 4ERKA 4I3ZA 3E3PA 3Q6WA 4RRVA 4U9AA 3TL8A 3AD6A 3LLTA 1ZWSA 4U40A 3U4WA 1WBPA 4FMQA 3RWQA 5AX9A 4HYUA 2YFXA 3HRBA 3GEQA 3I7BA 2W1IA 3EN5A 3OUNB 2BTSA 3DNEA 4FV6A 5AM7A 2VO3A 2CCHA 4L68A 5HE0A 4MX9A 5BYYA 4Q2AA 4LOQA 3QCQA 4XCUA 5CALA 1E1XA 3CLYA 4XG6A 2E2BA 3KXHA 3M1SA 4LOPA 4AS0A 4KBAA 1QPDA 2BVAA 2CKQA 2B7AA 4IZ7A 5K9IA 5CNOA 3VBWA 2QKWB 4E93A 4Y5HA 3JS2A 4EK6A 5M08A 3F3UA 4IWQA 5J9LA 3O71A 5AP3A 4TZRA 2UW5A 1P2AA 2HWOA 3O23A 4BTMA 5IQCA 3UP7A 5CSPA 2JEDA 5FEQA 3TCPA 5FG8A 2VTMA 3FY0A 4QP4A 3SAYA 3PJ8A 1OPLA 5CTPA 3TEIA 1J1CA 3VUKA 4CSVA 5H3QA 4DINA 4E6QA 3CQEA 3OC1A 3G5DA 3SXFA 2FA2A 2DYLA 3BHVA 3IONA 4MTAA 5K5XA 1J91A 3B2WA 5CF5A 1M14A 2JITA 3EQCA 1OL6A 2CN8A 4BI2A 5J7BA 2CSNA 4UN0C 2O0UA 5GIOE 4G17A 3FE3A 3LJ0A 4LQMA 4ZTHA 4IB3A 3IW6A 5CEIA 4Y95A 2ETMA 1W98A 4ZS4A 2UZBA 4BVUA 4DEAA 2VO7A 3A4PA 1FGKA 3M2WA 1YXSA 3CY3A 4FEVA 4Q5EA 4L53A 2XIYA 2C1BA 4GEOA 2R3NA 3PFQA 1V0BA 4RQVA 2Y9QA 1YDSE 3QQGA 4HVDA 1WAKA 5CEPA 2WTWA 4GFOA 5FUTA 1UVRA 3T3VA 4I0SA 5M56A 3DGKA 3NVMB 3G0FA 2OF4A 4L3JA 3R7OA 4BDIA 3MGYA 4P4CA 3O8UA 5AP6A 5ICPA 1MRYA 4IVDA 4JJRA 2Z7LA 4PX6A 4AP7A 2RGPA 5JSMA 3WYYA 2UZEA 2Y4IC 2QR7A 4HJOA 4UY9A 4ZTNA 2R5TA 3U6JA 3DZQA 1MQBA 2XH5A 3LFEA 1KE7A 1PXOA 5CZHA 4FUYA 4M84A 5LVLA 1NVSA 4EH9A 4HVHA 4NIFB 1KUTA 2P33A 2HENA 2VV9A 3GFWA 4D2VA 4GYIA 1P14A 2B9IA 3U54A 2VTJA 3HMNA 5HBHA 3K3JA 3V5LA 2HY0A 2I6LA 2UV2A 5HIDA 4E6CA 3ETAA 1XR1A 2WMSA 1ND4A 4RLKA 2BZJA 3KULB 4ZSLA 2YCSA 3LCSA 3HLLA 4KIKB 4FUXA 3MH2A 2YWPA 3KA0A 4KRCA 4YZNA 5DLSA 4AW2A 2WXVA 4G31A 3R1QA 2PMLX 3BRBA 4ACDA 4QMNA 1JPAA 4U6RA 4ALVA 1IEPA 3DB6A 4C33A 4F9BA 5HGIA 4XBRA 2QI8A 5EW9A 2NPQA 3CJGA 5GHVA 2BIKB 3GQIA 1HCKA 2F7XE 3MY1A 1GIHA 3A7IA 4NFNA 4ANBA 2GQGA 5M57A 2C0OA 3LFQA 5BVFA 3F2AA 2IZUA 4GT3A 4C4EA 5AA8A 4I0RA 5K4IA 1IAHA 4DTKA 3ZEPA 3TT0A 4JDJA 3FY2A 3R22A 2Z8CA 2OFVA 4I20A 3D5WA 3R1YA 3UQGA 5KX8A 5AEPA 5IQFA 1RQQA 4MQ2A 3ZM4A 4QTEA 4CFVA 4I1ZA 3DXPA 4PV0A 4G9CA 3CPBA 4LRKA 3JXWA 5BUJA 3O51A 3QKLA 2C6LA 2GNLA 5HVYA 4C37A 2YLEA 4QP7A 3L8XA 1U5QA 2X8IA 4K18A 3C5IA 2J2IB 4H3QA 2YJRA 2UZDA 4G16A 2J5EA 5CI7A 2XM8A 4PPAA 4FKSA 4FL3A 1OL2A 3DBQA 3MFTA 4EKLA 1Y6BA 3F3WA 3WILA 5K5NA 4AX8A 3NVKI 4UYAA 2FVDA 3BYMA 3B8RA 2NP8A 2WTDA 3IOPA 4RMZA 5L3AA 4UZDA 3ZFMA 5LCJA 1NA7A 3I81A 5D7AA 2X8DA 5B2MA 5FBNC 3CC6A 2H6DA 1YI4A 3A7GA 4NEUA 3MPMA 4FV0A 3A61A 3GBZA 3PLAE 2X1NA 2IN6A 3DB8A 4JBQA 4K0YA 3KGAA 3MY0A 3QD3A 2ITWA 5HESA 3SOAA 5L2TA 2HOGA 4J99A 2HY81 3TKHA 3DAEA 2YZLA 4MD9E 3OTVA 4IHPA 5CU4A 4APPA 4ASDA 1YXUA 4X2GA 2W5AA 5CI6A 3W2OA 1NXKA 3HMIA 3GC7A 3IDBA 4AOIA 4C3RA 3R1SA 4QT1A 5KHXA 3D2KA 2BRGA 4QP6A 4A9RA 4D4RA 4JVGA 5E7RA 1KOAA 2VWWA 5DA3A 2G2FA 4IJPA 3UBDA 3ENMA 4JIAA 5ANOA 4YC6A 3VO3A 4DHFA 3DDPA 4GG7A 4LMUA 4YSMA 3NW6A 4EOMA 2YERA 4KUJA 2OIBA 4MXOA 3BLRA 4FV5A 4UWYA 4B4LA 4RFMA 3PY3A 1UV5A 5JRQA 4CCBA 2J9MA 4RWKA 3MN3A 3OROA 4WNOA 1U5RA 2UW3A 5LWMA 4MD7E 3DZOA 3TDWA 2XB7A 2HW7A 2QLUA 5CU3A 2XNOA 5CVHA 1YKRA 3N4TA 3LMHA 4C4JA 4GW8A 4JQ8A 4QP1A 2J0IA 3NNWA 4NIFA 4ZZNA 1REJA 3OTUA 4BDBA 5HNBA 2XIKA 5AR2A 4MBJA 2HZ4A 4U5JA 3PSDA 3V5WA 5LVPA 3PDTA 4AAAA 4IX6A 1IA9A 4Y85A 4BHNA 5F9EA 5LARA 2CGUA 2C0TA 4EUTA 3IDPA 2VWZA 3VQUA 2HIWA 3I0QA 3IGOA 4NJ3A 5GIPE 1Q8WA 3Q2JA 4PDOA 3AC3A 4A7CA 5IH5A 4LGGA 4L52A 4BCOA 2YDJA 3O0GA 3QTIA 3P4KA 2PVJA 2YHVA 3HA6A 5HZNA 3R2BA 3EQPA 4YURA 2I0YA 5I0BA 3ACKA 4DH8A 4XP0A 5CZIA 3HUCA 4ASXA 4EH2A 3DU8A 3ET7A 3GCSA 4V0GB 4X0MA 3SXSA 4PY1A 4AT4A 2V62A 4YJUA 3IW8A 4FIHA 3DK7A 3Q9XA 3UG2A 1WBVA 3ZRMA 3KC3A 3LFFA 3SLSA 4AN3A 3IS5A 3DKFA 1MP8A 2AUHA 2F2CB 3LVPA 3HKOA 1T45A 5CEQA 3ZUVA 3FMEA 2VX0A 3EN4A 3E93A 1BKXA 3EN9A 4QPSA 3R7EA 2CN5A 3UMXA 3W10A 2GNJA 1F0QA 4N0SA 2XCHA 2E9VA 5LMKA 5CENA 1AD5A 2IVSA 3KRJA 3UNZA 5KMMA 4FEWA 3L1SA 3Q5IA 4FOCA 5CU2A 2C5VA 3LW0A 5HICA 4ANNA 5IUIA 4UYNA 4YC8A 4KS7A 2Q83A 3CGOA 2OJGA 4FTJA 3PXKA 4V05A 1BX6A 4CYJA 5CS6A 3NYNA 4BIEA 5EDQA 3P7AA 3TIYA 5FEEA 3MBLA 4EQCA 3CE3A 2IG7A 2PZRA 3ZZWA 5EM7A 4LFIA 3MY5A 4U44A 2OZAA 5H8GA 3HX4A 3Q4TA 4CKIA 1YW2A 3R04A 5DFPA 4X21A 4Z9LA 5IH4A 5E92A 1SYKA 1ZYSA 3QGYA 3C4XA 4KB8A 2ERZE 3VUTA 2NRYA 4QMZA 1R3CA 3L8SA 4FKIA 4D4YA 2VTIA 4R3CA 1OIYA 3BHYA 2FH9A 4EL9A 5BNJA 1ZYDA 3U6IA 4QP8A 4CMUA 3JVSA 3GC9A 4FZFB 3TACA 4U81A 4BWXA 5HU3A 4RJ7A 3WZDA 2CPKE 3UZRA 1SMHA 4ZSJA 1Y8GA 3P9JA 3LXPA 4DN5A 4WSYA 2QOIA 1UU8A 2W99B 4XG9A 4FG9A 3A8XA 5FLFA 1FINA 5BUEA 2GNIA 2EXEA 3C51A 5AP7A 4I5HA 4AOTA 3NNXA 2WTVA 4DGNA 4C3FA 4O7ZA 3GU6A 1F5QA 4M68A 4YZBA 4I4EA 3AT4A 3FEGA 1JKSA 4ANOA 4ZMFA 4QMVA 4DH1A 5CANA 1OKYA 2ONLA 4C7TA 4KINA 2WB8A 3K54A 4RJ8A 4D5KA 5IPJA 2HXLA 1OBDA 5D9HA 4OT5A 3NNVA 4NCTC 4W9WA 2UW8A 2QKRA 3DLZA 1OKWA 1KOBA 3ODYX 4FT5A 1ZZLA 3TUBA 3MJ2A 5C9CA 3ZFXA 3C9WA 3MVJA 4YZMA 1E9HA 3ORMA 4AWIA 4AG8A 4J71A 4W4XA 4PDSA 4X2KA 3E8EA 4JLCA 1M7QA 5EM6A 1FMKA 5L8LA 3ITZA 5HCYA 2UZUE 2ZAZA 3QQKA 4YC3A 3PTGA 1LUFA 4BCFA 3NR9A 1K3AA 3OBJA 3UIMA 2VX3A 4F70A 3EFKA 2Z7SA 3QRTA 2G1TA 3HV3A 5J9YA 3MVLA 1SM2A 4H39A 3KL8A 3MA6A 3FYJX 3C4FA 1STCE 2FB8A 3R71A 1JWHA 3BBWA 4FTNA 2O8YA 3W55A 4CFNA 3BYUA 4AF3A 4WNMA 4YJQA 2VTTA 2F7EE 3QRKA 2QONA 4Q9ZA 1OPKA 5J5SA 4MF1A 3MH3A 3VWAA 3BYVA 3ZDUA 3V6SA 5IDPA 2A27A 3ZM9A 3QC4A 4MEDA 4O0VA 3ZUTA 5BMMA 4ZTQA 4XP3A 4MF0A 4V0GA 4ANMA 4F4PA 2B53A 3HA8A 4IBMA 5E4HA 5J9ZA 3R30A 5L8KA 4JBOA 4E4XA 4FZDB 2B0QA 1LP4A 1OM1A 4PMTA 3FMJA 3ZHPC 1M7NA 5M51A 2C5XA 2X2KA 4JAIA 3EHAA 4BGGA 4QMTA 3CPCA 4D9UA 4OTHA 3BLHA 2YWVA 2WTJA 4PRJA 4F09A 5EHOA 4B7TA 1FOTA 5ETIA 4MVFA 2CKOA 3VBYA 3SG8A 2QO2A 4PPCA 3EYGA 1R0EA 3VS2A 5HHWA 2PUIA 1Q99A 3W2CA 3BBTB 3RM7A 5JQ8A 5T68A 3MIYA 1WBSA 4YR8A 3ATTA 4RC3A 3MTLA 1JVPP 3B2TA 4FICA 3WZKA 3ATSA 3LFDA 2BRNA 3FXXA 2QO7A 4O1OA 4FTMA 4JBPA 4MD8E 3FI2A 2OFUA 3VBVA 2XKEA 4O7SA 2C6MA 2C3KA 4U7ZA 5CQWA 2QOQA 2JAVA 5K0KA 4LGHA 2R0IA 4DFLA 2IJMA 3HDNA 4O81A 4F9AA 1Q8UA 3KKVA 2JDTA 3VRYA 4TKSA 2J5FA 5HVJA 4FV1A 5IA2A 5EQEA 5HD7A 3RPYA 1MRUA 3CTHA 4L45A 4O0SA 5FBOA 4EH7A 2YIYA 4RWLA 4AFEA 5HBJA 2J90A 3BHHA 1GOLA 3BQRA 2HW6A 2QOKA 4QP9A 3RZBA 3FI8A 1H1RA 5ACBC 3WOWA 4ZY4A 5LWNA 3EFWA 2W0JA 4IIRA 3OWJA 4HGEA 4YBKA 4O7VA 2BHHA 5EYDA 3QAME 2X6DA 3GU7A 2QD9A 2R3FA 1GIIA 4NYEA 4DT8A 3OT8A 3TTIA 3COIA 4O0UA 2FYSA 3AMYA 1BL7A 4B99A 4O83A 3BE9A 3SXRA 4RIWA 3FMNA 3Q9ZA 3NX8A 4ITHA 3UVPA 2R64A 4BTKA 4BICA 3HGKA 4KBCA 3BU3A 5IQHA 3HV4A 5ANEA 1WVWA 2EWAA 5AM6A 3NUNA 4TY1A 2A0CX 3SVVA 4AU8A 4EOQA 5A4QA 2RG6A 3R63A 4P7EA 3MESA 5GJFA 4RX5A 2PSQA 4F1TA 1YI3A 1XH5A 2XNGA 2WAJA 3L9MA 4W4WA 1UU3A 4YBJA 3H30A 2WNTA 4AZFA 4O0RA 4RC2A 4G3CA 5BYLA 3KMUA 2WMQA 2PTKA 2ITQA 2W1CA 2ITPA 1YHWA 5DT4A 4NKAA 3ZDIA 1PY5A 2BAQA 3HUBA 5E90A 2CJMA 5FWKK 1DI8A 3UYTA 5M4FA 3GGFA 2X9EA 4XLIA 1H1SA 4BBFA 1H24A 3FUPA 5GZ9A 1UKIA 3ZRKA 4D1ZA 4KKGA 4F9CA 3VRZA 4EHEA 4AGCA 4FT0A 4YTCA 4FT3A 4RA5A 5CF8A 4ZSAA 4M7IA 3S3IA 4QTCA 5EDRA 2F57A 1Y91A 2PVFA 3V8WA 3ZFYA 4PPBA 3IDCA 4F1OA 4CV9A 3GU8A 2ZV7A 4PDPA 2XRUA 4I6HA 1GZKA 1A48A 3KRRA 4I94A 2ZV2A 3WF8A 2OBJA 4XYFA 3A8WA 5GNKA 4EK4A 4EWHA 4I21A 2ZM3A 3VW8A 4N6YA 2X7OA 5EM5A 3MVHA 4FKLA 3ZBXA 5HO6A 4RX7A 1ZXEA 4U97A 2PMOX 1H26A 4BKZA 3PP1A 3D7TA 4DGGA 4ZZMA 1U54B 3CCNA 1DAYA 3UO6A 1A06A 2I0VA 2GDOA 3ORTA 1S9IA 3EWHA 4NW6A 5E8WA 3TZ8A 4CZTA 3NLBA 4FK6A 4RC4A 1MQ4A 1O6LA 3GU5A 3ZTXA 4II5A 3HV6A 3NCZA 5KZ0A 4RJ6A 4MNFA 4YP8A 3VUDA 4PUZA 3RJCA 3QTRA 3COHA 4YJPA 4UB7A 3UMWA 1H08A 1PXLA 1JLUE 1YXXA 4ENYA 2C5NA 4PQNA 2PK9A 5BVNA 3ALNA 3ULZA 4MXZA 2UZOA 4CFWA 2IO6A 3G51A 2QQ7A 2XIZA 4IAZA 3KRWA 3KY2A 3P23A 4PTEA 4WNPA 4WO5A 5DPVA 4ANSA 4FC0A 1H0WA 1UNLA 4N4SA 3SX9A 1QPEA 4RQKA 5CXZA 1LR4A 2A19B 4NM3A 3FWQA 4OGRA 3VUHA 1PKGA 1PYXA 2JFMA 1GZ8A 4XMOA 3PPKA 4AXAA 5FM2A 4DFYA 3ZXTA 4RGJA 4UMQA 3EIDA 3DBDA 2O3PA 3GVUA 3MW1A 3TUDA 3P1AA 2JDOA 2AYPA 3QYWA 1KE5A 1YWVA 4DFXE 3SDJA 4G6NA 3HYHA 4O7WA 2XEZA 4M69B 4IB1A 4OBOA 2E9NA 2EXCX 4MQ1A 5A46A 2JLDA 1PJKA 4K9YA 2WMVA 4MWHA 3U8WA 2X2LA 4G9RA 2WO6A 2GSFA 2FGIA 2OH4A 3R7YA 4X3FA 3G6GA 3TNIA 3UPXA 4BCJA 3BEAA 5ETFA 2JIVA 3R8ZA 4JT3A 3EQIA 5CAPA 3C0GA 4JAJA 3R8VA 4HVSA 2OXYA 1OIQA 3DJ7A 3MDYA 1PMVA 4FIEA 4IAAA 2QCSA 3QD0A 5EK7A 4BI1A 5AA9A 4I22A 2HELA 3UVQA 2OGVA 1WBWA 2VGPA 4FKGA 2GMXA 4XV2A 3FDNA 3MB6A 3UC4A 3LQ5A 3GP0A 5IF1A 1XHAA 2R3HA 3MH0A 5AV2A 3UIBA 4FR4A 3LM0A 1Z9XA 2HAKA 3NS9A 3UZTA 4EQUA 4AGUA 4BDEA 4BBMA 2JKMA 1OMWA 5LVNA 2J6MA 2XF0A 4FV2A 2QU5A 1OKVA 4TN6A 4XV9A 3ODZX 4EBWA 5LOHA 2XMYA 5TT7A 3QD4A 1G8SA 2WTKC 5DGZA 1QCFA 4HYIA 1KE6A 4K11A 5EYCA 4ZAUA 2VD5A 5L6PA 4MNEA 4JS8A 5KMLA 5A4LA 5E8ZA 4BR3A 3TIZA 4U79A 5DT0A 4JNWA 5CSVA 3FZOA 2LAVA 5EQPA 2GFCA 3UDBA 3EFLA 3TWJA 2UVZA 3JY9A 5CWZA 3FLYA 1TQIA 5E8TA 3LJ1A 1SVGA 3PVWA 5K4JA 4UXLA 2RFNA 3O17A 2GFSA 3RK9A 2W9ZB 3DXNA 2I7QA 3KXZA 4ID7A 1G5SA 3DY7A 4TYHA 2AC5A 4FSZA 3JYAA 5EOLA 3FJQE 4Y73A 5E8YA 1XH6A 1K2PA 4PNIA 3QQLA 5BYZA 1J7LA 3OXZA 5CT7A 3DT1A 2ITZA 2WMUA 3OOMA 5IH6A 5BX0A 3Q4CA 5CVGA 5HEZA 2YIXA 5E8VA 4MBLA 4S30A 4WKQA 4AW1A 5IKWA 4RIXB 1B6CB 4U3ZA 4HNFA 4TWCA 2YN8A 2VO6A 3HRCA 1OUKA 4TL0A 5F1ZA 3VBXA 3UIUA 4L9IA 4HZRA 3UIXA 1H1PA 3NAXA 5JFWA 2Y6MA 4OTWA 3WF6A 3F3VA 4C62A 3UVRA 3R8PA 4RWIA 4TT7A 4D4VA 3GENA 3SOCA 4FKQA 3IKAA 1PXMA 4DEHA 4ALWA 4GMYA 1SZMA 4IDVA 1WVXA 4C36A 3ZYAA 4IC7A 3P7CA 4J7BA 4QNAA 2ITVA 2WMBA 3RCJA 4EOIA 4USEA 1W82A 3VN9A 1Q4LA 3LIJA 2PUPA 4RJ5A 3B8QA 2UZWE 5HI2A 4QO9A 3T9TA 2PYWA 2ZM1A 4D0XA 4IM2A 3N4UA 4JG8A 4MAOA 4QYHA 3BHUA 3OY3A 2PVRA 4R77A 3QLFA 4FSWA 2XNBA 4FOBA 5J8IA 4APCA 3U6HA 2Y4IB 3F66A 4U0IA 3EJ1A 2VNWA 3QCYA 5L2QA 4PL4A 4YO4A 4R8QA 2RFDA 4BCGA 3DOGA 1FVTA 2HZ0A 4FNXA 4EZ5A 4DG2E 4USFA 1QL6A 4BDJA 1PXJA 2DUVA 3RKBA 4MCVA 4QP3A 3ZLWA 4ASZA 1XQZA 3D9VA 4U41A 4XJ0A 5HTIA 2GQSA 3Q96A 2C6EA 3CQUA 3R1NA 2JC6A 4FEQA 3DDQA 4NTSA 4W8EA 5KE0A 2DQ7X 2JIUA 2YLFA 4XLVA 1SVEA 4FSQA 3E92A 4P5QA 3PJCA 5HIEA 2EVAA 3QA8A 2UZVA 4ZSEA 4J53A 4L7FA 4CRLA 3KXMA 3L8PA 4KKHA 3TZ7A 3R6XA 3VBTA 4G3FA 4B0GA 5C1QB 4O7LA 1AQ1A 1V1KA 4H05A 2CGVA 1VZOA 2OI4X 3F5UA 3QXOA 3U9NA 4I5MA 5FEDA 4TYGA 4CFUA 3C4WA 3LLAA 4EOPA 2RFEA 4TYEA 4IC8A 4FKJA 4G5PA 5ACKA 2ERKA 5EG3A 3UGCA 4Z7GA 3GXLA 4J1RA 1UU7A 5D7VA 4ACCA 3RPRA 4HCVA 5CU6A 5JGDA 3WYXA 2C3IB 5A4TA 3L8VA 3LMIA 2E9OA 3BU5A 2WGJA 3E8DA 3L9NA 4JR3A 5CLPA 2R3MA 2VWYA 3AQVA 3MWUA 3KK9A 3QZFA 2A4LA 3ORKA 4M66A 5CF4A 5J5TA 3TNPC 1ZMVA 2J0JA 3VW6A 1G8AA 4IWDA 4P90A 3EB0A 4C2WA 2R3JA 3CEKA 3CQWA 3LOKA 4TW9A 5ANDA 2G2HA 5FP6A 4D55A 3ZZEA 4FG7A 4B8LA 1I44A 3MI9A 4FGBA 5LMBA 3DLSA 3MH1A 4HGLA 2I0EA 5TR6A 2X6EA 1H25A 3PLSA 4JIKA 4LMNA 5F94A 4LM5A 4KRDA 4BTJA 2ETRA 3ZH8A 3ZO1A 4BCPA 2FO0A 3UE4A 4FBXA 3DKOA 4YJVA 5JH6A 3OEFX 3IW4A 4JDHA 3AC1A 4O27B 5KMJA 3FHRA 3PXQA 2R0UA 2PE1A 3R9RA 4KNBA 2A1AB 4ALUA 5EYMA 4PWNA 4DF3A 3UOKA 2A2AA 3QX4A 4XS2A 1Y57A 2W4KA 5HO7A 2XK6A 4RBLA 2GHMA 5IA4A 3UO5A 3TG1A 4IMYA 1H28A 2BZKB 5BUIA 4A07A 3T8OA 5CEOA 3Q60A 3KF4A 3MFUA 4QMXA 4BL1A 3ULIA 3E87A 3DPKA 3I0OA 5M09A 4QQCA 4FTTA 1BMKA 4NM5A 4Y72A 3MS9A 5K3YA 3I4BA 3ZLSA 5HE1A 4BDFA 5J7HA 3NNUA 3DBEA 3F3ZA 5HG5A 4MWIA 4HVIA 3HAVA 5HORA 5JGAA 4RVMA 3Q6UA 4HOKA 4FVQA 4CT1A 5AUYA 2OLCA 1ZOEA 2DS1A 5IUGA 4C34A 3BWFA 4USDA 3VAPA 5DE2A 4NTTA 2OICA 2REIA 3H9RA 3C4ZA 4IB5A 2UZTA 2XK8A 3ANRA 1OZ1A 2IW8A 4XG3A 3HEGA 4C38A 5IMEA 4PMMA 3O50A 4AZTA 3DK3A 4HNIA 2BFYA 2HZNA 1PYEA 4EI4A 4QYGA 3VUGA 4XX9A 5EW3A 3IQ7A 3V5PA 2PPQA 3DK6A 3AT3A 3Q53A 4S34A 5CAUA 4AW5A 4FZ6A 5EKNA 4GKIA 3G6HA 4FG8A 3FKOA 1CM8A 1FPUA 1H4LA 4XOYA 3PA5A 3VUMA 2BDWA 5EFQA 5C8MA 2WQBA 4M12A 2R3PA 2XJ0A 4UZHA 5FDXA 3KULA 5CEMA 2OH0E 2OJJA 3PP0A 3ZO3A 4KIKA 2J7TA 3U55A 3GCQA 1Q3DA 4C2VA 3LAUA 4TXCA 1KV1A 1YOLA 2W5BA 3ELJA 3G33A 5FP5A 2QLQA 5FGKA 2WMTA 3TJCA 4L00A 3NRMA 4QPAA 4EJNA 1M2RA 2XKDA 1J7UA 4IX3A 1ZYJA 4AA5A 2I40A 3FPMA 4EJ7A 2VNYA 4OTFA 4EQMA 4J8MA 5IQEA 4BHZA 4W9XA 3N9XA 4DFBA 1JSUA 1ERKA 4IACA 2YM8A 2WD1A 1XH4A 5AP4A 3DJ5A 4O22A 3QTZA 4CGAA 4NM0A 3LMGA 4NH1A 4DAWA 5CQUA 5HNGA 2R2PA 3NAYA 5IG1A 4F7SA 1P4OA 4QMWA 4DE4A 2YM7A 2BZHB 3GUBA 3EL7A 4O1PA 5D12A 1X8BA 3UG1A 2QNJA 3KQ7A 3QQFA 2OXXA 2GS2A 2GHGA 1J7IA 3UNKA 1CKJA 3CJFA 3EKKA 3QQUA 3ZSIA 4IADA 2ZV8A 4XV1A 4R7BA 4XG8A 1I09A 2OW3A 4FV9A 4C8BA 2QR8A 5KHWA 3I60A 3VS1A 2YA9A 5AR3A 4UMUA 3BE2A 3JVRA 2IVUA 3D5VA 3I5NA 3F5GA 1YXVA 3EQGA 4P5ZA 4L01A 2QOCA 3IOKA 3E5AA 4KKEA 4PF4A 4MKCA 4RWJA 4EH6A 2B54A 3JPVA 3OCBA 4AOJA 3TV7A 3DXQA 2XVDA 1WBOA 2OG8A 3W2SA 5L2SA 3MVMA 4MXCA 3GCUA 5BVOA 1OL5A 4YJTA 4YHFA 2I1MA 5C03A 2GNHA 1RE8A 2HCKA 4FV3A 4FVRA 3W1FA 5IA3A 2BALA 4O84A 3IW5A 5F4NA 2Y6OA 3JUHA 2W4OA 2RG5A 2HYYA 4LUEA 4WOVA 4AT5A 5M4CA 2OK1A 1UU9A 4JI9A 4M97A 5F20A 2JIIA 3MSSA 4F64A 4FNWA 5CAOA 2C0IA 3POOA 2C30A 4K77A 2Y8OA 3KVWA 3QHWA 2BHEA 3FKNA 3QWJA 1O6YA 1UWJA 4TWPA 2IW9A 3SW4A 3VF9A 4CQGA 5KMNA 4FKUA 1H01A 3KCKA 3NZ0A 3SHEA 4L3PA 4U45A 4H58A 4ITJA 3RHXA 3P86A 1B38A 1U4DA 2B52A 2J51A 3R00A 2JD5A 4OTQA 3FI4A 3HNGA 5DHJA 3LPBA 4CFMA 4WRGA 2ITXA 1XBAA 2UZNA 2YIWA 3PA3A 3WF5A 4AN9A 4O7RA 4IEBA 4R78A 3DTWA 3QTUA 3ENHA 4K2RA 4YJNA 4WUNA 4XEYA 1ZYLA 4FT9A 4V01A 3Q9WA 3EN6A 4BZOA 2XUUA 2QOFA 2XM9A 5DT3A 4RFYA 4I6QA 2QO9A 3TXOA 5ETCA 2WMXA 2J0KA 4KAOA 5C4LA 4FIJA 2JDRA 3UTOA 4JR7A 4FTIA 4IXPA 3KXGA 4YLJA 5DBXA 5FD2A 4WIHA 4CZYB 4EH8A 5ANJA 2F9GA 3OW4A 4KD1A 5CF6A 3V5TA 4O86A 4PTCA 3G15A 3TUCA 4UWCA 1A9UA 2R3RA 3DBCA 3NUPA 5A3XA 4E20A 4F99A 4Z16A 1CKPA 3WBLA 4F0IA 4DLJA 2WTIA 3FV8A 2F49A 4JX3A 2YCFA 4KBKA 4R3RA 3QKKA 2J0MB 4QMPA 3KVXA 3QTSA 5LQFA 2WFYA 3G2FA 4EK3A 3H0ZA 4IZAA 3GC8A 3IPHA 2VTRA 1J1BA 3QX2A 5HG9A 2PVNA 3NW7A 2P3GX 1OB3A 1YDTE 2XBJA 4HCTA 4CCUA 5I3RA 1V0PA 5I9ZA 5DH3A 4C0TA 4QMLA 5KMIA 1U59A 4NW5A 1GAGA 4I23A 3F7WA 2IW6A 4O0WA 4AT3A 4D2TA 3ZO2A 3PG1A 5KKRC 3VJNA 2XJ1A 4IH8A 4JRVA 5AWMA 3PRIA 4YTHA 2HWPA 1GZOA 1P4FA 4AGDA 2JFLA 4V04A 2XKCA 3IG7A 5GZAA 3BWJA 2CGXA 2VZ6A 4MYGA 3EYHA 3Q4UA 3UYSA 4QMUA 4ZJIA 4R5YA 4PL5A 4TWNA 4ZK5A 3ZLYA 2YCRA 2BCJA 3L9PA 1CSNA 3HVCA 4C4HA 3QLGA 3FXZA 4HZSA 4J52A 1G3NA 4RJ3A 2BRMA 1OVEA 4ZXTA 1YRPA 2JDSA 2OXDA 5T3QA 3MFRA 4R7IA 3CD3A 3PXYA 5TOZA 2VWVA 3QKMA 4G3DA 2R3KA 4GUBA 4YGAA 1XWSA 4RPVA 4EBVA 2FSTX 2W1DA 3FC2A 3QBNA 3GQLA 4ZJVA 1LEZA 3S00A 3E63A 2C6KA 3F69A 3PWDA 4B9DA 3R8UA 2GCDA 4DBXA 3MB7A 2PZYA 3FMHA 5HCXA 4CNHA 2WQOA 4FE2A 3R28A 3LFNA 4DC2A 3R02A 4IVAA 4OTIA 3S1HA 4Q9SA 4YPSA 4U42A 1S9JA 3RTPA 3PZHA 3DV3A 5AV1A 5HNIX 3SGCA 2OIQA 1Z57A 3FSFA 3GCVA 4LUDA 1VJYA 4GFMA 4F9YA 2GHLA 5EHLA 2B9FA 2VWIA 3C4CA 5AR5A 3V04A 4EYJA 5DYJA 3EFJA 3FLWA 3N51A 4YZ9A 4KSQA 4W8DA 2W17A 3LQ8A 1TVOA 3OEZA 4ASEA 5BQ0A 1ZYCA 2HXQA 4L44A 5FXSA 4DITA 4F7LA 4G1WA 3ROYA 5FXQA 4DH7A 3GU4A 3PG3A 4BKJA 2XK9A 3C50A 4U8ZA 3MTFA 3GNIB 3NUUA 1V0OA 4JDIA 4BY9E 4OAUC 2GTNA 4I6BA 3FMKA 4IW0A 3LCTA 4FV7A 2J4ZA 3S0OA 5AR8A 2XNEA 3KB7A 2BFXA 4S32A 3QTWA 4ZJJA 2X7FA 3F82A 1KWPA 1L3RE 1ZARA 3OY1A 4R3PA 4NCTA 4TWOA 3RK7A 1JSTA 4XRJA 5CEKA 2JKQA 3DAKA 4EZ3A 4FKVA 4DYMA 4HYSA 3F5XA 4PDYA 3T9IA 4WNKA 4BYJA 4PMPA 3QZGA 1IG1A 4QP2A 2EXMA 3LCDA 3PY0A 4JX7A 2VGOA 4FSMA 4M0ZA 4DH3A 2WIHA 5E1EA 3ZC6A 4WA9A 4U80A 2PWLA 5EI8A 3BZ3A 2OJFE 3A62A 5L2WA 4FVPA 2RL5A 3MFSA 2WELA 1Q8TA 4QPMA 4RLLA 4NK9A 4LRMA 4CT2A 1PMNA 2XK3A 3QTXA 3VS3A 4BGQA 4HPTE 5ANGA 2UW0A 2VO0A 3ZMMA 4I0TA 3NMUF 4X3FC 4ZLZA 2GTMA 1PXKA 5HG8A 3WI6A 1T46A 5KCVA 3OBGA 3UNJA 4ZY5A 3NSZA 3H4JA 2YAKA 3ORLA 2CNVA 1CDKA 3V51A 2GPHA 4BI0A 3R7UA 3AMBA 2WU6A 4BCIA 2C6DA 2WKMA 4F0FA 2RKUA 4BCHA 4RA4A 4GL9A 3O8PA 3R7VA 2XS0A 1WBNA 3OMVA 3U51A 5AX3A 4F6WA 4QMMA 4O7YA 2ZMCA 3QU0A 4C35A 3V5QA 2OSCA 4E5AX 4UX9A 4A9YA 3BQCA 4O7NA 4RSSA 2H34A 4FF8A 4XP2A 3FXWA 5J1WA 1YVJA 4WHZA 3A99A 2YIQA 2QODA 3COKA 3R9HA 3P7BA 4N6ZA 3BU6A 5A6OA 5IA1A 3FMDA 3S2PA 3PUPA 3CY2A 4LG4A 1W0XC 4E26A 3DS6A 4EH5A 2VTQA 5K0XA 5DR9A 4KWPA 2PMIA 2WZJA 4FA2A 2PZPA 1GZNA 2IWIA 1E1VA 4F9WA 2YIRA 3F3TA 3FLNC 4DGMA 1GJOA 2PE2A 4G6LA 4OW8A 3HMMA 5M06A 2ZVAA 3QC9A 1YOMA 5ANIA 3WF9A 3PJ1A 5H9BA 4YJOA 4CFXA 3WZUA 2XIRA 3LXLA 4HVGA 4BCMA 3UOJA 3GOKA 4YO6A 4X7QA 3FLZA 4TYJA 4MBIA 4GSBA 4UMPA 3DQXA 2Q0BA 4YSJA 3WIKA 1DS5A 5FXRA 5HLPA 4X2FA 5EI6A 4PP7A 4FL2A 3GT8A 3ZC5A
chains in the Genus database with same CATH superfamily
2ZB1A 4O0YA 4QQ5A 5TKDA 5HLWA 3W8QA 5A9UA 4WBBB 2KTYA 3RP9A 5FM3A 4FTCA 3BHTA 4BIBA 1PMUA 4EHGA 5AFVA 2ZMDA 3C1XA 5E8XA 3AKJA 3OP5A 5AP0A 5H2UA 3FKLA 3AT2A 4DEEA 4QQTA 4GU9A 5I9WA 2YISA 4ZTRA 2BILB 4E4MA 1U46A 2YDKA 4CKRA 3PJ3A 1QPCA 4DA5A 2H8HA 4NWMA 2X81A 2W05A 3V6RA 3KIOC 3ANQA 3FMMA 2UZLA 4RJ4A 4TPTA 3C0IA 4XNEA 1UWHA 3W8LA 3KREA 2E9UA 4L6QA 2PVMA 4R5SA 4EOSA 3RGFA 5ETAA 2QOLA 4EYMA 4IZYA 2IZTA 1ZZ2A 4IWOA 4AA0A 4QYFA 3U87A 4X6QC 2F2UA 4RX9A 1TKIA 4RVLA 4ZS0A 1R39A 4E8AA 5HX6A 1XMMA 4EK5A 4QOXA 4YZDA 3PWYA 3BEGA 4ZTMA 2BUJA 2ITYA 5J1VA 3ORIA 3A60A 3QUEA 5CAVA 3MPTA 2O5KA 4PTGA 3O8TA 4CXAA 4U43A 3AKLA 2QG7A 5EKOA 2R3GA 2WIPA 4HPUE 2PULA 1IASA 3R73A 3GI3A 2YZAA 3QCSA 3D5XA 4UWBA 3FQEA 4R1YA 3RVGA 4AUAA 4L7SA 5HX8A 4DH5A 4WUAA 3LJ2A 4R1VA 3BELA 5BMSA 2C3JA 4IB0A 5EDPA 4EC9A 4PL3A 1VR2A 3FLSA 4HYHA 2WTKB 4QMSA 4J98A 1LEWA 1OIUA 5DMZA 4IM3A 4IFGA 4ONAA 1YQJA 2BIYA 5E1SA 3SW7A 3Q5ZA 5DEWA 3TN8A 4UBAA 1YHVA 4RZVA 3W2PA 2A98A 4XOZA 4EHVA 3W18A 3L9LA 3S4QA 4DFUA 1R1WA 4LV5A 2ITNA 2W1FA 4K6ZA 4YTFA 4JG6A 2R3OA 3BKBA 3MIAA 4OTGA 4FKRA 4W4YA 4BKYA 1LPUA 4MXAA 4C3PA 1J3HA 4YLKA 3REPA 1VYWA 4O7TA 3QWKA 2V5QA 2YM6A 4WG3A 2QOBA 4E5BA 2O64A 3FQHA 3QZIA 3KMWA 4LOOA 4P2KA 1NW1A 3BYOA 3ZSGA 1QMZA 1PHKA 2EU9A 5DRDA 2W96B 3EZRA 3VIDA 2CKPA 3A7FA 2G2IA 4FTUA 5JGBA 1VEBA 4UEUA 2C68A 3OZ6A 3RINA 2XNMA 3FPQA 2YM4A 4BCKA 5DNRA 2P2HA 4NKSA 5JN2A 3E7VA 3DNDA 2OWBA 4FKOA 3QZHA 2PVLA 4F6UA 1IAJA 3Q04A 3D2IA 1U54A 3KXXA 4GCJA 4QTBA 4TNBA 1BYGA 4AZSA 4E6AA 4EZ7A 4GFGA 5A14A 2FSOX 3D4QA 3HP2A 5BVDA 1ZOGA 2B9HA 2XP2A 5DRBA 3P08A 4BDAA 1OECA 5I5ZA 2WPAA 3G9NA 3NUYA 5A6NA 3WE4A 4E5WA 2CLQA 4RVKA 4ACMA 3ALOA 3K5VA 1OBGA 3OVVA 4GU6A 5JZNA 3F88A 4GT4A 5KUPA 4IQ6A 4EOLA 3II5A 3RPVA 1KE8A 3DAJA 5M07A 3KCFA 4GG5A 3JR1A 5DR6A 4BZNA 1UKHA 3HL7A 2GNGA 2QOHA 2W06A 4OTRA 4GRBA 2G15A 1RW8A 3F61A 5J95A 3SC1A 3OCGA 1Z5MA 3OT3A 3H0YA 2VTPA 4FYNA 1REKA 4YLLA 5IEXA 3BGPA 3FZRA 3QUDA 3F5PA 4FYOA 5HE2A 4BWKA 2BR1A 2C5YA 1XJDA 4M3QA 4FNYA 2AC3A 5DI1A 4ZTLA 2C6IA 3NGAA 2IZSA 4D2WA 2FUMA 5AJQA 5I9UA 3WZEA 1FMOE 5G6VA 2VUWA 3W16A 2OIDA 3DKCA 2VTSA 4G3EA 4GIIA 2C69A 4FKTA 3AGLA 4O96A 4AW0A 4BB4A 4S31A 5EYKA 1YWRA 4M69A 5A4CA 4FTRA 5AV3A 5IQGA 3EQHA 3I6WA 5GINE 3BCEA 3EQBA 5BV3A 5IA0A 4EH3A 5EQYA 4I5CA 4IVCA 2W9FB 5JT2A 1YI6A 5BVWA 4AXDA 2PZIA 2BPMA 3KXNA 4J8NA 4LL5A 2GS6A 3DKGA 4LRJA 5H8EA 5CU0A 3ZOSA 2Z02A 4DHZA 2YDIA 3FMLA 1Q8ZA 2C4GA 3C7QA 5HLNA 5IEYA 3OUKA 4Z55A 3O7LB 5C8NA 4B8MA 2PY3A 3I1AA 3LHJA 4EOJA 3VS0A 3WIGA 3WARA 1VYZA 3PVBA 3V8TA 4H3BA 5AAEA 1Q24A 4C4IA 2PL0A 4CMTA 2C6OA 4A4LA 1OITA 4GV1A 3QFVA 5KMKA 4UMRA 3NW5A 2VRXA 1Y8YA 4IE9A 5DOSA 2C6TA 5AR4A 3Q9YA 1YHSA 3QRIA 4I5PA 4BCQA 5D10A 5FTOA 3E64A 3NUAA 3AD4A 1KSWA 3PYYA 2CMWA 2IVVA 3T3UA 4BDKA 1M52A 3IGGA 4KIPA 5AV0A 3Q2MA 1W84A 5L6OA 3V01A 4DT9A 2R9SA 4OR5A 2ITUA 5D11A 5KNJA 3NIZA 3EMGA 2V7OA 3NEWA 2O63A 4H3PA 3CD8A 2PUUA 4BTFA 2R3QA 1ZLTA 3PSBA 4Y8DA 4WT6A 4X6RA 3R01A 5HU9A 3Q4ZA 3W0OA 2WMRA 2O65A 2VU3A 3QHRA 5H8BA 3R2YA 4O4EA 1SNUA 3CR0A 3RCDA 4ZMEA 2W4JA 3TI1A 4RX8A 4IVBA 2WEIA 3I79A 5CX9A 4XG2A 3R21A 2QHMA 1HCLA 3FI3A 2EB3A 2QURA 3CXWA 5I3OA 4AE9A 5KMOA 5HIBA 2WMAA 2WQNA 3FZPA 2OJ9A 1Y6AA 5HKMA 4CZUA 4D2RA 4MUQA 4K8AA 4RT7A 4CQEA 3P78A 1ST4A 1WZYA 4L8MA 2XBAA 3LCOA 3SKCA 4LI5A 3C5UA 4RIXA 4JQ7A 1ZMUA 5EH0A 4BBEA 4FODA 1FQ1B 3EL8A 4KS8A 4EHZA 3E8NA 2Z2WA 3R7GA 3ZBFA 4YHJA 4GS6A 5DN3A 4OBQA 4BIDA 3Q32A 5JFXA 5KBQA 4CD0A 4FKWA 2AEGA 2PVYA 2PVKA 3TM0A 5C27A 5E8UA 3R7IA 5LMKC 3CKWA 2BRHA 3FC1X 4XHKB 4D4SA 4DEIA 3DTCA 4EOKA 4CG9A 4BF2A 2V7AA 4BRXA 3FAAA 5BVEA 1JKLA 1TQPA 4RIYB 4E1ZA 4AE6A 4J96A 2OZAB 3RM6A 5FQDC 5JKGA 2C1AA 2HK5A 4C61A 2XCKA 2YM3A 5AUTA 5M4IA 3OF0A 2NYAA 3PA4A 5FRIA 4H1MA 4L67A 4O82A 1ZMWA 1YOJA 2OO8X 4XUFA 2CDZA 4G6OA 4ZY6A 4J97A 1ZRZA 2JKKA 4IAFA 3GB2A 5B7VA 4CTCA 1JKTA 3PE2A 3SV0A 4AQCA 5AAFA 5B2LA 2Y4PA 4N70A 4PP9A 2YITA 4ENXA 1UA2A 4M14A 4AGWA 4ANQA 3LFAA 2PUNA 4DBNA 3PPZA 1OGUA 3UJGA 2NO3A 4FEXA 2NRUA 4IX4A 3COMA 1FVVA 3BGQA 3CGFA 5L4QA 3VVHA 4C58A 3U9CA 4YJSA 2X0QA 3TDVA 5JQ5A 2UUEA 2IPXA 2X4ZA 3BV2A 1NVQA 3QTQA 4DEBA 4DEGA 3PXRA 4FZ7A 5AADA 4NUSA 4CEGA 4OBPA 3TNWA 4D2SA 3D7ZA 3A2CA 1SVHA 4O4FA 4YMJA 3BX5A 3C4EA 2O2UA 4NFMA 1BL6A 3E88A 1IA8A 4EWQA 1MUOA 3G90X 4L46A 4BDCA 4CLJA 4ZLYA 3I6UA 5M44A 1OPJA 2ONLC 3R9NA 3ZUUA 4IJ9A 1FVRA 2H9VA 2OZOA 4F6SA 5CVFA 5TE0A 3VF8A 5IEVA 1JSVA 5CXHA 1JNKA 3QALE 4DCEA 4RIOA 4GVAA 4TYIA 4DG3E 4F7NA 2ZDTA 4ITIA 1BLXA 4LGDA 2GS7A 2H96A 2C5OA 3SA0A 2RIOA 2DWBA 4O6LA 3DJ6A 3OHTA 3QA0A 3VJOA 5CASA 5I9XA 4BFMA 4FSYA 5C26A 3D5UA 3OG7A 3RBWA 4O38A 1M2PA 3EZVA 3SRVB 4FIGA 4W4VA 4ANLA 4F0GA 4FTQA 4MXYA 3LZBA 5IQBA 3C0HA 3E3BX 3K2LA 4GIHA 3ZRLA 1O9UA 4IM0A 3EQFA 1RDQE 3NUXA 3MPAA 4CVAA 2B55A 3H9FA 2FSLX 3HV5A 5L8JA 2F7ZE 2FSMX 5IZFA 4YPDA 3F6XA 2GQRA 1TZDA 4IZ5A 4WBOA 5IA5A 3VC4A 3V5JA 3AGMA 2CCIA 3GC0A 3PE1A 3PIXA 3QRJA 4FK3A 1BI7A 3D94A 4M8TA 3RAHA 4C4FA 3CSVA 3OXTA 3Q3BA 5AMNA 3FLQA 4DFNA 4ZLOA 2R3LA 2JKOA 1OL1A 5IISA 3OWPA 4FI1A 4DLIA 4HW7A 3H3CA 2XEYA 5AUUA 3BL9A 2WU7A 3LFBA 3PXFA 3QQJA 4X3JA 2J50A 3TTJA 4G3GA 3LE6A 4XG4A 4ZP5A 4OAVB 4C57A 2WOUA 3LXKA 3NYOA 2CHLA 5C4KA 5JFVA 4Q5HA 3OCTA 5ITAA 4OTPA 1W8CA 4QMOA 3N4VA 5EHYA 5JMSA 5IDNA 2JBPA 5HTBA 1L8TA 2XIXA 2XZSA 3C13A 3Q52A 4NU1A 4O2ZA 4IWPA 3RZFA 3KRXA 1XH7A 4D9TA 2WTCA 3OCSA 4OTDA 3OS3A 3LCKA 4E7WA 3BYSA 3ZEWA 3AG9A 1XMLA 4FL1A 3BI6A 5BPYA 2CNUA 2Z7RA 4MK0A 3CKXA 3PVGA 5CYIA 2R7IA 3CTJA 3PJ2A 4M67A 5AP5A 3RAKA 4DG0E 4NM7A 4GH2A 3V3VA 2UW7A 3AXWA 1PXNA 4RIYA 5B2KA 4A06A 1JQHA 5JZJA 3DBFA 4BCNA 1TQMA 4TRLA 2OU7A 5HQ0A 5LJJA 4EORA 1CMKE 2VAGA 5EOBA 4QNYA 3PIZA 3RAWA 4FT7A 2UVYA 2W1HA 2P0CA 3RPSA 3AMAA 4DDIA 3PRFA 1XBCA 2VTNA 5LCKA 4HGTA 3OWLA 3WF7A 3FZTA 2F4JA 3LXNA 4BDGA 3HECA 4CMOA 1RJBA 2WMWA 3KRLA 4G2FA 3S95A 5DWRA 1PXIA 5HO8A 5CSHA 2P2IA 4IAKA 4E6DA 4JQEA 5DIAA 2R7BA 3VULA 3NDMA 5HTCA 2UW6A 3LFCA 1WCCA 3HP5A 4CKJA 3ORNA 3ZXZA 2PHKA 5HD4A 1R78A 2YM5A 4HGSA 3ERKA 4I24A 1OUYA 4EH4A 4QQJA 3KMMA 1FGIA 2XJ2A 1YDRE 4CYIA 4IAYA 5CNNA 5DEYA 3PIYA 3VQHA 4A9UA 1B39A 3GOPA 3FYKX 3H10A 4RIWB 4JL9A 3DQWA 3ORXA 4I93A 2W1EA 4D0WA 3TV6A 2V0DA 2QOOA 4QRCA 4FTAA 4EKKA 3G0EA 3IW7A 4H1JA 4FIIA 5FDPA 3QUPA 4O21A 4YTIA 2G9XA 2XK4A 2ZYBA 4FKPA 2AQXA 4NT4A 3TNHA 3TV4A 4Z7HA 3QQHA 3W2QA 4ZOGA 1YXTA 3O96A 4QYEA 4CTBA 1OIRA 5IUHA 3POZA 2W7XA 5AIRA 3IO7A 4ZSGA 3R9OA 3SQQA 3VBQA 4JDKA 4BDHA 5IQDA 4WG5A 3W32A 5C8KA 2B9JA 3NCGA 3RPOA 2BAKA 1Q41A 2XNPA 5AUWA 5FTGA 1PKDA 5L2IA 3AD5A 5KKRB 4RVTA 1H0VA 2Y0AA 1M2QA 4JG7A 4UXQA 2BKZA 4XH6A 4GYGA 3KN5A 3UP2A 4YHTA 3AC5A 1ZAOA 3MA3A 1NY3A 1PXPA 3VHEA 2OJIA 3ACJA 2XKFA 3SRVA 4Z3VA 2CGWA 2YJSA 4L43A 3IK3A 2WQMA 3LQ3A 2BKKA 2ZM4A 5D1JA 5EI2A 4UV0A 4ACGA 4MHAA 4ZTSA 3RHKA 3MYGA 4DEDA 3PVUA 1H1QA 4MXXA 2KULA 5D41A 3W2RA 4I92A 4AA4A 2XK7A 3VS6A 3KEXA 4FSUA 3VONA 4LDTA 2B4SB 3BPRA 3RNIA 4GJ2A 3VNTA 5HCZA 2HZIA 4DFZE 4JRNA 3EH9A 3KFAA 3OFMA 2YAAA 1H27A 3DA6A 3BGZA 2V22A 5CT0A 1BUHA 3CTQA 2RFSA 2Z60A 3I7CA 4O0XA 2LGCA 1R0PA 4WRSA 4E4LA 1OKZA 4BJJB 4E4NA 1JKKA 4F65A 5J79A 4I6FA 1JAMA 3AC2A 4AN2A 2X39A 4Y46A 3D7TB 3LM5A 4FV8A 4CLIA 4A9TA 4XBUA 5AV4A 3ROCA 1APME 5E9EA 4QTDA 4AZWA 4DCAA 4FSNA 3QGWA 4O6EA 4D1XA 4FTOA 1HOWA 1JBPE 1WVYA 3AC8A 5GJDA 5GZ8A 4FV4A 4YJRA 2WEVA 2PE0A 3CBLA 3UODA 3UOHA 5LVMA 3PY1A 1Q3WA 1ZY4A 1GNGA 2BROA 3O7LD 3HRFA 3E62A 3P0MA 4L3LA 1JOWB 2BDJA 5I4NA 1EH4A 5KZIA 3FL5A 4S2ZA 5TF9A 2VTAA 5DG5A 1QPJA 5EW8A 4O0TA 1ATPE 2YACA 3D83A 5F95A 4FSRA 5IMXA 2VWUA 1Q62A 1W2DA 4D28A 4YU2A 1PMEA 3MV5A 4E73A 4KIQA 4O4BB 5AUXA 2UW4A 4D58A 5A54A 1YWNA 1XO2B 1H1WA 3D15A 2C47A 1O6KA 2XA4A 3UQCA 2IZRA 2X0GA 2XYUA 3RNYA 2X9FA 3W33A 4Y83A 4F1MA 3RK5A 3O2MA 3F2NA 3PXZA 4R7HA 4X2NA 4KSPA 3D0EA 4C02A 4BN1A 1AGWA 2YCQA 2BAJA 1WFCA 4JXFA 4DTAA 1NVRA 1M17A 2VTHA 3M11A 3PFYA 4NL0A 5KBRA 3W0RA 3WE8A 3UO4A 1GIJA 2I0HA 3UDTA 2CNQA 4S33A 2IVTA 3ORZA 3CIKA 5JRSA 3E7OA 5KO1A 4EOOA 3SD0A 1ZY5A 3QL8A 2YABA 3E8CA 4FNZA 3FZSA 2W5HA 3P5KA 3ZO4A 3SG9A 4G5JA 2XNNA 3MJ1A 4LYNA 3BV3A 4X2JA 4GVJA 2UW9A 5B0XA 3KK8A 5CY3A 1Q8YA 2C3LA 1OL7A 4FX3A 4J95A 2RF9A 3ZONA 4X3FB 3ZCLA 2JGZA 4F63A 3HMOA 5CSXA 4RFZA 5AUVA 4ARKA 3R8MA 3PSCA 4WG4A 3HMPA 2OF2A 2VWBA 3RAIA 5IQAA 3WZJA 3VS4A 4OLIA 5LXMA 4OT6A 3H9OA 1URCA 5G1XA 5HVKA 4AXEA 3QRUA 4G34A 4E3CA 5A4EA 2BMCA 4QMQA 4MH7A 3R83A 2B1PA 4BC6A 3F2RA 4UALA 4O91A 3EOCA 5I9VA 1W83A 4N57A 5DR2A 3VUIA 2ESMA 2ZV9A 4I41A 4CG8A 4FSTA 3HZTA 3IECA 1H8FA 3K3IA 4QYYA 4IDTA 5AIKA 3D14A 3FSKA 3TKUA 3TJDA 2NNWB 1PF8A 2Z7QA 2Y7JA 2ITTA 4JBVA 3A7HA 1UNHA 3GFEA 4O2PA 4AACA 2CLXA 3HV7A 4H36A 3THBA 3OD6X 5EM8A 4GUEA 4MNEB 3I5ZA 4CRSA 1DI9A 2QG5A 5I9YA 2W1GA 5AAGA 3TKIA 3EQRA 4XRLA 2SRCA 4FGRA 3JY0A 4NZWB 5E91A 3V8SA 3KN6A 1KE9A 3DCVA 2QVSE 4RG0A 4JMQA 4ZZOA 2J0LA 5CAQA 3FHIA 2YEXA 4YNEA 1MRVA 4BDDA 4M15A 4BGHA 4EC8A 3DFAA 3QD2B 1K9AA 4ZEGA 3GCPA 1GY3A 3K5UA 2BZIB 3NWWA 2GNFA 3G9LX 1URWA 4TYHB 3VHKA 4FTKA 5DVRA 3FBVA 3R9DA 4D2PA 2BRBA 4BJJA 4FTLA 5FTQA 2BTRA 4BZDA 4DGOA 2P4IA 2ACXA 3OW3A 5HOAA 1XBBA 3RWPA 3UZPA 5IU2A 4UMTA 5LVOA 4FEUA 1SNXA 3ORPA 2X4FA 1PRYA 4GK4A 1CTPE 3AC4A 4EK8A 3BLQA 3QXPA 5HG7A 2EUFB 4IAIA 3RI1A 3ZU7A 2XYNA 5BVKA 2VWXA 4LL0A 4R6VA 4Y5QA 5TO8A 3F7ZA 4D5HA 2ZDUA 2JDVA 3NPCA 1FBNA 4QMYA 4KA3A 3R8LA 4YNOA 3QYZA 3UOLA 2EB2A 3BIZA 1CKIA 1H07A 3U4UA 4ACHA 5M55A 3DFCB 4KABA 5M4UA 3FZ1A 3A7JA 4M0YA 3LKMA 4DHIB 4HCUA 4DGLC 4JOAA 4GK3A 5HE3A 2XRWA 1IRKA 3TZMA 2V55A 2PU8A 1WBTA 4NJDA 3HAMA 1UNGA 2PMNX 1OI9A 2R3IA 3NYVA 2UVXA 3HDMA 4QTAA 4M13A 4EEVA 5JFSA 4GK2A 3EKNA 2GU8A 4WSQA 4D1SA 2X2MA 1Q97A 3BL7A 4ORKA 2QC6A 4AFJA 5ANKA 5AP1A 1WMKA 5M53A 4OUCA 4NSTA 1P5EA 3M42A 4F7JA 1Q61A 3KU2A 5AP2A 4TTHB 5AR7A 5L6WL 2BDFA 5T6KA 2ZB0A 2E9PA 4IX5A 1W7HA 2OKRA 3LFSA 4RZWA 3UC3A 4GKHA 3UQFA 4YZCA 4DHJA 2PVHA 4YUQA 2WOTA 3FQSA 4FIFA 5CSWA 3OWKA 3ZLXA 2ITOA 2VTLA 4DTBA 5JEBA 3F9NA 4U3YA 3EQDA 2W1ZA 3EN7A 4K33A 4TNDA 4PNKA 4AZVA 1XH9A 3ZSHA 4I4FA 5LMAA 4BYIA 4FZAB 5HBEA 5J87A 4KIOA 5GJGA 4QD6A 1KV2A 3R0TA 4IANA 4DDGA 4PMSA 4AZEA 1XH8A 3PPJA 3QCXA 2QU6A 3OOGA 4ZIMA 1Q5KA 5E8SA 3NYXA 4EONA 2RSVA 1F3MC 4WD5A 1BI8A 2CKEA 4A4OA 3ID6C 4A4XA 2ZOQA 3CP9A 2G01A 3ZS5A 4EUUA 2QHNA 4K1BA 2WHBA 2JBOA 3NUSA 4XG7A 3CS9A 2R4BA 5AUZA 4C4GA 4ERWA 2IEWA 5C01A 3FL4A 3OXIA 4IFCA 3RMFA 4C59A 4L42A 1IR3A 3P79A 4BWPA 3UPZA 3TZ9A 1H00A 3TNQB 4LV8A 3A4OX 2ZJWA 3VS5A 3RALA 1PW2A 2Q0NA 2P55A 2VN9A 1XKKA 2VX1A 2X7GA 1DAWA 2XAMA 1NT2A 2ETKA 4A9SA 4XV3A 3VS7A 4CV8A 1DM2A 2JAMA 4GJ3A 4B6LA 3NIEA 2WQEA 5IQIA 2X8EA 3AOXA 3KF7A 2VTOA 4GT5A 1ZOHA 4F08A 3PZEA 3QF9A 4CFFA 2PZ5A 4ERKA 4I3ZA 3E3PA 3Q6WA 4RRVA 4U9AA 3TL8A 3AD6A 3LLTA 1ZWSA 4U40A 3U4WA 1WBPA 4FMQA 3RWQA 5AX9A 4HYUA 2YFXA 3HRBA 3GEQA 3I7BA 2W1IA 3EN5A 3OUNB 2BTSA 3DNEA 4FV6A 5AM7A 2VO3A 2CCHA 4L68A 5HE0A 4MX9A 5BYYA 4Q2AA 4LOQA 3QCQA 4XCUA 5CALA 1E1XA 3CLYA 4XG6A 2E2BA 3KXHA 3M1SA 4LOPA 4AS0A 4KBAA 1QPDA 2BVAA 2CKQA 2B7AA 4IZ7A 5K9IA 5CNOA 3VBWA 2QKWB 4E93A 4Y5HA 3JS2A 4EK6A 5M08A 3F3UA 4IWQA 5J9LA 3O71A 5AP3A 4TZRA 2UW5A 1P2AA 2HWOA 3O23A 4BTMA 5IQCA 3UP7A 5CSPA 2JEDA 5FEQA 3TCPA 5FG8A 2VTMA 3FY0A 4QP4A 3SAYA 3PJ8A 1OPLA 5CTPA 3TEIA 1J1CA 3VUKA 4CSVA 5H3QA 4DINA 4E6QA 2XALA 3CQEA 3OC1A 3G5DA 3SXFA 2FA2A 2DYLA 3BHVA 3IONA 4MTAA 5K5XA 1J91A 3B2WA 5CF5A 1M14A 2JITA 3EQCA 1OL6A 2CN8A 4BI2A 5J7BA 2CSNA 4UN0C 2O0UA 5GIOE 4G17A 3FE3A 3LJ0A 4LQMA 4ZTHA 4IB3A 3IW6A 5CEIA 4Y95A 2ETMA 1W98A 4ZS4A 2UZBA 4BVUA 4DEAA 2VO7A 3A4PA 1FGKA 3M2WA 1YXSA 3CY3A 4FEVA 4Q5EA 4L53A 2XIYA 2C1BA 4GEOA 2R3NA 3PFQA 1V0BA 4RQVA 2Y9QA 1YDSE 3QQGA 4HVDA 1WAKA 5CEPA 2WTWA 4GFOA 5FUTA 1UVRA 3T3VA 4I0SA 5M56A 3DGKA 3NVMB 3G0FA 2OF4A 4L3JA 3R7OA 4BDIA 3MGYA 4P4CA 3O8UA 5AP6A 5ICPA 1MRYA 4IVDA 4JJRA 2Z7LA 4PX6A 4AP7A 2RGPA 5JSMA 3WYYA 2UZEA 2Y4IC 2QR7A 4HJOA 4UY9A 4ZTNA 2R5TA 3U6JA 3DZQA 1MQBA 2XH5A 3LFEA 1KE7A 1PXOA 5CZHA 4FUYA 4M84A 5LVLA 1NVSA 4EH9A 4HVHA 4NIFB 1KUTA 2P33A 2HENA 2VV9A 3GFWA 4D2VA 4GYIA 1P14A 2B9IA 3U54A 2VTJA 3HMNA 5HBHA 3K3JA 3V5LA 3BLAA 2HY0A 2I6LA 2UV2A 5HIDA 4E6CA 3ETAA 1XR1A 2WMSA 1ND4A 4RLKA 2BZJA 3KULB 4ZSLA 2YCSA 3LCSA 3HLLA 4KIKB 4FUXA 3MH2A 2YWPA 3KA0A 4KRCA 4YZNA 5DLSA 4AW2A 2WXVA 4G31A 3R1QA 4I6LA 2PMLX 3BRBA 4ACDA 4QMNA 1JPAA 4U6RA 4ALVA 1IEPA 3DB6A 4C33A 4F9BA 5HGIA 4XBRA 2QI8A 5EW9A 2NPQA 3CJGA 5GHVA 2BIKB 3GQIA 1HCKA 2F7XE 3MY1A 1GIHA 3A7IA 4NFNA 4ANBA 2GQGA 5M57A 1W2CA 2C0OA 3LFQA 5BVFA 3TMOA 3F2AA 2IZUA 4GT3A 4C4EA 5AA8A 4I0RA 5K4IA 1IAHA 4DTKA 3ZEPA 3TT0A 4JDJA 3FY2A 3R22A 2Z8CA 2OFVA 4I20A 3D5WA 3R1YA 3UQGA 5KX8A 5AEPA 5IQFA 1RQQA 4MQ2A 3ZM4A 4QTEA 4CFVA 4I1ZA 3DXPA 4PV0A 4G9CA 3CPBA 4LRKA 3JXWA 5BUJA 3O51A 3QKLA 2C6LA 2GNLA 5HVYA 4C37A 2YLEA 4O4DA 4QP7A 3L8XA 1U5QA 2X8IA 4K18A 3C5IA 2J2IB 4H3QA 2YJRA 2UZDA 4G16A 2J5EA 5CI7A 2XM8A 4PPAA 4FKSA 4FL3A 1OL2A 3DBQA 3MFTA 4EKLA 1Y6BA 3F3WA 3WILA 5K5NA 4AX8A 3NVKI 4UYAA 2FVDA 3BYMA 3B8RA 2NP8A 2WTDA 3IOPA 4RMZA 5L3AA 4UZDA 3ZFMA 5LCJA 1NA7A 3I81A 5D7AA 2X8DA 5B2MA 5FBNC 3W0PA 3CC6A 2H6DA 1YI4A 3A7GA 4NEUA 3MPMA 4FV0A 3A61A 3GBZA 3PLAE 2X1NA 2IN6A 3DB8A 4JBQA 4K0YA 3KGAA 3MY0A 3QD3A 2ITWA 5HESA 3SOAA 5L2TA 2HOGA 4J99A 2HY81 3TKHA 3DAEA 2YZLA 4MD9E 3OTVA 4IHPA 5CU4A 4APPA 4ASDA 1YXUA 4X2GA 2W5AA 5CI6A 3W2OA 1NXKA 3HMIA 3GC7A 3IDBA 4AOIA 4C3RA 3R1SA 4QT1A 5KHXA 3D2KA 2BRGA 4QP6A 4A9RA 4D4RA 4JVGA 5E7RA 1KOAA 2VWWA 5DA3A 2G2FA 4IJPA 3UBDA 3ENMA 4JIAA 5ANOA 4YC6A 3VO3A 4DHFA 3DDPA 4GG7A 4LMUA 4YSMA 3NW6A 4EOMA 2YERA 4KUJA 2OIBA 4MXOA 3BLRA 4FV5A 4UWYA 4B4LA 4RFMA 1G8KA 3PY3A 1UV5A 5JRQA 4CCBA 2J9MA 4RWKA 3MN3A 3OROA 4WNOA 1U5RA 2UW3A 5LWMA 4MD7E 3DZOA 3TDWA 2XB7A 2HW7A 2QLUA 5CU3A 2XNOA 5CVHA 1YKRA 3N4TA 3LMHA 4C4JA 4GW8A 4JQ8A 4QP1A 2J0IA 3NNWA 4NIFA 4ZZNA 1REJA 3OTUA 4BDBA 5HNBA 2XIKA 5AR2A 4MBJA 2HZ4A 4U5JA 3PSDA 3V5WA 5LVPA