5H5QA

Crystal structure of human gpx4 in complex with gxpep-1
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
165
structure length
164
Chain Sequence
DDWRAARSMHEFSAKDIDGHMVNLDKYRGFVSIVTNVASQGKTEVNYTQLVDLHARYAERGLRILAFPSNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKIEVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGVVVKRYGPMEEPLVIEKDLPHYF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phospholipid hydroperoxide glutathione peroxidase, mitochond
publication title Discovery of GPX4 inhibitory peptides from random peptide T7 phage display and subsequent structural analysis
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 60
structure length 164
sequence length 165
ec nomenclature ec 1.11.1.12: Phospholipid-hydroperoxide glutathione peroxidase.
pdb deposition date 2016-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00255 GSHPx Glutathione peroxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5h5qA00
4EC0A 4TXVA 4X1UA 1DBYA 2L5OA 3F4SA 1J0FA 5D93A 2JL4A 3GKXA 5EL8A 5H5QA 3EINA 2R4VA 1AC1A 3LEFA 5G5EA 3VWUA 3HJMA 4K6XA 4OCFA 4ECBA 4NPBA 1QK8A 2IPAA 3M8NA 2HXKA 1AQVA 2WB9A 1HYUA 3K8NA 1ABAA 5G31A 4IVFA 3LGCA 4NWYA 2GQKA 5F07A 3DGQA 4PUAA 3A2WA 4FYUA 1S3AA 4TXOA 4V2MA 5JCUA 1TP9A 3TCOA 4GSTA 3FZ9A 1ZOFA 3ZL5A 1A8YA 3ZIVA 3G9BA 5LCZA 3TDGA 1Z6MA 2LNTA 5D96A 1M9BA 4OD7A 4O32A 3GX8A 4MF5A 4XHMA 4GWRA 4K9ZA 1AQWA 4EDYA 1BAYA 2GZPA 1PL2A 1Q4JA 1W89A 2YP6A 4WKWA 4J56E 4ML6A 4XIHA 2KP1A 3ZMLA 2IMFA 4F82A 2NDOA 1DE2A 3HJOA 2FUG2 3VURA 2WGRA 1GSUA 2DLXA 1GSQA 1AW9A 1SJZA 3LSZA 4MA9A 3GKNA 4ZXGA 4FO5A 2XBQA 5E59A 1PN9A 4YQVA 4WBRD 3TKSE 1IYHA 5GAND 1U3IA 3FR9A 1XW9A 2H1BA 1NW2A 5IIZA 2HNLA 2CQ9A 4DVCA 4KGIA 4JE1A 4KSMA 2GLRA 2NTOA 1SD8A 2HSYA 3CSIA 1V9WA 3IE3A 2TRXA 4AF2A 2HYXA 2H19A 2H1AA 2PWJA 2GQMA 1THXA 2L4QA 2AYTA 4JR6A 4OFTA 1ZZYA 1NHYA 3CTFA 5H5RA 4XCSA 1SL2B 1EP7A 4HQZA 4ZBBA 2HRFA 4LA1A 4KE3A 5DQYA 3UVHA 5IM9A 3D4TA 1TXXA 1WIKA 3KMNA 3L4NA 2E2MA 1K0MA 4EDZA 4MJEA 1OC8A 1T7PB 4ID0A 5DDLA 2AV4A 3LXTA 2DMLA 3D6IA 3NZNA 2ON5A 22GSA 1BX9A 4IBPA 3QD9A 3HCZA 1EEMA 2X99A 4XS6A 5KN1A 1U3AA 2CVBA 1T00A 1SJIA 1O7UA 2LQQA 1ZYQB 5D73A 2ES7A 2J9HA 5FHIA 1OE8A 9GSSA 4WF4A 3GH9A 2ZCTA 3HY2A 4HDEA 1BQ7A 1FB0A 2V1MA 2JADA 1VGLA 4G2EA 2JZRA 2WRTA 1F6MC 4TXOB 1WP0A 3IHQA 4EL1A 5G30A 4K7IA 2H75A 4O92A 4TR1A 3UEMA 3ZLPA 2VAFA 1RW1A 3RAZA 1YJ6A 2C3QA 4IHUA 2YZUA 1GNWA 2H71A 2CAIA 2X8CA 3GUSA 1MDJA 2M80A 2PUKC 1GUKA 5CYYA 3IR4A 4TKYA 2MBSA 4Z7XA 3F3QA 3ZZXA 2H6ZA 3F3RA 2NPBA 2B1LA 1TW9A 1G6WA 4MPGA 3C8EA 3FRCA 2DJ0A 4BA7A 4MCUA 2YWIA 3TRXA 5JWQB 2CAQA 2HZEA 4MH2A 4V1Ap 3GHAA 4J2FA 2IMKA 1LJRA 3BD2A 5IMZA 4MMMA 1PQNA 4I2TA 1XW6A 5F0GA 4WR5A 3HJPA 4DSQA 1MEKA 3QR6A 5GSSA 4BVXA 4X0XA 4DSSA 5IMFA 4TR4A 1TK5B 1TJDA 5IO0A 1YDKA 4MJCA 12GSA 4NHZA 1O73A 3QDNA 5J9CA 3KEBA 4OO5A 2H6YA 5HFIA 5ENUA 5COHA 5AISA 1ZL9A 2CVDA 1PA3A 1ERTA 5DVBA 1C72A 3EWLA 2FD3A 3UBLA 2HLSA 5F06A 1U87A 1FB6A 2A4VA 3FK8A 3C73A 2X64A 1O8XA 1PMTA 3HZ4A 2CZ3A 4ML1A 1K3LA 1XXUA 5ID2A 3ZITA 5L71A 2B1KA 2ALBA 1GLPA 4BL7A 6GSYA 1FO5A 5GAPD 2RUEA 4V1Ag 4JRRA 2BMXA 2KUCA 3VPTA 3DYRA 1MD3A 3W6GA 4GTUA 2VM2A 4KDUA 3ZYWA 5FT3A 1TRWA 3PR8A 1W4VA 5AGYA 2XBIA 3GA4A 4POKA 1QXHA 2A2SA 2TIRA 3G7JA 1NHOA 3DD3A 2F51A 1V57A 1TRUA 3IC4A 2LJRA 2QGVA 4I2UA 2VCQA 1ST9A 1YZXA 4K2DA 4MF6A 4G19A 2LNSA 1T8EB 1EV9A 1KTEA 3IK7A 1VF4A 4TR1B 1JHBA 2CX4A 5B8AA 2GSRA 3MDKA 1O85A 4MZBA 3VWWA 4POMA 3IAM2 4EE0A 4AJ6A 4DSRA 2CZ2A 2EIQA 2WCIA 3IAS2 4H86A 1PGTA 3P7XA 2EIRA 1GUMA 1WWJA 4E8HA 3GSTA 1Z6NA 4JR4A 3ZRDA 4CW9A 1FVKA 5CP1A 1T1VA 2R6KA 2HZEB 3IOSA 19GSA 2JZSA 4TR3A 3TRQA 3I43A 2L6CA 4FH8A 2ZNMA 1PRXA 3CSHA 4MZWA 1UA5A 3G7IA 11GSA 2AB6A 1J08A 2C0DA 1Z7PA 5DJMA 2YCDA 1TKDB 2O85A 3QAWA 3RBTA 1F3AA 2I9HA 4DSSB 2D2ZA 2K8VA 3F8UA 3CMIA 1SENA 5EY6A 2L6DA 4G9HA 4I5QA 2L59A 1GTAA 1SK2A 1XVWA 4MDCA 4K1FA 3F6DA 1VF2A 5CRWA 4V2NA 2V6KA 3W8SA 3ERFA 1XVQA 5ECQB 1EP8A 1PX7A 4FYCA 3H8QA 1A0RP 2MMZA 1YKAA 4TOPA 2C0EA 3FZAA 1CQHA 1QUWA 3M0FA 3V1WA 5ID2B 4GLTA 3DKSA 2PGTA 3ZVJD 1PL1A 1OC9A 4HU7A 2C0FA 4N0ZA 1R7HA 1XWCA 5IQYA 5JWRB 1F2EA 4YAPA 3FZ4A 3UARA 4N10A 3ME8A 2FY6A 1GSEA 2DBCA 4K0NA 1YY7A 3O6TA 2B5EA 3TB2A 4ZILA 3H79A 5E4WA 3GL3A 2YWMA 2DJJA 5IMDA 3GX0A 3HA9A 1BEDA 4OWYA 2VL2C 2GT6A 2F9SA 5G2ZA 1K0DA 3KZQA 2H73A 5JWOB 1F3BA 6GSXA 2WJUA 3CTGA 1EOHA 3TGZA 4KCEA 5J3RA 13GSA 3FZ5A 2ZUPA 3PGTA 3M9KA 1B8XA 3TKSA 1X9MB 2VUPA 2YZHA 3LYKA 3C7MA 5ELAA 4ZB6A 3FEUA 3Q74A 2C4JA 2H0IA 4KB3A 3TJBA 4L5OA 1E2YA 1YKCA 3HYPA 4TVEA 5CRGA 1ON4A 1UVZA 4F0CA 4POLA 2P0GA 2WFCA 1R4WA 4BWQA 2I81A 1WPIA 1A2LA 2VLVA 3GH6A 1MDKA 3CRTA 1T4YA 2P31A 3NIVA 4YQMA 2PPTA 2I4AA 1G7EA 2DC5A 4F0BA 3APQA 2RM6A 2IMDA 4JU5A 1A0FA 4ISDA 1B48A 4TRXA 2L5LA 3H93A 4GQCA 1B9YC 3ZTLA 1TRVA 2V2GA 2PVQA 2IMEA 1YQ1A 4OMVA 3EE2A 5DBQA 2H30A 1TI1A 3U6VA 1H75A 2YWOA 2CX3A 6GSWA 1M2BA 1AUCA 4TW5A 1SKWB 2H76A 3UMAA 1BG5A 3DRNA 1ERVA 4Q5FA 4V2LA 1LBKA 1GSSA 3KJYA 1PKZA 2E2GA 1AXDA 3D5JA 2X8GA 3OR5A 1TU7A 4RUVA 2N5FA 4NV2A 2FA4A 3S9FA 5IMVA 1OC9B 2KP2A 3KD0A 4IELA 1G6YA 2F3MA 2LQOA 3DWVA 2HSHA 4POBA 1X5DA 4ZBAA 2XHFA 5KN3A 4QQ7A 2IIYA 3KMOA 4LMWA 4EF0A 3KCMA 5ECLB 2FWFA 3VPQA 4EUYA 3D4MA 2DJ3A 2CT6A 3TJKA 1XBSA 5IPHA 2OACA 2F8FA 3QFAC 3GMFA 2C8UA 3VK9A 3DIEA 3IV4A 2LEGA 3E9JB 4X43A 1XWAA 3KIJA 2RUFA 4FYBA 3SWLA 1XOAA 4FIWA 4MZCA 2FCHA 4EXJA 2H8LA 3F6FA 2VD1A 1MD4A 2VOCA 1QMVA 2OBKA 2LS5A 4IQ1A 3TOUA 1M9AA 2K6VA 2REMA 5C00A 4BVYA 1AIUA 5ECHB 3BOAA 2IMIA 3TKQA 2YV7A 2M46A 1X5EA 2DJ2A 2WS2A 3UBKA 1OKDA 1B4QA 5ECRB 1GULA 3LJRA 2PBJA 1Z3EA 1IYIA 3TJGA 3EU3A 2V6OA 2L4CA 2B7JA 5HFGA 1T3BA 1MTCA 1GRXA 3I69A 2HRNA 5IO2A 2K9FA 3LXZA 6GSVA 3KGKA 1THOA 3J7Yb 5J41A 3UVTA 2YWNA 3WYWA 2LUSA 1XCCA 3I6AA 3HXSA 1DE1A 2K8SA 3H1NA 4N30A 2GZYA 1AQXA 2IL3A 1FHEA 4GCIA 4HJ2A 2FHEA 3TJFA 2OADA 1WJKA 3HD5A 3FHKA 3WGDA 1TK0B 4CHSA 2C3NA 2LTKA 4CDOA 1M7TA 3VWVA 3DMLA 3IRAA 1S3CA 2RM5A 3CRUA 1SYRA 4G10A 2M72A 2HT9A 1XIYA 2YOIA 5G1KA 3CSJA 6GSTA 3L9UA 4KNDA 1USBA 3LORA 4HJMA 3APOA 2YPMA 2MMAA 4ECCA 2H72A 1KNGA 1V58A 1XWBA 4PGTA 4WETA 4OFMA 1A2MA 4HS1A 2VCWA 4YAVA 4LL4B 1YEPA 4OFNA 1GNEA 3Q19A 2XPDA 5D9WA 3EVIA 2RLIA 5KEJA 3E0UA 3JCML 2JZTA 2AJQB 3APSA 2BJXA 1YEXA 1ML6A 5EPFA 4PNGA 1Y6EA 4NXIA 2VCTA 3C71A 3RPNA 2CVKA 2OA7A 4RQRA 4ZB8A 4ECJA 2B6MA 2YV9A 1SKSB 5J5NA 2DJ1A 4KDYA 3BCIA 1K0AA 3VI5A 1M99A 5INYA 1HNBA 4OO4A 4HUAA 3ZREA 2FWEA 3C1RA 2O7KA 2H1DA 1LU4A 5ECOB 3GRXA 2NVLA 2AUVA 1O81A 4EVMA 1A8LA 1WOUA 3GFKA 3GIXA 3LFLA 4PURA 2MMOA 1NSWA 1TTZA 1E6BA 4KW6A 5IMCA 1GTIA 3IDVA 1Z5YE 1TRSA 5AIVA 4F03A 4TN8A 2MZCA 1G7OA 1Y25A 3GN3A 4K7NA 4ACSA 1CQGA 4IN0A 1ZCPA 2OKAA 3BCKA 1X0RA 3IK9A 4HI7A 5ECNB 4KDXA 1XWGA 1I5GA 4PXOA 5DAKA 2VCXA 1S3DA 3PINA 2HZFA 2MBTA 2B5XA 1SK1A 3KP9A 1N8JA 2OE3A 1SU9A 1RQMA 4NAXA 2K18A 4YQUA 3EMPA 4IKHA 2O87A 4N11A 2HE3A 2FWGA 2FLSA 1DSBA 3D0ZA 3EURA 1B9XC 4GSNA 2KLXA 3UAPA 4MH3A 3QFBC 2YJHA 1OC3A 3FR6A 1EGRA 5IPGA 4ECIA 4GF0A 1M2AA 3F63A 5C04A 3L0HA 5DCGA 3LQ7A 3MSZA 3GYKA 3O76A 3WT1A 2FNOA 2I1UA 2PMTA 3RPPA 14GSA 2OJLA 3DVXA 3A2VA 3ISOA 4P3YB 5GSTA 2O89A 1TI3A 1JZRA 2L57A 1HNCA 3Q18A 4KX4A 5LD0A 1JLVA 4O7HA 1TK8B 1EGOA 3IPZA 4ILFA 5HR0A 2H1GA 3E3EA 3L78A 4MPFA 2IN3A 1A24A 8GSSA 4XTSA 5ECSA 1QFNA 5ECKB 16GSA 1V2AA 2PU9C 3ZFLA 2VCZA 4Q5NA 5CRHA 7GSSA 1I9DA 1VF3A 5KN2A 5DALA 4HOJA 1Q98A 3MNGA 1GSDA 2GT5A 5JCGA 3TKSC 1O6JA 3QMXA 2C3TA 1SKRB 1XW5A 1EV4A 4IQAA 1KBNA 4RI6A 4WR4A 1EOGA 2RIIA 2LRNA 2OE1A 2B3SA 4IJ3A 2E7PA 3HVSA 3IXRA 5AIXA 4I6XA 3L9SA 2ON7A 4PUFC 2KOKA 3DXBA 2VO4A 5GZZB 3CBUA 5B6NA 3TKRA 1JLWA 2VLTA 4GRFA 4MJBA 1FVJA 1T4ZA 1M2DA 4XRAA 2VL2A 3WGXA 1QGVA 3LYPA 2MMNA 2NBSA 2VL3A 4XS4A 1QQ2A 5H5SA 1GH2A 1K0NA 1UC7A 3U5RE 5DAKB 1TDIA 2I3YA 3UJ1A 4F9ZA 1JZOA 3LG6A 3VFIA 5B7CA 4DEJA 4XRDA 5F05A 2JSZA 3GKKA 3M9JA 1X9SB 4Q5RA 1O8WA 5ECIB 2WZ9A 3CYNA 1U88A 3FKFA 4JZQA 4OCEA 5HR3A 2R2JA 2YN1A 2XC2A 5HQPA 1EZKA 3MAKA 4JEDA 4NHWA 5ABRA 3US3A 4LMVA 4I97A 4WXTA 3TJJA 3VLNA 4WF5A 3N9JA 1FW1A 1K0OA 5JCWA 1GUHA 1GSYA 1XWKA 3F0IA 4E8EA 1JZWA 2H74A 2LRCA 3FR3A 2GSQA 4L5LA 5D9TA 6GSUA 2VD0A 3KTLA 4LL1B 3EYTA 3ZIJA 4MLYA 5A5KA 3D21A 5CNWA 1XPVA 2DMMA 1VRSD 4ZBDA 4RI7A 2Z9SA 4IGJA 2DIYA 4RQXA 5HR2A 3F4TA 4ZB9A 2GS3A 1XFLA 2C0GA 2JACA 1XOBA 3J7Yk 1R5PA 3DVWA 1FOVA 4PQHA 3C1SA 5DALB 3UIWA 1YF1A 1ACVA 2CV4A 2F8AA 4KAEA 4PQIA 1F9MA 4J57E 1VF1A 2QC7A 3ZVJA 3VI7A 2QKEA 3NOFA 3TOTA 2N5AA 3EMXA 1PKWA 2YANA 4ULXA 3LWAA 3HKRA 3W8JA 3ZMKA 2A2RA 4AJ8A 4I8BA 1TOFA 1XZOA 3KXOA 2H01A 1ZMAA 1PX6A 2LKUA 2YNXA 3WGEA 5CREA 3GKMA 1GTUA 1FG4A 2C1YA 1Z7RA 1GP1A 3PH9A 4HZ4A 4L8EA 1YF0A 3EU4A 3O3TA 4HU9A 4ZL8A 2HFDA 3GTUA 3RDWA 3RHBA 1TU8A 3TUEA 5AN1A 1F37A 2CA8A 4XS4B 1V40A 4MABA 1WRYA 3ERGA 2VLUA 4D73A 4Q5QA 2GSSA 1AAZA 2PERA 3KTBA 4KA0A 2H66A 5DQSA 4ZL7A 1BYEA 3R2QA 3ME7A 4HEA2 5B8BA 1SD9A 2R3XA 2EC4A 2GVPA 4L0UA 3WD6A 2LJAA 2H70A 1G0TA 3GURA 4KUNA 3G7YA 3KP8A 6GSSA 2LSTA 2QSIA 2FGXA 2R5GA 1GTBA 2MYGA 4ZL9A 1SK0A 3BJ5A 1ZGNA 2VCVA 2DJKA 4TR0A 1R5AA 2XPEA 5A4WA 3ZFBA 3ED3A 2GSTA 2FWHA 5G1LA 1X9WB 4KSOA 2IFQA 1HQOA 1NM3A 4L0WA 3P2AA 4PNFA 2YJ7A 5DJLA 2LJKA 2C80A 4MJAA 2J23A 1X5CA 2O8VB 4WEYA 3HZ8A 4QL9A 4EKZA 5CO3A 4QL7A 1K3OA 3UL3A 5IMAA 2FA8A 1V98A 5CRDA 3KM6A 4PQ1A 4AGSA 5A4VA 4N0VA 4K7OA 3RHCA 1SYXA 4MP4A 3EC3A 3IA1A 2H6XA 4K8MA 4ZIJA 1K0BA 1N2AA 1OYJA 3F9UA 10GSA 5B6MA 3Q6OA 1RK4A 2VIMA 4MK3A 4HQSA 1BJXA 4NMUA 3FY7A 1OVNA 3P8WA 3HVXA 2B5YA 1ZYEA 2LV3A 3QAVA 3KH7A 1J9BA 1M0UA 3FW2A 3GL5A 5FWGA 1OAZA 3N5OA 5F8BA 2AHEA 2BTOT 4BWSA 1U6TA 2WDUA 2H0GA 2IJYA 5J4UA 3DEXA 5IOXA 2KHPA 3QAGA 2GGTA 1MDIA 5ELGA 2PN8A 3M1GA 2R37A 4F2IA 1R26A 2GDRA 1URMA 1FAAA 3H4KA 5G5FA 4PX1A 4GSSA 3I9V2 5ECPB 3ERWA 4BPYA 2OE0A 2E0QA 3GTUB 4EO3A 5HFKA 2LRTA 1K0CA 4LLRA 2B7KA 2VL9A 3M3MA 3UOMA 2EIOA 2X8HA 5ECMB 2JSYA 5EVOA 4AJ7A 2G0FA 3HDCA 4D73B 3TKPA 4XS1A 3WT2A 3HVVA 1PSQA 2JU5A 3CXGA 3MWHA 4WBJA 2PVOC 2TRCP 4IW9A 4KCAA 5J9BA 2V32A 3GNJA 3QPMA 4IS0A 3A5WA 3TRPA 1HNAA 2IWTA 1KEBA 2H0HA 2WULA 4JBBA 3GSSA 2OBIA 2GZZA 2GQLA 2GTUA 4YH2A 4IJIA 2HI7A 1OKTA 2G2QA 1GWCA 3HHVA 2P5QA 3P90A 1H4OA 2IFQB 2P5RA 18GSA 1WE0A 4KH7A 5DCHA 5A4UA 2VM1A 3QOUA 4GQFA 3SBCA 4IP6A 1K3YA 5CAXA 3L9VA 1OE7A 3FYGA 17GSA 1SJ6A 2AAWA 3VWXA 1B4PA 1ILOA 2N5BA 3GV1A 5KN0A 1GSFA 5LNKe 2DSAA 3QCPA 4NV5A 4MF7A 3KH9A 3IBHA 5IOWA 1ERWA 3A2XA 1PD21 4GXZA 4O5RA 1JZDA 2V41A 1EWXA 1UN2A 4K0GA 1GLQA 5HR1A 20GSA 4HZ2A 2DIZA 1GL8A 4IP1A 1EEJA 1ERUA 1HD2A 1DUGA 5D9VA 3D22A 1JFUA 1SL1B 1A2JA 1SL0B 3A3TA 3AY8A 5D9XA 3F4RA 1A23A 1Z9HA 3BBYA 1WMJA 5D8IA
chains in the Genus database with same CATH superfamily
4EC0A 4TXVA 4X1UA 1DBYA 2L5OA 3F4SA 1J0FA 5D93A 2JL4A 3GKXA 5EL8A 5H5QA 3EINA 2R4VA 1AC1A 3LEFA 5G5EA 3VWUA 3HJMA 4K6XA 4OCFA 4ECBA 4NPBA 1QK8A 2IPAA 3M8NA 2HXKA 1AQVA 2WB9A 1HYUA 3K8NA 1ABAA 5G31A 4IVFA 3LGCA 4NWYA 2GQKA 5F07A 3DGQA 4PUAA 3A2WA 4FYUA 1S3AA 4TXOA 4V2MA 5JCUA 1TP9A 3TCOA 4GSTA 3FZ9A 1ZOFA 3ZL5A 1A8YA 3ZIVA 3G9BA 5LCZA 3TDGA 1Z6MA 2LNTA 5D96A 1M9BA 4OD7A 4O32A 3GX8A 4MF5A 4XHMA 4GWRA 4K9ZA 1AQWA 4EDYA 1BAYA 2GZPA 5BRTA 1PL2A 1Q4JA 1W89A 2YP6A 4WKWA 4J56E 4ML6A 4HSCX 4XIHA 2KP1A 3ZMLA 2IMFA 4F82A 2NDOA 1DE2A 3HJOA 2FUG2 3VURA 2WGRA 1GSUA 2DLXA 4PTSA 1GSQA 1AW9A 1SJZA 3LSZA 4MA9A 3GKNA 4ZXGA 3IC8A 4FO5A 2XBQA 5E59A 1PN9A 4YQVA 4WBRD 3TKSE 1IYHA 5GAND 1U3IA 3FR9A 1XW9A 2H1BA 1NW2A 5IIZA 2HNLA 2CQ9A 4DVCA 4KGIA 4JE1A 4KSMA 2GLRA 2NTOA 1SD8A 2HSYA 3CSIA 1V9WA 3IE3A 4A5PA 2A2PA 2TRXA 4AF2A 2HYXA 2H19A 2H1AA 2PWJA 2GQMA 1THXA 2L4QA 2AYTA 4JR6A 4OFTA 1ZZYA 1NHYA 3CTFA 5H5RA 4XCSA 1SL2B 1EP7A 4HQZA 4ZBBA 2HRFA 4LA1A 4KE3A 5DQYA 3UVHA 5IM9A 3D4TA 1TXXA 1WIKA 3KMNA 3L4NA 2E2MA 1K0MA 4EDZA 4MJEA 1OC8A 1T7PB 4ID0A 5DDLA 2AV4A 3LXTA 2DMLA 3D6IA 3NZNA 2ON5A 22GSA 1BX9A 4IBPA 3QD9A 3HCZA 1EEMA 2X99A 4XS6A 5KN1A 1U3AA 2CVBA 1T00A 1SJIA 1O7UA 2LQQA 1ZYQB 5D73A 2ES7A 2J9HA 5FHIA 4K2XA 1OE8A 9GSSA 4WF4A 3GH9A 2ZCTA 3HY2A 4HDEA 1BQ7A 1FB0A 2V1MA 2JADA 1VGLA 4G2EA 2JZRA 2WRTA 1F6MC 4TXOB 1WP0A 3IHQA 4EL1A 5G30A 4K7IA 2H75A 4O92A 4TR1A 3UEMA 3ZLPA 2VAFA 1ZYNA 1RW1A 3RAZA 1YJ6A 2C3QA 4IHUA 2YZUA 1GNWA 2H71A 2CAIA 2X8CA 3GUSA 1MDJA 2M80A 2PUKC 1GUKA 5CYYA 3IR4A 4TKYA 2MBSA 4Z7XA 3F3QA 3ZZXA 2H6ZA 3F3RA 3MIXA 2NPBA 2B1LA 1TW9A 1G6WA 4MPGA 3C8EA 3FRCA 2DJ0A 4BA7A 4MCUA 2YWIA 3TRXA 5JWQB 2CAQA 2HZEA 4MH2A 4V1Ap 3GHAA 4J2FA 2IMKA 1LJRA 3BD2A 5IMZA 4MMMA 1PQNA 4I2TA 1XW6A 1FOHA 4WR5A 3HJPA 5F0GA 4DSQA 1MEKA 3QR6A 5GSSA 4BVXA 4X0XA 4DSSA 5IMFA 4TR4A 1TK5B 1TJDA 5IO0A 1YDKA 4MJCA 12GSA 4NHZA 1O73A 3QDNA 5J9CA 3KEBA 4OO5A 2H6YA 1PN0A 5HFIA 5ENUA 5COHA 5AISA 1ZL9A 2CVDA 1PA3A 1ERTA 5DVBA 1C72A 3EWLA 2FD3A 3UBLA 2HLSA 5F06A 1U87A 1FB6A 2A4VA 3FK8A 3C73A 2X64A 1O8XA 1PMTA 3HZ4A 2CZ3A 4ML1A 1K3LA 1XXUA 5ID2A 3ZITA 5L71A 2B1KA 2ALBA 1GLPA 4BL7A 6GSYA 1FO5A 5GAPD 2RUEA 4V1Ag 4JRRA 2BMXA 2KUCA 4MNNA 3VPTA 3DYRA 1MD3A 3W6GA 4GTUA 2VM2A 4KDUA 3ZYWA 5FT3A 1TRWA 3PR8A 1W4VA 5AGYA 2XBIA 3GA4A 4POKA 1QXHA 2A2SA 2TIRA 3G7JA 1NHOA 3DD3A 2F51A 1V57A 1TRUA 3IC4A 2LJRA 2QGVA 4I2UA 2VCQA 1ST9A 1YZXA 4K2DA 4MF6A 1M3JA 4G19A 2LNSA 1T8EB 1EV9A 1KTEA 3IK7A 1VF4A 4TR1B 1JHBA 2CX4A 5B8AA 2GSRA 3MDKA 1O85A 4MZBA 3VWWA 4EIQA 4POMA 3IAM2 4EE0A 4AJ6A 4DSRA 2CZ2A 2EIQA 2WCIA 3IAS2 4H86A 1PGTA 3P7XA 2EIRA 1GUMA 1WWJA 4E8HA 3GSTA 3HVNA 1Z6NA 4JR4A 3ZRDA 4CW9A 1FVKA 5CP1A 1T1VA 2R6KA 2HZEB 3IOSA 19GSA 2JZSA 4TR3A 3TRQA 3I43A 2L6CA 4FH8A 2X49A 2ZNMA 1PRXA 3CSHA 4MZWA 1UA5A 3G7IA 11GSA 2AB6A 1J08A 4K5RA 2C0DA 1Z7PA 5DJMA 2YCDA 1TKDB 2O85A 4BVXB 3QAWA 3RBTA 1F3AA 2I9HA 4DSSB 2D2ZA 2K8VA 3F8UA 3CMIA 1SENA 5EY6A 2L6DA 4G9HA 4I5QA 2L59A 4KF9A 1GTAA 1SK2A 1XVWA 4MDCA 4K1FA 3F6DA 1VF2A 5CRWA 4G0LA 4V2NA 2V6KA 3W8SA 3ERFA 1XVQA 5ECQB 1EP8A 1PX7A 4FYCA 3H8QA 1A0RP 2MMZA 1YKAA 4TOPA 2C0EA 3FZAA 1CQHA 1QUWA 3M0FA 3V1WA 5ID2B 4GLTA 3DKSA 2PGTA 3ZVJD 1PL1A 1OC9A 4HU7A 2C0FA 4N0ZA 1R7HA 2A4HA 1XWCA 4BL7B 5IQYA 5JWRB 1F2EA 4YAPA 3FZ4A 3UARA 4N10A 3ME8A 2FY6A 1GSEA 2DBCA 4K0NA 1YY7A 3O6TA 2B5EA 3TB2A 4ZILA 3H79A 5E4WA 3GL3A 2YWMA 2DJJA 5IMDA 3GX0A 3HA9A 1BEDA 4OWYA 2VL2C 2GT6A 2F9SA 5G2ZA 1K0DA 3KZQA 2H73A 5JWOB 1F3BA 6GSXA 2WJUA 3CTGA 1EOHA 3TGZA 4KCEA 5J3RA 13GSA 3FZ5A 2ZUPA 3PGTA 3M9KA 1B8XA 3TKSA 1X9MB 2VUPA 4USSA 2YZHA 3LYKA 3C7MA 5ELAA 4ZB6A 3FEUA 3Q74A 2C4JA 2H0IA 4KB3A 3TJBA 4L5OA 1E2YA 1YKCA 2QA2A 3HYPA 4TVEA 5CRGA 1ON4A 1UVZA 4F0CA 4POLA 2P0GA 2WFCA 1R4WA 4BWQA 2I81A 1WPIA 1A2LA 2VLVA 3GH6A 1MDKA 3CRTA 1T4YA 2P31A 3NIVA 4YQMA 2PPTA 2I4AA 1G7EA 2DC5A 4F0BA 3APQA 2RM6A 2IMDA 4JU5A 1A0FA 4ISDA 1B48A 4TRXA 2L5LA 3H93A 4GQCA 1B9YC 3ZTLA 1TRVA 2V2GA 2PVQA 2IMEA 1YQ1A 4OMVA 3EE2A 5DBQA 2H30A 1TI1A 3U6VA 1H75A 2YWOA 2CX3A 6GSWA 1M2BA 1AUCA 4TW5A 1SKWB 2H76A 3UMAA 1BG5A 3DRNA 1ERVA 4Q5FA 4V2LA 2X4AA 1LBKA 2UZ8A 1GSSA 3KJYA 1PKZA 2E2GA 1AXDA 3D5JA 2X8GA 3OR5A 1TU7A 4RUVA 2N5FA 4NV2A 2FA4A 3S9FA 5IMVA 1OC9B 2KP2A 3KD0A 4IELA 1G6YA 2F3MA 2LQOA 3DWVA 2HSHA 4POBA 1X5DA 4ZBAA 2XHFA 5KN3A 4QQ7A 2IIYA 3KMOA 4LMWA 4EF0A 3KCMA 1ZYPA 5ECLB 2FWFA 3VPQA 4EUYA 3D4MA 2DJ3A 2CT6A 3TJKA 1XBSA 5IPHA 2OACA 2F8FA 3QFAC 3GMFA 2C8UA 3VK9A 3DIEA 3IV4A 2LEGA 3E9JB 4X43A 1XWAA 3KIJA 2RUFA 4FYBA 3SWLA 1XOAA 4FIWA 4MZCA 2FCHA 4EXJA 2H8LA 3F6FA 2VD1A 1MD4A 2VOCA 1QMVA 2OBKA 2LS5A 4IQ1A 3TOUA 1M9AA 2K6VA 2REMA 5C00A 4BVYA 1AIUA 5ECHB 3BOAA 2IMIA 2DKIA 3TKQA 2YV7A 2M46A 1X5EA 2DJ2A 2WS2A 3UBKA 1OKDA 1B4QA 3CQFA 5ECRB 1GULA 3LJRA 2PBJA 1Z3EA 1IYIA 3TJGA 3EU3A 2V6OA 2L4CA 2B7JA 5HFGA 1T3BA 1MTCA 1GRXA 3I69A 2HRNA 5IO2A 2K9FA 3LXZA 6GSVA 3KGKA 1THOA 3J7Yb 5J41A 3UVTA 2YWNA 3WYWA 2LUSA 1XCCA 3I6AA 3HXSA 1DE1A 2K8SA 3H1NA 4N30A 2GZYA 1AQXA 2IL3A 1FHEA 4GCIA 4HJ2A 2FHEA 3TJFA 2OADA 1WJKA 3HD5A 3FHKA 3WGDA 1TK0B 2HSMA 4CHSA 2C3NA 2LTKA 4CDOA 1M7TA 3VWVA 3DMLA 3IRAA 1S3CA 2RM5A 3CRUA 1SYRA 4G10A 2M72A 2HT9A 1XIYA 2YOIA 5G1KA 3CSJA 6GSTA 3L9UA 4KNDA 1USBA 3LORA 4HJMA 3APOA 2YPMA 2MMAA 4ECCA 2H72A 1KNGA 1V58A 1XWBA 4PGTA 4WETA 4OFMA 1A2MA 4HS1A 2VCWA 4YAVA 4LL4B 1YEPA 4OFNA 1GNEA 3A5IA 3Q19A 2XPDA 5D9WA 3EVIA 2RLIA 5KEJA 3E0UA 3JCML 2JZTA 2AJQB 3APSA 2BJXA 1YEXA 1ML6A 2DKHA 5EPFA 4PNGA 1Y6EA 4NXIA 2VCTA 3C71A 3RPNA 2CVKA 2OA7A 4RQRA 4ZB8A 4ECJA 2B6MA 2YV9A 1SKSB 5J5NA 2DJ1A 4KDYA 3BCIA 1K0AA 3VI5A 1M99A 5INYA 1HNBA 4OO4A 4HUAA 3ZREA 2R0GA 2FWEA 3C1RA 4BVYB 2O7KA 2H1DA 1LU4A 5ECOB 3GRXA 2NVLA 2AUVA 1O81A 4EVMA 1A8LA 1WOUA 3GFKA 3GIXA 3LFLA 4PURA 2MMOA 1NSWA 1TTZA 1E6BA 4KW6A 5IMCA 1GTIA 3IDVA 1Z5YE 1TRSA 5AIVA 4F03A 4TN8A 2MZCA 1G7OA 1Y25A 3GN3A 4K7NA 4ACSA 1CQGA 4IN0A 1ZCPA 2OKAA 3BCKA 1X0RA 3IK9A 4HI7A 5ECNB 4KDXA 1XWGA 1I5GA 4PXOA 5DAKA 4YKGA 2VCXA 1S3DA 3PINA 2HZFA 2MBTA 2B5XA 1SK1A 3KP9A 3FMWA 1N8JA 2OE3A 1SU9A 1RQMA 4NAXA 2K18A 4YQUA 3EMPA 4IKHA 2O87A 4N11A 2HE3A 2FWGA 2FLSA 1DSBA 3D0ZA 3EURA 1B9XC 4GSNA 2KLXA 3UAPA 4MH3A 3QFBC 2YJHA 1OC3A 3FR6A 1EGRA 5IPGA 4ECIA 4GF0A 1M2AA 3F63A 5C04A 3L0HA 5DCGA 3LQ7A 3MSZA 3GYKA 3LW9A 3O76A 3WT1A 2FNOA 2I1UA 2PMTA 3RPPA 14GSA 2OJLA 3DVXA 3A2VA 3ISOA 4Z2RA 4P3YB 5GSTA 2O89A 1TI3A 1JZRA 2L57A 1HNCA 3Q18A 4KX4A 5LD0A 1JLVA 4O7HA 1TK8B 1EGOA 3IPZA 4ILFA 5HR0A 2H1GA 3E3EA 3L78A 4MPFA 2IN3A 1A24A 8GSSA 4XTSA 5ECSA 1QFNA 5ECKB 16GSA 1V2AA 1S3RA 2PU9C 3ZFLA 2VCZA 4Q5NA 5CRHA 7GSSA 1I9DA 1VF3A 5KN2A 5DALA 3EPTA 4HOJA 1Q98A 3MNGA 1GSDA 2GT5A 5JCGA 3TKSC 1O6JA 3QMXA 2C3TA 1SKRB 1XW5A 1EV4A 4IQAA 1KBNA 4RI6A 4WR4A 1EOGA 2RIIA 2LRNA 2OE1A 2B3SA 4IJ3A 2E7PA 3HVSA 3IXRA 5AIXA 4I6XA 3L9SA 2ON7A 4PUFC 2KOKA 3DXBA 2VO4A 5GZZB 3CBUA 5B6NA 3TKRA 1JLWA 2VLTA 4GRFA 2QA1A 2HRKA 4MJBA 1FVJA 1T4ZA 1M2DA 4XRAA 2VL2A 3WGXA 1QGVA 3LYPA 2MMNA 2NBSA 2VL3A 4XS4A 1QQ2A 5H5SA 1GH2A 1K0NA 1UC7A 3U5RE 5DAKB 1TDIA 2I3YA 3UJ1A 4F9ZA 1XG8A 1JZOA 3LG6A 3VFIA 5B7CA 4DEJA 4XRDA 5F05A 2JSZA 3GKKA 3M9JA 1X9SB 4Q5RA 1O8WA 5ECIB 2R0PA 2WZ9A 3CYNA 1U88A 3FKFA 3PPUA 4JZQA 4OCEA 5HR3A 2R2JA 2YN1A 2XC2A 5HQPA 1EZKA 3MAKA 4JEDA 4NHWA 5ABRA 3US3A 4LMVA 4I97A 4WXTA 3TJJA 3VLNA 4WF5A 3N9JA 1FW1A 1K0OA 5JCWA 4FQUA 1GUHA 1XWKA 1GSYA 3F0IA 4E8EA 1JZWA 2H74A 2LRCA 3FR3A 2GSQA 4L5LA 5D9TA 4ICYA 6GSUA 2VD0A 3KTLA 4LL1B 3EYTA 3ZIJA 4MLYA 5A5KA 3D21A 5CNWA 1XPVA 2DMMA 1VRSD 4ZBDA 4RI7A 2Z9SA 4IGJA 2DIYA 3MYDA 4RQXA 5HR2A 3F4TA 4ZB9A 2GS3A 1XFLA 2C0GA 2JACA 1XOBA 3J7Yk 1R5PA 3DVWA 1FOVA 3IHGA 4PQHA 3C1SA 5DALB 3UIWA 1YF1A 1ACVA 2CV4A 2F8AA 4KAEA 4PQIA 1F9MA 4J57E 1VF1A 2QC7A 3ZVJA 3VI7A 2QKEA 4EIPA 3NOFA 3TOTA 2N5AA 3EMXA 1PKWA 2YANA 4ULXA 3LWAA 3HKRA 3W8JA 3ZMKA 2A2RA 4AJ8A 4I8BA 1TOFA 1XZOA 3KXOA 2H01A 1ZMAA 1PX6A 2LKUA 2YNXA 3WGEA 5CREA 3GKMA 1GTUA 1FG4A 2C1YA 1Z7RA 1GP1A 3PH9A 4HZ4A 4L8EA 1YF0A 3EU4A 3O3TA 4HU9A 4ZL8A 2HFDA 3GTUA 3RDWA 3RHBA 1TU8A 3TUEA 5AN1A 1F37A 2CA8A 4G0IA 4XS4B 1V40A 4MABA 1WRYA 3ERGA 2VLUA 4D73A 4Q5QA 2GSSA 1AAZA 2PERA 3KTBA 4KA0A 2H66A 5DQSA 4ZL7A 1BYEA 3R3EA 3R2QA 3ME7A 4O5QA 4HEA2 5B8BA 1SD9A 2R3XA 1PFOA 2EC4A 2GVPA 4L0UA 3WD6A 2LJAA 2H70A 1G0TA 3GURA 4KUNA 3G7YA 3KP8A 6GSSA 2LSTA 4BIKA 2QSIA 2FGXA 2R5GA 1GTBA 2MYGA 4ZL9A 5BMUA 1SK0A 3BJ5A 1ZGNA 2VCVA 2DJKA 4TR0A 1R5AA 2XPEA 5A4WA 3ZFBA 3ED3A 2GSTA 2FWHA 5G1LA 1X9WB 4KSOA 2IFQA 1HQOA 1NM3A 4L0WA 3P2AA 2HRAA 4PNFA 2YJ7A 5DJLA 2LJKA 2C80A 4MJAA 2J23A 1X5CA 2O8VB 4WEYA 3HZ8A 4QL9A 4EKZA 5CO3A 4QL7A 1K3OA 3UL3A 5IMAA 2FA8A 1V98A 5CRDA 3KM6A 4PQ1A 4AGSA 5A4VA 4N0VA 4K7OA 3RHCA 1SYXA 4MP4A 3EC3A 3IA1A 2H6XA 4K8MA 4ZIJA 1K0BA 1N2AA 1OYJA 3F9UA 10GSA 5B6MA 3Q6OA 1RK4A 2VIMA 4MK3A 4HQSA 1BJXA 4NMUA 3FY7A 5KOXA 1OVNA 3P8WA 3HVXA 1M3IA 2B5YA 1ZYEA 2LV3A 3QAVA 3KH7A 1J9BA 1M0UA 3FW2A 3GL5A 4K5SA 5FWGA 1OAZA 3N5OA 5F8BA 2AHEA 2BTOT 4BWSA 1U6TA 2WDUA 4CY8A 2H0GA 2IJYA 5J4UA 3DEXA 5IOXA 2KHPA 3QAGA 2GGTA 1MDIA 5ELGA 2PN8A 3M1GA 2R37A 4F2IA 4YKFA 1R26A 2GDRA 1URMA 1FAAA 3H4KA 5G5FA 4PX1A 4GSSA 3I9V2 5ECPB 3ERWA 4BPYA 2OE0A 2E0QA 3GTUB 4EO3A 5HFKA 2LRTA 1K0CA 4LLRA 2B7KA 2VL9A 3M3MA 3UOMA 2EIOA 2X8HA 5ECMB 2JSYA 5EVOA 4AJ7A 2G0FA 3HDCA 4D73B 3TKPA 4XS1A 3WT2A 3HVVA 1PSQA 2JU5A 3CXGA 3MWHA 4WBJA 2PVOC 2TRCP 4IW9A 4KCAA 5J9BA 2V32A 3GNJA 3QPMA 4IS0A 3A5WA 3TRPA 4Z2UA 1HNAA 4X4JA 2IWTA 1KEBA 4CY6A 2H0HA 2WULA 4JBBA 3GSSA 2OBIA 2GZZA 2GQLA 2GTUA 4YH2A 4IJIA 2HI7A 1OKTA 2G2QA 1GWCA 3HHVA 2P5QA 3P90A 1H4OA 2IFQB 2P5RA 18GSA 1WE0A 4KH7A 5DCHA 5A4UA 2VM1A 3QOUA 4GQFA 3SBCA 4IP6A 1K3YA 5CAXA 3L9VA 1OE7A 3FYGA 17GSA 1SJ6A 2AAWA 3VWXA 1B4PA 1ILOA 2N5BA 3GV1A 5KN0A 1GSFA 5LNKe 2DSAA 3QCPA 4G0KA 4NV5A 4MF7A 4Z2TA 5KOWA 3KH9A 3IBHA 5IOWA 1ERWA 3A2XA 1PD21 4GXZA 4O5RA 1JZDA 2V41A 1EWXA 1UN2A 4K0GA 1GLQA 5HR1A 20GSA 4HZ2A 2DIZA 1GL8A 4IP1A 4O5UA 1EEJA 1ERUA 1HD2A 1DUGA 5D9VA 3D22A 1JFUA 1SL1B 1A2JA 1SL0B 2R0CA 3A3TA 3AY8A 5D9XA 3F4RA 1A23A 1Z9HA 3BBYA 1WMJA 5D8IA
chains in the Genus database with same CATH topology
4EC0A 4TXVA 4X1UA 1DBYA 2L5OA 3F4SA 1J0FA 5D93A 2JL4A 3GKXA 5EL8A 5H5QA 3EINA 2R4VA 1AC1A 3LEFA 5G5EA 3VWUA 3HJMA 4K6XA 4OCFA 4ECBA 4NPBA 1QK8A 2IPAA 3M8NA 2HXKA 1AQVA 2WB9A 1HYUA 3K8NA 1ABAA 5G31A 4IVFA 3LGCA 4NWYA 2GQKA 5F07A 3DGQA 4PUAA 3A2WA 4FYUA 1S3AA 4TXOA 4V2MA 5JCUA 1TP9A 3TCOA 4GSTA 3FZ9A 1ZOFA 3ZL5A 1A8YA 3ZIVA 3G9BA 5LCZA 3TDGA 1Z6MA 2LNTA 5D96A 1M9BA 4OD7A 4O32A 3GX8A 4MF5A 4XHMA 4GWRA 4K9ZA 1AQWA 4EDYA 1BAYA 2GZPA 5BRTA 1PL2A 1Q4JA 1W89A 2YP6A 4WKWA 4J56E 4ML6A 4XIHA 2KP1A 3ZMLA 2IMFA 4F82A 2NDOA 1DE2A 3HJOA 2FUG2 3VURA 2WGRA 1GSUA 2DLXA 4PTSA 1GSQA 1AW9A 1SJZA 3LSZA 4MA9A 3GKNA 4ZXGA 3IC8A 4FO5A 2XBQA 5E59A 1PN9A 4YQVA 4WBRD 3TKSE 1IYHA 5GAND 1U3IA 3FR9A 1XW9A 2H1BA 1NW2A 5IIZA 2HNLA 2CQ9A 4DVCA 4KGIA 4JE1A 4KSMA 2GLRA 2NTOA 1SD8A 2HSYA 3CSIA 1V9WA 3IE3A 4A5PA 2A2PA 2TRXA 4AF2A 2HYXA 2H19A 2H1AA 2PWJA 2GQMA 1THXA 2L4QA 2AYTA 4JR6A 4OFTA 1ZZYA 1NHYA 3CTFA 5H5RA 4XCSA 1SL2B 1EP7A 4HQZA 4ZBBA 2HRFA 4LA1A 4KE3A 5DQYA 3UVHA 5IM9A 3D4TA 1TXXA 1WIKA 3KMNA 3L4NA 2E2MA 1K0MA 4EDZA 4MJEA 1OC8A 1T7PB 4ID0A 5DDLA 2AV4A 3LXTA 2DMLA 3D6IA 3NZNA 2ON5A 22GSA 1BX9A 4IBPA 3QD9A 3HCZA 1EEMA 2X99A 4XS6A 5KN1A 1U3AA 2CVBA 1T00A 1SJIA 1O7UA 2LQQA 1ZYQB 5D73A 2ES7A 2J9HA 5FHIA 4K2XA 1OE8A 9GSSA 4WF4A 3GH9A 2ZCTA 3HY2A 4HDEA 1BQ7A 1FB0A 2V1MA 2JADA 1VGLA 4G2EA 2JZRA 2WRTA 1F6MC 4TXOB 1WP0A 3IHQA 4EL1A 5G30A 4K7IA 2H75A 4O92A 4TR1A 3UEMA 3ZLPA 2VAFA 1ZYNA 1RW1A 3RAZA 1YJ6A 2C3QA 4IHUA 2YZUA 1GNWA 2H71A 2CAIA 2X8CA 3GUSA 1MDJA 2M80A 2PUKC 1GUKA 5CYYA 3IR4A 4TKYA 2MBSA 4Z7XA 3F3QA 3ZZXA 2H6ZA 3F3RA 3MIXA 2NPBA 2B1LA 1TW9A 1G6WA 4MPGA 3C8EA 3FRCA 2DJ0A 4BA7A 4MCUA 2YWIA 3TRXA 5JWQB 2CAQA 2HZEA 4MH2A 4V1Ap 3GHAA 4J2FA 2IMKA 1LJRA 3BD2A 5IMZA 4MMMA 1PQNA 4I2TA 1XW6A 1FOHA 4WR5A 3HJPA 5F0GA 4DSQA 1MEKA 3QR6A 5GSSA 4BVXA 4X0XA 4DSSA 5IMFA 4TR4A 1TK5B 1TJDA 5IO0A 1YDKA 4MJCA 12GSA 4NHZA 1O73A 3QDNA 5J9CA 3KEBA 4OO5A 2H6YA 1PN0A 5HFIA 5ENUA 5COHA 5AISA 1ZL9A 2CVDA 1PA3A 1ERTA 5DVBA 1C72A 3EWLA 2FD3A 3UBLA 2HLSA 5F06A 1U87A 1FB6A 2A4VA 3FK8A 3C73A 2X64A 1O8XA 1PMTA 3HZ4A 2CZ3A 4ML1A 1K3LA 1XXUA 5ID2A 3ZITA 5L71A 2B1KA 2ALBA 1GLPA 4BL7A 6GSYA 1FO5A 5GAPD 2RUEA 4V1Ag 4JRRA 2BMXA 2KUCA 4MNNA 3VPTA 3DYRA 1MD3A 3W6GA 4GTUA 2VM2A 4KDUA 3ZYWA 5FT3A 1TRWA 3PR8A 1W4VA 5AGYA 2XBIA 3GA4A 4POKA 1QXHA 2A2SA 2TIRA 3G7JA 1NHOA 3DD3A 2F51A 1V57A 1TRUA 3IC4A 2LJRA 2QGVA 4I2UA 2VCQA 1ST9A 1YZXA 4K2DA 4MF6A 4G19A 2LNSA 1T8EB 1EV9A 1KTEA 3IK7A 1VF4A 4TR1B 1JHBA 2CX4A 5B8AA 2GSRA 3MDKA 1O85A 4MZBA 3VWWA 4EIQA 4POMA 3IAM2 4EE0A 4AJ6A 4DSRA 2CZ2A 2EIQA 2WCIA 3IAS2 4H86A 1PGTA 3P7XA 2EIRA 1GUMA 1WWJA 4E8HA 3GSTA 1Z6NA 4JR4A 3ZRDA 4CW9A 1FVKA 5CP1A 1T1VA 2R6KA 2HZEB 3IOSA 19GSA 2JZSA 4TR3A 3TRQA 3I43A 2L6CA 4FH8A 2X49A 2ZNMA 1PRXA 3CSHA 4MZWA 1UA5A 3G7IA 11GSA 2AB6A 1J08A 4K5RA 2C0DA 1Z7PA 5DJMA 2YCDA 1TKDB 2O85A 4BVXB 3QAWA 3RBTA 1F3AA 2I9HA 4DSSB 2D2ZA 2K8VA 3F8UA 3CMIA 1SENA 5EY6A 2L6DA 4G9HA 4I5QA 2L59A 4KF9A 1GTAA 1SK2A 1XVWA 4MDCA 4K1FA 3F6DA 1VF2A 5CRWA 4G0LA 4V2NA 2V6KA 3W8SA 3ERFA 1XVQA 5ECQB 1EP8A 1PX7A 4FYCA 3H8QA 1A0RP 2MMZA 1YKAA 4TOPA 2C0EA 3FZAA 1CQHA 1QUWA 3M0FA 3V1WA 5ID2B 4GLTA 3DKSA 2PGTA 3ZVJD 1PL1A 1OC9A 4HU7A 2C0FA 4N0ZA 1R7HA 2A4HA 1XWCA 4BL7B 5IQYA 5JWRB 1F2EA 4YAPA 3FZ4A 3UARA 4N10A 3ME8A 2FY6A 1GSEA 2DBCA 4K0NA 1YY7A 3O6TA 2B5EA 3TB2A 4ZILA 3H79A 5E4WA 3GL3A 2YWMA 2DJJA 5IMDA 3GX0A 3HA9A 1BEDA 4OWYA 2VL2C 2GT6A 2F9SA 5G2ZA 1K0DA 3KZQA 2H73A 5JWOB 1F3BA 6GSXA 2WJUA 3CTGA 1EOHA 3TGZA 4KCEA 5J3RA 13GSA 3FZ5A 2ZUPA 3PGTA 3M9KA 1B8XA 3TKSA 1X9MB 2VUPA 4USSA 2YZHA 3LYKA 3C7MA 5ELAA 4ZB6A 3FEUA 3Q74A 2C4JA 2H0IA 4KB3A 3TJBA 4L5OA 1E2YA 1YKCA 2QA2A 3HYPA 4TVEA 5CRGA 1ON4A 1UVZA 4F0CA 4POLA 2P0GA 2WFCA 1R4WA 4BWQA 2I81A 1WPIA 1A2LA 2VLVA 3GH6A 1MDKA 3CRTA 1T4YA 2P31A 3NIVA 4YQMA 2PPTA 2I4AA 1G7EA 2DC5A 4F0BA 3APQA 2RM6A 2IMDA 4JU5A 1A0FA 4ISDA 1B48A 4TRXA 2L5LA 3H93A 4GQCA 1B9YC 3ZTLA 1TRVA 2V2GA 2PVQA 2IMEA 1YQ1A 4OMVA 3EE2A 5DBQA 2H30A 1TI1A 3U6VA 1H75A 2YWOA 2CX3A 6GSWA 1M2BA 1AUCA 4TW5A 1SKWB 2H76A 3UMAA 1BG5A 3DRNA 1ERVA 4Q5FA 4V2LA 2X4AA 1LBKA 2UZ8A 1GSSA 3KJYA 1PKZA 2E2GA 1AXDA 3D5JA 2X8GA 3OR5A 1TU7A 4RUVA 2N5FA 4NV2A 2FA4A 3S9FA 5IMVA 1OC9B 2KP2A 3KD0A 4IELA 1G6YA 2F3MA 2LQOA 3DWVA 2HSHA 4POBA 1X5DA 4ZBAA 2XHFA 5KN3A 4QQ7A 2IIYA 3KMOA 4LMWA 4EF0A 3KCMA 1ZYPA 5ECLB 2FWFA 3VPQA 4EUYA 3D4MA 2DJ3A 2CT6A 3TJKA 1XBSA 5IPHA 2OACA 2F8FA 3QFAC 3GMFA 2C8UA 3VK9A 3DIEA 3IV4A 2LEGA 3E9JB 4X43A 1XWAA 3KIJA 2RUFA 4FYBA 3SWLA 1XOAA 4FIWA 4MZCA 2FCHA 4EXJA 2H8LA 3F6FA 2VD1A 1MD4A 2VOCA 1QMVA 2OBKA 2LS5A 4IQ1A 3TOUA 1M9AA 2K6VA 2REMA 5C00A 4BVYA 1AIUA 5ECHB 3BOAA 2IMIA 2DKIA 3TKQA 2YV7A 2M46A 1X5EA 2DJ2A 2WS2A 3UBKA 1OKDA 1B4QA 5ECRB 1GULA 3LJRA 2PBJA 1Z3EA 1IYIA 3TJGA 3EU3A 2V6OA 2L4CA 2B7JA 5HFGA 1T3BA 1MTCA 1GRXA 3I69A 2HRNA 5IO2A 2K9FA 3LXZA 6GSVA 3KGKA 1THOA 3J7Yb 5J41A 3UVTA 2YWNA 3WYWA 2LUSA 1XCCA 3I6AA 3HXSA 1DE1A 2K8SA 3H1NA 4N30A 2GZYA 1AQXA 2IL3A 1FHEA 4GCIA 4HJ2A 2FHEA 3TJFA 2OADA 1WJKA 3HD5A 3FHKA 3WGDA 1TK0B 2HSMA 4CHSA 2C3NA 2LTKA 4CDOA 1M7TA 3VWVA 3DMLA 3IRAA 1S3CA 2RM5A 3CRUA 1SYRA 4G10A 2M72A 2HT9A 1XIYA 2YOIA 5G1KA 3CSJA 6GSTA 3L9UA 4KNDA 1USBA 3LORA 4HJMA 3APOA 2YPMA 2MMAA 4ECCA 2H72A 1KNGA 1V58A 1XWBA 4PGTA 4WETA 4OFMA 1A2MA 4HS1A 2VCWA 4YAVA 4LL4B 1YEPA 4OFNA 1GNEA 3A5IA 3Q19A 2XPDA 5D9WA 3EVIA 2RLIA 5KEJA 3E0UA 3JCML 2JZTA 2AJQB 3APSA 2BJXA 1YEXA 1ML6A 2DKHA 5EPFA 4PNGA 1Y6EA 4NXIA 2VCTA 3C71A 3RPNA 2CVKA 2OA7A 4RQRA 4ZB8A 4ECJA 2B6MA 2YV9A 1SKSB 5J5NA 2DJ1A 4KDYA 3BCIA 1K0AA 3VI5A 1M99A 5INYA 1HNBA 4OO4A 4HUAA 3ZREA 2R0GA 2FWEA 3C1RA 4BVYB 2O7KA 2H1DA 1LU4A 5ECOB 3GRXA 2NVLA 2AUVA 1O81A 4EVMA 1A8LA 1WOUA 3GFKA 3GIXA 3LFLA 4PURA 2MMOA 1NSWA 1TTZA 1E6BA 4KW6A 5IMCA 1GTIA 3IDVA 1Z5YE 1TRSA 5AIVA 4F03A 4TN8A 2MZCA 1G7OA 1Y25A 3GN3A 4K7NA 4ACSA 1CQGA 4IN0A 1ZCPA 2OKAA 3BCKA 1X0RA 3IK9A 4HI7A 5ECNB 4KDXA 1XWGA 1I5GA 4PXOA 5DAKA 4YKGA 2VCXA 1S3DA 3PINA 2HZFA 2MBTA 2B5XA 1SK1A 3KP9A 3FMWA 1N8JA 2OE3A 1SU9A 1RQMA 4NAXA 2K18A 4YQUA 3EMPA 4IKHA 2O87A 4N11A 2HE3A 2FWGA 2FLSA 1DSBA 3D0ZA 3EURA 1B9XC 4GSNA 2KLXA 3UAPA 4MH3A 3QFBC 2YJHA 1OC3A 3FR6A 1EGRA 5IPGA 4ECIA 4GF0A 1M2AA 3F63A 5C04A 3L0HA 5DCGA 3LQ7A 3MSZA 3GYKA 3LW9A 3O76A 3WT1A 2FNOA 2I1UA 2PMTA 3RPPA 14GSA 2OJLA 3DVXA 3A2VA 3ISOA 4Z2RA 4P3YB 5GSTA 2O89A 1TI3A 1JZRA 2L57A 1HNCA 3Q18A 4KX4A 5LD0A 1JLVA 4O7HA 1TK8B 1EGOA 3IPZA 4ILFA 5HR0A 2H1GA 3E3EA 3L78A 4MPFA 2IN3A 1A24A 8GSSA 4XTSA 5ECSA 1QFNA 5ECKB 16GSA 1V2AA 2PU9C 3ZFLA 2VCZA 4Q5NA 5CRHA 7GSSA 1I9DA 1VF3A 5KN2A 5DALA 3EPTA 4HOJA 1Q98A 3MNGA 1GSDA 2GT5A 5JCGA 3TKSC 1O6JA 3QMXA 2C3TA 1SKRB 1XW5A 1EV4A 4IQAA 1KBNA 4RI6A 4WR4A 1EOGA 2RIIA 2LRNA 2OE1A 2B3SA 4IJ3A 2E7PA 3HVSA 3IXRA 5AIXA 4I6XA 3L9SA 2ON7A 4PUFC 2KOKA 3DXBA 2VO4A 5GZZB 3CBUA 5B6NA 3TKRA 1JLWA 2VLTA 4GRFA 2QA1A 2HRKA 4MJBA 1FVJA 1T4ZA 1M2DA 4XRAA 2VL2A 3WGXA 1QGVA 3LYPA 2MMNA 2NBSA 2VL3A 4XS4A 1QQ2A 5H5SA 1GH2A 1K0NA 1UC7A 3U5RE 5DAKB 1TDIA 2I3YA 3UJ1A 4F9ZA 1JZOA 3LG6A 3VFIA 5B7CA 4DEJA 4XRDA 5F05A 2JSZA 3GKKA 3M9JA 1X9SB 4Q5RA 1O8WA 5ECIB 2R0PA 2WZ9A 3CYNA 1U88A 3FKFA 3PPUA 4JZQA 4OCEA 5HR3A 2R2JA 2YN1A 2XC2A 5HQPA 1EZKA 3MAKA 4JEDA 4NHWA 5ABRA 3US3A 4LMVA 4I97A 4WXTA 3TJJA 3VLNA 4WF5A 3N9JA 1FW1A 1K0OA 5JCWA 4FQUA 1GUHA 1XWKA 1GSYA 3F0IA 4E8EA 1JZWA 2H74A 2LRCA 3FR3A 2GSQA 4L5LA 5D9TA 4ICYA 6GSUA 2VD0A 3KTLA 4LL1B 3EYTA 3ZIJA 4MLYA 5A5KA 3D21A 5CNWA 1XPVA 2DMMA 1VRSD 4ZBDA 4RI7A 2Z9SA 4IGJA 2DIYA 3MYDA 4RQXA 5HR2A 3F4TA 4ZB9A 2GS3A 1XFLA 2C0GA 2JACA 1XOBA 3J7Yk 1R5PA 3DVWA 1FOVA 3IHGA 4PQHA 3C1SA 5DALB 3UIWA 1YF1A 1ACVA 2CV4A 2F8AA 4KAEA 4PQIA 1F9MA 4J57E 1VF1A 2QC7A 3ZVJA 3VI7A 2QKEA 4EIPA 3NOFA 3TOTA 2N5AA 3EMXA 1PKWA 2YANA 4ULXA 3LWAA 3HKRA 3W8JA 3ZMKA 2A2RA 4AJ8A 4I8BA 1TOFA 1XZOA 3KXOA 2H01A 1ZMAA 1PX6A 2LKUA 2YNXA 3WGEA 5CREA 3GKMA 1GTUA 1FG4A 2C1YA 1Z7RA 1GP1A 3PH9A 4HZ4A 4L8EA 1YF0A 3EU4A 3O3TA 4HU9A 4ZL8A 2HFDA 3GTUA 3RDWA 3RHBA 1TU8A 3TUEA 5AN1A 1F37A 2CA8A 4G0IA 4XS4B 1V40A 4MABA 1WRYA 3ERGA 2VLUA 4D73A 4Q5QA 2GSSA 1AAZA 2PERA 3KTBA 4KA0A 2H66A 5DQSA 4ZL7A 1BYEA 3R3EA 3R2QA 3ME7A 4O5QA 4HEA2 5B8BA 1SD9A 2R3XA 2EC4A 2GVPA 4L0UA 3WD6A 2LJAA 2H70A 1G0TA 3GURA 4KUNA 3G7YA 3KP8A 6GSSA 2LSTA 2QSIA 2FGXA 2R5GA 1GTBA 2MYGA 4ZL9A 5BMUA 1SK0A 3BJ5A 1ZGNA 2VCVA 2DJKA 4TR0A 1R5AA 2XPEA 5A4WA 3ZFBA 3ED3A 2GSTA 2FWHA 5G1LA 1X9WB 4KSOA 2IFQA 1HQOA 1NM3A 4L0WA 3P2AA 2HRAA 4PNFA 2YJ7A 5DJLA 2LJKA 2C80A 4MJAA 2J23A 1X5CA 2O8VB 4WEYA 3HZ8A 4QL9A 4EKZA 5CO3A 4QL7A 1K3OA 3UL3A 5IMAA 2FA8A 1V98A 5CRDA 3KM6A 4PQ1A 4AGSA 5A4VA 4N0VA 4K7OA 3RHCA 1SYXA 4MP4A 3EC3A 3IA1A 2H6XA 4K8MA 4ZIJA 1K0BA 1N2AA 1OYJA 3F9UA 10GSA 5B6MA 3Q6OA 1RK4A 2VIMA 4MK3A 4HQSA 1BJXA 4NMUA 3FY7A 5KOXA 1OVNA 3P8WA 3HVXA 2B5YA 1ZYEA 2LV3A 3QAVA 3KH7A 1J9BA 1M0UA 3FW2A 3GL5A 4K5SA 5FWGA 1OAZA 3N5OA 5F8BA 2AHEA 2BTOT 4BWSA 1U6TA 2WDUA 4CY8A 2H0GA 2IJYA 5J4UA 3DEXA 5IOXA 2KHPA 3QAGA 2GGTA 1MDIA 5ELGA 2PN8A 3M1GA 2R37A 4F2IA 4YKFA 1R26A 2GDRA 1URMA 1FAAA 3H4KA 5G5FA 4PX1A 4GSSA 3I9V2 5ECPB 3ERWA 4BPYA 2OE0A 2E0QA 3GTUB 4EO3A 5HFKA 2LRTA 1K0CA 4LLRA 2B7KA 2VL9A 3M3MA 3UOMA 2EIOA 2X8HA 5ECMB 2JSYA 5EVOA 4AJ7A 2G0FA 3HDCA 4D73B 3TKPA 4XS1A 3WT2A 3HVVA 1PSQA 2JU5A 3CXGA 3MWHA 4WBJA 2PVOC 2TRCP 4IW9A 4KCAA 5J9BA 2V32A 3GNJA 3QPMA 4IS0A 3A5WA 3TRPA 4Z2UA 1HNAA 4X4JA 2IWTA 1KEBA 4CY6A 2H0HA 2WULA 4JBBA 3GSSA 2OBIA 2GZZA 2GQLA 2GTUA 4YH2A 4IJIA 2HI7A 1OKTA 2G2QA 1GWCA 3HHVA 2P5QA 3P90A 1H4OA 2IFQB 2P5RA 18GSA 1WE0A 4KH7A 5DCHA 5A4UA 2VM1A 3QOUA 4GQFA 3SBCA 4IP6A 1K3YA 5CAXA 3L9VA 1OE7A 3FYGA 17GSA 1SJ6A 2AAWA 3VWXA 1B4PA 1ILOA 2N5BA 3GV1A 5KN0A 1GSFA 5LNKe 2DSAA 3QCPA 4G0KA 4NV5A 4MF7A 4Z2TA 5KOWA 3KH9A 3IBHA 5IOWA 1ERWA 3A2XA 1PD21 4GXZA 4O5RA 1JZDA 2V41A 1EWXA 1UN2A 4K0GA 1GLQA 5HR1A 20GSA 4HZ2A 2DIZA 1GL8A 4IP1A 4O5UA 1EEJA 1ERUA 1HD2A 1DUGA 5D9VA 3D22A 1JFUA 1SL1B 1A2JA 1SL0B 2R0CA 3A3TA 3AY8A 5D9XA 3F4RA 1A23A 1Z9HA 3BBYA 1WMJA 5D8IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EC0 A;  4TXV A;  4X1U A;  1DBY A;  2L5O A;  3F4S A;  1J0F A;  5D93 A;  2JL4 A;  3GKX A;  5EL8 A;  5H5Q A;  3EIN A;  2R4V A;  1AC1 A;  3LEF A;  5G5E A;  3VWU A;  3HJM A;  4K6X A;  4OCF A;  4ECB A;  4NPB A;  1QK8 A;  2IPA A;  3M8N A;  2HXK A;  1AQV A;  2WB9 A;  1HYU A;  3K8N A;  1ABA A;  5G31 A;  4IVF A;  3LGC A;  4NWY A;  2GQK A;  5F07 A;  3DGQ A;  4PUA A;  3A2W A;  4FYU A;  1S3A A;  4TXO A;  4V2M A;  5JCU A;  1TP9 A;  3TCO A;  4GST A;  3FZ9 A;  1ZOF A;  3ZL5 A;  1A8Y A;  3ZIV A;  3G9B A;  5LCZ A;  3TDG A;  1Z6M A;  2LNT A;  5D96 A;  1M9B A;  4OD7 A;  4O32 A;  3GX8 A;  4MF5 A;  4XHM A;  4GWR A;  4K9Z A;  1AQW A;  4EDY A;  1BAY A;  2GZP A;  1PL2 A;  1Q4J A;  1W89 A;  2YP6 A;  4WKW A;  4J56 E;  4ML6 A;  4XIH A;  2KP1 A;  3ZML A;  2IMF A;  4F82 A;  2NDO A;  1DE2 A;  3HJO A;  2FUG 2;  3VUR A;  2WGR A;  1GSU A;  2DLX A;  1GSQ A;  1AW9 A;  1SJZ A;  3LSZ A;  4MA9 A;  3GKN A;  4ZXG A;  4FO5 A;  2XBQ A;  5E59 A;  1PN9 A;  4YQV A;  4WBR D;  3TKS E;  1IYH A;  5GAN D;  1U3I A;  3FR9 A;  1XW9 A;  2H1B A;  1NW2 A;  5IIZ A;  2HNL A;  2CQ9 A;  4DVC A;  4KGI A;  4JE1 A;  4KSM A;  2GLR A;  2NTO A;  1SD8 A;  2HSY A;  3CSI A;  1V9W A;  3IE3 A;  2TRX A;  4AF2 A;  2HYX A;  2H19 A;  2H1A A;  2PWJ A;  2GQM A;  1THX A;  2L4Q A;  2AYT A;  4JR6 A;  4OFT A;  1ZZY A;  1NHY A;  3CTF A;  5H5R A;  4XCS A;  1SL2 B;  1EP7 A;  4HQZ A;  4ZBB A;  2HRF A;  4LA1 A;  4KE3 A;  5DQY A;  3UVH A;  5IM9 A;  3D4T A;  1TXX A;  1WIK A;  3KMN A;  3L4N A;  2E2M A;  1K0M A;  4EDZ A;  4MJE A;  1OC8 A;  1T7P B;  4ID0 A;  5DDL A;  2AV4 A;  3LXT A;  2DML A;  3D6I A;  3NZN A;  2ON5 A;  22GS A;  1BX9 A;  4IBP A;  3QD9 A;  3HCZ A;  1EEM A;  2X99 A;  4XS6 A;  5KN1 A;  1U3A A;  2CVB A;  1T00 A;  1SJI A;  1O7U A;  2LQQ A;  1ZYQ B;  5D73 A;  2ES7 A;  2J9H A;  5FHI A;  1OE8 A;  9GSS A;  4WF4 A;  3GH9 A;  2ZCT A;  3HY2 A;  4HDE A;  1BQ7 A;  1FB0 A;  2V1M A;  2JAD A;  1VGL A;  4G2E A;  2JZR A;  2WRT A;  1F6M C;  4TXO B;  1WP0 A;  3IHQ A;  4EL1 A;  5G30 A;  4K7I A;  2H75 A;  4O92 A;  4TR1 A;  3UEM A;  3ZLP A;  2VAF A;  1RW1 A;  3RAZ A;  1YJ6 A;  2C3Q A;  4IHU A;  2YZU A;  1GNW A;  2H71 A;  2CAI A;  2X8C A;  3GUS A;  1MDJ A;  2M80 A;  2PUK C;  1GUK A;  5CYY A;  3IR4 A;  4TKY A;  2MBS A;  4Z7X A;  3F3Q A;  3ZZX A;  2H6Z A;  3F3R A;  2NPB A;  2B1L A;  1TW9 A;  1G6W A;  4MPG A;  3C8E A;  3FRC A;  2DJ0 A;  4BA7 A;  4MCU A;  2YWI A;  3TRX A;  5JWQ B;  2CAQ A;  2HZE A;  4MH2 A;  4V1A p;  3GHA A;  4J2F A;  2IMK A;  1LJR A;  3BD2 A;  5IMZ A;  4MMM A;  1PQN A;  4I2T A;  1XW6 A;  5F0G A;  4WR5 A;  3HJP A;  4DSQ A;  1MEK A;  3QR6 A;  5GSS A;  4BVX A;  4X0X A;  4DSS A;  5IMF A;  4TR4 A;  1TK5 B;  1TJD A;  5IO0 A;  1YDK A;  4MJC A;  12GS A;  4NHZ A;  1O73 A;  3QDN A;  5J9C A;  3KEB A;  4OO5 A;  2H6Y A;  5HFI A;  5ENU A;  5COH A;  5AIS A;  1ZL9 A;  2CVD A;  1PA3 A;  1ERT A;  5DVB A;  1C72 A;  3EWL A;  2FD3 A;  3UBL A;  2HLS A;  5F06 A;  1U87 A;  1FB6 A;  2A4V A;  3FK8 A;  3C73 A;  2X64 A;  1O8X A;  1PMT A;  3HZ4 A;  2CZ3 A;  4ML1 A;  1K3L A;  1XXU A;  5ID2 A;  3ZIT A;  5L71 A;  2B1K A;  2ALB A;  1GLP A;  4BL7 A;  6GSY A;  1FO5 A;  5GAP D;  2RUE A;  4V1A g;  4JRR A;  2BMX A;  2KUC A;  3VPT A;  3DYR A;  1MD3 A;  3W6G A;  4GTU A;  2VM2 A;  4KDU A;  3ZYW A;  5FT3 A;  1TRW A;  3PR8 A;  1W4V A;  5AGY A;  2XBI A;  3GA4 A;  4POK A;  1QXH A;  2A2S A;  2TIR A;  3G7J A;  1NHO A;  3DD3 A;  2F51 A;  1V57 A;  1TRU A;  3IC4 A;  2LJR A;  2QGV A;  4I2U A;  2VCQ A;  1ST9 A;  1YZX A;  4K2D A;  4MF6 A;  4G19 A;  2LNS A;  1T8E B;  1EV9 A;  1KTE A;  3IK7 A;  1VF4 A;  4TR1 B;  1JHB A;  2CX4 A;  5B8A A;  2GSR A;  3MDK A;  1O85 A;  4MZB A;  3VWW A;  4POM A;  3IAM 2;  4EE0 A;  4AJ6 A;  4DSR A;  2CZ2 A;  2EIQ A;  2WCI A;  3IAS 2;  4H86 A;  1PGT A;  3P7X A;  2EIR A;  1GUM A;  1WWJ A;  4E8H A;  3GST A;  1Z6N A;  4JR4 A;  3ZRD A;  4CW9 A;  1FVK A;  5CP1 A;  1T1V A;  2R6K A;  2HZE B;  3IOS A;  19GS A;  2JZS A;  4TR3 A;  3TRQ A;  3I43 A;  2L6C A;  4FH8 A;  2ZNM A;  1PRX A;  3CSH A;  4MZW A;  1UA5 A;  3G7I A;  11GS A;  2AB6 A;  1J08 A;  2C0D A;  1Z7P A;  5DJM A;  2YCD A;  1TKD B;  2O85 A;  3QAW A;  3RBT A;  1F3A A;  2I9H A;  4DSS B;  2D2Z A;  2K8V A;  3F8U A;  3CMI A;  1SEN A;  5EY6 A;  2L6D A;  4G9H A;  4I5Q A;  2L59 A;  1GTA A;  1SK2 A;  1XVW A;  4MDC A;  4K1F A;  3F6D A;  1VF2 A;  5CRW A;  4V2N A;  2V6K A;  3W8S A;  3ERF A;  1XVQ A;  5ECQ B;  1EP8 A;  1PX7 A;  4FYC A;  3H8Q A;  1A0R P;  2MMZ A;  1YKA A;  4TOP A;  2C0E A;  3FZA A;  1CQH A;  1QUW A;  3M0F A;  3V1W A;  5ID2 B;  4GLT A;  3DKS A;  2PGT A;  3ZVJ D;  1PL1 A;  1OC9 A;  4HU7 A;  2C0F A;  4N0Z A;  1R7H A;  1XWC A;  5IQY A;  5JWR B;  1F2E A;  4YAP A;  3FZ4 A;  3UAR A;  4N10 A;  3ME8 A;  2FY6 A;  1GSE A;  2DBC A;  4K0N A;  1YY7 A;  3O6T A;  2B5E A;  3TB2 A;  4ZIL A;  3H79 A;  5E4W A;  3GL3 A;  2YWM A;  2DJJ A;  5IMD A;  3GX0 A;  3HA9 A;  1BED A;  4OWY A;  2VL2 C;  2GT6 A;  2F9S A;  5G2Z A;  1K0D A;  3KZQ A;  2H73 A;  5JWO B;  1F3B A;  6GSX A;  2WJU A;  3CTG A;  1EOH A;  3TGZ A;  4KCE A;  5J3R A;  13GS A;  3FZ5 A;  2ZUP A;  3PGT A;  3M9K A;  1B8X A;  3TKS A;  1X9M B;  2VUP A;  2YZH A;  3LYK A;  3C7M A;  5ELA A;  4ZB6 A;  3FEU A;  3Q74 A;  2C4J A;  2H0I A;  4KB3 A;  3TJB A;  4L5O A;  1E2Y A;  1YKC A;  3HYP A;  4TVE A;  5CRG A;  1ON4 A;  1UVZ A;  4F0C A;  4POL A;  2P0G A;  2WFC A;  1R4W A;  4BWQ A;  2I81 A;  1WPI A;  1A2L A;  2VLV A;  3GH6 A;  1MDK A;  3CRT A;  1T4Y A;  2P31 A;  3NIV A;  4YQM A;  2PPT A;  2I4A A;  1G7E A;  2DC5 A;  4F0B A;  3APQ A;  2RM6 A;  2IMD A;  4JU5 A;  1A0F A;  4ISD A;  1B48 A;  4TRX A;  2L5L A;  3H93 A;  4GQC A;  1B9Y C;  3ZTL A;  1TRV A;  2V2G A;  2PVQ A;  2IME A;  1YQ1 A;  4OMV A;  3EE2 A;  5DBQ A;  2H30 A;  1TI1 A;  3U6V A;  1H75 A;  2YWO A;  2CX3 A;  6GSW A;  1M2B A;  1AUC A;  4TW5 A;  1SKW B;  2H76 A;  3UMA A;  1BG5 A;  3DRN A;  1ERV A;  4Q5F A;  4V2L A;  1LBK A;  1GSS A;  3KJY A;  1PKZ A;  2E2G A;  1AXD A;  3D5J A;  2X8G A;  3OR5 A;  1TU7 A;  4RUV A;  2N5F A;  4NV2 A;  2FA4 A;  3S9F A;  5IMV A;  1OC9 B;  2KP2 A;  3KD0 A;  4IEL A;  1G6Y A;  2F3M A;  2LQO A;  3DWV A;  2HSH A;  4POB A;  1X5D A;  4ZBA A;  2XHF A;  5KN3 A;  4QQ7 A;  2IIY A;  3KMO A;  4LMW A;  4EF0 A;  3KCM A;  5ECL B;  2FWF A;  3VPQ A;  4EUY A;  3D4M A;  2DJ3 A;  2CT6 A;  3TJK A;  1XBS A;  5IPH A;  2OAC A;  2F8F A;  3QFA C;  3GMF A;  2C8U A;  3VK9 A;  3DIE A;  3IV4 A;  2LEG A;  3E9J B;  4X43 A;  1XWA A;  3KIJ A;  2RUF A;  4FYB A;  3SWL A;  1XOA A;  4FIW A;  4MZC A;  2FCH A;  4EXJ A;  2H8L A;  3F6F A;  2VD1 A;  1MD4 A;  2VOC A;  1QMV A;  2OBK A;  2LS5 A;  4IQ1 A;  3TOU A;  1M9A A;  2K6V A;  2REM A;  5C00 A;  4BVY A;  1AIU A;  5ECH B;  3BOA A;  2IMI A;  3TKQ A;  2YV7 A;  2M46 A;  1X5E A;  2DJ2 A;  2WS2 A;  3UBK A;  1OKD A;  1B4Q A;  5ECR B;  1GUL A;  3LJR A;  2PBJ A;  1Z3E A;  1IYI A;  3TJG A;  3EU3 A;  2V6O A;  2L4C A;  2B7J A;  5HFG A;  1T3B A;  1MTC A;  1GRX A;  3I69 A;  2HRN A;  5IO2 A;  2K9F A;  3LXZ A;  6GSV A;  3KGK A;  1THO A;  3J7Y b;  5J41 A;  3UVT A;  2YWN A;  3WYW A;  2LUS A;  1XCC A;  3I6A A;  3HXS A;  1DE1 A;  2K8S A;  3H1N A;  4N30 A;  2GZY A;  1AQX A;  2IL3 A;  1FHE A;  4GCI A;  4HJ2 A;  2FHE A;  3TJF A;  2OAD A;  1WJK A;  3HD5 A;  3FHK A;  3WGD A;  1TK0 B;  4CHS A;  2C3N A;  2LTK A;  4CDO A;  1M7T A;  3VWV A;  3DML A;  3IRA A;  1S3C A;  2RM5 A;  3CRU A;  1SYR A;  4G10 A;  2M72 A;  2HT9 A;  1XIY A;  2YOI A;  5G1K A;  3CSJ A;  6GST A;  3L9U A;  4KND A;  1USB A;  3LOR A;  4HJM A;  3APO A;  2YPM A;  2MMA A;  4ECC A;  2H72 A;  1KNG A;  1V58 A;  1XWB A;  4PGT A;  4WET A;  4OFM A;  1A2M A;  4HS1 A;  2VCW A;  4YAV A;  4LL4 B;  1YEP A;  4OFN A;  1GNE A;  3Q19 A;  2XPD A;  5D9W A;  3EVI A;  2RLI A;  5KEJ A;  3E0U A;  3JCM L;  2JZT A;  2AJQ B;  3APS A;  2BJX A;  1YEX A;  1ML6 A;  5EPF A;  4PNG A;  1Y6E A;  4NXI A;  2VCT A;  3C71 A;  3RPN A;  2CVK A;  2OA7 A;  4RQR A;  4ZB8 A;  4ECJ A;  2B6M A;  2YV9 A;  1SKS B;  5J5N A;  2DJ1 A;  4KDY A;  3BCI A;  1K0A A;  3VI5 A;  1M99 A;  5INY A;  1HNB A;  4OO4 A;  4HUA A;  3ZRE A;  2FWE A;  3C1R A;  2O7K A;  2H1D A;  1LU4 A;  5ECO B;  3GRX A;  2NVL A;  2AUV A;  1O81 A;  4EVM A;  1A8L A;  1WOU A;  3GFK A;  3GIX A;  3LFL A;  4PUR A;  2MMO A;  1NSW A;  1TTZ A;  1E6B A;  4KW6 A;  5IMC A;  1GTI A;  3IDV A;  1Z5Y E;  1TRS A;  5AIV A;  4F03 A;  4TN8 A;  2MZC A;  1G7O A;  1Y25 A;  3GN3 A;  4K7N A;  4ACS A;  1CQG A;  4IN0 A;  1ZCP A;  2OKA A;  3BCK A;  1X0R A;  3IK9 A;  4HI7 A;  5ECN B;  4KDX A;  1XWG A;  1I5G A;  4PXO A;  5DAK A;  2VCX A;  1S3D A;  3PIN A;  2HZF A;  2MBT A;  2B5X A;  1SK1 A;  3KP9 A;  1N8J A;  2OE3 A;  1SU9 A;  1RQM A;  4NAX A;  2K18 A;  4YQU A;  3EMP A;  4IKH A;  2O87 A;  4N11 A;  2HE3 A;  2FWG A;  2FLS A;  1DSB A;  3D0Z A;  3EUR A;  1B9X C;  4GSN A;  2KLX A;  3UAP A;  4MH3 A;  3QFB C;  2YJH A;  1OC3 A;  3FR6 A;  1EGR A;  5IPG A;  4ECI A;  4GF0 A;  1M2A A;  3F63 A;  5C04 A;  3L0H A;  5DCG A;  3LQ7 A;  3MSZ A;  3GYK A;  3O76 A;  3WT1 A;  2FNO A;  2I1U A;  2PMT A;  3RPP A;  14GS A;  2OJL A;  3DVX A;  3A2V A;  3ISO A;  4P3Y B;  5GST A;  2O89 A;  1TI3 A;  1JZR A;  2L57 A;  1HNC A;  3Q18 A;  4KX4 A;  5LD0 A;  1JLV A;  4O7H A;  1TK8 B;  1EGO A;  3IPZ A;  4ILF A;  5HR0 A;  2H1G A;  3E3E A;  3L78 A;  4MPF A;  2IN3 A;  1A24 A;  8GSS A;  4XTS A;  5ECS A;  1QFN A;  5ECK B;  16GS A;  1V2A A;  2PU9 C;  3ZFL A;  2VCZ A;  4Q5N A;  5CRH A;  7GSS A;  1I9D A;  1VF3 A;  5KN2 A;  5DAL A;  4HOJ A;  1Q98 A;  3MNG A;  1GSD A;  2GT5 A;  5JCG A;  3TKS C;  1O6J A;  3QMX A;  2C3T A;  1SKR B;  1XW5 A;  1EV4 A;  4IQA A;  1KBN A;  4RI6 A;  4WR4 A;  1EOG A;  2RII A;  2LRN A;  2OE1 A;  2B3S A;  4IJ3 A;  2E7P A;  3HVS A;  3IXR A;  5AIX A;  4I6X A;  3L9S A;  2ON7 A;  4PUF C;  2KOK A;  3DXB A;  2VO4 A;  5GZZ B;  3CBU A;  5B6N A;  3TKR A;  1JLW A;  2VLT A;  4GRF A;  4MJB A;  1FVJ A;  1T4Z A;  1M2D A;  4XRA A;  2VL2 A;  3WGX A;  1QGV A;  3LYP A;  2MMN A;  2NBS A;  2VL3 A;  4XS4 A;  1QQ2 A;  5H5S A;  1GH2 A;  1K0N A;  1UC7 A;  3U5R E;  5DAK B;  1TDI A;  2I3Y A;  3UJ1 A;  4F9Z A;  1JZO A;  3LG6 A;  3VFI A;  5B7C A;  4DEJ A;  4XRD A;  5F05 A;  2JSZ A;  3GKK A;  3M9J A;  1X9S B;  4Q5R A;  1O8W A;  5ECI B;  2WZ9 A;  3CYN A;  1U88 A;  3FKF A;  4JZQ A;  4OCE A;  5HR3 A;  2R2J A;  2YN1 A;  2XC2 A;  5HQP A;  1EZK A;  3MAK A;  4JED A;  4NHW A;  5ABR A;  3US3 A;  4LMV A;  4I97 A;  4WXT A;  3TJJ A;  3VLN A;  4WF5 A;  3N9J A;  1FW1 A;  1K0O A;  5JCW A;  1GUH A;  1GSY A;  1XWK A;  3F0I A;  4E8E A;  1JZW A;  2H74 A;  2LRC A;  3FR3 A;  2GSQ A;  4L5L A;  5D9T A;  6GSU A;  2VD0 A;  3KTL A;  4LL1 B;  3EYT A;  3ZIJ A;  4MLY A;  5A5K A;  3D21 A;  5CNW A;  1XPV A;  2DMM A;  1VRS D;  4ZBD A;  4RI7 A;  2Z9S A;  4IGJ A;  2DIY A;  4RQX A;  5HR2 A;  3F4T A;  4ZB9 A;  2GS3 A;  1XFL A;  2C0G A;  2JAC A;  1XOB A;  3J7Y k;  1R5P A;  3DVW A;  1FOV A;  4PQH A;  3C1S A;  5DAL B;  3UIW A;  1YF1 A;  1ACV A;  2CV4 A;  2F8A A;  4KAE A;  4PQI A;  1F9M A;  4J57 E;  1VF1 A;  2QC7 A;  3ZVJ A;  3VI7 A;  2QKE A;  3NOF A;  3TOT A;  2N5A A;  3EMX A;  1PKW A;  2YAN A;  4ULX A;  3LWA A;  3HKR A;  3W8J A;  3ZMK A;  2A2R A;  4AJ8 A;  4I8B A;  1TOF A;  1XZO A;  3KXO A;  2H01 A;  1ZMA A;  1PX6 A;  2LKU A;  2YNX A;  3WGE A;  5CRE A;  3GKM A;  1GTU A;  1FG4 A;  2C1Y A;  1Z7R A;  1GP1 A;  3PH9 A;  4HZ4 A;  4L8E A;  1YF0 A;  3EU4 A;  3O3T A;  4HU9 A;  4ZL8 A;  2HFD A;  3GTU A;  3RDW A;  3RHB A;  1TU8 A;  3TUE A;  5AN1 A;  1F37 A;  2CA8 A;  4XS4 B;  1V40 A;  4MAB A;  1WRY A;  3ERG A;  2VLU A;  4D73 A;  4Q5Q A;  2GSS A;  1AAZ A;  2PER A;  3KTB A;  4KA0 A;  2H66 A;  5DQS A;  4ZL7 A;  1BYE A;  3R2Q A;  3ME7 A;  4HEA 2;  5B8B A;  1SD9 A;  2R3X A;  2EC4 A;  2GVP A;  4L0U A;  3WD6 A;  2LJA A;  2H70 A;  1G0T A;  3GUR A;  4KUN A;  3G7Y A;  3KP8 A;  6GSS A;  2LST A;  2QSI A;  2FGX A;  2R5G A;  1GTB A;  2MYG A;  4ZL9 A;  1SK0 A;  3BJ5 A;  1ZGN A;  2VCV A;  2DJK A;  4TR0 A;  1R5A A;  2XPE A;  5A4W A;  3ZFB A;  3ED3 A;  2GST A;  2FWH A;  5G1L A;  1X9W B;  4KSO A;  2IFQ A;  1HQO A;  1NM3 A;  4L0W A;  3P2A A;  4PNF A;  2YJ7 A;  5DJL A;  2LJK A;  2C80 A;  4MJA A;  2J23 A;  1X5C A;  2O8V B;  4WEY A;  3HZ8 A;  4QL9 A;  4EKZ A;  5CO3 A;  4QL7 A;  1K3O A;  3UL3 A;  5IMA A;  2FA8 A;  1V98 A;  5CRD A;  3KM6 A;  4PQ1 A;  4AGS A;  5A4V A;  4N0V A;  4K7O A;  3RHC A;  1SYX A;  4MP4 A;  3EC3 A;  3IA1 A;  2H6X A;  4K8M A;  4ZIJ A;  1K0B A;  1N2A A;  1OYJ A;  3F9U A;  10GS A;  5B6M A;  3Q6O A;  1RK4 A;  2VIM A;  4MK3 A;  4HQS A;  1BJX A;  4NMU A;  3FY7 A;  1OVN A;  3P8W A;  3HVX A;  2B5Y A;  1ZYE A;  2LV3 A;  3QAV A;  3KH7 A;  1J9B A;  1M0U A;  3FW2 A;  3GL5 A;  5FWG A;  1OAZ A;  3N5O A;  5F8B A;  2AHE A;  2BTO T;  4BWS A;  1U6T A;  2WDU A;  2H0G A;  2IJY A;  5J4U A;  3DEX A;  5IOX A;  2KHP A;  3QAG A;  2GGT A;  1MDI A;  5ELG A;  2PN8 A;  3M1G A;  2R37 A;  4F2I A;  1R26 A;  2GDR A;  1URM A;  1FAA A;  3H4K A;  5G5F A;  4PX1 A;  4GSS A;  3I9V 2;  5ECP B;  3ERW A;  4BPY A;  2OE0 A;  2E0Q A;  3GTU B;  4EO3 A;  5HFK A;  2LRT A;  1K0C A;  4LLR A;  2B7K A;  2VL9 A;  3M3M A;  3UOM A;  2EIO A;  2X8H A;  5ECM B;  2JSY A;  5EVO A;  4AJ7 A;  2G0F A;  3HDC A;  4D73 B;  3TKP A;  4XS1 A;  3WT2 A;  3HVV A;  1PSQ A;  2JU5 A;  3CXG A;  3MWH A;  4WBJ A;  2PVO C;  2TRC P;  4IW9 A;  4KCA A;  5J9B A;  2V32 A;  3GNJ A;  3QPM A;  4IS0 A;  3A5W A;  3TRP A;  1HNA A;  2IWT A;  1KEB A;  2H0H A;  2WUL A;  4JBB A;  3GSS A;  2OBI A;  2GZZ A;  2GQL A;  2GTU A;  4YH2 A;  4IJI A;  2HI7 A;  1OKT A;  2G2Q A;  1GWC A;  3HHV A;  2P5Q A;  3P90 A;  1H4O A;  2IFQ B;  2P5R A;  18GS A;  1WE0 A;  4KH7 A;  5DCH A;  5A4U A;  2VM1 A;  3QOU A;  4GQF A;  3SBC A;  4IP6 A;  1K3Y A;  5CAX A;  3L9V A;  1OE7 A;  3FYG A;  17GS A;  1SJ6 A;  2AAW A;  3VWX A;  1B4P A;  1ILO A;  2N5B A;  3GV1 A;  5KN0 A;  1GSF A;  5LNK e;  2DSA A;  3QCP A;  4NV5 A;  4MF7 A;  3KH9 A;  3IBH A;  5IOW A;  1ERW A;  3A2X A;  1PD2 1;  4GXZ A;  4O5R A;  1JZD A;  2V41 A;  1EWX A;  1UN2 A;  4K0G A;  1GLQ A;  5HR1 A;  20GS A;  4HZ2 A;  2DIZ A;  1GL8 A;  4IP1 A;  1EEJ A;  1ERU A;  1HD2 A;  1DUG A;  5D9V A;  3D22 A;  1JFU A;  1SL1 B;  1A2J A;  1SL0 B;  3A3T A;  3AY8 A;  5D9X A;  3F4R A;  1A23 A;  1Z9H A;  3BBY A;  1WMJ A;  5D8I A; 
#chains in the Genus database with same CATH topology
 4EC0 A;  4TXV A;  4X1U A;  1DBY A;  2L5O A;  3F4S A;  1J0F A;  5D93 A;  2JL4 A;  3GKX A;  5EL8 A;  5H5Q A;  3EIN A;  2R4V A;  1AC1 A;  3LEF A;  5G5E A;  3VWU A;  3HJM A;  4K6X A;  4OCF A;  4ECB A;  4NPB A;  1QK8 A;  2IPA A;  3M8N A;  2HXK A;  1AQV A;  2WB9 A;  1HYU A;  3K8N A;  1ABA A;  5G31 A;  4IVF A;  3LGC A;  4NWY A;  2GQK A;  5F07 A;  3DGQ A;  4PUA A;  3A2W A;  4FYU A;  1S3A A;  4TXO A;  4V2M A;  5JCU A;  1TP9 A;  3TCO A;  4GST A;  3FZ9 A;  1ZOF A;  3ZL5 A;  1A8Y A;  3ZIV A;  3G9B A;  5LCZ A;  3TDG A;  1Z6M A;  2LNT A;  5D96 A;  1M9B A;  4OD7 A;  4O32 A;  3GX8 A;  4MF5 A;  4XHM A;  4GWR A;  4K9Z A;  1AQW A;  4EDY A;  1BAY A;  2GZP A;  5BRT A;  1PL2 A;  1Q4J A;  1W89 A;  2YP6 A;  4WKW A;  4J56 E;  4ML6 A;  4HSC X;  4XIH A;  2KP1 A;  3ZML A;  2IMF A;  4F82 A;  2NDO A;  1DE2 A;  3HJO A;  2FUG 2;  3VUR A;  2WGR A;  1GSU A;  2DLX A;  4PTS A;  1GSQ A;  1AW9 A;  1SJZ A;  3LSZ A;  4MA9 A;  3GKN A;  4ZXG A;  3IC8 A;  4FO5 A;  2XBQ A;  5E59 A;  1PN9 A;  4YQV A;  4WBR D;  3TKS E;  1IYH A;  5GAN D;  1U3I A;  3FR9 A;  1XW9 A;  2H1B A;  1NW2 A;  5IIZ A;  2HNL A;  2CQ9 A;  4DVC A;  4KGI A;  4JE1 A;  4KSM A;  2GLR A;  2NTO A;  1SD8 A;  2HSY A;  3CSI A;  1V9W A;  3IE3 A;  4A5P A;  2A2P A;  2TRX A;  4AF2 A;  2HYX A;  2H19 A;  2H1A A;  2PWJ A;  2GQM A;  1THX A;  2L4Q A;  2AYT A;  4JR6 A;  4OFT A;  1ZZY A;  1NHY A;  3CTF A;  5H5R A;  4XCS A;  1SL2 B;  1EP7 A;  4HQZ A;  4ZBB A;  2HRF A;  4LA1 A;  4KE3 A;  5DQY A;  3UVH A;  5IM9 A;  3D4T A;  1TXX A;  1WIK A;  3KMN A;  3L4N A;  2E2M A;  1K0M A;  4EDZ A;  4MJE A;  1OC8 A;  1T7P B;  4ID0 A;  5DDL A;  2AV4 A;  3LXT A;  2DML A;  3D6I A;  3NZN A;  2ON5 A;  22GS A;  1BX9 A;  4IBP A;  3QD9 A;  3HCZ A;  1EEM A;  2X99 A;  4XS6 A;  5KN1 A;  1U3A A;  2CVB A;  1T00 A;  1SJI A;  1O7U A;  2LQQ A;  1ZYQ B;  5D73 A;  2ES7 A;  2J9H A;  5FHI A;  4K2X A;  1OE8 A;  9GSS A;  4WF4 A;  3GH9 A;  2ZCT A;  3HY2 A;  4HDE A;  1BQ7 A;  1FB0 A;  2V1M A;  2JAD A;  1VGL A;  4G2E A;  2JZR A;  2WRT A;  1F6M C;  4TXO B;  1WP0 A;  3IHQ A;  4EL1 A;  5G30 A;  4K7I A;  2H75 A;  4O92 A;  4TR1 A;  3UEM A;  3ZLP A;  2VAF A;  1ZYN A;  1RW1 A;  3RAZ A;  1YJ6 A;  2C3Q A;  4IHU A;  2YZU A;  1GNW A;  2H71 A;  2CAI A;  2X8C A;  3GUS A;  1MDJ A;  2M80 A;  2PUK C;  1GUK A;  5CYY A;  3IR4 A;  4TKY A;  2MBS A;  4Z7X A;  3F3Q A;  3ZZX A;  2H6Z A;  3F3R A;  3MIX A;  2NPB A;  2B1L A;  1TW9 A;  1G6W A;  4MPG A;  3C8E A;  3FRC A;  2DJ0 A;  4BA7 A;  4MCU A;  2YWI A;  3TRX A;  5JWQ B;  2CAQ A;  2HZE A;  4MH2 A;  4V1A p;  3GHA A;  4J2F A;  2IMK A;  1LJR A;  3BD2 A;  5IMZ A;  4MMM A;  1PQN A;  4I2T A;  1XW6 A;  1FOH A;  4WR5 A;  3HJP A;  5F0G A;  4DSQ A;  1MEK A;  3QR6 A;  5GSS A;  4BVX A;  4X0X A;  4DSS A;  5IMF A;  4TR4 A;  1TK5 B;  1TJD A;  5IO0 A;  1YDK A;  4MJC A;  12GS A;  4NHZ A;  1O73 A;  3QDN A;  5J9C A;  3KEB A;  4OO5 A;  2H6Y A;  1PN0 A;  5HFI A;  5ENU A;  5COH A;  5AIS A;  1ZL9 A;  2CVD A;  1PA3 A;  1ERT A;  5DVB A;  1C72 A;  3EWL A;  2FD3 A;  3UBL A;  2HLS A;  5F06 A;  1U87 A;  1FB6 A;  2A4V A;  3FK8 A;  3C73 A;  2X64 A;  1O8X A;  1PMT A;  3HZ4 A;  2CZ3 A;  4ML1 A;  1K3L A;  1XXU A;  5ID2 A;  3ZIT A;  5L71 A;  2B1K A;  2ALB A;  1GLP A;  4BL7 A;  6GSY A;  1FO5 A;  5GAP D;  2RUE A;  4V1A g;  4JRR A;  2BMX A;  2KUC A;  4MNN A;  3VPT A;  3DYR A;  1MD3 A;  3W6G A;  4GTU A;  2VM2 A;  4KDU A;  3ZYW A;  5FT3 A;  1TRW A;  3PR8 A;  1W4V A;  5AGY A;  2XBI A;  3GA4 A;  4POK A;  1QXH A;  2A2S A;  2TIR A;  3G7J A;  1NHO A;  3DD3 A;  2F51 A;  1V57 A;  1TRU A;  3IC4 A;  2LJR A;  2QGV A;  4I2U A;  2VCQ A;  1ST9 A;  1YZX A;  4K2D A;  4MF6 A;  1M3J A;  4G19 A;  2LNS A;  1T8E B;  1EV9 A;  1KTE A;  3IK7 A;  1VF4 A;  4TR1 B;  1JHB A;  2CX4 A;  5B8A A;  2GSR A;  3MDK A;  1O85 A;  4MZB A;  3VWW A;  4EIQ A;  4POM A;  3IAM 2;  4EE0 A;  4AJ6 A;  4DSR A;  2CZ2 A;  2EIQ A;  2WCI A;  3IAS 2;  4H86 A;  1PGT A;  3P7X A;  2EIR A;  1GUM A;  1WWJ A;  4E8H A;  3GST A;  3HVN A;  1Z6N A;  4JR4 A;  3ZRD A;  4CW9 A;  1FVK A;  5CP1 A;  1T1V A;  2R6K A;  2HZE B;  3IOS A;  19GS A;  2JZS A;  4TR3 A;  3TRQ A;  3I43 A;  2L6C A;  4FH8 A;  2X49 A;  2ZNM A;  1PRX A;  3CSH A;  4MZW A;  1UA5 A;  3G7I A;  11GS A;  2AB6 A;  1J08 A;  4K5R A;  2C0D A;  1Z7P A;  5DJM A;  2YCD A;  1TKD B;  2O85 A;  4BVX B;  3QAW A;  3RBT A;  1F3A A;  2I9H A;  4DSS B;  2D2Z A;  2K8V A;  3F8U A;  3CMI A;  1SEN A;  5EY6 A;  2L6D A;  4G9H A;  4I5Q A;  2L59 A;  4KF9 A;  1GTA A;  1SK2 A;  1XVW A;  4MDC A;  4K1F A;  3F6D A;  1VF2 A;  5CRW A;  4G0L A;  4V2N A;  2V6K A;  3W8S A;  3ERF A;  1XVQ A;  5ECQ B;  1EP8 A;  1PX7 A;  4FYC A;  3H8Q A;  1A0R P;  2MMZ A;  1YKA A;  4TOP A;  2C0E A;  3FZA A;  1CQH A;  1QUW A;  3M0F A;  3V1W A;  5ID2 B;  4GLT A;  3DKS A;  2PGT A;  3ZVJ D;  1PL1 A;  1OC9 A;  4HU7 A;  2C0F A;  4N0Z A;  1R7H A;  2A4H A;  1XWC A;  4BL7 B;  5IQY A;  5JWR B;  1F2E A;  4YAP A;  3FZ4 A;  3UAR A;  4N10 A;  3ME8 A;  2FY6 A;  1GSE A;  2DBC A;  4K0N A;  1YY7 A;  3O6T A;  2B5E A;  3TB2 A;  4ZIL A;  3H79 A;  5E4W A;  3GL3 A;  2YWM A;  2DJJ A;  5IMD A;  3GX0 A;  3HA9 A;  1BED A;  4OWY A;  2VL2 C;  2GT6 A;  2F9S A;  5G2Z A;  1K0D A;  3KZQ A;  2H73 A;  5JWO B;  1F3B A;  6GSX A;  2WJU A;  3CTG A;  1EOH A;  3TGZ A;  4KCE A;  5J3R A;  13GS A;  3FZ5 A;  2ZUP A;  3PGT A;  3M9K A;  1B8X A;  3TKS A;  1X9M B;  2VUP A;  4USS A;  2YZH A;  3LYK A;  3C7M A;  5ELA A;  4ZB6 A;  3FEU A;  3Q74 A;  2C4J A;  2H0I A;  4KB3 A;  3TJB A;  4L5O A;  1E2Y A;  1YKC A;  2QA2 A;  3HYP A;  4TVE A;  5CRG A;  1ON4 A;  1UVZ A;  4F0C A;  4POL A;  2P0G A;  2WFC A;  1R4W A;  4BWQ A;  2I81 A;  1WPI A;  1A2L A;  2VLV A;  3GH6 A;  1MDK A;  3CRT A;  1T4Y A;  2P31 A;  3NIV A;  4YQM A;  2PPT A;  2I4A A;  1G7E A;  2DC5 A;  4F0B A;  3APQ A;  2RM6 A;  2IMD A;  4JU5 A;  1A0F A;  4ISD A;  1B48 A;  4TRX A;  2L5L A;  3H93 A;  4GQC A;  1B9Y C;  3ZTL A;  1TRV A;  2V2G A;  2PVQ A;  2IME A;  1YQ1 A;  4OMV A;  3EE2 A;  5DBQ A;  2H30 A;  1TI1 A;  3U6V A;  1H75 A;  2YWO A;  2CX3 A;  6GSW A;  1M2B A;  1AUC A;  4TW5 A;  1SKW B;  2H76 A;  3UMA A;  1BG5 A;  3DRN A;  1ERV A;  4Q5F A;  4V2L A;  2X4A A;  1LBK A;  2UZ8 A;  1GSS A;  3KJY A;  1PKZ A;  2E2G A;  1AXD A;  3D5J A;  2X8G A;  3OR5 A;  1TU7 A;  4RUV A;  2N5F A;  4NV2 A;  2FA4 A;  3S9F A;  5IMV A;  1OC9 B;  2KP2 A;  3KD0 A;  4IEL A;  1G6Y A;  2F3M A;  2LQO A;  3DWV A;  2HSH A;  4POB A;  1X5D A;  4ZBA A;  2XHF A;  5KN3 A;  4QQ7 A;  2IIY A;  3KMO A;  4LMW A;  4EF0 A;  3KCM A;  1ZYP A;  5ECL B;  2FWF A;  3VPQ A;  4EUY A;  3D4M A;  2DJ3 A;  2CT6 A;  3TJK A;  1XBS A;  5IPH A;  2OAC A;  2F8F A;  3QFA C;  3GMF A;  2C8U A;  3VK9 A;  3DIE A;  3IV4 A;  2LEG A;  3E9J B;  4X43 A;  1XWA A;  3KIJ A;  2RUF A;  4FYB A;  3SWL A;  1XOA A;  4FIW A;  4MZC A;  2FCH A;  4EXJ A;  2H8L A;  3F6F A;  2VD1 A;  1MD4 A;  2VOC A;  1QMV A;  2OBK A;  2LS5 A;  4IQ1 A;  3TOU A;  1M9A A;  2K6V A;  2REM A;  5C00 A;  4BVY A;  1AIU A;  5ECH B;  3BOA A;  2IMI A;  2DKI A;  3TKQ A;  2YV7 A;  2M46 A;  1X5E A;  2DJ2 A;  2WS2 A;  3UBK A;  1OKD A;  1B4Q A;  3CQF A;  5ECR B;  1GUL A;  3LJR A;  2PBJ A;  1Z3E A;  1IYI A;  3TJG A;  3EU3 A;  2V6O A;  2L4C A;  2B7J A;  5HFG A;  1T3B A;  1MTC A;  1GRX A;  3I69 A;  2HRN A;  5IO2 A;  2K9F A;  3LXZ A;  6GSV A;  3KGK A;  1THO A;  3J7Y b;  5J41 A;  3UVT A;  2YWN A;  3WYW A;  2LUS A;  1XCC A;  3I6A A;  3HXS A;  1DE1 A;  2K8S A;  3H1N A;  4N30 A;  2GZY A;  1AQX A;  2IL3 A;  1FHE A;  4GCI A;  4HJ2 A;  2FHE A;  3TJF A;  2OAD A;  1WJK A;  3HD5 A;  3FHK A;  3WGD A;  1TK0 B;  2HSM A;  4CHS A;  2C3N A;  2LTK A;  4CDO A;  1M7T A;  3VWV A;  3DML A;  3IRA A;  1S3C A;  2RM5 A;  3CRU A;  1SYR A;  4G10 A;  2M72 A;  2HT9 A;  1XIY A;  2YOI A;  5G1K A;  3CSJ A;  6GST A;  3L9U A;  4KND A;  1USB A;  3LOR A;  4HJM A;  3APO A;  2YPM A;  2MMA A;  4ECC A;  2H72 A;  1KNG A;  1V58 A;  1XWB A;  4PGT A;  4WET A;  4OFM A;  1A2M A;  4HS1 A;  2VCW A;  4YAV A;  4LL4 B;  1YEP A;  4OFN A;  1GNE A;  3A5I A;  3Q19 A;  2XPD A;  5D9W A;  3EVI A;  2RLI A;  5KEJ A;  3E0U A;  3JCM L;  2JZT A;  2AJQ B;  3APS A;  2BJX A;  1YEX A;  1ML6 A;  2DKH A;  5EPF A;  4PNG A;  1Y6E A;  4NXI A;  2VCT A;  3C71 A;  3RPN A;  2CVK A;  2OA7 A;  4RQR A;  4ZB8 A;  4ECJ A;  2B6M A;  2YV9 A;  1SKS B;  5J5N A;  2DJ1 A;  4KDY A;  3BCI A;  1K0A A;  3VI5 A;  1M99 A;  5INY A;  1HNB A;  4OO4 A;  4HUA A;  3ZRE A;  2R0G A;  2FWE A;  3C1R A;  4BVY B;  2O7K A;  2H1D A;  1LU4 A;  5ECO B;  3GRX A;  2NVL A;  2AUV A;  1O81 A;  4EVM A;  1A8L A;  1WOU A;  3GFK A;  3GIX A;  3LFL A;  4PUR A;  2MMO A;  1NSW A;  1TTZ A;  1E6B A;  4KW6 A;  5IMC A;  1GTI A;  3IDV A;  1Z5Y E;  1TRS A;  5AIV A;  4F03 A;  4TN8 A;  2MZC A;  1G7O A;  1Y25 A;  3GN3 A;  4K7N A;  4ACS A;  1CQG A;  4IN0 A;  1ZCP A;  2OKA A;  3BCK A;  1X0R A;  3IK9 A;  4HI7 A;  5ECN B;  4KDX A;  1XWG A;  1I5G A;  4PXO A;  5DAK A;  4YKG A;  2VCX A;  1S3D A;  3PIN A;  2HZF A;  2MBT A;  2B5X A;  1SK1 A;  3KP9 A;  3FMW A;  1N8J A;  2OE3 A;  1SU9 A;  1RQM A;  4NAX A;  2K18 A;  4YQU A;  3EMP A;  4IKH A;  2O87 A;  4N11 A;  2HE3 A;  2FWG A;  2FLS A;  1DSB A;  3D0Z A;  3EUR A;  1B9X C;  4GSN A;  2KLX A;  3UAP A;  4MH3 A;  3QFB C;  2YJH A;  1OC3 A;  3FR6 A;  1EGR A;  5IPG A;  4ECI A;  4GF0 A;  1M2A A;  3F63 A;  5C04 A;  3L0H A;  5DCG A;  3LQ7 A;  3MSZ A;  3GYK A;  3LW9 A;  3O76 A;  3WT1 A;  2FNO A;  2I1U A;  2PMT A;  3RPP A;  14GS A;  2OJL A;  3DVX A;  3A2V A;  3ISO A;  4Z2R A;  4P3Y B;  5GST A;  2O89 A;  1TI3 A;  1JZR A;  2L57 A;  1HNC A;  3Q18 A;  4KX4 A;  5LD0 A;  1JLV A;  4O7H A;  1TK8 B;  1EGO A;  3IPZ A;  4ILF A;  5HR0 A;  2H1G A;  3E3E A;  3L78 A;  4MPF A;  2IN3 A;  1A24 A;  8GSS A;  4XTS A;  5ECS A;  1QFN A;  5ECK B;  16GS A;  1V2A A;  1S3R A;  2PU9 C;  3ZFL A;  2VCZ A;  4Q5N A;  5CRH A;  7GSS A;  1I9D A;  1VF3 A;  5KN2 A;  5DAL A;  3EPT A;  4HOJ A;  1Q98 A;  3MNG A;  1GSD A;  2GT5 A;  5JCG A;  3TKS C;  1O6J A;  3QMX A;  2C3T A;  1SKR B;  1XW5 A;  1EV4 A;  4IQA A;  1KBN A;  4RI6 A;  4WR4 A;  1EOG A;  2RII A;  2LRN A;  2OE1 A;  2B3S A;  4IJ3 A;  2E7P A;  3HVS A;  3IXR A;  5AIX A;  4I6X A;  3L9S A;  2ON7 A;  4PUF C;  2KOK A;  3DXB A;  2VO4 A;  5GZZ B;  3CBU A;  5B6N A;  3TKR A;  1JLW A;  2VLT A;  4GRF A;  2QA1 A;  2HRK A;  4MJB A;  1FVJ A;  1T4Z A;  1M2D A;  4XRA A;  2VL2 A;  3WGX A;  1QGV A;  3LYP A;  2MMN A;  2NBS A;  2VL3 A;  4XS4 A;  1QQ2 A;  5H5S A;  1GH2 A;  1K0N A;  1UC7 A;  3U5R E;  5DAK B;  1TDI A;  2I3Y A;  3UJ1 A;  4F9Z A;  1XG8 A;  1JZO A;  3LG6 A;  3VFI A;  5B7C A;  4DEJ A;  4XRD A;  5F05 A;  2JSZ A;  3GKK A;  3M9J A;  1X9S B;  4Q5R A;  1O8W A;  5ECI B;  2R0P A;  2WZ9 A;  3CYN A;  1U88 A;  3FKF A;  3PPU A;  4JZQ A;  4OCE A;  5HR3 A;  2R2J A;  2YN1 A;  2XC2 A;  5HQP A;  1EZK A;  3MAK A;  4JED A;  4NHW A;  5ABR A;  3US3 A;  4LMV A;  4I97 A;  4WXT A;  3TJJ A;  3VLN A;  4WF5 A;  3N9J A;  1FW1 A;  1K0O A;  5JCW A;  4FQU A;  1GUH A;  1XWK A;  1GSY A;  3F0I A;  4E8E A;  1JZW A;  2H74 A;  2LRC A;  3FR3 A;  2GSQ A;  4L5L A;  5D9T A;  4ICY A;  6GSU A;  2VD0 A;  3KTL A;  4LL1 B;  3EYT A;  3ZIJ A;  4MLY A;  5A5K A;  3D21 A;  5CNW A;  1XPV A;  2DMM A;  1VRS D;  4ZBD A;  4RI7 A;  2Z9S A;  4IGJ A;  2DIY A;  3MYD A;  4RQX A;  5HR2 A;  3F4T A;  4ZB9 A;  2GS3 A;  1XFL A;  2C0G A;  2JAC A;  1XOB A;  3J7Y k;  1R5P A;  3DVW A;  1FOV A;  3IHG A;  4PQH A;  3C1S A;  5DAL B;  3UIW A;  1YF1 A;  1ACV A;  2CV4 A;  2F8A A;  4KAE A;  4PQI A;  1F9M A;  4J57 E;  1VF1 A;  2QC7 A;  3ZVJ A;  3VI7 A;  2QKE A;  4EIP A;  3NOF A;  3TOT A;  2N5A A;  3EMX A;  1PKW A;  2YAN A;  4ULX A;  3LWA A;  3HKR A;  3W8J A;  3ZMK A;  2A2R A;  4AJ8 A;  4I8B A;  1TOF A;  1XZO A;  3KXO A;  2H01 A;  1ZMA A;  1PX6 A;  2LKU A;  2YNX A;  3WGE A;  5CRE A;  3GKM A;  1GTU A;  1FG4 A;  2C1Y A;  1Z7R A;  1GP1 A;  3PH9 A;  4HZ4 A;  4L8E A;  1YF0 A;  3EU4 A;  3O3T A;  4HU9 A;  4ZL8 A;  2HFD A;  3GTU A;  3RDW A;  3RHB A;  1TU8 A;  3TUE A;  5AN1 A;  1F37 A;  2CA8 A;  4G0I A;  4XS4 B;  1V40 A;  4MAB A;  1WRY A;  3ERG A;  2VLU A;  4D73 A;  4Q5Q A;  2GSS A;  1AAZ A;  2PER A;  3KTB A;  4KA0 A;  2H66 A;  5DQS A;  4ZL7 A;  1BYE A;  3R3E A;  3R2Q A;  3ME7 A;  4O5Q A;  4HEA 2;  5B8B A;  1SD9 A;  2R3X A;  1PFO A;  2EC4 A;  2GVP A;  4L0U A;  3WD6 A;  2LJA A;  2H70 A;  1G0T A;  3GUR A;  4KUN A;  3G7Y A;  3KP8 A;  6GSS A;  2LST A;  4BIK A;  2QSI A;  2FGX A;  2R5G A;  1GTB A;  2MYG A;  4ZL9 A;  5BMU A;  1SK0 A;  3BJ5 A;  1ZGN A;  2VCV A;  2DJK A;  4TR0 A;  1R5A A;  2XPE A;  5A4W A;  3ZFB A;  3ED3 A;  2GST A;  2FWH A;  5G1L A;  1X9W B;  4KSO A;  2IFQ A;  1HQO A;  1NM3 A;  4L0W A;  3P2A A;  2HRA A;  4PNF A;  2YJ7 A;  5DJL A;  2LJK A;  2C80 A;  4MJA A;  2J23 A;  1X5C A;  2O8V B;  4WEY A;  3HZ8 A;  4QL9 A;  4EKZ A;  5CO3 A;  4QL7 A;  1K3O A;  3UL3 A;  5IMA A;  2FA8 A;  1V98 A;  5CRD A;  3KM6 A;  4PQ1 A;  4AGS A;  5A4V A;  4N0V A;  4K7O A;  3RHC A;  1SYX A;  4MP4 A;  3EC3 A;  3IA1 A;  2H6X A;  4K8M A;  4ZIJ A;  1K0B A;  1N2A A;  1OYJ A;  3F9U A;  10GS A;  5B6M A;  3Q6O A;  1RK4 A;  2VIM A;  4MK3 A;  4HQS A;  1BJX A;  4NMU A;  3FY7 A;  5KOX A;  1OVN A;  3P8W A;  3HVX A;  1M3I A;  2B5Y A;  1ZYE A;  2LV3 A;  3QAV A;  3KH7 A;  1J9B A;  1M0U A;  3FW2 A;  3GL5 A;  4K5S A;  5FWG A;  1OAZ A;  3N5O A;  5F8B A;  2AHE A;  2BTO T;  4BWS A;  1U6T A;  2WDU A;  4CY8 A;  2H0G A;  2IJY A;  5J4U A;  3DEX A;  5IOX A;  2KHP A;  3QAG A;  2GGT A;  1MDI A;  5ELG A;  2PN8 A;  3M1G A;  2R37 A;  4F2I A;  4YKF A;  1R26 A;  2GDR A;  1URM A;  1FAA A;  3H4K A;  5G5F A;  4PX1 A;  4GSS A;  3I9V 2;  5ECP B;  3ERW A;  4BPY A;  2OE0 A;  2E0Q A;  3GTU B;  4EO3 A;  5HFK A;  2LRT A;  1K0C A;  4LLR A;  2B7K A;  2VL9 A;  3M3M A;  3UOM A;  2EIO A;  2X8H A;  5ECM B;  2JSY A;  5EVO A;  4AJ7 A;  2G0F A;  3HDC A;  4D73 B;  3TKP A;  4XS1 A;  3WT2 A;  3HVV A;  1PSQ A;  2JU5 A;  3CXG A;  3MWH A;  4WBJ A;  2PVO C;  2TRC P;  4IW9 A;  4KCA A;  5J9B A;  2V32 A;  3GNJ A;  3QPM A;  4IS0 A;  3A5W A;  3TRP A;  4Z2U A;  1HNA A;  4X4J A;  2IWT A;  1KEB A;  4CY6 A;  2H0H A;  2WUL A;  4JBB A;  3GSS A;  2OBI A;  2GZZ A;  2GQL A;  2GTU A;  4YH2 A;  4IJI A;  2HI7 A;  1OKT A;  2G2Q A;  1GWC A;  3HHV A;  2P5Q A;  3P90 A;  1H4O A;  2IFQ B;  2P5R A;  18GS A;  1WE0 A;  4KH7 A;  5DCH A;  5A4U A;  2VM1 A;  3QOU A;  4GQF A;  3SBC A;  4IP6 A;  1K3Y A;  5CAX A;  3L9V A;  1OE7 A;  3FYG A;  17GS A;  1SJ6 A;  2AAW A;  3VWX A;  1B4P A;  1ILO A;  2N5B A;  3GV1 A;  5KN0 A;  1GSF A;  5LNK e;  2DSA A;  3QCP A;  4G0K A;  4NV5 A;  4MF7 A;  4Z2T A;  5KOW A;  3KH9 A;  3IBH A;  5IOW A;  1ERW A;  3A2X A;  1PD2 1;  4GXZ A;  4O5R A;  1JZD A;  2V41 A;  1EWX A;  1UN2 A;  4K0G A;  1GLQ A;  5HR1 A;  20GS A;  4HZ2 A;  2DIZ A;  1GL8 A;  4IP1 A;  4O5U A;  1EEJ A;  1ERU A;  1HD2 A;  1DUG A;  5D9V A;  3D22 A;  1JFU A;  1SL1 B;  1A2J A;  1SL0 B;  2R0C A;  3A3T A;  3AY8 A;  5D9X A;  3F4R A;  1A23 A;  1Z9H A;  3BBY A;  1WMJ A;  5D8I A; 
#chains in the Genus database with same CATH homology
 4EC0 A;  4TXV A;  4X1U A;  1DBY A;  2L5O A;  3F4S A;  1J0F A;  5D93 A;  2JL4 A;  3GKX A;  5EL8 A;  5H5Q A;  3EIN A;  2R4V A;  1AC1 A;  3LEF A;  5G5E A;  3VWU A;  3HJM A;  4K6X A;  4OCF A;  4ECB A;  4NPB A;  1QK8 A;  2IPA A;  3M8N A;  2HXK A;  1AQV A;  2WB9 A;  1HYU A;  3K8N A;  1ABA A;  5G31 A;  4IVF A;  3LGC A;  4NWY A;  2GQK A;  5F07 A;  3DGQ A;  4PUA A;  3A2W A;  4FYU A;  1S3A A;  4TXO A;  4V2M A;  5JCU A;  1TP9 A;  3TCO A;  4GST A;  3FZ9 A;  1ZOF A;  3ZL5 A;  1A8Y A;  3ZIV A;  3G9B A;  5LCZ A;  3TDG A;  1Z6M A;  2LNT A;  5D96 A;  1M9B A;  4OD7 A;  4O32 A;  3GX8 A;  4MF5 A;  4XHM A;  4GWR A;  4K9Z A;  1AQW A;  4EDY A;  1BAY A;  2GZP A;  5BRT A;  1PL2 A;  1Q4J A;  1W89 A;  2YP6 A;  4WKW A;  4J56 E;  4ML6 A;  4XIH A;  2KP1 A;  3ZML A;  2IMF A;  4F82 A;  2NDO A;  1DE2 A;  3HJO A;  2FUG 2;  3VUR A;  2WGR A;  1GSU A;  2DLX A;  4PTS A;  1GSQ A;  1AW9 A;  1SJZ A;  3LSZ A;  4MA9 A;  3GKN A;  4ZXG A;  3IC8 A;  4FO5 A;  2XBQ A;  5E59 A;  1PN9 A;  4YQV A;  4WBR D;  3TKS E;  1IYH A;  5GAN D;  1U3I A;  3FR9 A;  1XW9 A;  2H1B A;  1NW2 A;  5IIZ A;  2HNL A;  2CQ9 A;  4DVC A;  4KGI A;  4JE1 A;  4KSM A;  2GLR A;  2NTO A;  1SD8 A;  2HSY A;  3CSI A;  1V9W A;  3IE3 A;  4A5P A;  2A2P A;  2TRX A;  4AF2 A;  2HYX A;  2H19 A;  2H1A A;  2PWJ A;  2GQM A;  1THX A;  2L4Q A;  2AYT A;  4JR6 A;  4OFT A;  1ZZY A;  1NHY A;  3CTF A;  5H5R A;  4XCS A;  1SL2 B;  1EP7 A;  4HQZ A;  4ZBB A;  2HRF A;  4LA1 A;  4KE3 A;  5DQY A;  3UVH A;  5IM9 A;  3D4T A;  1TXX A;  1WIK A;  3KMN A;  3L4N A;  2E2M A;  1K0M A;  4EDZ A;  4MJE A;  1OC8 A;  1T7P B;  4ID0 A;  5DDL A;  2AV4 A;  3LXT A;  2DML A;  3D6I A;  3NZN A;  2ON5 A;  22GS A;  1BX9 A;  4IBP A;  3QD9 A;  3HCZ A;  1EEM A;  2X99 A;  4XS6 A;  5KN1 A;  1U3A A;  2CVB A;  1T00 A;  1SJI A;  1O7U A;  2LQQ A;  1ZYQ B;  5D73 A;  2ES7 A;  2J9H A;  5FHI A;  4K2X A;  1OE8 A;  9GSS A;  4WF4 A;  3GH9 A;  2ZCT A;  3HY2 A;  4HDE A;  1BQ7 A;  1FB0 A;  2V1M A;  2JAD A;  1VGL A;  4G2E A;  2JZR A;  2WRT A;  1F6M C;  4TXO B;  1WP0 A;  3IHQ A;  4EL1 A;  5G30 A;  4K7I A;  2H75 A;  4O92 A;  4TR1 A;  3UEM A;  3ZLP A;  2VAF A;  1ZYN A;  1RW1 A;  3RAZ A;  1YJ6 A;  2C3Q A;  4IHU A;  2YZU A;  1GNW A;  2H71 A;  2CAI A;  2X8C A;  3GUS A;  1MDJ A;  2M80 A;  2PUK C;  1GUK A;  5CYY A;  3IR4 A;  4TKY A;  2MBS A;  4Z7X A;  3F3Q A;  3ZZX A;  2H6Z A;  3F3R A;  3MIX A;  2NPB A;  2B1L A;  1TW9 A;  1G6W A;  4MPG A;  3C8E A;  3FRC A;  2DJ0 A;  4BA7 A;  4MCU A;  2YWI A;  3TRX A;  5JWQ B;  2CAQ A;  2HZE A;  4MH2 A;  4V1A p;  3GHA A;  4J2F A;  2IMK A;  1LJR A;  3BD2 A;  5IMZ A;  4MMM A;  1PQN A;  4I2T A;  1XW6 A;  1FOH A;  4WR5 A;  3HJP A;  5F0G A;  4DSQ A;  1MEK A;  3QR6 A;  5GSS A;  4BVX A;  4X0X A;  4DSS A;  5IMF A;  4TR4 A;  1TK5 B;  1TJD A;  5IO0 A;  1YDK A;  4MJC A;  12GS A;  4NHZ A;  1O73 A;  3QDN A;  5J9C A;  3KEB A;  4OO5 A;  2H6Y A;  1PN0 A;  5HFI A;  5ENU A;  5COH A;  5AIS A;  1ZL9 A;  2CVD A;  1PA3 A;  1ERT A;  5DVB A;  1C72 A;  3EWL A;  2FD3 A;  3UBL A;  2HLS A;  5F06 A;  1U87 A;  1FB6 A;  2A4V A;  3FK8 A;  3C73 A;  2X64 A;  1O8X A;  1PMT A;  3HZ4 A;  2CZ3 A;  4ML1 A;  1K3L A;  1XXU A;  5ID2 A;  3ZIT A;  5L71 A;  2B1K A;  2ALB A;  1GLP A;  4BL7 A;  6GSY A;  1FO5 A;  5GAP D;  2RUE A;  4V1A g;  4JRR A;  2BMX A;  2KUC A;  4MNN A;  3VPT A;  3DYR A;  1MD3 A;  3W6G A;  4GTU A;  2VM2 A;  4KDU A;  3ZYW A;  5FT3 A;  1TRW A;  3PR8 A;  1W4V A;  5AGY A;  2XBI A;  3GA4 A;  4POK A;  1QXH A;  2A2S A;  2TIR A;  3G7J A;  1NHO A;  3DD3 A;  2F51 A;  1V57 A;  1TRU A;  3IC4 A;  2LJR A;  2QGV A;  4I2U A;  2VCQ A;  1ST9 A;  1YZX A;  4K2D A;  4MF6 A;  4G19 A;  2LNS A;  1T8E B;  1EV9 A;  1KTE A;  3IK7 A;  1VF4 A;  4TR1 B;  1JHB A;  2CX4 A;  5B8A A;  2GSR A;  3MDK A;  1O85 A;  4MZB A;  3VWW A;  4EIQ A;  4POM A;  3IAM 2;  4EE0 A;  4AJ6 A;  4DSR A;  2CZ2 A;  2EIQ A;  2WCI A;  3IAS 2;  4H86 A;  1PGT A;  3P7X A;  2EIR A;  1GUM A;  1WWJ A;  4E8H A;  3GST A;  1Z6N A;  4JR4 A;  3ZRD A;  4CW9 A;  1FVK A;  5CP1 A;  1T1V A;  2R6K A;  2HZE B;  3IOS A;  19GS A;  2JZS A;  4TR3 A;  3TRQ A;  3I43 A;  2L6C A;  4FH8 A;  2X49 A;  2ZNM A;  1PRX A;  3CSH A;  4MZW A;  1UA5 A;  3G7I A;  11GS A;  2AB6 A;  1J08 A;  4K5R A;  2C0D A;  1Z7P A;  5DJM A;  2YCD A;  1TKD B;  2O85 A;  4BVX B;  3QAW A;  3RBT A;  1F3A A;  2I9H A;  4DSS B;  2D2Z A;  2K8V A;  3F8U A;  3CMI A;  1SEN A;  5EY6 A;  2L6D A;  4G9H A;  4I5Q A;  2L59 A;  4KF9 A;  1GTA A;  1SK2 A;  1XVW A;  4MDC A;  4K1F A;  3F6D A;  1VF2 A;  5CRW A;  4G0L A;  4V2N A;  2V6K A;  3W8S A;  3ERF A;  1XVQ A;  5ECQ B;  1EP8 A;  1PX7 A;  4FYC A;  3H8Q A;  1A0R P;  2MMZ A;  1YKA A;  4TOP A;  2C0E A;  3FZA A;  1CQH A;  1QUW A;  3M0F A;  3V1W A;  5ID2 B;  4GLT A;  3DKS A;  2PGT A;  3ZVJ D;  1PL1 A;  1OC9 A;  4HU7 A;  2C0F A;  4N0Z A;  1R7H A;  2A4H A;  1XWC A;  4BL7 B;  5IQY A;  5JWR B;  1F2E A;  4YAP A;  3FZ4 A;  3UAR A;  4N10 A;  3ME8 A;  2FY6 A;  1GSE A;  2DBC A;  4K0N A;  1YY7 A;  3O6T A;  2B5E A;  3TB2 A;  4ZIL A;  3H79 A;  5E4W A;  3GL3 A;  2YWM A;  2DJJ A;  5IMD A;  3GX0 A;  3HA9 A;  1BED A;  4OWY A;  2VL2 C;  2GT6 A;  2F9S A;  5G2Z A;  1K0D A;  3KZQ A;  2H73 A;  5JWO B;  1F3B A;  6GSX A;  2WJU A;  3CTG A;  1EOH A;  3TGZ A;  4KCE A;  5J3R A;  13GS A;  3FZ5 A;  2ZUP A;  3PGT A;  3M9K A;  1B8X A;  3TKS A;  1X9M B;  2VUP A;  4USS A;  2YZH A;  3LYK A;  3C7M A;  5ELA A;  4ZB6 A;  3FEU A;  3Q74 A;  2C4J A;  2H0I A;  4KB3 A;  3TJB A;  4L5O A;  1E2Y A;  1YKC A;  2QA2 A;  3HYP A;  4TVE A;  5CRG A;  1ON4 A;  1UVZ A;  4F0C A;  4POL A;  2P0G A;  2WFC A;  1R4W A;  4BWQ A;  2I81 A;  1WPI A;  1A2L A;  2VLV A;  3GH6 A;  1MDK A;  3CRT A;  1T4Y A;  2P31 A;  3NIV A;  4YQM A;  2PPT A;  2I4A A;  1G7E A;  2DC5 A;  4F0B A;  3APQ A;  2RM6 A;  2IMD A;  4JU5 A;  1A0F A;  4ISD A;  1B48 A;  4TRX A;  2L5L A;  3H93 A;  4GQC A;  1B9Y C;  3ZTL A;  1TRV A;  2V2G A;  2PVQ A;  2IME A;  1YQ1 A;  4OMV A;  3EE2 A;  5DBQ A;  2H30 A;  1TI1 A;  3U6V A;  1H75 A;  2YWO A;  2CX3 A;  6GSW A;  1M2B A;  1AUC A;  4TW5 A;  1SKW B;  2H76 A;  3UMA A;  1BG5 A;  3DRN A;  1ERV A;  4Q5F A;  4V2L A;  2X4A A;  1LBK A;  2UZ8 A;  1GSS A;  3KJY A;  1PKZ A;  2E2G A;  1AXD A;  3D5J A;  2X8G A;  3OR5 A;  1TU7 A;  4RUV A;  2N5F A;  4NV2 A;  2FA4 A;  3S9F A;  5IMV A;  1OC9 B;  2KP2 A;  3KD0 A;  4IEL A;  1G6Y A;  2F3M A;  2LQO A;  3DWV A;  2HSH A;  4POB A;  1X5D A;  4ZBA A;  2XHF A;  5KN3 A;  4QQ7 A;  2IIY A;  3KMO A;  4LMW A;  4EF0 A;  3KCM A;  1ZYP A;  5ECL B;  2FWF A;  3VPQ A;  4EUY A;  3D4M A;  2DJ3 A;  2CT6 A;  3TJK A;  1XBS A;  5IPH A;  2OAC A;  2F8F A;  3QFA C;  3GMF A;  2C8U A;  3VK9 A;  3DIE A;  3IV4 A;  2LEG A;  3E9J B;  4X43 A;  1XWA A;  3KIJ A;  2RUF A;  4FYB A;  3SWL A;  1XOA A;  4FIW A;  4MZC A;  2FCH A;  4EXJ A;  2H8L A;  3F6F A;  2VD1 A;  1MD4 A;  2VOC A;  1QMV A;  2OBK A;  2LS5 A;  4IQ1 A;  3TOU A;  1M9A A;  2K6V A;  2REM A;  5C00 A;  4BVY A;  1AIU A;  5ECH B;  3BOA A;  2IMI A;  2DKI A;  3TKQ A;  2YV7 A;  2M46 A;  1X5E A;  2DJ2 A;  2WS2 A;  3UBK A;  1OKD A;  1B4Q A;  5ECR B;  1GUL A;  3LJR A;  2PBJ A;  1Z3E A;  1IYI A;  3TJG A;  3EU3 A;  2V6O A;  2L4C A;  2B7J A;  5HFG A;  1T3B A;  1MTC A;  1GRX A;  3I69 A;  2HRN A;  5IO2 A;  2K9F A;  3LXZ A;  6GSV A;  3KGK A;  1THO A;  3J7Y b;  5J41 A;  3UVT A;  2YWN A;  3WYW A;  2LUS A;  1XCC A;  3I6A A;  3HXS A;  1DE1 A;  2K8S A;  3H1N A;  4N30 A;  2GZY A;  1AQX A;  2IL3 A;  1FHE A;  4GCI A;  4HJ2 A;  2FHE A;  3TJF A;  2OAD A;  1WJK A;  3HD5 A;  3FHK A;  3WGD A;  1TK0 B;  2HSM A;  4CHS A;  2C3N A;  2LTK A;  4CDO A;  1M7T A;  3VWV A;  3DML A;  3IRA A;  1S3C A;  2RM5 A;  3CRU A;  1SYR A;  4G10 A;  2M72 A;  2HT9 A;  1XIY A;  2YOI A;  5G1K A;  3CSJ A;  6GST A;  3L9U A;  4KND A;  1USB A;  3LOR A;  4HJM A;  3APO A;  2YPM A;  2MMA A;  4ECC A;  2H72 A;  1KNG A;  1V58 A;  1XWB A;  4PGT A;  4WET A;  4OFM A;  1A2M A;  4HS1 A;  2VCW A;  4YAV A;  4LL4 B;  1YEP A;  4OFN A;  1GNE A;  3A5I A;  3Q19 A;  2XPD A;  5D9W A;  3EVI A;  2RLI A;  5KEJ A;  3E0U A;  3JCM L;  2JZT A;  2AJQ B;  3APS A;  2BJX A;  1YEX A;  1ML6 A;  2DKH A;  5EPF A;  4PNG A;  1Y6E A;  4NXI A;  2VCT A;  3C71 A;  3RPN A;  2CVK A;  2OA7 A;  4RQR A;  4ZB8 A;  4ECJ A;  2B6M A;  2YV9 A;  1SKS B;  5J5N A;  2DJ1 A;  4KDY A;  3BCI A;  1K0A A;  3VI5 A;  1M99 A;  5INY A;  1HNB A;  4OO4 A;  4HUA A;  3ZRE A;  2R0G A;  2FWE A;  3C1R A;  4BVY B;  2O7K A;  2H1D A;  1LU4 A;  5ECO B;  3GRX A;  2NVL A;  2AUV A;  1O81 A;  4EVM A;  1A8L A;  1WOU A;  3GFK A;  3GIX A;  3LFL A;  4PUR A;  2MMO A;  1NSW A;  1TTZ A;  1E6B A;  4KW6 A;  5IMC A;  1GTI A;  3IDV A;  1Z5Y E;  1TRS A;  5AIV A;  4F03 A;  4TN8 A;  2MZC A;  1G7O A;  1Y25 A;  3GN3 A;  4K7N A;  4ACS A;  1CQG A;  4IN0 A;  1ZCP A;  2OKA A;  3BCK A;  1X0R A;  3IK9 A;  4HI7 A;  5ECN B;  4KDX A;  1XWG A;  1I5G A;  4PXO A;  5DAK A;  4YKG A;  2VCX A;  1S3D A;  3PIN A;  2HZF A;  2MBT A;  2B5X A;  1SK1 A;  3KP9 A;  3FMW A;  1N8J A;  2OE3 A;  1SU9 A;  1RQM A;  4NAX A;  2K18 A;  4YQU A;  3EMP A;  4IKH A;  2O87 A;  4N11 A;  2HE3 A;  2FWG A;  2FLS A;  1DSB A;  3D0Z A;  3EUR A;  1B9X C;  4GSN A;  2KLX A;  3UAP A;  4MH3 A;  3QFB C;  2YJH A;  1OC3 A;  3FR6 A;  1EGR A;  5IPG A;  4ECI A;  4GF0 A;  1M2A A;  3F63 A;  5C04 A;  3L0H A;  5DCG A;  3LQ7 A;  3MSZ A;  3GYK A;  3LW9 A;  3O76 A;  3WT1 A;  2FNO A;  2I1U A;  2PMT A;  3RPP A;  14GS A;  2OJL A;  3DVX A;  3A2V A;  3ISO A;  4Z2R A;  4P3Y B;  5GST A;  2O89 A;  1TI3 A;  1JZR A;  2L57 A;  1HNC A;  3Q18 A;  4KX4 A;  5LD0 A;  1JLV A;  4O7H A;  1TK8 B;  1EGO A;  3IPZ A;  4ILF A;  5HR0 A;  2H1G A;  3E3E A;  3L78 A;  4MPF A;  2IN3 A;  1A24 A;  8GSS A;  4XTS A;  5ECS A;  1QFN A;  5ECK B;  16GS A;  1V2A A;  2PU9 C;  3ZFL A;  2VCZ A;  4Q5N A;  5CRH A;  7GSS A;  1I9D A;  1VF3 A;  5KN2 A;  5DAL A;  3EPT A;  4HOJ A;  1Q98 A;  3MNG A;  1GSD A;  2GT5 A;  5JCG A;  3TKS C;  1O6J A;  3QMX A;  2C3T A;  1SKR B;  1XW5 A;  1EV4 A;  4IQA A;  1KBN A;  4RI6 A;  4WR4 A;  1EOG A;  2RII A;  2LRN A;  2OE1 A;  2B3S A;  4IJ3 A;  2E7P A;  3HVS A;  3IXR A;  5AIX A;  4I6X A;  3L9S A;  2ON7 A;  4PUF C;  2KOK A;  3DXB A;  2VO4 A;  5GZZ B;  3CBU A;  5B6N A;  3TKR A;  1JLW A;  2VLT A;  4GRF A;  2QA1 A;  2HRK A;  4MJB A;  1FVJ A;  1T4Z A;  1M2D A;  4XRA A;  2VL2 A;  3WGX A;  1QGV A;  3LYP A;  2MMN A;  2NBS A;  2VL3 A;  4XS4 A;  1QQ2 A;  5H5S A;  1GH2 A;  1K0N A;  1UC7 A;  3U5R E;  5DAK B;  1TDI A;  2I3Y A;  3UJ1 A;  4F9Z A;  1JZO A;  3LG6 A;  3VFI A;  5B7C A;  4DEJ A;  4XRD A;  5F05 A;  2JSZ A;  3GKK A;  3M9J A;  1X9S B;  4Q5R A;  1O8W A;  5ECI B;  2R0P A;  2WZ9 A;  3CYN A;  1U88 A;  3FKF A;  3PPU A;  4JZQ A;  4OCE A;  5HR3 A;  2R2J A;  2YN1 A;  2XC2 A;  5HQP A;  1EZK A;  3MAK A;  4JED A;  4NHW A;  5ABR A;  3US3 A;  4LMV A;  4I97 A;  4WXT A;  3TJJ A;  3VLN A;  4WF5 A;  3N9J A;  1FW1 A;  1K0O A;  5JCW A;  4FQU A;  1GUH A;  1XWK A;  1GSY A;  3F0I A;  4E8E A;  1JZW A;  2H74 A;  2LRC A;  3FR3 A;  2GSQ A;  4L5L A;  5D9T A;  4ICY A;  6GSU A;  2VD0 A;  3KTL A;  4LL1 B;  3EYT A;  3ZIJ A;  4MLY A;  5A5K A;  3D21 A;  5CNW A;  1XPV A;  2DMM A;  1VRS D;  4ZBD A;  4RI7 A;  2Z9S A;  4IGJ A;  2DIY A;  3MYD A;  4RQX A;  5HR2 A;  3F4T A;  4ZB9 A;  2GS3 A;  1XFL A;  2C0G A;  2JAC A;  1XOB A;  3J7Y k;  1R5P A;  3DVW A;  1FOV A;  3IHG A;  4PQH A;  3C1S A;  5DAL B;  3UIW A;  1YF1 A;  1ACV A;  2CV4 A;  2F8A A;  4KAE A;  4PQI A;  1F9M A;  4J57 E;  1VF1 A;  2QC7 A;  3ZVJ A;  3VI7 A;  2QKE A;  4EIP A;  3NOF A;  3TOT A;  2N5A A;  3EMX A;  1PKW A;  2YAN A;  4ULX A;  3LWA A;  3HKR A;  3W8J A;  3ZMK A;  2A2R A;  4AJ8 A;  4I8B A;  1TOF A;  1XZO A;  3KXO A;  2H01 A;  1ZMA A;  1PX6 A;  2LKU A;  2YNX A;  3WGE A;  5CRE A;  3GKM A;  1GTU A;  1FG4 A;  2C1Y A;  1Z7R A;  1GP1 A;  3PH9 A;  4HZ4 A;  4L8E A;  1YF0 A;  3EU4 A;  3O3T A;  4HU9 A;  4ZL8 A;  2HFD A;  3GTU A;  3RDW A;  3RHB A;  1TU8 A;  3TUE A;  5AN1 A;  1F37 A;  2CA8 A;  4G0I A;  4XS4 B;  1V40 A;  4MAB A;  1WRY A;  3ERG A;  2VLU A;  4D73 A;  4Q5Q A;  2GSS A;  1AAZ A;  2PER A;  3KTB A;  4KA0 A;  2H66 A;  5DQS A;  4ZL7 A;  1BYE A;  3R3E A;  3R2Q A;  3ME7 A;  4O5Q A;  4HEA 2;  5B8B A;  1SD9 A;  2R3X A;  2EC4 A;  2GVP A;  4L0U A;  3WD6 A;  2LJA A;  2H70 A;  1G0T A;  3GUR A;  4KUN A;  3G7Y A;  3KP8 A;  6GSS A;  2LST A;  2QSI A;  2FGX A;  2R5G A;  1GTB A;  2MYG A;  4ZL9 A;  5BMU A;  1SK0 A;  3BJ5 A;  1ZGN A;  2VCV A;  2DJK A;  4TR0 A;  1R5A A;  2XPE A;  5A4W A;  3ZFB A;  3ED3 A;  2GST A;  2FWH A;  5G1L A;  1X9W B;  4KSO A;  2IFQ A;  1HQO A;  1NM3 A;  4L0W A;  3P2A A;  2HRA A;  4PNF A;  2YJ7 A;  5DJL A;  2LJK A;  2C80 A;  4MJA A;  2J23 A;  1X5C A;  2O8V B;  4WEY A;  3HZ8 A;  4QL9 A;  4EKZ A;  5CO3 A;  4QL7 A;  1K3O A;  3UL3 A;  5IMA A;  2FA8 A;  1V98 A;  5CRD A;  3KM6 A;  4PQ1 A;  4AGS A;  5A4V A;  4N0V A;  4K7O A;  3RHC A;  1SYX A;  4MP4 A;  3EC3 A;  3IA1 A;  2H6X A;  4K8M A;  4ZIJ A;  1K0B A;  1N2A A;  1OYJ A;  3F9U A;  10GS A;  5B6M A;  3Q6O A;  1RK4 A;  2VIM A;  4MK3 A;  4HQS A;  1BJX A;  4NMU A;  3FY7 A;  5KOX A;  1OVN A;  3P8W A;  3HVX A;  2B5Y A;  1ZYE A;  2LV3 A;  3QAV A;  3KH7 A;  1J9B A;  1M0U A;  3FW2 A;  3GL5 A;  4K5S A;  5FWG A;  1OAZ A;  3N5O A;  5F8B A;  2AHE A;  2BTO T;  4BWS A;  1U6T A;  2WDU A;  4CY8 A;  2H0G A;  2IJY A;  5J4U A;  3DEX A;  5IOX A;  2KHP A;  3QAG A;  2GGT A;  1MDI A;  5ELG A;  2PN8 A;  3M1G A;  2R37 A;  4F2I A;  4YKF A;  1R26 A;  2GDR A;  1URM A;  1FAA A;  3H4K A;  5G5F A;  4PX1 A;  4GSS A;  3I9V 2;  5ECP B;  3ERW A;  4BPY A;  2OE0 A;  2E0Q A;  3GTU B;  4EO3 A;  5HFK A;  2LRT A;  1K0C A;  4LLR A;  2B7K A;  2VL9 A;  3M3M A;  3UOM A;  2EIO A;  2X8H A;  5ECM B;  2JSY A;  5EVO A;  4AJ7 A;  2G0F A;  3HDC A;  4D73 B;  3TKP A;  4XS1 A;  3WT2 A;  3HVV A;  1PSQ A;  2JU5 A;  3CXG A;  3MWH A;  4WBJ A;  2PVO C;  2TRC P;  4IW9 A;  4KCA A;  5J9B A;  2V32 A;  3GNJ A;  3QPM A;  4IS0 A;  3A5W A;  3TRP A;  4Z2U A;  1HNA A;  4X4J A;  2IWT A;  1KEB A;  4CY6 A;  2H0H A;  2WUL A;  4JBB A;  3GSS A;  2OBI A;  2GZZ A;  2GQL A;  2GTU A;  4YH2 A;  4IJI A;  2HI7 A;  1OKT A;  2G2Q A;  1GWC A;  3HHV A;  2P5Q A;  3P90 A;  1H4O A;  2IFQ B;  2P5R A;  18GS A;  1WE0 A;  4KH7 A;  5DCH A;  5A4U A;  2VM1 A;  3QOU A;  4GQF A;  3SBC A;  4IP6 A;  1K3Y A;  5CAX A;  3L9V A;  1OE7 A;  3FYG A;  17GS A;  1SJ6 A;  2AAW A;  3VWX A;  1B4P A;  1ILO A;  2N5B A;  3GV1 A;  5KN0 A;  1GSF A;  5LNK e;  2DSA A;  3QCP A;  4G0K A;  4NV5 A;  4MF7 A;  4Z2T A;  5KOW A;  3KH9 A;  3IBH A;  5IOW A;  1ERW A;  3A2X A;  1PD2 1;  4GXZ A;  4O5R A;  1JZD A;  2V41 A;  1EWX A;  1UN2 A;  4K0G A;  1GLQ A;  5HR1 A;  20GS A;  4HZ2 A;  2DIZ A;  1GL8 A;  4IP1 A;  4O5U A;  1EEJ A;  1ERU A;  1HD2 A;  1DUG A;  5D9V A;  3D22 A;  1JFU A;  1SL1 B;  1A2J A;  1SL0 B;  2R0C A;  3A3T A;  3AY8 A;  5D9X A;  3F4R A;  1A23 A;  1Z9H A;  3BBY A;  1WMJ A;  5D8I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...