The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
75
|
sequence length |
267
|
structure length |
267
|
Chain Sequence |
SFDGFFLHHMTAELRANLEGGRIQKINQPFEQEIVLNIRSNRQSHKLLLSAHSVFGRVQLTQSDFTNPKVPNTFTMILRKYLQGAIIEEIRQLDNDRILEFSVSNKDEIGDHIQATLIVEIMGKHSNIILVDKSEQKIIEAIKHVGFSQNSYRTILPGSTYIRPPETHSLNPYTVSDEKLFEILSTQELSPKNLQQVFQGLGRDTASELANHLQIDRLKNFRAFFDQATQPSLTDKSYAALPFANSPENQPHFESLSSLLDFYYQDK
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Cell adhesion
|
molecule keywords |
Fibronectin/fibrinogen binding protein
|
publication title |
Structural and functional analysis of an anchorless fibronectin-binding protein FBPS from Gram-positive bacterium Streptococcus suis
pubmed doi rcsb |
source organism |
Streptococcus suis
|
total genus |
75
|
structure length |
267
|
sequence length |
267
|
ec nomenclature | |
pdb deposition date | 2016-10-27 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Roll | ibrinogen binding protein from staphylococcus aureus fold | ibrinogen binding protein from staphylococcus aureus domain | ||
Alpha Beta | 3-Layer(aba) Sandwich | Ribonuclease HI; Chain A | fibrinogen binding protein from staphylococcus aureus domain like |
#chains in the Genus database with same CATH superfamily 5H3X A; 3DOA A; #chains in the Genus database with same CATH topology 3DOA A; 1QHK A; 1RU3 A; 3I04 M; 1MJG M; 3PMQ A; 2Z8Y M; 5H3X A; 3GIT A; 3BSU A; 1OAO C; 3BL4 A; 3I01 M; #chains in the Genus database with same CATH homology 5H3X A; 3DOA A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...