5H5QA

Crystal structure of human gpx4 in complex with gxpep-1
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
165
structure length
164
Chain Sequence
b'DDWRAARSMHEFSAKDIDGHMVNLDKYRGFVSIVTNVASQGKTEVNYTQLVDLHARYAERGLRILAFPSNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKIEVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGVVVKRYGPMEEPLVIEKDLPHYF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phospholipid hydroperoxide glutathione peroxidase, mitochond
publication title Discovery of GPX4 inhibitory peptides from random peptide T7 phage display and subsequent structural analysis
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 60
structure length 164
sequence length 165
ec nomenclature ec 1.11.1.12: Phospholipid-hydroperoxide glutathione peroxidase.
pdb deposition date 2016-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00255 GSHPx Glutathione peroxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5h5qA00
4YAVA 1FW1A 1SU9A 3DWVA 4F2IA 2OJLA 4AJ8A 3D21A 1EGRA 2GQMA 2ES7A 1FG4A 4BVXA 1YEXA 4ECCA 3F6FA 2CZ2A 1T8EB 3MDKA 2MZCA 1DE1A 2XBIA 2MMZA 3TGZA 3LYPA 3C8EA 2VL9A 5B8BA 3CBUA 3K8NA 2L4CA 1UN2A 3Q18A 2E2MA 2C0EA 3IE3A 4L0UA 4KB3A 2YZUA 1PGTA 3RPPA 2EIRA 1OC9A 5COHA 3KTBA 1PKWA 4KW6A 1PSQA 5ID2A 4MH3A 4OD7A 3M9JA 3KMOA 4WF4A 4AJ6A 3GNJA 3G9BA 4KDYA 5B6NA 5FHIA 2OACA 2X64A 3M9KA 3W8SA 2XPDA 3F4SA 2FY6A 2B6MA 1QXHA 3VWXA 14GSA 3ZVJA 4MZWA 5IOXA 2V6OA 4TR1A 3TJGA 1EV9A 2F9SA 1K0AA 3SWLA 2QC7A 2F8AA 3UVTA 2WFCA 3ERGA 1XVWA 2H76A 5F05A 4TXOB 5D9XA 5F0GA 2DIZA 5KN1A 2VLVA 3IPZA 3RBTA 2VL2C 3TOTA 1VF1A 2VCQA 5GAND 2O89A 2JZTA 1KEBA 1XWAA 4YH2A 1Q98A 2DSAA 1PX6A 1AIUA 1ERTA 1K3YA 4PQIA 3UMAA 4TVEA 3GHAA 1CQGA 4TR4A 5IO0A 1N8JA 3TDGA 2LTKA 3C71A 5CAXA 2CQ9A 2NPBA 3RHBA 2PPTA 4FYCA 4EUYA 1V2AA 1VGLA 1ZYQB 1NHYA 4WR5A 4POBA 3MWHA 2AV4A 2O7KA 2WZ9A 1LBKA 5CYYA 3GV1A 1EZKA 4QL9A 1M7TA 5J5NA 5HR3A 2IL3A 2LQQA 2GZZA 5J3RA 2BJXA 4JBBA 1XOBA 1SJZA 2NDOA 4GWRA 1GNEA 1XVQA 1SL2B 4YQMA 3QAVA 1SK0A 1B9YC 2AUVA 4PXOA 4OFNA 3DIEA 2H6YA 4NHWA 4HI7A 1MDIA 1Y25A 3F6DA 3LWAA 4GCIA 4MH2A 2HZEB 2A2SA 3KM6A 5LCZA 3US3A 2IFQB 3GX8A 2DJJA 3BOAA 2ZNMA 2PWJA 1GSQA 3TCOA 2GT6A 4L5LA 1NM3A 3FY7A 4PURA 1X9SB 2ON7A 1YEPA 2H19A 2LUSA 4LMWA 2V6KA 1PX7A 22GSA 1BG5A 4WR4A 3UARA 1TDIA 3P8WA 3H93A 4NV2A 1OVNA 4KH7A 2EIOA 3UEMA 5JCUA 2LRTA 5EY6A 4OO4A 2TIRA 2PU9C 1F3AA 3QDNA 5J9CA 4TW5A 1TTZA 5CRDA 4IJIA 3WYWA 1XWCA 3ERFA 5GZZB 4ZBBA 1FOVA 3EC3A 3TRQA 4N0VA 3LEFA 1ZMAA 3F0IA 5B7CA 5CRHA 4ECBA 2ZUPA 4HQZA 1AUCA 1BJXA 3EURA 1SD8A 3FYGA 2LKUA 3EYTA 2CX3A 1W89A 2L59A 2MMOA 3ZMKA 2XPEA 4V2LA 3IR4A 1AAZA 2JZRA 5G30A 5H5RA 3TKPA 1JLVA 1AC1A 10GSA 1UC7A 2EIQA 1TI3A 1X9MB 1GWCA 1HYUA 2JACA 2WJUA 1T4YA 3KD0A 1K3OA 3UIWA 16GSA 4TXOA 1ZYEA 5ECLB 1B48A 2NTOA 2RM6A 2CZ3A 4IBPA 1FVJA 2DJKA 3TJFA 5ELGA 2TRXA 4EVMA 2L5LA 1U3AA 5ENUA 3HXSA 1SKWB 3L9VA 1R26A 3HZ8A 4EC0A 4WEYA 4OFTA 4QL7A 3RAZA 2YWMA 3BBYA 4KCAA 1FHEA 1BX9A 2VCTA 3HHVA 2HSHA 3PR8A 2YWIA 1BQ7A 1SYRA 1M2AA 2GSTA 3KCMA 3DMLA 2YJ7A 1G6YA 2MBTA 3ZREA 1GUKA 2MYGA 4GRFA 3VFIA 4IHUA 4IVFA 3BCKA 3WT2A 2E0QA 5EPFA 5G5FA 3APQA 2BMXA 4LLRA 2IWTA 4P3YB 4NV5A 3HJPA 1EP8A 1K0DA 2B3SA 3ZTLA 2L6CA 1GNWA 5DDLA 5G1KA 5CNWA 4BWSA 4MK3A 1I9DA 4OCEA 1WIKA 3ZRDA 5IQYA 1TI1A 4OWYA 1OKTA 1A0RP 2R4VA 1V57A 2GDRA 2VOCA 2GZPA 2HZEA 3QFAC 1QUWA 1PD21 5HFIA 4ULXA 4I2TA 2IFQA 2AJQB 2CAQA 4QQ7A 3AY8A 3HCZA 3TKSE 1SK2A 1MD4A 2GZYA 1TKDB 4ID0A 2XC2A 1X5EA 3VPQA 3ZZXA 4GSNA 3FR3A 2H1BA 3TJJA 2CX4A 2GLRA 4HDEA 3EU3A 3ZYWA 2OBIA 1JZWA 1A23A 1GSYA 2PGTA 1A2MA 5GSTA 1GL8A 3GMFA 1SJIA 3FZ4A 2N5FA 3APSA 2HFDA 2GT5A 3FK8A 1YKAA 2K8SA 2LJAA 4YQVA 3VWWA 2LJRA 1TK0B 4HZ4A 4IJ3A 4G2EA 2P5QA 3RPNA 1TRVA 1O81A 5HFKA 4K0GA 1AQVA 5B6MA 1M9BA 4GXZA 4WKWA 2LRCA 1JZOA 1B4QA 2BTOT 4AGSA 4N11A 4F0CA 5D73A 5HR1A 1GSEA 5ECIB 2VIMA 1M99A 3FZ5A 5J9BA 4GSTA 3PINA 1VF2A 4MPFA 2WS2A 4ZB8A 2FWFA 4KDXA 5AN1A 3GH9A 1TRWA 2OE1A 2JU5A 5ELAA 4HJMA 1OC3A 3EE2A 4HZ2A 2JZSA 4IELA 1OKDA 3H1NA 1U3IA 3KH7A 1PN9A 1EOGA 2F8FA 2ON5A 3EINA 2FLSA 1J9BA 2DJ2A 4XS6A 4RQRA 5CRGA 2FUG2 3DEXA 1AXDA 3IOSA 4PUFC 4Q5RA 3DYRA 5LNKe 4HJ2A 4IQ1A 3W8JA 4PNGA 1YZXA 1A2LA 5HQPA 2H6XA 3IC4A 5CP1A 5C00A 1TOFA 5CO3A 1ERVA 4NMUA 2DJ3A 1JHBA 4FO5A 3D0ZA 4O7HA 4L5OA 4KNDA 2E7PA 2FWEA 4JRRA 2I4AA 2WULA 2PMTA 1IYHA 3IAM2 2V2GA 4DVCA 3F4TA 2VLUA 4IS0A 5F07A 4MP4A 1ZL9A 5ECHB 1THOA 2VD1A 3MSZA 3VI5A 1SD9A 3BD2A 1BAYA 1JFUA 1G0TA 3TJKA 1SKRB 2YPMA 4MJAA 4EL1A 1YF1A 3QD9A 3I6AA 5JCWA 2B1KA 4PQHA 4X1UA 1S3AA 3ZVJD 4POKA 4K9ZA 4ML1A 4OFMA 3RHCA 2PN8A 3G7IA 2AHEA 5DAKB 5B8AA 1OE8A 4GLTA 3ZIJA 3EMPA 1WP0A 4XS4B 2QGVA 3WGEA 1O8XA 3IBHA 2HYXA 1EOHA 3D4TA 4DSSB 3GSSA 3R2QA 2X8HA 1U88A 1SK1A 1C72A 2FNOA 2QKEA 4NAXA 4POLA 5FWGA 4HU9A 1UVZA 1U6TA 4JR4A 5F8BA 1Z5YE 2C3NA 2X8GA 5HFGA 4KAEA 3O3TA 1FB0A 3U5RE 2GSSA 3E3EA 5HR0A 1V58A 4F82A 1SJ6A 1XZOA 1TU8A 3Q6OA 5D96A 1AW9A 6GSUA 5DALB 2C4JA 3QOUA 4H86A 3S9FA 3HKRA 4XHMA 2HLSA 1PL1A 4D73B 4EXJA 5EVOA 4TXVA 1TJDA 2YWOA 1GH2A 1GP1A 1FAAA 2V32A 4MPGA 3HD5A 4OCFA 4JZQA 2YJHA 1URMA 4ZL8A 4WBRD 2LNTA 5IOWA 1XCCA 4IP6A 4HS1A 1EEJA 5DVBA 5ECPB 4F0BA 3KJYA 1H75A 1VF3A 1N2AA 4PX1A 2HNLA 1HNAA 1PMTA 2PVOC 1EEMA 1R5PA 2R5GA 4J56E 2H75A 2LSTA 3DKSA 3D5JA 3ZLPA 1TK8B 3TB2A 3NOFA 3TKQA 1ACVA 1XFLA 3FR9A 4POMA 5A5KA 1T00A 2GTUA 2VAFA 1BYEA 3D6IA 3C1SA 2LV3A 5D9WA 3LG6A 1J0FA 3UL3A 2B7KA 3CSHA 3VWUA 3TUEA 2I1UA 3L78A 2F3MA 4I5QA 2R3XA 3GFKA 1GTIA 3CYNA 3CMIA 4N30A 4ML6A 4HEA2 4K7IA 5AGYA 2H1DA 3F9UA 2JL4A 1PL2A 5JWQB 3VWVA 4DSQA 2VD0A 3CRUA 2C80A 5ECKB 4BVYA 5ECMB 4EKZA 4FYUA 3WGXA 2C1YA 2OADA 3NIVA 3D22A 1OAZA 2X99A 1LU4A 2JSZA 2RUEA 2GS3A 5DAKA 1GUHA 2RM5A 1Z3EA 2AYTA 5AIXA 3IXRA 1FB6A 2GSRA 4MF7A 1XW9A 3GSTA 2KP1A 4XS4A 3HYPA 4J2FA 3G7JA 5JWOB 2VM1A 2H1GA 4MZCA 2M72A 3TRXA 3P7XA 1AQWA 4TN8A 1RW1A 3H8QA 2CVDA 5GSSA 4DSSA 3ZFLA 2PVQA 5IPHA 3H79A 4K7NA 1BEDA 3VPTA 6GSWA 3CXGA 2I3YA 2G2QA 2R6KA 5D8IA 1IYIA 2HXKA 2L6DA 3D4MA 3M1GA 2FD3A 5A4UA 4O32A 1Z7PA 3FRCA 2H71A 1X5CA 1Z7RA 2H01A 1H4OA 1OYJA 3G7YA 2A2RA 2H70A 4GTUA 5INYA 3QR6A 2HI7A 5CREA 1PRXA 4KDUA 3KMNA 1R5AA 1E6BA 3VK9A 3ZMLA 4NPBA 2C3TA 3DGQA 3A2XA 1THXA 3KP9A 5CRWA 3F4RA 2LQOA 4RI7A 1WRYA 20GSA 4N10A 1GULA 2TRCP 1MTCA 2R37A 3VLNA 1GSSA 1A8LA 1A2JA 5DALA 4ACSA 4DSRA 2H0HA 2M80A 4MJBA 4IN0A 4RQXA 3UBLA 6GSVA 4D73A 2H66A 2N5BA 4EF0A 3VURA 1KBNA 2EC4A 2GVPA 3KIJA 1I5GA 2WDUA 5A4VA 3QCPA 4ZL7A 2GSQA 1GRXA 2NBSA 1UA5A 3M3MA 1T7PB 3KGKA 1PKZA 2H6ZA 3O6TA 13GSA 1MD3A 2YWNA 2H72A 2RLIA 1XBSA 1S3DA 5EL8A 1TU7A 2K6VA 3GURA 4MCUA 5KN2A 3GL5A 3VI7A 2V1MA 1F37A 3CTFA 1K0MA 1M0UA 2H73A 2B5EA 2YOIA 3OR5A 1QK8A 1F3BA 1DUGA 5DJLA 2AB6A 4OO5A 3IV4A 4KA0A 4Q5QA 5H5SA 1O73A 4OMVA 5E59A 3Q19A 6GSXA 4F9ZA 2ZCTA 3HDCA 1EP7A 5G2ZA 17GSA 2B5XA 3IK7A 4ECJA 5FT3A 2VCXA 3ISOA 4ZBAA 1T3BA 3J7Yb 2LJKA 2YNXA 5IMVA 2J23A 4I6XA 3DVXA 2VO4A 2H1AA 2RIIA 4X43A 1YDKA 2HZFA 2WCIA 3I69A 3M8NA 3GIXA 4EE0A 4O5RA 1GUMA 2F51A 2C0DA 1ON4A 3KZQA 1R7HA 3LXTA 4JE1A 1VF4A 3IAS2 1X9WB 3NZNA 3IRAA 1NW2A 3BJ5A 3PGTA 1Q4JA 4MJEA 3L9UA 4PQ1A 4TR3A 1A0FA 4FYBA 4DEJA 2P0GA 1TW9A 1ZZYA 2OA7A 1R4WA 1YQ1A 3FR6A 3A3TA 3QMXA 1ZOFA 3F3RA 4K8MA 1DE2A 2HE3A 5IMAA 3TRPA 1SL0B 3UBKA 4MABA 4F03A 3N5OA 1WMJA 1V9WA 4JR6A 1GTUA 3BCIA 4EO3A 3HA9A 5F06A 3I9V2 3GYKA 2CT6A 4AJ7A 6GSYA 4K7OA 3A2VA 4LL4B 2CV4A 2VLTA 4I2UA 2LNSA 1Z9HA 4L8EA 1RK4A 3P2AA 4FH8A 2YZHA 3GKMA 3UAPA 1PA3A 4ZB9A 5G31A 2N5AA 4BPYA 3CSJA 3WD6A 4MF5A 2V41A 2VCVA 2NVLA 5KEJA 3ZITA 4IKHA 1QGVA 3FW2A 3PH9A 2B5YA 1A24A 3SBCA 1DBYA 1XWGA 1K0CA 1EWXA 5IIZA 2XHFA 4O92A 2YN1A 2PUKC 1FO5A 2IMFA 3FHKA 2HRFA 3CTGA 1F9MA 4GQCA 2VUPA 2J9HA 5IMZA 3ME7A 1V98A 3KH9A 4X0XA 4NWYA 4Q5NA 1A8YA 2VCWA 2XBQA 3APOA 2KHPA 2CA8A 1XOAA 1XPVA 1ZCPA 2DIYA 2I9HA 1QFNA 4ZILA 3TKSA 1TRSA 3TKSC 2B1LA 3GA4A 1ST9A 2GQKA 3KP8A 2REMA 2LEGA 3EWLA 3WGDA 1OC8A 3LFLA 1PQNA 1OE7A 5J4UA 1AQXA 3L9SA 4KX4A 2VL2A 3QPMA 3LQ7A 5H5QA 2DBCA 3IHQA 3ED3A 4K0NA 4WETA 5IPGA 4K1FA 2X8CA 4MLYA 5J41A 5KN0A 3FZ9A 4Q5FA 5IMDA 1K3LA 5JWRB 3KEBA 1ILOA 5ECRB 4YAPA 1WOUA 1WWJA 19GSA 4JEDA 3GTUB 1QMVA 3ZFBA 1EGOA 3O76A 1O6JA 1X5DA 1M2DA 4MMMA 3GKNA 1ML6A 1HQOA 3MAKA 2YANA 3L0HA 1XW5A 2IMIA 1E2YA 1J08A 4E8EA 4ISDA 1V40A 1M9AA 2KUCA 2K9FA 2IMEA 1XWKA 2OKAA 2DLXA 1JLWA 3ME8A 4V1Ap 4RI6A 5IMFA 1G6WA 1KNGA 3HJOA 2RUFA 2ALBA 5ABRA 3GL3A 1YJ6A 1HD2A 3LSZA 2P5RA 3DVWA 2HSYA 1W4VA 3EVIA 4XRAA 3C7MA 3E9JB 1VRSD 1SENA 4RUVA 2DC5A 2YV9A 2MMNA 3E0UA 2M46A 2MMAA 2WB9A 5DCGA 2DJ0A 3KXOA 4K2DA 4E8HA 8GSSA 3GX0A 2DJ1A 3H4KA 4KE3A 2LRNA 3Q74A 1F6MC 12GSA 2WGRA 3C1RA 4HQSA 2FWGA 5DJMA 1G7OA 2QSIA 11GSA 2L57A 2GQLA 1SL1B 2CAIA 4XTSA 4BL7A 1NSWA 1YF0A 5DQYA 3IA1A 2FA8A 2E2GA 1LJRA 3FZAA 5ECOB 4MF6A 3QAWA 4IQAA 5D93A 4YQUA 1K0NA 2IJYA 2IPAA 2DMLA 3JCML 3LGCA 4IGJA 2PBJA 1USBA 2JADA 2LS5A 4KSOA 2KLXA 4ZB6A 3GN3A 1WPIA 2GGTA 4IP1A 4PUAA 4HUAA 5HR2A 1T1VA 2A4VA 5C04A 4KSMA 3CRTA 4AF2A 5DCHA 1ERUA 3CSIA 4MZBA 1M2BA 3GRXA 5E4WA 4WXTA 2C0GA 4WBJA 9GSSA 4G10A 2IIYA 4J57E 4KCEA 4ZXGA 3QAGA 2H8LA 4CHSA 3FEUA 3DRNA 2FGXA 1SKSB 3F63A 1XW6A 1F2EA 2C3QA 3ZIVA 2KP2A 1XXUA 4FIWA 1DSBA 2AAWA 1GLPA 2MBSA 2B7JA 2L4QA 1GSUA 1S3CA 2G0FA 3P90A 2K18A 1MDKA 1TXXA 6GSSA 3GKXA 1O85A 3C73A 5ECSA 2CVBA 2WRTA 1Z6NA 3WT1A 2IMDA 4XS1A 2H30A 3F3QA 4IW9A 2OE3A 1CQHA 1T4ZA 5KN3A 2FWHA 1KTEA 3GH6A 2CVKA 1Z6MA 4ILFA 3IDVA 4TRXA 3LORA 4LMVA 1MDJA 4MA9A 2FCHA 3TJBA 2OBKA 4L0WA 3L4NA 5G5EA 3LXZA 3ERWA 1O7UA 5D9VA 5IMCA 1K0BA 2PERA 5G1LA 2C0FA 3F8UA 3GTUA 1HNBA 4CDOA 2D2ZA 6GSTA 4G19A 1B4PA 2H74A 1GSDA 1OC9B 2HT9A 4GSSA 4MJCA 1RQMA 1GSFA 2FHEA 3A5WA 4V1Ag 4HU7A 1ZGNA 2IN3A 5ID2B 3HJMA 1TP9A 2P31A 2H0IA 4PNFA 1Y6EA 1XWBA 2R2JA 5D9TA 1NHOA 5ECQB 4V2NA 1ERWA 4HOJA 3A2WA 1ABAA 2FA4A 4GF0A 1TK5B 3QFBC 4V2MA 4CW9A 4I97A 3ZL5A 4TR1B 1B8XA 4BA7A 1GLQA 3LJRA 4XIHA 4MDCA 2I81A 3IK9A 4ZBDA 4LL1B 4BWQA 4N0ZA 5DQSA 4ZIJA 2O87A 4XCSA 2O85A 2HRNA 3FKFA 1B9XC 3GUSA 1XIYA 1QQ2A 2DMMA 4KUNA 3I43A 3UVHA 1U87A 5AIVA 5LD0A 3GKKA 2YP6A 3HVXA 18GSA 2VM2A 3U6VA 5DBQA 4G9HA 3TKRA 5IM9A 1JZDA 2L5OA 3EU4A 4K6XA 4TOPA 2IMKA 4EDZA 4XRDA 1WE0A 1O8WA 3LYKA 2OE0A 1SYXA 2C8UA 2O8VB 1K0OA 3KTLA 1MEKA 1WJKA 3UJ1A 1JZRA 4PGTA 1YKCA 1FVKA 2K8VA 2YCDA 3MNGA 4ZL9A 2YV7A 4TR0A 2JSYA 3HY2A 1EV4A 2VL3A 1YY7A 2Z9SA 3DD3A 4EDYA 1TRUA 3RDWA 5ECNB 3TOUA 3EMXA 4TKYA 4NXIA 5JCGA 5A4WA 1X0RA 4JU5A 3HZ4A 1GTBA 4LA1A 3DXBA 4KGIA 3W6GA 5L71A 3J7Yk 4ECIA 1GTAA 5IO2A 3N9JA 5GAPD 2VCZA 1G7EA 2H0GA 3HVVA 4WF5A 2KOKA 3UOMA 4NHZA 1HNCA 5AISA 7GSSA 3HVSA 3M0FA 4I8BA 3V1WA 4GQFA 4Z7XA
chains in the Genus database with same CATH superfamily
3MIXA 4YAVA 1FW1A 1SU9A 3DWVA 4F2IA 2OJLA 4AJ8A 3D21A 1EGRA 2GQMA 2ES7A 1FG4A 4BVXA 1YEXA 4ECCA 3F6FA 2CZ2A 1T8EB 3MDKA 2MZCA 1DE1A 2XBIA 2MMZA 3TGZA 3LYPA 3C8EA 2VL9A 4O5QA 5B8BA 3CBUA 3K8NA 2L4CA 1UN2A 3Q18A 2E2MA 2C0EA 3IE3A 4L0UA 4KB3A 2YZUA 1PGTA 3RPPA 2EIRA 1OC9A 5COHA 3KTBA 1PKWA 4KW6A 1PSQA 5ID2A 4MH3A 4OD7A 3M9JA 3KMOA 4WF4A 4AJ6A 3GNJA 3G9BA 4KDYA 5B6NA 5FHIA 2OACA 2X64A 3M9KA 3W8SA 2XPDA 3F4SA 1PN0A 2FY6A 2B6MA 1QXHA 3VWXA 14GSA 3ZVJA 4G0LA 4MZWA 5IOXA 2V6OA 4TR1A 3TJGA 1EV9A 2F9SA 1K0AA 3SWLA 2QC7A 2F8AA 3UVTA 2WFCA 3ERGA 1XVWA 2H76A 5F05A 4TXOB 5D9XA 5F0GA 2DIZA 5KN1A 2VLVA 3IPZA 3RBTA 2VL2C 3TOTA 1VF1A 2VCQA 5KOXA 5GAND 2O89A 2JZTA 1KEBA 1XWAA 4YH2A 1Q98A 2DSAA 1PX6A 1AIUA 1ERTA 1K3YA 4PQIA 3UMAA 4TVEA 3GHAA 1CQGA 4TR4A 5IO0A 1N8JA 3TDGA 2LTKA 3C71A 5CAXA 2CQ9A 2NPBA 3RHBA 2HRAA 2PPTA 4FYCA 4EUYA 1V2AA 1VGLA 1ZYQB 3FMWA 1NHYA 4WR5A 4POBA 3MWHA 4EIPA 2AV4A 2O7KA 2WZ9A 1LBKA 5CYYA 3GV1A 1EZKA 4QL9A 1M7TA 5J5NA 5HR3A 1XG8A 2IL3A 2LQQA 2GZZA 5J3RA 2BJXA 4JBBA 1XOBA 1SJZA 2NDOA 4GWRA 1GNEA 1XVQA 1SL2B 4YQMA 3QAVA 1SK0A 1B9YC 2AUVA 4PXOA 4OFNA 3DIEA 2H6YA 4NHWA 4HI7A 1MDIA 2QA2A 1Y25A 3F6DA 3LWAA 4GCIA 4MH2A 4CY8A 2HZEB 2A2SA 2R0GA 3KM6A 5LCZA 3US3A 2IFQB 3GX8A 2DJJA 3BOAA 2ZNMA 2PWJA 1GSQA 3TCOA 2GT6A 4L5LA 1NM3A 3FY7A 4PURA 1X9SB 2ON7A 1YEPA 2H19A 2LUSA 4LMWA 2V6KA 1PX7A 22GSA 1BG5A 4WR4A 3UARA 1TDIA 3P8WA 3H93A 4NV2A 1OVNA 4KH7A 2EIOA 3UEMA 5JCUA 2LRTA 5EY6A 4OO4A 2TIRA 2PU9C 1F3AA 3QDNA 5J9CA 4TW5A 1TTZA 5CRDA 4IJIA 3WYWA 1XWCA 3ERFA 5GZZB 4ZBBA 1FOVA 3EC3A 3TRQA 4N0VA 3LEFA 1ZMAA 3F0IA 5B7CA 5CRHA 4ECBA 2ZUPA 4HQZA 1AUCA 1BJXA 3EURA 1SD8A 3FYGA 2LKUA 3EYTA 2CX3A 1W89A 2L59A 2MMOA 3ZMKA 2XPEA 4V2LA 3IR4A 1AAZA 2JZRA 5G30A 5H5RA 3TKPA 1JLVA 1AC1A 10GSA 1UC7A 2EIQA 1TI3A 1X9MB 1GWCA 1HYUA 2JACA 2WJUA 1T4YA 3KD0A 4Z2RA 1K3OA 3UIWA 16GSA 4TXOA 1ZYEA 5ECLB 1B48A 2NTOA 2RM6A 2CZ3A 4IBPA 1FVJA 2DJKA 3TJFA 5ELGA 2TRXA 4EVMA 2L5LA 1U3AA 5ENUA 3HXSA 1SKWB 3L9VA 1R26A 3HZ8A 4EC0A 4WEYA 4OFTA 4QL7A 3RAZA 2YWMA 3BBYA 4KCAA 1FHEA 1BX9A 2VCTA 3HHVA 3PPUA 4O5UA 4ICYA 2HSHA 3PR8A 2YWIA 1BQ7A 1SYRA 1M2AA 2GSTA 3KCMA 3DMLA 2YJ7A 1G6YA 2MBTA 3ZREA 1GUKA 2MYGA 4GRFA 3VFIA 4IHUA 4IVFA 2HRKA 3BCKA 3WT2A 4USSA 2E0QA 5EPFA 5G5FA 3APQA 2BMXA 4LLRA 2IWTA 4P3YB 4NV5A 3HJPA 1EP8A 1K0DA 2B3SA 3ZTLA 2L6CA 1GNWA 5DDLA 5G1KA 5CNWA 4BWSA 4MK3A 1I9DA 4OCEA 1WIKA 3ZRDA 5IQYA 1TI1A 4OWYA 1OKTA 1A0RP 2R4VA 1V57A 2GDRA 2VOCA 2GZPA 2HZEA 1PFOA 3QFAC 1QUWA 1PD21 5HFIA 4ULXA 4I2TA 2IFQA 2AJQB 2CAQA 4QQ7A 3AY8A 3HCZA 3TKSE 1SK2A 1MD4A 2GZYA 1TKDB 4ID0A 2XC2A 1X5EA 3VPQA 3ZZXA 4GSNA 3FR3A 2H1BA 3TJJA 2CX4A 2GLRA 4HDEA 3EU3A 3ZYWA 4Z2TA 2OBIA 1JZWA 1A23A 1GSYA 2PGTA 1A2MA 5GSTA 1GL8A 3GMFA 1SJIA 3FZ4A 2N5FA 3APSA 2HFDA 2GT5A 3FK8A 1YKAA 4CY6A 2K8SA 2LJAA 4YQVA 3VWWA 3IHGA 2LJRA 1TK0B 2DKHA 4HZ4A 4IJ3A 4G2EA 2P5QA 3RPNA 1TRVA 1O81A 5HFKA 4K0GA 1AQVA 5B6MA 1M9BA 4GXZA 4WKWA 2LRCA 1JZOA 1B4QA 2BTOT 4AGSA 4N11A 4F0CA 5D73A 5HR1A 1GSEA 5ECIB 2VIMA 1M99A 3FZ5A 5J9BA 4GSTA 3PINA 1VF2A 4MPFA 2WS2A 4ZB8A 2FWFA 4KDXA 5AN1A 3GH9A 1TRWA 2OE1A 2JU5A 5ELAA 4HJMA 1OC3A 3EE2A 4HZ2A 2JZSA 4IELA 1OKDA 3H1NA 1U3IA 3KH7A 1PN9A 1EOGA 2F8FA 2ON5A 3EINA 2FLSA 1J9BA 2DJ2A 4XS6A 4RQRA 5CRGA 2FUG2 3DEXA 1AXDA 3IOSA 4PUFC 4Q5RA 3DYRA 5LNKe 4HJ2A 4IQ1A 3W8JA 4PNGA 1YZXA 1A2LA 5HQPA 2H6XA 3IC4A 5CP1A 5C00A 1TOFA 5CO3A 1ERVA 4NMUA 2DJ3A 1JHBA 4FO5A 3D0ZA 4O7HA 4L5OA 4YKFA 4KNDA 2E7PA 2FWEA 4JRRA 2I4AA 2WULA 2PMTA 1IYHA 3IAM2 2V2GA 4DVCA 3F4TA 2VLUA 4IS0A 5F07A 4MP4A 1ZL9A 5ECHB 1THOA 2VD1A 3MSZA 3VI5A 1SD9A 3BD2A 1BAYA 1JFUA 1G0TA 3TJKA 1SKRB 2YPMA 4MJAA 4EL1A 1YF1A 3QD9A 3I6AA 5JCWA 2B1KA 4PQHA 4X1UA 4BVYB 1S3AA 3ZVJD 4POKA 4K9ZA 4ML1A 4OFMA 3RHCA 2PN8A 3G7IA 2AHEA 5DAKB 5B8AA 1OE8A 4GLTA 4Z2UA 3ZIJA 3EMPA 1WP0A 4XS4B 2QGVA 3WGEA 1O8XA 3IBHA 2HYXA 1EOHA 3D4TA 4DSSB 3GSSA 3R2QA 2X8HA 1U88A 1SK1A 1C72A 2FNOA 2QKEA 4NAXA 4POLA 5FWGA 4HU9A 1UVZA 1U6TA 2DKIA 4YKGA 4JR4A 5F8BA 1Z5YE 2C3NA 2X8GA 5HFGA 4KAEA 3O3TA 1FB0A 3U5RE 2GSSA 3E3EA 5HR0A 1V58A 4F82A 1SJ6A 1XZOA 1TU8A 3Q6OA 5D96A 3LW9A 1AW9A 6GSUA 5DALB 2C4JA 3QOUA 4H86A 3S9FA 3HKRA 4XHMA 2HLSA 1PL1A 4D73B 4EXJA 5EVOA 4TXVA 1TJDA 2YWOA 1GH2A 1GP1A 1FAAA 2V32A 4MPGA 3HD5A 4OCFA 4JZQA 2YJHA 1URMA 4ZL8A 4WBRD 2LNTA 5IOWA 1XCCA 4K5SA 4IP6A 4HS1A 1EEJA 5DVBA 5ECPB 4F0BA 3KJYA 4FQUA 1H75A 1VF3A 1N2AA 4PX1A 2HNLA 1HNAA 1PMTA 2PVOC 1EEMA 1R5PA 2R5GA 4J56E 2H75A 2LSTA 3DKSA 3D5JA 3ZLPA 1TK8B 3TB2A 3NOFA 3TKQA 1ACVA 1XFLA 3FR9A 4POMA 5A5KA 1T00A 2GTUA 2VAFA 1BYEA 3D6IA 3C1SA 2LV3A 5D9WA 3LG6A 1J0FA 4MNNA 3UL3A 2B7KA 3CSHA 3VWUA 3TUEA 2I1UA 3L78A 2F3MA 4I5QA 2R3XA 3GFKA 1GTIA 3CYNA 3CMIA 1FOHA 4N30A 4ML6A 4HEA2 4K7IA 5AGYA 2H1DA 3F9UA 2JL4A 1PL2A 5JWQB 3VWVA 4DSQA 2VD0A 3CRUA 2C80A 5ECKB 4BVYA 5ECMB 4EKZA 4FYUA 3WGXA 2C1YA 2OADA 3NIVA 3D22A 1OAZA 2X99A 1LU4A 2JSZA 2RUEA 2GS3A 5DAKA 1GUHA 2RM5A 1Z3EA 2AYTA 5AIXA 3IXRA 1FB6A 2GSRA 4MF7A 1XW9A 3GSTA 2KP1A 4XS4A 3HYPA 4J2FA 3G7JA 5JWOB 2VM1A 2H1GA 4MZCA 2M72A 3TRXA 3P7XA 1AQWA 4TN8A 1RW1A 3H8QA 2CVDA 5GSSA 4DSSA 3ZFLA 2PVQA 5IPHA 3H79A 4K7NA 1BEDA 3VPTA 6GSWA 3CXGA 2I3YA 2G2QA 2R6KA 5D8IA 1IYIA 2HXKA 5BMUA 2L6DA 3D4MA 3M1GA 2UZ8A 2FD3A 5A4UA 4O32A 1Z7PA 3FRCA 2H71A 1X5CA 1Z7RA 2H01A 1H4OA 1OYJA 3G7YA 2A2RA 2H70A 4GTUA 5INYA 3QR6A 2HI7A 5CREA 1PRXA 4KDUA 3KMNA 4A5PA 1R5AA 1E6BA 3VK9A 3ZMLA 4NPBA 2C3TA 3DGQA 3A2XA 1THXA 3KP9A 5CRWA 3F4RA 2LQOA 4RI7A 1WRYA 20GSA 4N10A 1GULA 2A2PA 2TRCP 1MTCA 2R37A 3VLNA 1GSSA 1A8LA 1A2JA 5DALA 4G0IA 4ACSA 4DSRA 3CQFA 2H0HA 2M80A 4MJBA 4IN0A 4RQXA 3UBLA 6GSVA 4D73A 2H66A 2N5BA 4EF0A 3VURA 1KBNA 2EC4A 2GVPA 3KIJA 1I5GA 2WDUA 5A4VA 3QCPA 4ZL7A 2GSQA 1GRXA 2NBSA 1UA5A 3M3MA 1T7PB 3KGKA 1PKZA 2H6ZA 3O6TA 13GSA 1MD3A 2YWNA 2H72A 2RLIA 1XBSA 1S3DA 5EL8A 1TU7A 2K6VA 3GURA 4MCUA 5KN2A 3GL5A 3VI7A 2V1MA 1F37A 3CTFA 1K0MA 1M0UA 2H73A 2B5EA 2YOIA 3OR5A 1QK8A 1F3BA 1DUGA 5DJLA 2AB6A 4OO5A 3IV4A 4KA0A 4Q5QA 5H5SA 1O73A 4OMVA 5E59A 3Q19A 6GSXA 4F9ZA 2ZCTA 3HDCA 1EP7A 5G2ZA 17GSA 2B5XA 3IK7A 4ECJA 5FT3A 2VCXA 3ISOA 4ZBAA 1T3BA 3J7Yb 2LJKA 2YNXA 5IMVA 2J23A 4I6XA 3DVXA 2VO4A 2H1AA 2RIIA 4X43A 1YDKA 2HZFA 2WCIA 3I69A 3M8NA 3GIXA 4EE0A 4O5RA 1GUMA 2F51A 2C0DA 1ON4A 3KZQA 1R7HA 3LXTA 4JE1A 1VF4A 3IAS2 1X9WB 3NZNA 3IRAA 1NW2A 3BJ5A 3PGTA 1Q4JA 4MJEA 3EPTA 3L9UA 4PQ1A 4TR3A 1A0FA 4FYBA 4DEJA 2P0GA 1TW9A 1ZZYA 4X4JA 2OA7A 1R4WA 1YQ1A 3FR6A 3A3TA 3QMXA 1ZOFA 3F3RA 4K8MA 1DE2A 2HE3A 5IMAA 3TRPA 1SL0B 3UBKA 4MABA 5KOWA 4F03A 3N5OA 4BL7B 1WMJA 1V9WA 4JR6A 1GTUA 3BCIA 4EO3A 3HA9A 5F06A 3I9V2 3GYKA 2CT6A 4AJ7A 6GSYA 4K7OA 3A2VA 4LL4B 2CV4A 2VLTA 4I2UA 2LNSA 1Z9HA 4L8EA 1RK4A 3P2AA 4FH8A 2YZHA 3GKMA 3UAPA 1PA3A 4ZB9A 5G31A 2N5AA 4BPYA 3CSJA 3WD6A 4MF5A 2V41A 2VCVA 2QA1A 2NVLA 5KEJA 3ZITA 4IKHA 1QGVA 3FW2A 3PH9A 2B5YA 1A24A 3SBCA 1DBYA 1XWGA 1K0CA 1EWXA 5IIZA 2XHFA 4O92A 2YN1A 2PUKC 1FO5A 2IMFA 4HSCX 3FHKA 2HRFA 3CTGA 1F9MA 4GQCA 2VUPA 2J9HA 5IMZA 3ME7A 1V98A 3KH9A 4X0XA 4NWYA 4Q5NA 1A8YA 2VCWA 2XBQA 3APOA 2KHPA 2CA8A 1XOAA 1XPVA 1ZCPA 2DIYA 2I9HA 1QFNA 4ZILA 3TKSA 1TRSA 3TKSC 2B1LA 3GA4A 1ST9A 2GQKA 3KP8A 2REMA 2LEGA 3EWLA 3WGDA 1OC8A 3LFLA 1PQNA 1OE7A 5J4UA 1AQXA 3L9SA 4KX4A 3IC8A 2VL2A 3QPMA 3LQ7A 5H5QA 2DBCA 3IHQA 3ED3A 4K0NA 4WETA 5IPGA 4K1FA 2X8CA 4MLYA 5J41A 5KN0A 3FZ9A 4Q5FA 5IMDA 1K3LA 5JWRB 3KEBA 1M3IA 1ILOA 5ECRB 4PTSA 4YAPA 1WOUA 1WWJA 19GSA 4JEDA 3GTUB 1QMVA 3ZFBA 1EGOA 3O76A 1O6JA 1X5DA 1M2DA 4MMMA 3GKNA 1ML6A 1HQOA 3MAKA 2YANA 3L0HA 1XW5A 2IMIA 2X49A 1E2YA 1J08A 4E8EA 4ISDA 1V40A 1M9AA 2KUCA 2K9FA 2IMEA 1XWKA 2OKAA 2DLXA 1JLWA 3ME8A 4V1Ap 4RI6A 5IMFA 1G6WA 1KNGA 3HJOA 2RUFA 2ALBA 3R3EA 5ABRA 3GL3A 1YJ6A 1HD2A 3LSZA 2P5RA 3DVWA 2HSYA 1W4VA 3EVIA 4K5RA 4XRAA 3C7MA 3E9JB 1VRSD 1SENA 4RUVA 2DC5A 2YV9A 2MMNA 3E0UA 2M46A 2MMAA 2WB9A 5DCGA 2DJ0A 3KXOA 4K2DA 4E8HA 8GSSA 3GX0A 2DJ1A 3H4KA 4KE3A 2LRNA 3Q74A 1F6MC 12GSA 2WGRA 3C1RA 2HSMA 4HQSA 2FWGA 5DJMA 1G7OA 2QSIA 11GSA 2L57A 2GQLA 1SL1B 2CAIA 4XTSA 4BL7A 1NSWA 1YF0A 5DQYA 3IA1A 2FA8A 2E2GA 1LJRA 3FZAA 5ECOB 4MF6A 3QAWA 4IQAA 5D93A 4YQUA 1K0NA 2IJYA 2IPAA 2DMLA 3JCML 3LGCA 4IGJA 2PBJA 1USBA 2JADA 2LS5A 4KSOA 2KLXA 4ZB6A 3GN3A 1WPIA 2GGTA 4IP1A 4PUAA 4HUAA 2R0PA 1T1VA 2A4VA 5HR2A 5C04A 4KSMA 3CRTA 4AF2A 5DCHA 1ERUA 3CSIA 4MZBA 1M2BA 3GRXA 5E4WA 4WXTA 2C0GA 4WBJA 9GSSA 4G10A 2IIYA 4J57E 4KCEA 4ZXGA 3QAGA 1ZYPA 2A4HA 2H8LA 3MYDA 4CHSA 3FEUA 3DRNA 2FGXA 1SKSB 3F63A 1XW6A 1F2EA 2C3QA 3ZIVA 2KP2A 1XXUA 4FIWA 1DSBA 2AAWA 1GLPA 2MBSA 2B7JA 3HVNA 2L4QA 1GSUA 1S3CA 2G0FA 3P90A 2K18A 1MDKA 1TXXA 6GSSA 3GKXA 1O85A 4G0KA 3C73A 5ECSA 2CVBA 2WRTA 1Z6NA 3WT1A 4EIQA 2IMDA 4XS1A 2H30A 3F3QA 4IW9A 2OE3A 1CQHA 1T4ZA 5KN3A 2FWHA 1KTEA 3GH6A 2R0CA 2CVKA 1Z6MA 4BVXB 4ILFA 3IDVA 4TRXA 1S3RA 4KF9A 3LORA 4LMVA 1MDJA 4MA9A 2FCHA 3TJBA 2OBKA 5BRTA 4L0WA 3L4NA 5G5EA 3LXZA 3ERWA 1O7UA 5D9VA 5IMCA 1K0BA 2PERA 5G1LA 2C0FA 3F8UA 3GTUA 1HNBA 4CDOA 2D2ZA 6GSTA 4G19A 1B4PA 2H74A 1GSDA 1OC9B 2HT9A 4GSSA 4MJCA 1RQMA 1GSFA 2FHEA 3A5WA 4V1Ag 4HU7A 1ZGNA 2IN3A 3A5IA 5ID2B 3HJMA 1TP9A 2P31A 2H0IA 4PNFA 1Y6EA 1XWBA 2R2JA 5D9TA 1NHOA 5ECQB 4V2NA 1ERWA 4HOJA 3A2WA 1ABAA 2FA4A 4GF0A 1TK5B 3QFBC 4V2MA 4CW9A 4I97A 3ZL5A 4TR1B 1B8XA 4BA7A 1GLQA 3LJRA 4XIHA 4MDCA 2I81A 3IK9A 4ZBDA 4LL1B 4BWQA 4N0ZA 5DQSA 4ZIJA 2O87A 4XCSA 2O85A 4BIKA 2HRNA 3FKFA 1B9XC 3GUSA 1XIYA 1QQ2A 2DMMA 4KUNA 3I43A 3UVHA 1U87A 5AIVA 5LD0A 3GKKA 2YP6A 3HVXA 18GSA 2VM2A 3U6VA 5DBQA 4G9HA 3TKRA 5IM9A 1JZDA 2L5OA 3EU4A 4K6XA 4TOPA 2IMKA 1ZYNA 4EDZA 4XRDA 1WE0A 1O8WA 2X4AA 3LYKA 2OE0A 1SYXA 2C8UA 2O8VB 1K0OA 3KTLA 1MEKA 1WJKA 3UJ1A 1JZRA 4PGTA 1YKCA 1FVKA 2K8VA 2YCDA 3MNGA 4ZL9A 2YV7A 4TR0A 2JSYA 3HY2A 1EV4A 2VL3A 1YY7A 2Z9SA 3DD3A 4EDYA 1TRUA 3RDWA 5ECNB 1M3JA 3TOUA 3EMXA 4TKYA 4NXIA 5JCGA 5A4WA 1X0RA 4K2XA 4JU5A 3HZ4A 1GTBA 4LA1A 3DXBA 4KGIA 3W6GA 5L71A 3J7Yk 4ECIA 1GTAA 5IO2A 3N9JA 5GAPD 2VCZA 1G7EA 2H0GA 3HVVA 4WF5A 2KOKA 3UOMA 4NHZA 1HNCA 5AISA 7GSSA 3HVSA 3M0FA 4I8BA 3V1WA 4GQFA 4Z7XA
chains in the Genus database with same CATH topology
3MIXA 4YAVA 1FW1A 1SU9A 3DWVA 4F2IA 2OJLA 4AJ8A 3D21A 1EGRA 2GQMA 2ES7A 1FG4A 4BVXA 1YEXA 4ECCA 3F6FA 2CZ2A 1T8EB 3MDKA 2MZCA 1DE1A 2XBIA 2MMZA 3TGZA 3LYPA 3C8EA 2VL9A 4O5QA 5B8BA 3CBUA 3K8NA 2L4CA 1UN2A 3Q18A 2E2MA 2C0EA 3IE3A 4L0UA 4KB3A 2YZUA 1PGTA 3RPPA 2EIRA 1OC9A 5COHA 3KTBA 1PKWA 4KW6A 1PSQA 5ID2A 4MH3A 4OD7A 3M9JA 3KMOA 4WF4A 4AJ6A 3GNJA 3G9BA 4KDYA 5B6NA 5FHIA 2OACA 2X64A 3M9KA 3W8SA 2XPDA 3F4SA 1PN0A 2FY6A 2B6MA 1QXHA 3VWXA 14GSA 3ZVJA 4G0LA 4MZWA 5IOXA 2V6OA 4TR1A 3TJGA 1EV9A 2F9SA 1K0AA 3SWLA 2QC7A 2F8AA 3UVTA 2WFCA 3ERGA 1XVWA 2H76A 5F05A 4TXOB 5D9XA 5F0GA 2DIZA 5KN1A 2VLVA 3IPZA 3RBTA 2VL2C 3TOTA 1VF1A 2VCQA 5KOXA 5GAND 2O89A 2JZTA 1KEBA 1XWAA 4YH2A 1Q98A 2DSAA 1PX6A 1AIUA 1ERTA 1K3YA 4PQIA 3UMAA 4TVEA 3GHAA 1CQGA 4TR4A 5IO0A 1N8JA 3TDGA 2LTKA 3C71A 5CAXA 2CQ9A 2NPBA 3RHBA 2HRAA 2PPTA 4FYCA 4EUYA 1V2AA 1VGLA 1ZYQB 3FMWA 1NHYA 4WR5A 4POBA 3MWHA 4EIPA 2AV4A 2O7KA 2WZ9A 1LBKA 5CYYA 3GV1A 1EZKA 4QL9A 1M7TA 5J5NA 5HR3A 2IL3A 2LQQA 2GZZA 5J3RA 2BJXA 4JBBA 1XOBA 1SJZA 2NDOA 4GWRA 1GNEA 1XVQA 1SL2B 4YQMA 3QAVA 1SK0A 1B9YC 2AUVA 4PXOA 4OFNA 3DIEA 2H6YA 4NHWA 4HI7A 1MDIA 2QA2A 1Y25A 3F6DA 3LWAA 4GCIA 4MH2A 4CY8A 2HZEB 2A2SA 2R0GA 3KM6A 5LCZA 3US3A 2IFQB 3GX8A 2DJJA 3BOAA 2ZNMA 2PWJA 1GSQA 3TCOA 2GT6A 4L5LA 1NM3A 3FY7A 4PURA 1X9SB 2ON7A 1YEPA 2H19A 2LUSA 4LMWA 2V6KA 1PX7A 22GSA 1BG5A 4WR4A 3UARA 1TDIA 3P8WA 3H93A 4NV2A 1OVNA 4KH7A 2EIOA 3UEMA 5JCUA 2LRTA 5EY6A 4OO4A 2TIRA 2PU9C 1F3AA 3QDNA 5J9CA 4TW5A 1TTZA 5CRDA 4IJIA 3WYWA 1XWCA 3ERFA 5GZZB 4ZBBA 1FOVA 3EC3A 3TRQA 4N0VA 3LEFA 1ZMAA 3F0IA 5B7CA 5CRHA 4ECBA 2ZUPA 4HQZA 1AUCA 1BJXA 3EURA 1SD8A 3FYGA 2LKUA 3EYTA 2CX3A 1W89A 2L59A 2MMOA 3ZMKA 2XPEA 4V2LA 3IR4A 1AAZA 2JZRA 5G30A 5H5RA 3TKPA 1JLVA 1AC1A 10GSA 1UC7A 2EIQA 1TI3A 1X9MB 1GWCA 1HYUA 2JACA 2WJUA 1T4YA 3KD0A 4Z2RA 1K3OA 3UIWA 16GSA 4TXOA 1ZYEA 5ECLB 1B48A 2NTOA 2RM6A 2CZ3A 4IBPA 1FVJA 2DJKA 3TJFA 5ELGA 2TRXA 4EVMA 2L5LA 1U3AA 5ENUA 3HXSA 1SKWB 3L9VA 1R26A 3HZ8A 4EC0A 4WEYA 4OFTA 4QL7A 3RAZA 2YWMA 3BBYA 4KCAA 1FHEA 1BX9A 2VCTA 3HHVA 3PPUA 4O5UA 4ICYA 2HSHA 3PR8A 2YWIA 1BQ7A 1SYRA 1M2AA 2GSTA 3KCMA 3DMLA 2YJ7A 1G6YA 2MBTA 3ZREA 1GUKA 2MYGA 4GRFA 3VFIA 4IHUA 4IVFA 2HRKA 3BCKA 3WT2A 4USSA 2E0QA 5EPFA 5G5FA 3APQA 2BMXA 4LLRA 2IWTA 4P3YB 4NV5A 3HJPA 1EP8A 1K0DA 2B3SA 3ZTLA 2L6CA 1GNWA 5DDLA 5G1KA 5CNWA 4BWSA 4MK3A 1I9DA 4OCEA 1WIKA 3ZRDA 5IQYA 1TI1A 4OWYA 1OKTA 1A0RP 2R4VA 1V57A 2GDRA 2VOCA 2GZPA 2HZEA 3QFAC 1QUWA 1PD21 5HFIA 4ULXA 4I2TA 2IFQA 2AJQB 2CAQA 4QQ7A 3AY8A 3HCZA 3TKSE 1SK2A 1MD4A 2GZYA 1TKDB 4ID0A 2XC2A 1X5EA 3VPQA 3ZZXA 4GSNA 3FR3A 2H1BA 3TJJA 2CX4A 2GLRA 4HDEA 3EU3A 3ZYWA 4Z2TA 2OBIA 1JZWA 1A23A 1GSYA 2PGTA 1A2MA 5GSTA 1GL8A 3GMFA 1SJIA 3FZ4A 2N5FA 3APSA 2HFDA 2GT5A 3FK8A 1YKAA 4CY6A 2K8SA 2LJAA 4YQVA 3VWWA 3IHGA 2LJRA 1TK0B 2DKHA 4HZ4A 4IJ3A 4G2EA 2P5QA 3RPNA 1TRVA 1O81A 5HFKA 4K0GA 1AQVA 5B6MA 1M9BA 4GXZA 4WKWA 2LRCA 1JZOA 1B4QA 2BTOT 4AGSA 4N11A 4F0CA 5D73A 5HR1A 1GSEA 5ECIB 2VIMA 1M99A 3FZ5A 5J9BA 4GSTA 3PINA 1VF2A 4MPFA 2WS2A 4ZB8A 2FWFA 4KDXA 5AN1A 3GH9A 1TRWA 2OE1A 2JU5A 5ELAA 4HJMA 1OC3A 3EE2A 4HZ2A 2JZSA 4IELA 1OKDA 3H1NA 1U3IA 3KH7A 1PN9A 1EOGA 2F8FA 2ON5A 3EINA 2FLSA 1J9BA 2DJ2A 4XS6A 4RQRA 5CRGA 2FUG2 3DEXA 1AXDA 3IOSA 4PUFC 4Q5RA 3DYRA 5LNKe 4HJ2A 4IQ1A 3W8JA 4PNGA 1YZXA 1A2LA 5HQPA 2H6XA 3IC4A 5CP1A 5C00A 1TOFA 5CO3A 1ERVA 4NMUA 2DJ3A 1JHBA 4FO5A 3D0ZA 4O7HA 4L5OA 4YKFA 4KNDA 2E7PA 2FWEA 4JRRA 2I4AA 2WULA 2PMTA 1IYHA 3IAM2 2V2GA 4DVCA 3F4TA 2VLUA 4IS0A 5F07A 4MP4A 1ZL9A 5ECHB 1THOA 2VD1A 3MSZA 3VI5A 1SD9A 3BD2A 1BAYA 1JFUA 1G0TA 3TJKA 1SKRB 2YPMA 4MJAA 4EL1A 1YF1A 3QD9A 3I6AA 5JCWA 2B1KA 4PQHA 4X1UA 4BVYB 1S3AA 3ZVJD 4POKA 4K9ZA 4ML1A 4OFMA 3RHCA 2PN8A 3G7IA 2AHEA 5DAKB 5B8AA 1OE8A 4GLTA 4Z2UA 3ZIJA 3EMPA 1WP0A 4XS4B 2QGVA 3WGEA 1O8XA 3IBHA 2HYXA 1EOHA 3D4TA 4DSSB 3GSSA 3R2QA 2X8HA 1U88A 1SK1A 1C72A 2FNOA 2QKEA 4NAXA 4POLA 5FWGA 4HU9A 1UVZA 1U6TA 2DKIA 4YKGA 4JR4A 5F8BA 1Z5YE 2C3NA 2X8GA 5HFGA 4KAEA 3O3TA 1FB0A 3U5RE 2GSSA 3E3EA 5HR0A 1V58A 4F82A 1SJ6A 1XZOA 1TU8A 3Q6OA 5D96A 3LW9A 1AW9A 6GSUA 5DALB 2C4JA 3QOUA 4H86A 3S9FA 3HKRA 4XHMA 2HLSA 1PL1A 4D73B 4EXJA 5EVOA 4TXVA 1TJDA 2YWOA 1GH2A 1GP1A 1FAAA 2V32A 4MPGA 3HD5A 4OCFA 4JZQA 2YJHA 1URMA 4ZL8A 4WBRD 2LNTA 5IOWA 1XCCA 4K5SA 4IP6A 4HS1A 1EEJA 5DVBA 5ECPB 4F0BA 3KJYA 4FQUA 1H75A 1VF3A 1N2AA 4PX1A 2HNLA 1HNAA 1PMTA 2PVOC 1EEMA 1R5PA 2R5GA 4J56E 2H75A 2LSTA 3DKSA 3D5JA 3ZLPA 1TK8B 3TB2A 3NOFA 3TKQA 1ACVA 1XFLA 3FR9A 4POMA 5A5KA 1T00A 2GTUA 2VAFA 1BYEA 3D6IA 3C1SA 2LV3A 5D9WA 3LG6A 1J0FA 4MNNA 3UL3A 2B7KA 3CSHA 3VWUA 3TUEA 2I1UA 3L78A 2F3MA 4I5QA 2R3XA 3GFKA 1GTIA 3CYNA 3CMIA 1FOHA 4N30A 4ML6A 4HEA2 4K7IA 5AGYA 2H1DA 3F9UA 2JL4A 1PL2A 5JWQB 3VWVA 4DSQA 2VD0A 3CRUA 2C80A 5ECKB 4BVYA 5ECMB 4EKZA 4FYUA 3WGXA 2C1YA 2OADA 3NIVA 3D22A 1OAZA 2X99A 1LU4A 2JSZA 2RUEA 2GS3A 5DAKA 1GUHA 2RM5A 1Z3EA 2AYTA 5AIXA 3IXRA 1FB6A 2GSRA 4MF7A 1XW9A 3GSTA 2KP1A 4XS4A 3HYPA 4J2FA 3G7JA 5JWOB 2VM1A 2H1GA 4MZCA 2M72A 3TRXA 3P7XA 1AQWA 4TN8A 1RW1A 3H8QA 2CVDA 5GSSA 4DSSA 3ZFLA 2PVQA 5IPHA 3H79A 4K7NA 1BEDA 3VPTA 6GSWA 3CXGA 2I3YA 2G2QA 2R6KA 5D8IA 1IYIA 2HXKA 5BMUA 2L6DA 3D4MA 3M1GA 2UZ8A 2FD3A 5A4UA 4O32A 1Z7PA 3FRCA 2H71A 1X5CA 1Z7RA 2H01A 1H4OA 1OYJA 3G7YA 2A2RA 2H70A 4GTUA 5INYA 3QR6A 2HI7A 5CREA 1PRXA 4KDUA 3KMNA 4A5PA 1R5AA 1E6BA 3VK9A 3ZMLA 4NPBA 2C3TA 3DGQA 3A2XA 1THXA 3KP9A 5CRWA 3F4RA 2LQOA 4RI7A 1WRYA 20GSA 4N10A 1GULA 2A2PA 2TRCP 1MTCA 2R37A 3VLNA 1GSSA 1A8LA 1A2JA 5DALA 4G0IA 4ACSA 4DSRA 2H0HA 2M80A 4MJBA 4IN0A 4RQXA 3UBLA 6GSVA 4D73A 2H66A 2N5BA 4EF0A 3VURA 1KBNA 2EC4A 2GVPA 3KIJA 1I5GA 2WDUA 5A4VA 3QCPA 4ZL7A 2GSQA 1GRXA 2NBSA 1UA5A 3M3MA 1T7PB 3KGKA 1PKZA 2H6ZA 3O6TA 13GSA 1MD3A 2YWNA 2H72A 2RLIA 1XBSA 1S3DA 5EL8A 1TU7A 2K6VA 3GURA 4MCUA 5KN2A 3GL5A 3VI7A 2V1MA 1F37A 3CTFA 1K0MA 1M0UA 2H73A 2B5EA 2YOIA 3OR5A 1QK8A 1F3BA 1DUGA 5DJLA 2AB6A 4OO5A 3IV4A 4KA0A 4Q5QA 5H5SA 1O73A 4OMVA 5E59A 3Q19A 6GSXA 4F9ZA 2ZCTA 3HDCA 1EP7A 5G2ZA 17GSA 2B5XA 3IK7A 4ECJA 5FT3A 2VCXA 3ISOA 4ZBAA 1T3BA 3J7Yb 2LJKA 2YNXA 5IMVA 2J23A 4I6XA 3DVXA 2VO4A 2H1AA 2RIIA 4X43A 1YDKA 2HZFA 2WCIA 3I69A 3M8NA 3GIXA 4EE0A 4O5RA 1GUMA 2F51A 2C0DA 1ON4A 3KZQA 1R7HA 3LXTA 4JE1A 1VF4A 3IAS2 1X9WB 3NZNA 3IRAA 1NW2A 3BJ5A 3PGTA 1Q4JA 4MJEA 3EPTA 3L9UA 4PQ1A 4TR3A 1A0FA 4FYBA 4DEJA 2P0GA 1TW9A 1ZZYA 4X4JA 2OA7A 1R4WA 1YQ1A 3FR6A 3A3TA 3QMXA 1ZOFA 3F3RA 4K8MA 1DE2A 2HE3A 5IMAA 3TRPA 1SL0B 3UBKA 4MABA 5KOWA 4F03A 3N5OA 4BL7B 1WMJA 1V9WA 4JR6A 1GTUA 3BCIA 4EO3A 3HA9A 5F06A 3I9V2 3GYKA 2CT6A 4AJ7A 6GSYA 4K7OA 3A2VA 4LL4B 2CV4A 2VLTA 4I2UA 2LNSA 1Z9HA 4L8EA 1RK4A 3P2AA 4FH8A 2YZHA 3GKMA 3UAPA 1PA3A 4ZB9A 5G31A 2N5AA 4BPYA 3CSJA 3WD6A 4MF5A 2V41A 2VCVA 2QA1A 2NVLA 5KEJA 3ZITA 4IKHA 1QGVA 3FW2A 3PH9A 2B5YA 1A24A 3SBCA 1DBYA 1XWGA 1K0CA 1EWXA 5IIZA 2XHFA 4O92A 2YN1A 2PUKC 1FO5A 2IMFA 3FHKA 2HRFA 3CTGA 1F9MA 4GQCA 2VUPA 2J9HA 5IMZA 3ME7A 1V98A 3KH9A 4X0XA 4NWYA 4Q5NA 1A8YA 2VCWA 2XBQA 3APOA 2KHPA 2CA8A 1XOAA 1XPVA 1ZCPA 2DIYA 2I9HA 1QFNA 4ZILA 3TKSA 1TRSA 3TKSC 2B1LA 3GA4A 1ST9A 2GQKA 3KP8A 2REMA 2LEGA 3EWLA 3WGDA 1OC8A 3LFLA 1PQNA 1OE7A 5J4UA 1AQXA 3L9SA 4KX4A 3IC8A 2VL2A 3QPMA 3LQ7A 5H5QA 2DBCA 3IHQA 3ED3A 4K0NA 4WETA 5IPGA 4K1FA 2X8CA 4MLYA 5J41A 5KN0A 3FZ9A 4Q5FA 5IMDA 1K3LA 5JWRB 3KEBA 1ILOA 5ECRB 4PTSA 4YAPA 1WOUA 1WWJA 19GSA 4JEDA 3GTUB 1QMVA 3ZFBA 1EGOA 3O76A 1O6JA 1X5DA 1M2DA 4MMMA 3GKNA 1ML6A 1HQOA 3MAKA 2YANA 3L0HA 1XW5A 2IMIA 2X49A 1E2YA 1J08A 4E8EA 4ISDA 1V40A 1M9AA 2KUCA 2K9FA 2IMEA 1XWKA 2OKAA 2DLXA 1JLWA 3ME8A 4V1Ap 4RI6A 5IMFA 1G6WA 1KNGA 3HJOA 2RUFA 2ALBA 3R3EA 5ABRA 3GL3A 1YJ6A 1HD2A 3LSZA 2P5RA 3DVWA 2HSYA 1W4VA 3EVIA 4K5RA 4XRAA 3C7MA 3E9JB 1VRSD 1SENA 4RUVA 2DC5A 2YV9A 2MMNA 3E0UA 2M46A 2MMAA 2WB9A 5DCGA 2DJ0A 3KXOA 4K2DA 4E8HA 8GSSA 3GX0A 2DJ1A 3H4KA 4KE3A 2LRNA 3Q74A 1F6MC 12GSA 2WGRA 3C1RA 2HSMA 4HQSA 2FWGA 5DJMA 1G7OA 2QSIA 11GSA 2L57A 2GQLA 1SL1B 2CAIA 4XTSA 4BL7A 1NSWA 1YF0A 5DQYA 3IA1A 2FA8A 2E2GA 1LJRA 3FZAA 5ECOB 4MF6A 3QAWA 4IQAA 5D93A 4YQUA 1K0NA 2IJYA 2IPAA 2DMLA 3JCML 3LGCA 4IGJA 2PBJA 1USBA 2JADA 2LS5A 4KSOA 2KLXA 4ZB6A 3GN3A 1WPIA 2GGTA 4IP1A 4PUAA 4HUAA 2R0PA 1T1VA 2A4VA 5HR2A 5C04A 4KSMA 3CRTA 4AF2A 5DCHA 1ERUA 3CSIA 4MZBA 1M2BA 3GRXA 5E4WA 4WXTA 2C0GA 4WBJA 9GSSA 4G10A 2IIYA 4J57E 4KCEA 4ZXGA 3QAGA 1ZYPA 2A4HA 2H8LA 3MYDA 4CHSA 3FEUA 3DRNA 2FGXA 1SKSB 3F63A 1XW6A 1F2EA 2C3QA 3ZIVA 2KP2A 1XXUA 4FIWA 1DSBA 2AAWA 1GLPA 2MBSA 2B7JA 2L4QA 1GSUA 1S3CA 2G0FA 3P90A 2K18A 1MDKA 1TXXA 6GSSA 3GKXA 1O85A 4G0KA 3C73A 5ECSA 2CVBA 2WRTA 1Z6NA 3WT1A 4EIQA 2IMDA 4XS1A 2H30A 3F3QA 4IW9A 2OE3A 1CQHA 1T4ZA 5KN3A 2FWHA 1KTEA 3GH6A 2R0CA 2CVKA 1Z6MA 4BVXB 4ILFA 3IDVA 4TRXA 4KF9A 3LORA 4LMVA 1MDJA 4MA9A 2FCHA 3TJBA 2OBKA 5BRTA 4L0WA 3L4NA 5G5EA 3LXZA 3ERWA 1O7UA 5D9VA 5IMCA 1K0BA 2PERA 5G1LA 2C0FA 3F8UA 3GTUA 1HNBA 4CDOA 2D2ZA 6GSTA 4G19A 1B4PA 2H74A 1GSDA 1OC9B 2HT9A 4GSSA 4MJCA 1RQMA 1GSFA 2FHEA 3A5WA 4V1Ag 4HU7A 1ZGNA 2IN3A 3A5IA 5ID2B 3HJMA 1TP9A 2P31A 2H0IA 4PNFA 1Y6EA 1XWBA 2R2JA 5D9TA 1NHOA 5ECQB 4V2NA 1ERWA 4HOJA 3A2WA 1ABAA 2FA4A 4GF0A 1TK5B 3QFBC 4V2MA 4CW9A 4I97A 3ZL5A 4TR1B 1B8XA 4BA7A 1GLQA 3LJRA 4XIHA 4MDCA 2I81A 3IK9A 4ZBDA 4LL1B 4BWQA 4N0ZA 5DQSA 4ZIJA 2O87A 4XCSA 2O85A 2HRNA 3FKFA 1B9XC 3GUSA 1XIYA 1QQ2A 2DMMA 4KUNA 3I43A 3UVHA 1U87A 5AIVA 5LD0A 3GKKA 2YP6A 3HVXA 18GSA 2VM2A 3U6VA 5DBQA 4G9HA 3TKRA 5IM9A 1JZDA 2L5OA 3EU4A 4K6XA 4TOPA 2IMKA 1ZYNA 4EDZA 4XRDA 1WE0A 1O8WA 2X4AA 3LYKA 2OE0A 1SYXA 2C8UA 2O8VB 1K0OA 3KTLA 1MEKA 1WJKA 3UJ1A 1JZRA 4PGTA 1YKCA 1FVKA 2K8VA 2YCDA 3MNGA 4ZL9A 2YV7A 4TR0A 2JSYA 3HY2A 1EV4A 2VL3A 1YY7A 2Z9SA 3DD3A 4EDYA 1TRUA 3RDWA 5ECNB 3TOUA 3EMXA 4TKYA 4NXIA 5JCGA 5A4WA 1X0RA 4K2XA 4JU5A 3HZ4A 1GTBA 4LA1A 3DXBA 4KGIA 3W6GA 5L71A 3J7Yk 4ECIA 1GTAA 5IO2A 3N9JA 5GAPD 2VCZA 1G7EA 2H0GA 3HVVA 4WF5A 2KOKA 3UOMA 4NHZA 1HNCA 5AISA 7GSSA 3HVSA 3M0FA 4I8BA 3V1WA 4GQFA 4Z7XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YAV A;  1FW1 A;  1SU9 A;  3DWV A;  4F2I A;  2OJL A;  4AJ8 A;  3D21 A;  1EGR A;  2GQM A;  2ES7 A;  1FG4 A;  4BVX A;  1YEX A;  4ECC A;  3F6F A;  2CZ2 A;  1T8E B;  3MDK A;  2MZC A;  1DE1 A;  2XBI A;  2MMZ A;  3TGZ A;  3LYP A;  3C8E A;  2VL9 A;  5B8B A;  3CBU A;  3K8N A;  2L4C A;  1UN2 A;  3Q18 A;  2E2M A;  2C0E A;  3IE3 A;  4L0U A;  4KB3 A;  2YZU A;  1PGT A;  3RPP A;  2EIR A;  1OC9 A;  5COH A;  3KTB A;  1PKW A;  4KW6 A;  1PSQ A;  5ID2 A;  4MH3 A;  4OD7 A;  3M9J A;  3KMO A;  4WF4 A;  4AJ6 A;  3GNJ A;  3G9B A;  4KDY A;  5B6N A;  5FHI A;  2OAC A;  2X64 A;  3M9K A;  3W8S A;  2XPD A;  3F4S A;  2FY6 A;  2B6M A;  1QXH A;  3VWX A;  14GS A;  3ZVJ A;  4MZW A;  5IOX A;  2V6O A;  4TR1 A;  3TJG A;  1EV9 A;  2F9S A;  1K0A A;  3SWL A;  2QC7 A;  2F8A A;  3UVT A;  2WFC A;  3ERG A;  1XVW A;  2H76 A;  5F05 A;  4TXO B;  5D9X A;  5F0G A;  2DIZ A;  5KN1 A;  2VLV A;  3IPZ A;  3RBT A;  2VL2 C;  3TOT A;  1VF1 A;  2VCQ A;  5GAN D;  2O89 A;  2JZT A;  1KEB A;  1XWA A;  4YH2 A;  1Q98 A;  2DSA A;  1PX6 A;  1AIU A;  1ERT A;  1K3Y A;  4PQI A;  3UMA A;  4TVE A;  3GHA A;  1CQG A;  4TR4 A;  5IO0 A;  1N8J A;  3TDG A;  2LTK A;  3C71 A;  5CAX A;  2CQ9 A;  2NPB A;  3RHB A;  2PPT A;  4FYC A;  4EUY A;  1V2A A;  1VGL A;  1ZYQ B;  1NHY A;  4WR5 A;  4POB A;  3MWH A;  2AV4 A;  2O7K A;  2WZ9 A;  1LBK A;  5CYY A;  3GV1 A;  1EZK A;  4QL9 A;  1M7T A;  5J5N A;  5HR3 A;  2IL3 A;  2LQQ A;  2GZZ A;  5J3R A;  2BJX A;  4JBB A;  1XOB A;  1SJZ A;  2NDO A;  4GWR A;  1GNE A;  1XVQ A;  1SL2 B;  4YQM A;  3QAV A;  1SK0 A;  1B9Y C;  2AUV A;  4PXO A;  4OFN A;  3DIE A;  2H6Y A;  4NHW A;  4HI7 A;  1MDI A;  1Y25 A;  3F6D A;  3LWA A;  4GCI A;  4MH2 A;  2HZE B;  2A2S A;  3KM6 A;  5LCZ A;  3US3 A;  2IFQ B;  3GX8 A;  2DJJ A;  3BOA A;  2ZNM A;  2PWJ A;  1GSQ A;  3TCO A;  2GT6 A;  4L5L A;  1NM3 A;  3FY7 A;  4PUR A;  1X9S B;  2ON7 A;  1YEP A;  2H19 A;  2LUS A;  4LMW A;  2V6K A;  1PX7 A;  22GS A;  1BG5 A;  4WR4 A;  3UAR A;  1TDI A;  3P8W A;  3H93 A;  4NV2 A;  1OVN A;  4KH7 A;  2EIO A;  3UEM A;  5JCU A;  2LRT A;  5EY6 A;  4OO4 A;  2TIR A;  2PU9 C;  1F3A A;  3QDN A;  5J9C A;  4TW5 A;  1TTZ A;  5CRD A;  4IJI A;  3WYW A;  1XWC A;  3ERF A;  5GZZ B;  4ZBB A;  1FOV A;  3EC3 A;  3TRQ A;  4N0V A;  3LEF A;  1ZMA A;  3F0I A;  5B7C A;  5CRH A;  4ECB A;  2ZUP A;  4HQZ A;  1AUC A;  1BJX A;  3EUR A;  1SD8 A;  3FYG A;  2LKU A;  3EYT A;  2CX3 A;  1W89 A;  2L59 A;  2MMO A;  3ZMK A;  2XPE A;  4V2L A;  3IR4 A;  1AAZ A;  2JZR A;  5G30 A;  5H5R A;  3TKP A;  1JLV A;  1AC1 A;  10GS A;  1UC7 A;  2EIQ A;  1TI3 A;  1X9M B;  1GWC A;  1HYU A;  2JAC A;  2WJU A;  1T4Y A;  3KD0 A;  1K3O A;  3UIW A;  16GS A;  4TXO A;  1ZYE A;  5ECL B;  1B48 A;  2NTO A;  2RM6 A;  2CZ3 A;  4IBP A;  1FVJ A;  2DJK A;  3TJF A;  5ELG A;  2TRX A;  4EVM A;  2L5L A;  1U3A A;  5ENU A;  3HXS A;  1SKW B;  3L9V A;  1R26 A;  3HZ8 A;  4EC0 A;  4WEY A;  4OFT A;  4QL7 A;  3RAZ A;  2YWM A;  3BBY A;  4KCA A;  1FHE A;  1BX9 A;  2VCT A;  3HHV A;  2HSH A;  3PR8 A;  2YWI A;  1BQ7 A;  1SYR A;  1M2A A;  2GST A;  3KCM A;  3DML A;  2YJ7 A;  1G6Y A;  2MBT A;  3ZRE A;  1GUK A;  2MYG A;  4GRF A;  3VFI A;  4IHU A;  4IVF A;  3BCK A;  3WT2 A;  2E0Q A;  5EPF A;  5G5F A;  3APQ A;  2BMX A;  4LLR A;  2IWT A;  4P3Y B;  4NV5 A;  3HJP A;  1EP8 A;  1K0D A;  2B3S A;  3ZTL A;  2L6C A;  1GNW A;  5DDL A;  5G1K A;  5CNW A;  4BWS A;  4MK3 A;  1I9D A;  4OCE A;  1WIK A;  3ZRD A;  5IQY A;  1TI1 A;  4OWY A;  1OKT A;  1A0R P;  2R4V A;  1V57 A;  2GDR A;  2VOC A;  2GZP A;  2HZE A;  3QFA C;  1QUW A;  1PD2 1;  5HFI A;  4ULX A;  4I2T A;  2IFQ A;  2AJQ B;  2CAQ A;  4QQ7 A;  3AY8 A;  3HCZ A;  3TKS E;  1SK2 A;  1MD4 A;  2GZY A;  1TKD B;  4ID0 A;  2XC2 A;  1X5E A;  3VPQ A;  3ZZX A;  4GSN A;  3FR3 A;  2H1B A;  3TJJ A;  2CX4 A;  2GLR A;  4HDE A;  3EU3 A;  3ZYW A;  2OBI A;  1JZW A;  1A23 A;  1GSY A;  2PGT A;  1A2M A;  5GST A;  1GL8 A;  3GMF A;  1SJI A;  3FZ4 A;  2N5F A;  3APS A;  2HFD A;  2GT5 A;  3FK8 A;  1YKA A;  2K8S A;  2LJA A;  4YQV A;  3VWW A;  2LJR A;  1TK0 B;  4HZ4 A;  4IJ3 A;  4G2E A;  2P5Q A;  3RPN A;  1TRV A;  1O81 A;  5HFK A;  4K0G A;  1AQV A;  5B6M A;  1M9B A;  4GXZ A;  4WKW A;  2LRC A;  1JZO A;  1B4Q A;  2BTO T;  4AGS A;  4N11 A;  4F0C A;  5D73 A;  5HR1 A;  1GSE A;  5ECI B;  2VIM A;  1M99 A;  3FZ5 A;  5J9B A;  4GST A;  3PIN A;  1VF2 A;  4MPF A;  2WS2 A;  4ZB8 A;  2FWF A;  4KDX A;  5AN1 A;  3GH9 A;  1TRW A;  2OE1 A;  2JU5 A;  5ELA A;  4HJM A;  1OC3 A;  3EE2 A;  4HZ2 A;  2JZS A;  4IEL A;  1OKD A;  3H1N A;  1U3I A;  3KH7 A;  1PN9 A;  1EOG A;  2F8F A;  2ON5 A;  3EIN A;  2FLS A;  1J9B A;  2DJ2 A;  4XS6 A;  4RQR A;  5CRG A;  2FUG 2;  3DEX A;  1AXD A;  3IOS A;  4PUF C;  4Q5R A;  3DYR A;  5LNK e;  4HJ2 A;  4IQ1 A;  3W8J A;  4PNG A;  1YZX A;  1A2L A;  5HQP A;  2H6X A;  3IC4 A;  5CP1 A;  5C00 A;  1TOF A;  5CO3 A;  1ERV A;  4NMU A;  2DJ3 A;  1JHB A;  4FO5 A;  3D0Z A;  4O7H A;  4L5O A;  4KND A;  2E7P A;  2FWE A;  4JRR A;  2I4A A;  2WUL A;  2PMT A;  1IYH A;  3IAM 2;  2V2G A;  4DVC A;  3F4T A;  2VLU A;  4IS0 A;  5F07 A;  4MP4 A;  1ZL9 A;  5ECH B;  1THO A;  2VD1 A;  3MSZ A;  3VI5 A;  1SD9 A;  3BD2 A;  1BAY A;  1JFU A;  1G0T A;  3TJK A;  1SKR B;  2YPM A;  4MJA A;  4EL1 A;  1YF1 A;  3QD9 A;  3I6A A;  5JCW A;  2B1K A;  4PQH A;  4X1U A;  1S3A A;  3ZVJ D;  4POK A;  4K9Z A;  4ML1 A;  4OFM A;  3RHC A;  2PN8 A;  3G7I A;  2AHE A;  5DAK B;  5B8A A;  1OE8 A;  4GLT A;  3ZIJ A;  3EMP A;  1WP0 A;  4XS4 B;  2QGV A;  3WGE A;  1O8X A;  3IBH A;  2HYX A;  1EOH A;  3D4T A;  4DSS B;  3GSS A;  3R2Q A;  2X8H A;  1U88 A;  1SK1 A;  1C72 A;  2FNO A;  2QKE A;  4NAX A;  4POL A;  5FWG A;  4HU9 A;  1UVZ A;  1U6T A;  4JR4 A;  5F8B A;  1Z5Y E;  2C3N A;  2X8G A;  5HFG A;  4KAE A;  3O3T A;  1FB0 A;  3U5R E;  2GSS A;  3E3E A;  5HR0 A;  1V58 A;  4F82 A;  1SJ6 A;  1XZO A;  1TU8 A;  3Q6O A;  5D96 A;  1AW9 A;  6GSU A;  5DAL B;  2C4J A;  3QOU A;  4H86 A;  3S9F A;  3HKR A;  4XHM A;  2HLS A;  1PL1 A;  4D73 B;  4EXJ A;  5EVO A;  4TXV A;  1TJD A;  2YWO A;  1GH2 A;  1GP1 A;  1FAA A;  2V32 A;  4MPG A;  3HD5 A;  4OCF A;  4JZQ A;  2YJH A;  1URM A;  4ZL8 A;  4WBR D;  2LNT A;  5IOW A;  1XCC A;  4IP6 A;  4HS1 A;  1EEJ A;  5DVB A;  5ECP B;  4F0B A;  3KJY A;  1H75 A;  1VF3 A;  1N2A A;  4PX1 A;  2HNL A;  1HNA A;  1PMT A;  2PVO C;  1EEM A;  1R5P A;  2R5G A;  4J56 E;  2H75 A;  2LST A;  3DKS A;  3D5J A;  3ZLP A;  1TK8 B;  3TB2 A;  3NOF A;  3TKQ A;  1ACV A;  1XFL A;  3FR9 A;  4POM A;  5A5K A;  1T00 A;  2GTU A;  2VAF A;  1BYE A;  3D6I A;  3C1S A;  2LV3 A;  5D9W A;  3LG6 A;  1J0F A;  3UL3 A;  2B7K A;  3CSH A;  3VWU A;  3TUE A;  2I1U A;  3L78 A;  2F3M A;  4I5Q A;  2R3X A;  3GFK A;  1GTI A;  3CYN A;  3CMI A;  4N30 A;  4ML6 A;  4HEA 2;  4K7I A;  5AGY A;  2H1D A;  3F9U A;  2JL4 A;  1PL2 A;  5JWQ B;  3VWV A;  4DSQ A;  2VD0 A;  3CRU A;  2C80 A;  5ECK B;  4BVY A;  5ECM B;  4EKZ A;  4FYU A;  3WGX A;  2C1Y A;  2OAD A;  3NIV A;  3D22 A;  1OAZ A;  2X99 A;  1LU4 A;  2JSZ A;  2RUE A;  2GS3 A;  5DAK A;  1GUH A;  2RM5 A;  1Z3E A;  2AYT A;  5AIX A;  3IXR A;  1FB6 A;  2GSR A;  4MF7 A;  1XW9 A;  3GST A;  2KP1 A;  4XS4 A;  3HYP A;  4J2F A;  3G7J A;  5JWO B;  2VM1 A;  2H1G A;  4MZC A;  2M72 A;  3TRX A;  3P7X A;  1AQW A;  4TN8 A;  1RW1 A;  3H8Q A;  2CVD A;  5GSS A;  4DSS A;  3ZFL A;  2PVQ A;  5IPH A;  3H79 A;  4K7N A;  1BED A;  3VPT A;  6GSW A;  3CXG A;  2I3Y A;  2G2Q A;  2R6K A;  5D8I A;  1IYI A;  2HXK A;  2L6D A;  3D4M A;  3M1G A;  2FD3 A;  5A4U A;  4O32 A;  1Z7P A;  3FRC A;  2H71 A;  1X5C A;  1Z7R A;  2H01 A;  1H4O A;  1OYJ A;  3G7Y A;  2A2R A;  2H70 A;  4GTU A;  5INY A;  3QR6 A;  2HI7 A;  5CRE A;  1PRX A;  4KDU A;  3KMN A;  1R5A A;  1E6B A;  3VK9 A;  3ZML A;  4NPB A;  2C3T A;  3DGQ A;  3A2X A;  1THX A;  3KP9 A;  5CRW A;  3F4R A;  2LQO A;  4RI7 A;  1WRY A;  20GS A;  4N10 A;  1GUL A;  2TRC P;  1MTC A;  2R37 A;  3VLN A;  1GSS A;  1A8L A;  1A2J A;  5DAL A;  4ACS A;  4DSR A;  2H0H A;  2M80 A;  4MJB A;  4IN0 A;  4RQX A;  3UBL A;  6GSV A;  4D73 A;  2H66 A;  2N5B A;  4EF0 A;  3VUR A;  1KBN A;  2EC4 A;  2GVP A;  3KIJ A;  1I5G A;  2WDU A;  5A4V A;  3QCP A;  4ZL7 A;  2GSQ A;  1GRX A;  2NBS A;  1UA5 A;  3M3M A;  1T7P B;  3KGK A;  1PKZ A;  2H6Z A;  3O6T A;  13GS A;  1MD3 A;  2YWN A;  2H72 A;  2RLI A;  1XBS A;  1S3D A;  5EL8 A;  1TU7 A;  2K6V A;  3GUR A;  4MCU A;  5KN2 A;  3GL5 A;  3VI7 A;  2V1M A;  1F37 A;  3CTF A;  1K0M A;  1M0U A;  2H73 A;  2B5E A;  2YOI A;  3OR5 A;  1QK8 A;  1F3B A;  1DUG A;  5DJL A;  2AB6 A;  4OO5 A;  3IV4 A;  4KA0 A;  4Q5Q A;  5H5S A;  1O73 A;  4OMV A;  5E59 A;  3Q19 A;  6GSX A;  4F9Z A;  2ZCT A;  3HDC A;  1EP7 A;  5G2Z A;  17GS A;  2B5X A;  3IK7 A;  4ECJ A;  5FT3 A;  2VCX A;  3ISO A;  4ZBA A;  1T3B A;  3J7Y b;  2LJK A;  2YNX A;  5IMV A;  2J23 A;  4I6X A;  3DVX A;  2VO4 A;  2H1A A;  2RII A;  4X43 A;  1YDK A;  2HZF A;  2WCI A;  3I69 A;  3M8N A;  3GIX A;  4EE0 A;  4O5R A;  1GUM A;  2F51 A;  2C0D A;  1ON4 A;  3KZQ A;  1R7H A;  3LXT A;  4JE1 A;  1VF4 A;  3IAS 2;  1X9W B;  3NZN A;  3IRA A;  1NW2 A;  3BJ5 A;  3PGT A;  1Q4J A;  4MJE A;  3L9U A;  4PQ1 A;  4TR3 A;  1A0F A;  4FYB A;  4DEJ A;  2P0G A;  1TW9 A;  1ZZY A;  2OA7 A;  1R4W A;  1YQ1 A;  3FR6 A;  3A3T A;  3QMX A;  1ZOF A;  3F3R A;  4K8M A;  1DE2 A;  2HE3 A;  5IMA A;  3TRP A;  1SL0 B;  3UBK A;  4MAB A;  4F03 A;  3N5O A;  1WMJ A;  1V9W A;  4JR6 A;  1GTU A;  3BCI A;  4EO3 A;  3HA9 A;  5F06 A;  3I9V 2;  3GYK A;  2CT6 A;  4AJ7 A;  6GSY A;  4K7O A;  3A2V A;  4LL4 B;  2CV4 A;  2VLT A;  4I2U A;  2LNS A;  1Z9H A;  4L8E A;  1RK4 A;  3P2A A;  4FH8 A;  2YZH A;  3GKM A;  3UAP A;  1PA3 A;  4ZB9 A;  5G31 A;  2N5A A;  4BPY A;  3CSJ A;  3WD6 A;  4MF5 A;  2V41 A;  2VCV A;  2NVL A;  5KEJ A;  3ZIT A;  4IKH A;  1QGV A;  3FW2 A;  3PH9 A;  2B5Y A;  1A24 A;  3SBC A;  1DBY A;  1XWG A;  1K0C A;  1EWX A;  5IIZ A;  2XHF A;  4O92 A;  2YN1 A;  2PUK C;  1FO5 A;  2IMF A;  3FHK A;  2HRF A;  3CTG A;  1F9M A;  4GQC A;  2VUP A;  2J9H A;  5IMZ A;  3ME7 A;  1V98 A;  3KH9 A;  4X0X A;  4NWY A;  4Q5N A;  1A8Y A;  2VCW A;  2XBQ A;  3APO A;  2KHP A;  2CA8 A;  1XOA A;  1XPV A;  1ZCP A;  2DIY A;  2I9H A;  1QFN A;  4ZIL A;  3TKS A;  1TRS A;  3TKS C;  2B1L A;  3GA4 A;  1ST9 A;  2GQK A;  3KP8 A;  2REM A;  2LEG A;  3EWL A;  3WGD A;  1OC8 A;  3LFL A;  1PQN A;  1OE7 A;  5J4U A;  1AQX A;  3L9S A;  4KX4 A;  2VL2 A;  3QPM A;  3LQ7 A;  5H5Q A;  2DBC A;  3IHQ A;  3ED3 A;  4K0N A;  4WET A;  5IPG A;  4K1F A;  2X8C A;  4MLY A;  5J41 A;  5KN0 A;  3FZ9 A;  4Q5F A;  5IMD A;  1K3L A;  5JWR B;  3KEB A;  1ILO A;  5ECR B;  4YAP A;  1WOU A;  1WWJ A;  19GS A;  4JED A;  3GTU B;  1QMV A;  3ZFB A;  1EGO A;  3O76 A;  1O6J A;  1X5D A;  1M2D A;  4MMM A;  3GKN A;  1ML6 A;  1HQO A;  3MAK A;  2YAN A;  3L0H A;  1XW5 A;  2IMI A;  1E2Y A;  1J08 A;  4E8E A;  4ISD A;  1V40 A;  1M9A A;  2KUC A;  2K9F A;  2IME A;  1XWK A;  2OKA A;  2DLX A;  1JLW A;  3ME8 A;  4V1A p;  4RI6 A;  5IMF A;  1G6W A;  1KNG A;  3HJO A;  2RUF A;  2ALB A;  5ABR A;  3GL3 A;  1YJ6 A;  1HD2 A;  3LSZ A;  2P5R A;  3DVW A;  2HSY A;  1W4V A;  3EVI A;  4XRA A;  3C7M A;  3E9J B;  1VRS D;  1SEN A;  4RUV A;  2DC5 A;  2YV9 A;  2MMN A;  3E0U A;  2M46 A;  2MMA A;  2WB9 A;  5DCG A;  2DJ0 A;  3KXO A;  4K2D A;  4E8H A;  8GSS A;  3GX0 A;  2DJ1 A;  3H4K A;  4KE3 A;  2LRN A;  3Q74 A;  1F6M C;  12GS A;  2WGR A;  3C1R A;  4HQS A;  2FWG A;  5DJM A;  1G7O A;  2QSI A;  11GS A;  2L57 A;  2GQL A;  1SL1 B;  2CAI A;  4XTS A;  4BL7 A;  1NSW A;  1YF0 A;  5DQY A;  3IA1 A;  2FA8 A;  2E2G A;  1LJR A;  3FZA A;  5ECO B;  4MF6 A;  3QAW A;  4IQA A;  5D93 A;  4YQU A;  1K0N A;  2IJY A;  2IPA A;  2DML A;  3JCM L;  3LGC A;  4IGJ A;  2PBJ A;  1USB A;  2JAD A;  2LS5 A;  4KSO A;  2KLX A;  4ZB6 A;  3GN3 A;  1WPI A;  2GGT A;  4IP1 A;  4PUA A;  4HUA A;  5HR2 A;  1T1V A;  2A4V A;  5C04 A;  4KSM A;  3CRT A;  4AF2 A;  5DCH A;  1ERU A;  3CSI A;  4MZB A;  1M2B A;  3GRX A;  5E4W A;  4WXT A;  2C0G A;  4WBJ A;  9GSS A;  4G10 A;  2IIY A;  4J57 E;  4KCE A;  4ZXG A;  3QAG A;  2H8L A;  4CHS A;  3FEU A;  3DRN A;  2FGX A;  1SKS B;  3F63 A;  1XW6 A;  1F2E A;  2C3Q A;  3ZIV A;  2KP2 A;  1XXU A;  4FIW A;  1DSB A;  2AAW A;  1GLP A;  2MBS A;  2B7J A;  2L4Q A;  1GSU A;  1S3C A;  2G0F A;  3P90 A;  2K18 A;  1MDK A;  1TXX A;  6GSS A;  3GKX A;  1O85 A;  3C73 A;  5ECS A;  2CVB A;  2WRT A;  1Z6N A;  3WT1 A;  2IMD A;  4XS1 A;  2H30 A;  3F3Q A;  4IW9 A;  2OE3 A;  1CQH A;  1T4Z A;  5KN3 A;  2FWH A;  1KTE A;  3GH6 A;  2CVK A;  1Z6M A;  4ILF A;  3IDV A;  4TRX A;  3LOR A;  4LMV A;  1MDJ A;  4MA9 A;  2FCH A;  3TJB A;  2OBK A;  4L0W A;  3L4N A;  5G5E A;  3LXZ A;  3ERW A;  1O7U A;  5D9V A;  5IMC A;  1K0B A;  2PER A;  5G1L A;  2C0F A;  3F8U A;  3GTU A;  1HNB A;  4CDO A;  2D2Z A;  6GST A;  4G19 A;  1B4P A;  2H74 A;  1GSD A;  1OC9 B;  2HT9 A;  4GSS A;  4MJC A;  1RQM A;  1GSF A;  2FHE A;  3A5W A;  4V1A g;  4HU7 A;  1ZGN A;  2IN3 A;  5ID2 B;  3HJM A;  1TP9 A;  2P31 A;  2H0I A;  4PNF A;  1Y6E A;  1XWB A;  2R2J A;  5D9T A;  1NHO A;  5ECQ B;  4V2N A;  1ERW A;  4HOJ A;  3A2W A;  1ABA A;  2FA4 A;  4GF0 A;  1TK5 B;  3QFB C;  4V2M A;  4CW9 A;  4I97 A;  3ZL5 A;  4TR1 B;  1B8X A;  4BA7 A;  1GLQ A;  3LJR A;  4XIH A;  4MDC A;  2I81 A;  3IK9 A;  4ZBD A;  4LL1 B;  4BWQ A;  4N0Z A;  5DQS A;  4ZIJ A;  2O87 A;  4XCS A;  2O85 A;  2HRN A;  3FKF A;  1B9X C;  3GUS A;  1XIY A;  1QQ2 A;  2DMM A;  4KUN A;  3I43 A;  3UVH A;  1U87 A;  5AIV A;  5LD0 A;  3GKK A;  2YP6 A;  3HVX A;  18GS A;  2VM2 A;  3U6V A;  5DBQ A;  4G9H A;  3TKR A;  5IM9 A;  1JZD A;  2L5O A;  3EU4 A;  4K6X A;  4TOP A;  2IMK A;  4EDZ A;  4XRD A;  1WE0 A;  1O8W A;  3LYK A;  2OE0 A;  1SYX A;  2C8U A;  2O8V B;  1K0O A;  3KTL A;  1MEK A;  1WJK A;  3UJ1 A;  1JZR A;  4PGT A;  1YKC A;  1FVK A;  2K8V A;  2YCD A;  3MNG A;  4ZL9 A;  2YV7 A;  4TR0 A;  2JSY A;  3HY2 A;  1EV4 A;  2VL3 A;  1YY7 A;  2Z9S A;  3DD3 A;  4EDY A;  1TRU A;  3RDW A;  5ECN B;  3TOU A;  3EMX A;  4TKY A;  4NXI A;  5JCG A;  5A4W A;  1X0R A;  4JU5 A;  3HZ4 A;  1GTB A;  4LA1 A;  3DXB A;  4KGI A;  3W6G A;  5L71 A;  3J7Y k;  4ECI A;  1GTA A;  5IO2 A;  3N9J A;  5GAP D;  2VCZ A;  1G7E A;  2H0G A;  3HVV A;  4WF5 A;  2KOK A;  3UOM A;  4NHZ A;  1HNC A;  5AIS A;  7GSS A;  3HVS A;  3M0F A;  4I8B A;  3V1W A;  4GQF A;  4Z7X A; 
#chains in the Genus database with same CATH topology
 3MIX A;  4YAV A;  1FW1 A;  1SU9 A;  3DWV A;  4F2I A;  2OJL A;  4AJ8 A;  3D21 A;  1EGR A;  2GQM A;  2ES7 A;  1FG4 A;  4BVX A;  1YEX A;  4ECC A;  3F6F A;  2CZ2 A;  1T8E B;  3MDK A;  2MZC A;  1DE1 A;  2XBI A;  2MMZ A;  3TGZ A;  3LYP A;  3C8E A;  2VL9 A;  4O5Q A;  5B8B A;  3CBU A;  3K8N A;  2L4C A;  1UN2 A;  3Q18 A;  2E2M A;  2C0E A;  3IE3 A;  4L0U A;  4KB3 A;  2YZU A;  1PGT A;  3RPP A;  2EIR A;  1OC9 A;  5COH A;  3KTB A;  1PKW A;  4KW6 A;  1PSQ A;  5ID2 A;  4MH3 A;  4OD7 A;  3M9J A;  3KMO A;  4WF4 A;  4AJ6 A;  3GNJ A;  3G9B A;  4KDY A;  5B6N A;  5FHI A;  2OAC A;  2X64 A;  3M9K A;  3W8S A;  2XPD A;  3F4S A;  1PN0 A;  2FY6 A;  2B6M A;  1QXH A;  3VWX A;  14GS A;  3ZVJ A;  4G0L A;  4MZW A;  5IOX A;  2V6O A;  4TR1 A;  3TJG A;  1EV9 A;  2F9S A;  1K0A A;  3SWL A;  2QC7 A;  2F8A A;  3UVT A;  2WFC A;  3ERG A;  1XVW A;  2H76 A;  5F05 A;  4TXO B;  5D9X A;  5F0G A;  2DIZ A;  5KN1 A;  2VLV A;  3IPZ A;  3RBT A;  2VL2 C;  3TOT A;  1VF1 A;  2VCQ A;  5KOX A;  5GAN D;  2O89 A;  2JZT A;  1KEB A;  1XWA A;  4YH2 A;  1Q98 A;  2DSA A;  1PX6 A;  1AIU A;  1ERT A;  1K3Y A;  4PQI A;  3UMA A;  4TVE A;  3GHA A;  1CQG A;  4TR4 A;  5IO0 A;  1N8J A;  3TDG A;  2LTK A;  3C71 A;  5CAX A;  2CQ9 A;  2NPB A;  3RHB A;  2HRA A;  2PPT A;  4FYC A;  4EUY A;  1V2A A;  1VGL A;  1ZYQ B;  3FMW A;  1NHY A;  4WR5 A;  4POB A;  3MWH A;  4EIP A;  2AV4 A;  2O7K A;  2WZ9 A;  1LBK A;  5CYY A;  3GV1 A;  1EZK A;  4QL9 A;  1M7T A;  5J5N A;  5HR3 A;  1XG8 A;  2IL3 A;  2LQQ A;  2GZZ A;  5J3R A;  2BJX A;  4JBB A;  1XOB A;  1SJZ A;  2NDO A;  4GWR A;  1GNE A;  1XVQ A;  1SL2 B;  4YQM A;  3QAV A;  1SK0 A;  1B9Y C;  2AUV A;  4PXO A;  4OFN A;  3DIE A;  2H6Y A;  4NHW A;  4HI7 A;  1MDI A;  2QA2 A;  1Y25 A;  3F6D A;  3LWA A;  4GCI A;  4MH2 A;  4CY8 A;  2HZE B;  2A2S A;  2R0G A;  3KM6 A;  5LCZ A;  3US3 A;  2IFQ B;  3GX8 A;  2DJJ A;  3BOA A;  2ZNM A;  2PWJ A;  1GSQ A;  3TCO A;  2GT6 A;  4L5L A;  1NM3 A;  3FY7 A;  4PUR A;  1X9S B;  2ON7 A;  1YEP A;  2H19 A;  2LUS A;  4LMW A;  2V6K A;  1PX7 A;  22GS A;  1BG5 A;  4WR4 A;  3UAR A;  1TDI A;  3P8W A;  3H93 A;  4NV2 A;  1OVN A;  4KH7 A;  2EIO A;  3UEM A;  5JCU A;  2LRT A;  5EY6 A;  4OO4 A;  2TIR A;  2PU9 C;  1F3A A;  3QDN A;  5J9C A;  4TW5 A;  1TTZ A;  5CRD A;  4IJI A;  3WYW A;  1XWC A;  3ERF A;  5GZZ B;  4ZBB A;  1FOV A;  3EC3 A;  3TRQ A;  4N0V A;  3LEF A;  1ZMA A;  3F0I A;  5B7C A;  5CRH A;  4ECB A;  2ZUP A;  4HQZ A;  1AUC A;  1BJX A;  3EUR A;  1SD8 A;  3FYG A;  2LKU A;  3EYT A;  2CX3 A;  1W89 A;  2L59 A;  2MMO A;  3ZMK A;  2XPE A;  4V2L A;  3IR4 A;  1AAZ A;  2JZR A;  5G30 A;  5H5R A;  3TKP A;  1JLV A;  1AC1 A;  10GS A;  1UC7 A;  2EIQ A;  1TI3 A;  1X9M B;  1GWC A;  1HYU A;  2JAC A;  2WJU A;  1T4Y A;  3KD0 A;  4Z2R A;  1K3O A;  3UIW A;  16GS A;  4TXO A;  1ZYE A;  5ECL B;  1B48 A;  2NTO A;  2RM6 A;  2CZ3 A;  4IBP A;  1FVJ A;  2DJK A;  3TJF A;  5ELG A;  2TRX A;  4EVM A;  2L5L A;  1U3A A;  5ENU A;  3HXS A;  1SKW B;  3L9V A;  1R26 A;  3HZ8 A;  4EC0 A;  4WEY A;  4OFT A;  4QL7 A;  3RAZ A;  2YWM A;  3BBY A;  4KCA A;  1FHE A;  1BX9 A;  2VCT A;  3HHV A;  3PPU A;  4O5U A;  4ICY A;  2HSH A;  3PR8 A;  2YWI A;  1BQ7 A;  1SYR A;  1M2A A;  2GST A;  3KCM A;  3DML A;  2YJ7 A;  1G6Y A;  2MBT A;  3ZRE A;  1GUK A;  2MYG A;  4GRF A;  3VFI A;  4IHU A;  4IVF A;  2HRK A;  3BCK A;  3WT2 A;  4USS A;  2E0Q A;  5EPF A;  5G5F A;  3APQ A;  2BMX A;  4LLR A;  2IWT A;  4P3Y B;  4NV5 A;  3HJP A;  1EP8 A;  1K0D A;  2B3S A;  3ZTL A;  2L6C A;  1GNW A;  5DDL A;  5G1K A;  5CNW A;  4BWS A;  4MK3 A;  1I9D A;  4OCE A;  1WIK A;  3ZRD A;  5IQY A;  1TI1 A;  4OWY A;  1OKT A;  1A0R P;  2R4V A;  1V57 A;  2GDR A;  2VOC A;  2GZP A;  2HZE A;  1PFO A;  3QFA C;  1QUW A;  1PD2 1;  5HFI A;  4ULX A;  4I2T A;  2IFQ A;  2AJQ B;  2CAQ A;  4QQ7 A;  3AY8 A;  3HCZ A;  3TKS E;  1SK2 A;  1MD4 A;  2GZY A;  1TKD B;  4ID0 A;  2XC2 A;  1X5E A;  3VPQ A;  3ZZX A;  4GSN A;  3FR3 A;  2H1B A;  3TJJ A;  2CX4 A;  2GLR A;  4HDE A;  3EU3 A;  3ZYW A;  4Z2T A;  2OBI A;  1JZW A;  1A23 A;  1GSY A;  2PGT A;  1A2M A;  5GST A;  1GL8 A;  3GMF A;  1SJI A;  3FZ4 A;  2N5F A;  3APS A;  2HFD A;  2GT5 A;  3FK8 A;  1YKA A;  4CY6 A;  2K8S A;  2LJA A;  4YQV A;  3VWW A;  3IHG A;  2LJR A;  1TK0 B;  2DKH A;  4HZ4 A;  4IJ3 A;  4G2E A;  2P5Q A;  3RPN A;  1TRV A;  1O81 A;  5HFK A;  4K0G A;  1AQV A;  5B6M A;  1M9B A;  4GXZ A;  4WKW A;  2LRC A;  1JZO A;  1B4Q A;  2BTO T;  4AGS A;  4N11 A;  4F0C A;  5D73 A;  5HR1 A;  1GSE A;  5ECI B;  2VIM A;  1M99 A;  3FZ5 A;  5J9B A;  4GST A;  3PIN A;  1VF2 A;  4MPF A;  2WS2 A;  4ZB8 A;  2FWF A;  4KDX A;  5AN1 A;  3GH9 A;  1TRW A;  2OE1 A;  2JU5 A;  5ELA A;  4HJM A;  1OC3 A;  3EE2 A;  4HZ2 A;  2JZS A;  4IEL A;  1OKD A;  3H1N A;  1U3I A;  3KH7 A;  1PN9 A;  1EOG A;  2F8F A;  2ON5 A;  3EIN A;  2FLS A;  1J9B A;  2DJ2 A;  4XS6 A;  4RQR A;  5CRG A;  2FUG 2;  3DEX A;  1AXD A;  3IOS A;  4PUF C;  4Q5R A;  3DYR A;  5LNK e;  4HJ2 A;  4IQ1 A;  3W8J A;  4PNG A;  1YZX A;  1A2L A;  5HQP A;  2H6X A;  3IC4 A;  5CP1 A;  5C00 A;  1TOF A;  5CO3 A;  1ERV A;  4NMU A;  2DJ3 A;  1JHB A;  4FO5 A;  3D0Z A;  4O7H A;  4L5O A;  4YKF A;  4KND A;  2E7P A;  2FWE A;  4JRR A;  2I4A A;  2WUL A;  2PMT A;  1IYH A;  3IAM 2;  2V2G A;  4DVC A;  3F4T A;  2VLU A;  4IS0 A;  5F07 A;  4MP4 A;  1ZL9 A;  5ECH B;  1THO A;  2VD1 A;  3MSZ A;  3VI5 A;  1SD9 A;  3BD2 A;  1BAY A;  1JFU A;  1G0T A;  3TJK A;  1SKR B;  2YPM A;  4MJA A;  4EL1 A;  1YF1 A;  3QD9 A;  3I6A A;  5JCW A;  2B1K A;  4PQH A;  4X1U A;  4BVY B;  1S3A A;  3ZVJ D;  4POK A;  4K9Z A;  4ML1 A;  4OFM A;  3RHC A;  2PN8 A;  3G7I A;  2AHE A;  5DAK B;  5B8A A;  1OE8 A;  4GLT A;  4Z2U A;  3ZIJ A;  3EMP A;  1WP0 A;  4XS4 B;  2QGV A;  3WGE A;  1O8X A;  3IBH A;  2HYX A;  1EOH A;  3D4T A;  4DSS B;  3GSS A;  3R2Q A;  2X8H A;  1U88 A;  1SK1 A;  1C72 A;  2FNO A;  2QKE A;  4NAX A;  4POL A;  5FWG A;  4HU9 A;  1UVZ A;  1U6T A;  2DKI A;  4YKG A;  4JR4 A;  5F8B A;  1Z5Y E;  2C3N A;  2X8G A;  5HFG A;  4KAE A;  3O3T A;  1FB0 A;  3U5R E;  2GSS A;  3E3E A;  5HR0 A;  1V58 A;  4F82 A;  1SJ6 A;  1XZO A;  1TU8 A;  3Q6O A;  5D96 A;  3LW9 A;  1AW9 A;  6GSU A;  5DAL B;  2C4J A;  3QOU A;  4H86 A;  3S9F A;  3HKR A;  4XHM A;  2HLS A;  1PL1 A;  4D73 B;  4EXJ A;  5EVO A;  4TXV A;  1TJD A;  2YWO A;  1GH2 A;  1GP1 A;  1FAA A;  2V32 A;  4MPG A;  3HD5 A;  4OCF A;  4JZQ A;  2YJH A;  1URM A;  4ZL8 A;  4WBR D;  2LNT A;  5IOW A;  1XCC A;  4K5S A;  4IP6 A;  4HS1 A;  1EEJ A;  5DVB A;  5ECP B;  4F0B A;  3KJY A;  4FQU A;  1H75 A;  1VF3 A;  1N2A A;  4PX1 A;  2HNL A;  1HNA A;  1PMT A;  2PVO C;  1EEM A;  1R5P A;  2R5G A;  4J56 E;  2H75 A;  2LST A;  3DKS A;  3D5J A;  3ZLP A;  1TK8 B;  3TB2 A;  3NOF A;  3TKQ A;  1ACV A;  1XFL A;  3FR9 A;  4POM A;  5A5K A;  1T00 A;  2GTU A;  2VAF A;  1BYE A;  3D6I A;  3C1S A;  2LV3 A;  5D9W A;  3LG6 A;  1J0F A;  4MNN A;  3UL3 A;  2B7K A;  3CSH A;  3VWU A;  3TUE A;  2I1U A;  3L78 A;  2F3M A;  4I5Q A;  2R3X A;  3GFK A;  1GTI A;  3CYN A;  3CMI A;  1FOH A;  4N30 A;  4ML6 A;  4HEA 2;  4K7I A;  5AGY A;  2H1D A;  3F9U A;  2JL4 A;  1PL2 A;  5JWQ B;  3VWV A;  4DSQ A;  2VD0 A;  3CRU A;  2C80 A;  5ECK B;  4BVY A;  5ECM B;  4EKZ A;  4FYU A;  3WGX A;  2C1Y A;  2OAD A;  3NIV A;  3D22 A;  1OAZ A;  2X99 A;  1LU4 A;  2JSZ A;  2RUE A;  2GS3 A;  5DAK A;  1GUH A;  2RM5 A;  1Z3E A;  2AYT A;  5AIX A;  3IXR A;  1FB6 A;  2GSR A;  4MF7 A;  1XW9 A;  3GST A;  2KP1 A;  4XS4 A;  3HYP A;  4J2F A;  3G7J A;  5JWO B;  2VM1 A;  2H1G A;  4MZC A;  2M72 A;  3TRX A;  3P7X A;  1AQW A;  4TN8 A;  1RW1 A;  3H8Q A;  2CVD A;  5GSS A;  4DSS A;  3ZFL A;  2PVQ A;  5IPH A;  3H79 A;  4K7N A;  1BED A;  3VPT A;  6GSW A;  3CXG A;  2I3Y A;  2G2Q A;  2R6K A;  5D8I A;  1IYI A;  2HXK A;  5BMU A;  2L6D A;  3D4M A;  3M1G A;  2UZ8 A;  2FD3 A;  5A4U A;  4O32 A;  1Z7P A;  3FRC A;  2H71 A;  1X5C A;  1Z7R A;  2H01 A;  1H4O A;  1OYJ A;  3G7Y A;  2A2R A;  2H70 A;  4GTU A;  5INY A;  3QR6 A;  2HI7 A;  5CRE A;  1PRX A;  4KDU A;  3KMN A;  4A5P A;  1R5A A;  1E6B A;  3VK9 A;  3ZML A;  4NPB A;  2C3T A;  3DGQ A;  3A2X A;  1THX A;  3KP9 A;  5CRW A;  3F4R A;  2LQO A;  4RI7 A;  1WRY A;  20GS A;  4N10 A;  1GUL A;  2A2P A;  2TRC P;  1MTC A;  2R37 A;  3VLN A;  1GSS A;  1A8L A;  1A2J A;  5DAL A;  4G0I A;  4ACS A;  4DSR A;  3CQF A;  2H0H A;  2M80 A;  4MJB A;  4IN0 A;  4RQX A;  3UBL A;  6GSV A;  4D73 A;  2H66 A;  2N5B A;  4EF0 A;  3VUR A;  1KBN A;  2EC4 A;  2GVP A;  3KIJ A;  1I5G A;  2WDU A;  5A4V A;  3QCP A;  4ZL7 A;  2GSQ A;  1GRX A;  2NBS A;  1UA5 A;  3M3M A;  1T7P B;  3KGK A;  1PKZ A;  2H6Z A;  3O6T A;  13GS A;  1MD3 A;  2YWN A;  2H72 A;  2RLI A;  1XBS A;  1S3D A;  5EL8 A;  1TU7 A;  2K6V A;  3GUR A;  4MCU A;  5KN2 A;  3GL5 A;  3VI7 A;  2V1M A;  1F37 A;  3CTF A;  1K0M A;  1M0U A;  2H73 A;  2B5E A;  2YOI A;  3OR5 A;  1QK8 A;  1F3B A;  1DUG A;  5DJL A;  2AB6 A;  4OO5 A;  3IV4 A;  4KA0 A;  4Q5Q A;  5H5S A;  1O73 A;  4OMV A;  5E59 A;  3Q19 A;  6GSX A;  4F9Z A;  2ZCT A;  3HDC A;  1EP7 A;  5G2Z A;  17GS A;  2B5X A;  3IK7 A;  4ECJ A;  5FT3 A;  2VCX A;  3ISO A;  4ZBA A;  1T3B A;  3J7Y b;  2LJK A;  2YNX A;  5IMV A;  2J23 A;  4I6X A;  3DVX A;  2VO4 A;  2H1A A;  2RII A;  4X43 A;  1YDK A;  2HZF A;  2WCI A;  3I69 A;  3M8N A;  3GIX A;  4EE0 A;  4O5R A;  1GUM A;  2F51 A;  2C0D A;  1ON4 A;  3KZQ A;  1R7H A;  3LXT A;  4JE1 A;  1VF4 A;  3IAS 2;  1X9W B;  3NZN A;  3IRA A;  1NW2 A;  3BJ5 A;  3PGT A;  1Q4J A;  4MJE A;  3EPT A;  3L9U A;  4PQ1 A;  4TR3 A;  1A0F A;  4FYB A;  4DEJ A;  2P0G A;  1TW9 A;  1ZZY A;  4X4J A;  2OA7 A;  1R4W A;  1YQ1 A;  3FR6 A;  3A3T A;  3QMX A;  1ZOF A;  3F3R A;  4K8M A;  1DE2 A;  2HE3 A;  5IMA A;  3TRP A;  1SL0 B;  3UBK A;  4MAB A;  5KOW A;  4F03 A;  3N5O A;  4BL7 B;  1WMJ A;  1V9W A;  4JR6 A;  1GTU A;  3BCI A;  4EO3 A;  3HA9 A;  5F06 A;  3I9V 2;  3GYK A;  2CT6 A;  4AJ7 A;  6GSY A;  4K7O A;  3A2V A;  4LL4 B;  2CV4 A;  2VLT A;  4I2U A;  2LNS A;  1Z9H A;  4L8E A;  1RK4 A;  3P2A A;  4FH8 A;  2YZH A;  3GKM A;  3UAP A;  1PA3 A;  4ZB9 A;  5G31 A;  2N5A A;  4BPY A;  3CSJ A;  3WD6 A;  4MF5 A;  2V41 A;  2VCV A;  2QA1 A;  2NVL A;  5KEJ A;  3ZIT A;  4IKH A;  1QGV A;  3FW2 A;  3PH9 A;  2B5Y A;  1A24 A;  3SBC A;  1DBY A;  1XWG A;  1K0C A;  1EWX A;  5IIZ A;  2XHF A;  4O92 A;  2YN1 A;  2PUK C;  1FO5 A;  2IMF A;  4HSC X;  3FHK A;  2HRF A;  3CTG A;  1F9M A;  4GQC A;  2VUP A;  2J9H A;  5IMZ A;  3ME7 A;  1V98 A;  3KH9 A;  4X0X A;  4NWY A;  4Q5N A;  1A8Y A;  2VCW A;  2XBQ A;  3APO A;  2KHP A;  2CA8 A;  1XOA A;  1XPV A;  1ZCP A;  2DIY A;  2I9H A;  1QFN A;  4ZIL A;  3TKS A;  1TRS A;  3TKS C;  2B1L A;  3GA4 A;  1ST9 A;  2GQK A;  3KP8 A;  2REM A;  2LEG A;  3EWL A;  3WGD A;  1OC8 A;  3LFL A;  1PQN A;  1OE7 A;  5J4U A;  1AQX A;  3L9S A;  4KX4 A;  3IC8 A;  2VL2 A;  3QPM A;  3LQ7 A;  5H5Q A;  2DBC A;  3IHQ A;  3ED3 A;  4K0N A;  4WET A;  5IPG A;  4K1F A;  2X8C A;  4MLY A;  5J41 A;  5KN0 A;  3FZ9 A;  4Q5F A;  5IMD A;  1K3L A;  5JWR B;  3KEB A;  1M3I A;  1ILO A;  5ECR B;  4PTS A;  4YAP A;  1WOU A;  1WWJ A;  19GS A;  4JED A;  3GTU B;  1QMV A;  3ZFB A;  1EGO A;  3O76 A;  1O6J A;  1X5D A;  1M2D A;  4MMM A;  3GKN A;  1ML6 A;  1HQO A;  3MAK A;  2YAN A;  3L0H A;  1XW5 A;  2IMI A;  2X49 A;  1E2Y A;  1J08 A;  4E8E A;  4ISD A;  1V40 A;  1M9A A;  2KUC A;  2K9F A;  2IME A;  1XWK A;  2OKA A;  2DLX A;  1JLW A;  3ME8 A;  4V1A p;  4RI6 A;  5IMF A;  1G6W A;  1KNG A;  3HJO A;  2RUF A;  2ALB A;  3R3E A;  5ABR A;  3GL3 A;  1YJ6 A;  1HD2 A;  3LSZ A;  2P5R A;  3DVW A;  2HSY A;  1W4V A;  3EVI A;  4K5R A;  4XRA A;  3C7M A;  3E9J B;  1VRS D;  1SEN A;  4RUV A;  2DC5 A;  2YV9 A;  2MMN A;  3E0U A;  2M46 A;  2MMA A;  2WB9 A;  5DCG A;  2DJ0 A;  3KXO A;  4K2D A;  4E8H A;  8GSS A;  3GX0 A;  2DJ1 A;  3H4K A;  4KE3 A;  2LRN A;  3Q74 A;  1F6M C;  12GS A;  2WGR A;  3C1R A;  2HSM A;  4HQS A;  2FWG A;  5DJM A;  1G7O A;  2QSI A;  11GS A;  2L57 A;  2GQL A;  1SL1 B;  2CAI A;  4XTS A;  4BL7 A;  1NSW A;  1YF0 A;  5DQY A;  3IA1 A;  2FA8 A;  2E2G A;  1LJR A;  3FZA A;  5ECO B;  4MF6 A;  3QAW A;  4IQA A;  5D93 A;  4YQU A;  1K0N A;  2IJY A;  2IPA A;  2DML A;  3JCM L;  3LGC A;  4IGJ A;  2PBJ A;  1USB A;  2JAD A;  2LS5 A;  4KSO A;  2KLX A;  4ZB6 A;  3GN3 A;  1WPI A;  2GGT A;  4IP1 A;  4PUA A;  4HUA A;  2R0P A;  1T1V A;  2A4V A;  5HR2 A;  5C04 A;  4KSM A;  3CRT A;  4AF2 A;  5DCH A;  1ERU A;  3CSI A;  4MZB A;  1M2B A;  3GRX A;  5E4W A;  4WXT A;  2C0G A;  4WBJ A;  9GSS A;  4G10 A;  2IIY A;  4J57 E;  4KCE A;  4ZXG A;  3QAG A;  1ZYP A;  2A4H A;  2H8L A;  3MYD A;  4CHS A;  3FEU A;  3DRN A;  2FGX A;  1SKS B;  3F63 A;  1XW6 A;  1F2E A;  2C3Q A;  3ZIV A;  2KP2 A;  1XXU A;  4FIW A;  1DSB A;  2AAW A;  1GLP A;  2MBS A;  2B7J A;  3HVN A;  2L4Q A;  1GSU A;  1S3C A;  2G0F A;  3P90 A;  2K18 A;  1MDK A;  1TXX A;  6GSS A;  3GKX A;  1O85 A;  4G0K A;  3C73 A;  5ECS A;  2CVB A;  2WRT A;  1Z6N A;  3WT1 A;  4EIQ A;  2IMD A;  4XS1 A;  2H30 A;  3F3Q A;  4IW9 A;  2OE3 A;  1CQH A;  1T4Z A;  5KN3 A;  2FWH A;  1KTE A;  3GH6 A;  2R0C A;  2CVK A;  1Z6M A;  4BVX B;  4ILF A;  3IDV A;  4TRX A;  1S3R A;  4KF9 A;  3LOR A;  4LMV A;  1MDJ A;  4MA9 A;  2FCH A;  3TJB A;  2OBK A;  5BRT A;  4L0W A;  3L4N A;  5G5E A;  3LXZ A;  3ERW A;  1O7U A;  5D9V A;  5IMC A;  1K0B A;  2PER A;  5G1L A;  2C0F A;  3F8U A;  3GTU A;  1HNB A;  4CDO A;  2D2Z A;  6GST A;  4G19 A;  1B4P A;  2H74 A;  1GSD A;  1OC9 B;  2HT9 A;  4GSS A;  4MJC A;  1RQM A;  1GSF A;  2FHE A;  3A5W A;  4V1A g;  4HU7 A;  1ZGN A;  2IN3 A;  3A5I A;  5ID2 B;  3HJM A;  1TP9 A;  2P31 A;  2H0I A;  4PNF A;  1Y6E A;  1XWB A;  2R2J A;  5D9T A;  1NHO A;  5ECQ B;  4V2N A;  1ERW A;  4HOJ A;  3A2W A;  1ABA A;  2FA4 A;  4GF0 A;  1TK5 B;  3QFB C;  4V2M A;  4CW9 A;  4I97 A;  3ZL5 A;  4TR1 B;  1B8X A;  4BA7 A;  1GLQ A;  3LJR A;  4XIH A;  4MDC A;  2I81 A;  3IK9 A;  4ZBD A;  4LL1 B;  4BWQ A;  4N0Z A;  5DQS A;  4ZIJ A;  2O87 A;  4XCS A;  2O85 A;  4BIK A;  2HRN A;  3FKF A;  1B9X C;  3GUS A;  1XIY A;  1QQ2 A;  2DMM A;  4KUN A;  3I43 A;  3UVH A;  1U87 A;  5AIV A;  5LD0 A;  3GKK A;  2YP6 A;  3HVX A;  18GS A;  2VM2 A;  3U6V A;  5DBQ A;  4G9H A;  3TKR A;  5IM9 A;  1JZD A;  2L5O A;  3EU4 A;  4K6X A;  4TOP A;  2IMK A;  1ZYN A;  4EDZ A;  4XRD A;  1WE0 A;  1O8W A;  2X4A A;  3LYK A;  2OE0 A;  1SYX A;  2C8U A;  2O8V B;  1K0O A;  3KTL A;  1MEK A;  1WJK A;  3UJ1 A;  1JZR A;  4PGT A;  1YKC A;  1FVK A;  2K8V A;  2YCD A;  3MNG A;  4ZL9 A;  2YV7 A;  4TR0 A;  2JSY A;  3HY2 A;  1EV4 A;  2VL3 A;  1YY7 A;  2Z9S A;  3DD3 A;  4EDY A;  1TRU A;  3RDW A;  5ECN B;  1M3J A;  3TOU A;  3EMX A;  4TKY A;  4NXI A;  5JCG A;  5A4W A;  1X0R A;  4K2X A;  4JU5 A;  3HZ4 A;  1GTB A;  4LA1 A;  3DXB A;  4KGI A;  3W6G A;  5L71 A;  3J7Y k;  4ECI A;  1GTA A;  5IO2 A;  3N9J A;  5GAP D;  2VCZ A;  1G7E A;  2H0G A;  3HVV A;  4WF5 A;  2KOK A;  3UOM A;  4NHZ A;  1HNC A;  5AIS A;  7GSS A;  3HVS A;  3M0F A;  4I8B A;  3V1W A;  4GQF A;  4Z7X A; 
#chains in the Genus database with same CATH homology
 3MIX A;  4YAV A;  1FW1 A;  1SU9 A;  3DWV A;  4F2I A;  2OJL A;  4AJ8 A;  3D21 A;  1EGR A;  2GQM A;  2ES7 A;  1FG4 A;  4BVX A;  1YEX A;  4ECC A;  3F6F A;  2CZ2 A;  1T8E B;  3MDK A;  2MZC A;  1DE1 A;  2XBI A;  2MMZ A;  3TGZ A;  3LYP A;  3C8E A;  2VL9 A;  4O5Q A;  5B8B A;  3CBU A;  3K8N A;  2L4C A;  1UN2 A;  3Q18 A;  2E2M A;  2C0E A;  3IE3 A;  4L0U A;  4KB3 A;  2YZU A;  1PGT A;  3RPP A;  2EIR A;  1OC9 A;  5COH A;  3KTB A;  1PKW A;  4KW6 A;  1PSQ A;  5ID2 A;  4MH3 A;  4OD7 A;  3M9J A;  3KMO A;  4WF4 A;  4AJ6 A;  3GNJ A;  3G9B A;  4KDY A;  5B6N A;  5FHI A;  2OAC A;  2X64 A;  3M9K A;  3W8S A;  2XPD A;  3F4S A;  1PN0 A;  2FY6 A;  2B6M A;  1QXH A;  3VWX A;  14GS A;  3ZVJ A;  4G0L A;  4MZW A;  5IOX A;  2V6O A;  4TR1 A;  3TJG A;  1EV9 A;  2F9S A;  1K0A A;  3SWL A;  2QC7 A;  2F8A A;  3UVT A;  2WFC A;  3ERG A;  1XVW A;  2H76 A;  5F05 A;  4TXO B;  5D9X A;  5F0G A;  2DIZ A;  5KN1 A;  2VLV A;  3IPZ A;  3RBT A;  2VL2 C;  3TOT A;  1VF1 A;  2VCQ A;  5KOX A;  5GAN D;  2O89 A;  2JZT A;  1KEB A;  1XWA A;  4YH2 A;  1Q98 A;  2DSA A;  1PX6 A;  1AIU A;  1ERT A;  1K3Y A;  4PQI A;  3UMA A;  4TVE A;  3GHA A;  1CQG A;  4TR4 A;  5IO0 A;  1N8J A;  3TDG A;  2LTK A;  3C71 A;  5CAX A;  2CQ9 A;  2NPB A;  3RHB A;  2HRA A;  2PPT A;  4FYC A;  4EUY A;  1V2A A;  1VGL A;  1ZYQ B;  3FMW A;  1NHY A;  4WR5 A;  4POB A;  3MWH A;  4EIP A;  2AV4 A;  2O7K A;  2WZ9 A;  1LBK A;  5CYY A;  3GV1 A;  1EZK A;  4QL9 A;  1M7T A;  5J5N A;  5HR3 A;  2IL3 A;  2LQQ A;  2GZZ A;  5J3R A;  2BJX A;  4JBB A;  1XOB A;  1SJZ A;  2NDO A;  4GWR A;  1GNE A;  1XVQ A;  1SL2 B;  4YQM A;  3QAV A;  1SK0 A;  1B9Y C;  2AUV A;  4PXO A;  4OFN A;  3DIE A;  2H6Y A;  4NHW A;  4HI7 A;  1MDI A;  2QA2 A;  1Y25 A;  3F6D A;  3LWA A;  4GCI A;  4MH2 A;  4CY8 A;  2HZE B;  2A2S A;  2R0G A;  3KM6 A;  5LCZ A;  3US3 A;  2IFQ B;  3GX8 A;  2DJJ A;  3BOA A;  2ZNM A;  2PWJ A;  1GSQ A;  3TCO A;  2GT6 A;  4L5L A;  1NM3 A;  3FY7 A;  4PUR A;  1X9S B;  2ON7 A;  1YEP A;  2H19 A;  2LUS A;  4LMW A;  2V6K A;  1PX7 A;  22GS A;  1BG5 A;  4WR4 A;  3UAR A;  1TDI A;  3P8W A;  3H93 A;  4NV2 A;  1OVN A;  4KH7 A;  2EIO A;  3UEM A;  5JCU A;  2LRT A;  5EY6 A;  4OO4 A;  2TIR A;  2PU9 C;  1F3A A;  3QDN A;  5J9C A;  4TW5 A;  1TTZ A;  5CRD A;  4IJI A;  3WYW A;  1XWC A;  3ERF A;  5GZZ B;  4ZBB A;  1FOV A;  3EC3 A;  3TRQ A;  4N0V A;  3LEF A;  1ZMA A;  3F0I A;  5B7C A;  5CRH A;  4ECB A;  2ZUP A;  4HQZ A;  1AUC A;  1BJX A;  3EUR A;  1SD8 A;  3FYG A;  2LKU A;  3EYT A;  2CX3 A;  1W89 A;  2L59 A;  2MMO A;  3ZMK A;  2XPE A;  4V2L A;  3IR4 A;  1AAZ A;  2JZR A;  5G30 A;  5H5R A;  3TKP A;  1JLV A;  1AC1 A;  10GS A;  1UC7 A;  2EIQ A;  1TI3 A;  1X9M B;  1GWC A;  1HYU A;  2JAC A;  2WJU A;  1T4Y A;  3KD0 A;  4Z2R A;  1K3O A;  3UIW A;  16GS A;  4TXO A;  1ZYE A;  5ECL B;  1B48 A;  2NTO A;  2RM6 A;  2CZ3 A;  4IBP A;  1FVJ A;  2DJK A;  3TJF A;  5ELG A;  2TRX A;  4EVM A;  2L5L A;  1U3A A;  5ENU A;  3HXS A;  1SKW B;  3L9V A;  1R26 A;  3HZ8 A;  4EC0 A;  4WEY A;  4OFT A;  4QL7 A;  3RAZ A;  2YWM A;  3BBY A;  4KCA A;  1FHE A;  1BX9 A;  2VCT A;  3HHV A;  3PPU A;  4O5U A;  4ICY A;  2HSH A;  3PR8 A;  2YWI A;  1BQ7 A;  1SYR A;  1M2A A;  2GST A;  3KCM A;  3DML A;  2YJ7 A;  1G6Y A;  2MBT A;  3ZRE A;  1GUK A;  2MYG A;  4GRF A;  3VFI A;  4IHU A;  4IVF A;  2HRK A;  3BCK A;  3WT2 A;  4USS A;  2E0Q A;  5EPF A;  5G5F A;  3APQ A;  2BMX A;  4LLR A;  2IWT A;  4P3Y B;  4NV5 A;  3HJP A;  1EP8 A;  1K0D A;  2B3S A;  3ZTL A;  2L6C A;  1GNW A;  5DDL A;  5G1K A;  5CNW A;  4BWS A;  4MK3 A;  1I9D A;  4OCE A;  1WIK A;  3ZRD A;  5IQY A;  1TI1 A;  4OWY A;  1OKT A;  1A0R P;  2R4V A;  1V57 A;  2GDR A;  2VOC A;  2GZP A;  2HZE A;  3QFA C;  1QUW A;  1PD2 1;  5HFI A;  4ULX A;  4I2T A;  2IFQ A;  2AJQ B;  2CAQ A;  4QQ7 A;  3AY8 A;  3HCZ A;  3TKS E;  1SK2 A;  1MD4 A;  2GZY A;  1TKD B;  4ID0 A;  2XC2 A;  1X5E A;  3VPQ A;  3ZZX A;  4GSN A;  3FR3 A;  2H1B A;  3TJJ A;  2CX4 A;  2GLR A;  4HDE A;  3EU3 A;  3ZYW A;  4Z2T A;  2OBI A;  1JZW A;  1A23 A;  1GSY A;  2PGT A;  1A2M A;  5GST A;  1GL8 A;  3GMF A;  1SJI A;  3FZ4 A;  2N5F A;  3APS A;  2HFD A;  2GT5 A;  3FK8 A;  1YKA A;  4CY6 A;  2K8S A;  2LJA A;  4YQV A;  3VWW A;  3IHG A;  2LJR A;  1TK0 B;  2DKH A;  4HZ4 A;  4IJ3 A;  4G2E A;  2P5Q A;  3RPN A;  1TRV A;  1O81 A;  5HFK A;  4K0G A;  1AQV A;  5B6M A;  1M9B A;  4GXZ A;  4WKW A;  2LRC A;  1JZO A;  1B4Q A;  2BTO T;  4AGS A;  4N11 A;  4F0C A;  5D73 A;  5HR1 A;  1GSE A;  5ECI B;  2VIM A;  1M99 A;  3FZ5 A;  5J9B A;  4GST A;  3PIN A;  1VF2 A;  4MPF A;  2WS2 A;  4ZB8 A;  2FWF A;  4KDX A;  5AN1 A;  3GH9 A;  1TRW A;  2OE1 A;  2JU5 A;  5ELA A;  4HJM A;  1OC3 A;  3EE2 A;  4HZ2 A;  2JZS A;  4IEL A;  1OKD A;  3H1N A;  1U3I A;  3KH7 A;  1PN9 A;  1EOG A;  2F8F A;  2ON5 A;  3EIN A;  2FLS A;  1J9B A;  2DJ2 A;  4XS6 A;  4RQR A;  5CRG A;  2FUG 2;  3DEX A;  1AXD A;  3IOS A;  4PUF C;  4Q5R A;  3DYR A;  5LNK e;  4HJ2 A;  4IQ1 A;  3W8J A;  4PNG A;  1YZX A;  1A2L A;  5HQP A;  2H6X A;  3IC4 A;  5CP1 A;  5C00 A;  1TOF A;  5CO3 A;  1ERV A;  4NMU A;  2DJ3 A;  1JHB A;  4FO5 A;  3D0Z A;  4O7H A;  4L5O A;  4YKF A;  4KND A;  2E7P A;  2FWE A;  4JRR A;  2I4A A;  2WUL A;  2PMT A;  1IYH A;  3IAM 2;  2V2G A;  4DVC A;  3F4T A;  2VLU A;  4IS0 A;  5F07 A;  4MP4 A;  1ZL9 A;  5ECH B;  1THO A;  2VD1 A;  3MSZ A;  3VI5 A;  1SD9 A;  3BD2 A;  1BAY A;  1JFU A;  1G0T A;  3TJK A;  1SKR B;  2YPM A;  4MJA A;  4EL1 A;  1YF1 A;  3QD9 A;  3I6A A;  5JCW A;  2B1K A;  4PQH A;  4X1U A;  4BVY B;  1S3A A;  3ZVJ D;  4POK A;  4K9Z A;  4ML1 A;  4OFM A;  3RHC A;  2PN8 A;  3G7I A;  2AHE A;  5DAK B;  5B8A A;  1OE8 A;  4GLT A;  4Z2U A;  3ZIJ A;  3EMP A;  1WP0 A;  4XS4 B;  2QGV A;  3WGE A;  1O8X A;  3IBH A;  2HYX A;  1EOH A;  3D4T A;  4DSS B;  3GSS A;  3R2Q A;  2X8H A;  1U88 A;  1SK1 A;  1C72 A;  2FNO A;  2QKE A;  4NAX A;  4POL A;  5FWG A;  4HU9 A;  1UVZ A;  1U6T A;  2DKI A;  4YKG A;  4JR4 A;  5F8B A;  1Z5Y E;  2C3N A;  2X8G A;  5HFG A;  4KAE A;  3O3T A;  1FB0 A;  3U5R E;  2GSS A;  3E3E A;  5HR0 A;  1V58 A;  4F82 A;  1SJ6 A;  1XZO A;  1TU8 A;  3Q6O A;  5D96 A;  3LW9 A;  1AW9 A;  6GSU A;  5DAL B;  2C4J A;  3QOU A;  4H86 A;  3S9F A;  3HKR A;  4XHM A;  2HLS A;  1PL1 A;  4D73 B;  4EXJ A;  5EVO A;  4TXV A;  1TJD A;  2YWO A;  1GH2 A;  1GP1 A;  1FAA A;  2V32 A;  4MPG A;  3HD5 A;  4OCF A;  4JZQ A;  2YJH A;  1URM A;  4ZL8 A;  4WBR D;  2LNT A;  5IOW A;  1XCC A;  4K5S A;  4IP6 A;  4HS1 A;  1EEJ A;  5DVB A;  5ECP B;  4F0B A;  3KJY A;  4FQU A;  1H75 A;  1VF3 A;  1N2A A;  4PX1 A;  2HNL A;  1HNA A;  1PMT A;  2PVO C;  1EEM A;  1R5P A;  2R5G A;  4J56 E;  2H75 A;  2LST A;  3DKS A;  3D5J A;  3ZLP A;  1TK8 B;  3TB2 A;  3NOF A;  3TKQ A;  1ACV A;  1XFL A;  3FR9 A;  4POM A;  5A5K A;  1T00 A;  2GTU A;  2VAF A;  1BYE A;  3D6I A;  3C1S A;  2LV3 A;  5D9W A;  3LG6 A;  1J0F A;  4MNN A;  3UL3 A;  2B7K A;  3CSH A;  3VWU A;  3TUE A;  2I1U A;  3L78 A;  2F3M A;  4I5Q A;  2R3X A;  3GFK A;  1GTI A;  3CYN A;  3CMI A;  1FOH A;  4N30 A;  4ML6 A;  4HEA 2;  4K7I A;  5AGY A;  2H1D A;  3F9U A;  2JL4 A;  1PL2 A;  5JWQ B;  3VWV A;  4DSQ A;  2VD0 A;  3CRU A;  2C80 A;  5ECK B;  4BVY A;  5ECM B;  4EKZ A;  4FYU A;  3WGX A;  2C1Y A;  2OAD A;  3NIV A;  3D22 A;  1OAZ A;  2X99 A;  1LU4 A;  2JSZ A;  2RUE A;  2GS3 A;  5DAK A;  1GUH A;  2RM5 A;  1Z3E A;  2AYT A;  5AIX A;  3IXR A;  1FB6 A;  2GSR A;  4MF7 A;  1XW9 A;  3GST A;  2KP1 A;  4XS4 A;  3HYP A;  4J2F A;  3G7J A;  5JWO B;  2VM1 A;  2H1G A;  4MZC A;  2M72 A;  3TRX A;  3P7X A;  1AQW A;  4TN8 A;  1RW1 A;  3H8Q A;  2CVD A;  5GSS A;  4DSS A;  3ZFL A;  2PVQ A;  5IPH A;  3H79 A;  4K7N A;  1BED A;  3VPT A;  6GSW A;  3CXG A;  2I3Y A;  2G2Q A;  2R6K A;  5D8I A;  1IYI A;  2HXK A;  5BMU A;  2L6D A;  3D4M A;  3M1G A;  2UZ8 A;  2FD3 A;  5A4U A;  4O32 A;  1Z7P A;  3FRC A;  2H71 A;  1X5C A;  1Z7R A;  2H01 A;  1H4O A;  1OYJ A;  3G7Y A;  2A2R A;  2H70 A;  4GTU A;  5INY A;  3QR6 A;  2HI7 A;  5CRE A;  1PRX A;  4KDU A;  3KMN A;  4A5P A;  1R5A A;  1E6B A;  3VK9 A;  3ZML A;  4NPB A;  2C3T A;  3DGQ A;  3A2X A;  1THX A;  3KP9 A;  5CRW A;  3F4R A;  2LQO A;  4RI7 A;  1WRY A;  20GS A;  4N10 A;  1GUL A;  2A2P A;  2TRC P;  1MTC A;  2R37 A;  3VLN A;  1GSS A;  1A8L A;  1A2J A;  5DAL A;  4G0I A;  4ACS A;  4DSR A;  2H0H A;  2M80 A;  4MJB A;  4IN0 A;  4RQX A;  3UBL A;  6GSV A;  4D73 A;  2H66 A;  2N5B A;  4EF0 A;  3VUR A;  1KBN A;  2EC4 A;  2GVP A;  3KIJ A;  1I5G A;  2WDU A;  5A4V A;  3QCP A;  4ZL7 A;  2GSQ A;  1GRX A;  2NBS A;  1UA5 A;  3M3M A;  1T7P B;  3KGK A;  1PKZ A;  2H6Z A;  3O6T A;  13GS A;  1MD3 A;  2YWN A;  2H72 A;  2RLI A;  1XBS A;  1S3D A;  5EL8 A;  1TU7 A;  2K6V A;  3GUR A;  4MCU A;  5KN2 A;  3GL5 A;  3VI7 A;  2V1M A;  1F37 A;  3CTF A;  1K0M A;  1M0U A;  2H73 A;  2B5E A;  2YOI A;  3OR5 A;  1QK8 A;  1F3B A;  1DUG A;  5DJL A;  2AB6 A;  4OO5 A;  3IV4 A;  4KA0 A;  4Q5Q A;  5H5S A;  1O73 A;  4OMV A;  5E59 A;  3Q19 A;  6GSX A;  4F9Z A;  2ZCT A;  3HDC A;  1EP7 A;  5G2Z A;  17GS A;  2B5X A;  3IK7 A;  4ECJ A;  5FT3 A;  2VCX A;  3ISO A;  4ZBA A;  1T3B A;  3J7Y b;  2LJK A;  2YNX A;  5IMV A;  2J23 A;  4I6X A;  3DVX A;  2VO4 A;  2H1A A;  2RII A;  4X43 A;  1YDK A;  2HZF A;  2WCI A;  3I69 A;  3M8N A;  3GIX A;  4EE0 A;  4O5R A;  1GUM A;  2F51 A;  2C0D A;  1ON4 A;  3KZQ A;  1R7H A;  3LXT A;  4JE1 A;  1VF4 A;  3IAS 2;  1X9W B;  3NZN A;  3IRA A;  1NW2 A;  3BJ5 A;  3PGT A;  1Q4J A;  4MJE A;  3EPT A;  3L9U A;  4PQ1 A;  4TR3 A;  1A0F A;  4FYB A;  4DEJ A;  2P0G A;  1TW9 A;  1ZZY A;  4X4J A;  2OA7 A;  1R4W A;  1YQ1 A;  3FR6 A;  3A3T A;  3QMX A;  1ZOF A;  3F3R A;  4K8M A;  1DE2 A;  2HE3 A;  5IMA A;  3TRP A;  1SL0 B;  3UBK A;  4MAB A;  5KOW A;  4F03 A;  3N5O A;  4BL7 B;  1WMJ A;  1V9W A;  4JR6 A;  1GTU A;  3BCI A;  4EO3 A;  3HA9 A;  5F06 A;  3I9V 2;  3GYK A;  2CT6 A;  4AJ7 A;  6GSY A;  4K7O A;  3A2V A;  4LL4 B;  2CV4 A;  2VLT A;  4I2U A;  2LNS A;  1Z9H A;  4L8E A;  1RK4 A;  3P2A A;  4FH8 A;  2YZH A;  3GKM A;  3UAP A;  1PA3 A;  4ZB9 A;  5G31 A;  2N5A A;  4BPY A;  3CSJ A;  3WD6 A;  4MF5 A;  2V41 A;  2VCV A;  2QA1 A;  2NVL A;  5KEJ A;  3ZIT A;  4IKH A;  1QGV A;  3FW2 A;  3PH9 A;  2B5Y A;  1A24 A;  3SBC A;  1DBY A;  1XWG A;  1K0C A;  1EWX A;  5IIZ A;  2XHF A;  4O92 A;  2YN1 A;  2PUK C;  1FO5 A;  2IMF A;  3FHK A;  2HRF A;  3CTG A;  1F9M A;  4GQC A;  2VUP A;  2J9H A;  5IMZ A;  3ME7 A;  1V98 A;  3KH9 A;  4X0X A;  4NWY A;  4Q5N A;  1A8Y A;  2VCW A;  2XBQ A;  3APO A;  2KHP A;  2CA8 A;  1XOA A;  1XPV A;  1ZCP A;  2DIY A;  2I9H A;  1QFN A;  4ZIL A;  3TKS A;  1TRS A;  3TKS C;  2B1L A;  3GA4 A;  1ST9 A;  2GQK A;  3KP8 A;  2REM A;  2LEG A;  3EWL A;  3WGD A;  1OC8 A;  3LFL A;  1PQN A;  1OE7 A;  5J4U A;  1AQX A;  3L9S A;  4KX4 A;  3IC8 A;  2VL2 A;  3QPM A;  3LQ7 A;  5H5Q A;  2DBC A;  3IHQ A;  3ED3 A;  4K0N A;  4WET A;  5IPG A;  4K1F A;  2X8C A;  4MLY A;  5J41 A;  5KN0 A;  3FZ9 A;  4Q5F A;  5IMD A;  1K3L A;  5JWR B;  3KEB A;  1ILO A;  5ECR B;  4PTS A;  4YAP A;  1WOU A;  1WWJ A;  19GS A;  4JED A;  3GTU B;  1QMV A;  3ZFB A;  1EGO A;  3O76 A;  1O6J A;  1X5D A;  1M2D A;  4MMM A;  3GKN A;  1ML6 A;  1HQO A;  3MAK A;  2YAN A;  3L0H A;  1XW5 A;  2IMI A;  2X49 A;  1E2Y A;  1J08 A;  4E8E A;  4ISD A;  1V40 A;  1M9A A;  2KUC A;  2K9F A;  2IME A;  1XWK A;  2OKA A;  2DLX A;  1JLW A;  3ME8 A;  4V1A p;  4RI6 A;  5IMF A;  1G6W A;  1KNG A;  3HJO A;  2RUF A;  2ALB A;  3R3E A;  5ABR A;  3GL3 A;  1YJ6 A;  1HD2 A;  3LSZ A;  2P5R A;  3DVW A;  2HSY A;  1W4V A;  3EVI A;  4K5R A;  4XRA A;  3C7M A;  3E9J B;  1VRS D;  1SEN A;  4RUV A;  2DC5 A;  2YV9 A;  2MMN A;  3E0U A;  2M46 A;  2MMA A;  2WB9 A;  5DCG A;  2DJ0 A;  3KXO A;  4K2D A;  4E8H A;  8GSS A;  3GX0 A;  2DJ1 A;  3H4K A;  4KE3 A;  2LRN A;  3Q74 A;  1F6M C;  12GS A;  2WGR A;  3C1R A;  2HSM A;  4HQS A;  2FWG A;  5DJM A;  1G7O A;  2QSI A;  11GS A;  2L57 A;  2GQL A;  1SL1 B;  2CAI A;  4XTS A;  4BL7 A;  1NSW A;  1YF0 A;  5DQY A;  3IA1 A;  2FA8 A;  2E2G A;  1LJR A;  3FZA A;  5ECO B;  4MF6 A;  3QAW A;  4IQA A;  5D93 A;  4YQU A;  1K0N A;  2IJY A;  2IPA A;  2DML A;  3JCM L;  3LGC A;  4IGJ A;  2PBJ A;  1USB A;  2JAD A;  2LS5 A;  4KSO A;  2KLX A;  4ZB6 A;  3GN3 A;  1WPI A;  2GGT A;  4IP1 A;  4PUA A;  4HUA A;  2R0P A;  1T1V A;  2A4V A;  5HR2 A;  5C04 A;  4KSM A;  3CRT A;  4AF2 A;  5DCH A;  1ERU A;  3CSI A;  4MZB A;  1M2B A;  3GRX A;  5E4W A;  4WXT A;  2C0G A;  4WBJ A;  9GSS A;  4G10 A;  2IIY A;  4J57 E;  4KCE A;  4ZXG A;  3QAG A;  1ZYP A;  2A4H A;  2H8L A;  3MYD A;  4CHS A;  3FEU A;  3DRN A;  2FGX A;  1SKS B;  3F63 A;  1XW6 A;  1F2E A;  2C3Q A;  3ZIV A;  2KP2 A;  1XXU A;  4FIW A;  1DSB A;  2AAW A;  1GLP A;  2MBS A;  2B7J A;  2L4Q A;  1GSU A;  1S3C A;  2G0F A;  3P90 A;  2K18 A;  1MDK A;  1TXX A;  6GSS A;  3GKX A;  1O85 A;  4G0K A;  3C73 A;  5ECS A;  2CVB A;  2WRT A;  1Z6N A;  3WT1 A;  4EIQ A;  2IMD A;  4XS1 A;  2H30 A;  3F3Q A;  4IW9 A;  2OE3 A;  1CQH A;  1T4Z A;  5KN3 A;  2FWH A;  1KTE A;  3GH6 A;  2R0C A;  2CVK A;  1Z6M A;  4BVX B;  4ILF A;  3IDV A;  4TRX A;  4KF9 A;  3LOR A;  4LMV A;  1MDJ A;  4MA9 A;  2FCH A;  3TJB A;  2OBK A;  5BRT A;  4L0W A;  3L4N A;  5G5E A;  3LXZ A;  3ERW A;  1O7U A;  5D9V A;  5IMC A;  1K0B A;  2PER A;  5G1L A;  2C0F A;  3F8U A;  3GTU A;  1HNB A;  4CDO A;  2D2Z A;  6GST A;  4G19 A;  1B4P A;  2H74 A;  1GSD A;  1OC9 B;  2HT9 A;  4GSS A;  4MJC A;  1RQM A;  1GSF A;  2FHE A;  3A5W A;  4V1A g;  4HU7 A;  1ZGN A;  2IN3 A;  3A5I A;  5ID2 B;  3HJM A;  1TP9 A;  2P31 A;  2H0I A;  4PNF A;  1Y6E A;  1XWB A;  2R2J A;  5D9T A;  1NHO A;  5ECQ B;  4V2N A;  1ERW A;  4HOJ A;  3A2W A;  1ABA A;  2FA4 A;  4GF0 A;  1TK5 B;  3QFB C;  4V2M A;  4CW9 A;  4I97 A;  3ZL5 A;  4TR1 B;  1B8X A;  4BA7 A;  1GLQ A;  3LJR A;  4XIH A;  4MDC A;  2I81 A;  3IK9 A;  4ZBD A;  4LL1 B;  4BWQ A;  4N0Z A;  5DQS A;  4ZIJ A;  2O87 A;  4XCS A;  2O85 A;  2HRN A;  3FKF A;  1B9X C;  3GUS A;  1XIY A;  1QQ2 A;  2DMM A;  4KUN A;  3I43 A;  3UVH A;  1U87 A;  5AIV A;  5LD0 A;  3GKK A;  2YP6 A;  3HVX A;  18GS A;  2VM2 A;  3U6V A;  5DBQ A;  4G9H A;  3TKR A;  5IM9 A;  1JZD A;  2L5O A;  3EU4 A;  4K6X A;  4TOP A;  2IMK A;  1ZYN A;  4EDZ A;  4XRD A;  1WE0 A;  1O8W A;  2X4A A;  3LYK A;  2OE0 A;  1SYX A;  2C8U A;  2O8V B;  1K0O A;  3KTL A;  1MEK A;  1WJK A;  3UJ1 A;  1JZR A;  4PGT A;  1YKC A;  1FVK A;  2K8V A;  2YCD A;  3MNG A;  4ZL9 A;  2YV7 A;  4TR0 A;  2JSY A;  3HY2 A;  1EV4 A;  2VL3 A;  1YY7 A;  2Z9S A;  3DD3 A;  4EDY A;  1TRU A;  3RDW A;  5ECN B;  3TOU A;  3EMX A;  4TKY A;  4NXI A;  5JCG A;  5A4W A;  1X0R A;  4K2X A;  4JU5 A;  3HZ4 A;  1GTB A;  4LA1 A;  3DXB A;  4KGI A;  3W6G A;  5L71 A;  3J7Y k;  4ECI A;  1GTA A;  5IO2 A;  3N9J A;  5GAP D;  2VCZ A;  1G7E A;  2H0G A;  3HVV A;  4WF5 A;  2KOK A;  3UOM A;  4NHZ A;  1HNC A;  5AIS A;  7GSS A;  3HVS A;  3M0F A;  4I8B A;  3V1W A;  4GQF A;  4Z7X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...