5H6QB

Crystal structure of lsd1-corest in complex with peptide 11
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
131
structure length
131
Chain Sequence
b'KPPKGMFLSQEDVEAVSANATAATTVLRQLDMELVSVKRQIQNIKQTNSALKEKLDGGIEPYRLPEVIQKCNARWTTEEQLLAVQAIRKYGRDFQAISDVIGNKSVVQVKNFFVNYRRRFNIDEVLQEWEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Lysine-specific histone demethylase 1A
molecule tags Oxidoreductase/transcription/inhibitor
source organism Homo sapiens
publication title Development and crystallographic evaluation of histone H3 peptide with N-terminal serine substitution as a potent inhibitor of lysine-specific demethylase 1.
pubmed doi rcsb
total genus 41
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2016-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00249 Myb_DNA-binding Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1880 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5h6qB00
3ZMUB 2XAJB 5LHIB 2X0LB 5LHHB 5L3BB 4UVBB 3ZN1B 2Y48B 3ZMSB 4BAYB 5LBQB 2IW5B 5L3EB 5LGNB 2XAFB 3ZN0B 4UV9B 4UVAB 5H6QB 5L3GB 3ZMTB 5LHGB 5L3FB 2XAHB 2XAQB 4UV8B 4UVCB 5L3DB 5LGTB 2UXNB 4KUMB 2XASB 5L3CB 5H6RB 3ZMZB 4XBFB 2V1DB 5LGUB 4UXNB 4CZZB 2UXXB 2XAGB 3ZMVB
chains in the Genus database with same CATH superfamily
3RRWA 5HXSA 2BBHA 2NTYA 1XDPA 3PUVF 2H7VC 2EHOC 1Y01A 2BG9A 2WP9A 4HFDA 4JLEA 5AQJB 3CMLA 5FY7A 1FIOA 3VU7H 5HWYA 2YINA 2PTFA 3OTOT 2LOPA 2K9AA 2P9BA 3MJXA 5LMNT 1HNWT 4JI7T 1US7B 4MHCA 3GA8A 5LBQB 3ZSTA 3M65A 1BR4A 4QXHB 2DNXA 2E5VA 3OPCA 4UF0B 1FEWA 3SFDA 4HFCA 1CHUA 1B7TA 2Q9QB 3P4PA 3K3OA 3UU3A 3GN5A 1J5ET 1ZP0A 3KV5A 3TLWA 4CN4A 4B6XA 1FJGT 1VCSA 4AXPA 2LE8A 3KBTA 3N5LA 1NAFA 2CXFA 2LHNA 2QA7A 3PV0F 2WMNA 4IGUA 3AB3B 4IE7A 1HG2A 1QLBA 3ZKRA 5FL1A 5IYZE 2X9XA 2VKJA 3UU8A 4X20E 5AQIB 3UUBA 4CN1A 1N34T 5HEJA 2Q9QD 2V7JA 3AEDA 1D0ZA 1ZEEA 2CXDA 5IUXA 2H3RA 4WYVA 2ACXA 4LMKA 4YY3T 1OEDA 1HNXT 2BKOA 3ONXA 3FZLB 4IL4A 2CHOA 3RQWA 3C50A 4H9RC 2W2UA 3AA1B 3BQLA 2Z6EA 5TAOA 3CQGB 2F4VT 5LBMA 4DV6T 1D1CA 2PG8A 5HAXA 1IBLT 4K0KT 3ZSSA 4AKGA 2B1EA 4TUYE 4JI8T 3E22E 3K3QC 4F8HA 3ANWA 4LFBT 3CK6A 2XQ9A 5HCMA 4G63A 3KV9A 4Z90A 3UFGA 4UV8B 1BR0A 2BG9B 3N9QA 4TWHA 4WBNE 4PJJA 4ZZCA 4QXBB 3PUXF 3R6NA 3UTKA 4ILAA 2CM0A 2V6XA 4P0BA 3RIFA 4UXNB 4AKLA 3TLTA 4L5GA 3U3IA 4YJ2E 2D5UA 3C4WA 3AA6B 4NUVA 1LKXA 2WQYA 2JMHA 3ZT6A 3HKBE 3LBXB 2LSKA 2HN1A 2XAJB 2NW8A 1YKHB 1MIYA 2XHEB 3C64A 3M3ZB 2AE9A 4U3CA 3NZPA 4LF4T 3EHZA 4ZS2A 3UU5A 4GYRA 2HN2A 2MAWA 5FP3A 1XMOT 3PTRB 4JI0T 4I43B 3UFEA 3FHNA 3TLVA 2HPLA 2IDOB 2KWIB 5L3EB 2V5DA 4IE6A 1AJ3A 3H37A 4J2CA 3I9WA 2ZM8A 4H63H 1OEDC 2PBIA 5H6QB 4DMVA 4N78D 4AQFC 3RC8A 4ZI2C 3U78A 3F2EA 1D0YA 4OK0A 4M1PA 5AQSB 3ZMTB 4MBQA 4P09A 4TNWA 4DV0T 4BA9A 2VKDA 1ZKEA 3P4RA 4GIWA 4EZHA 3VR8A 2XZEA 4EZ4A 4DR5T 4DR6T 5KXJA 5FY0A 3CQXC 2V1DB 2YU2A 2LLYA 2X51A 2K3WA 2CBJA 5FVLA 1EZ3A 3AAEB 3I0QA 4A5XA 4EIWA 1IBKT 2ODVA 2CE7A 5CA1E 4GKKT 4ANJA 2E5LT 4BJMA 1MMDA 4TX5A 4U74A 1H7CA 3N2KE 5HXEA 5L2LA 3RIAA 2DHRA 2QVAA 2J47A 3H3MA 2VWAA 2C0SA 3HL6A 2KSRA 2VL8A 3JAFA 3ONLC 5CJ5A 3CX6B 4HFBA 4I55E 1N33T 3AECA 1HR0T 2ZMAA 2YN6A 3A8YC 2H89A 3SRZA 4YTNA 4PJNA 2UUCT 2E9XA 2E8IA 3IA3A 3KV6A 4HFEA 3OKQA 4DBQA 4JYAT 1DU2A 2LSGA 2BKNA 5DQWA 4U7YA 4DR1T 4A98A 5L3FB 2AXDS 3UUNA 4O4JE 2BS3A 3RIUA 5L3CB 2N1GA 3Q5WA 2WWUA 4XZCA 5FL0A 3PUWF 1T98A 2J62A 4YTMA 2QRXA 4I0UA 2ACZA 3Q2MA 1BR1A 4PK4A 3AA0B 4DUZT 2RPAA 1T72A 4NUUA 4QX8B 4HWFA 3SOLA 3KV4A 3MACA 3MKDA 1MIWA 3T8OA 4E7ZA 5HWXA 5JDHA 5L3BB 5M4YA 1NENA 1SUMB 2W4XA 2VVSA 2YOEA 1R8IA 2ZM0A 3IEEA 4O4IE 5AQMB 5HCJA 4TWDA 5F3JA 3NWIA 5JQGE 2VQFT 4BAYB 3QB5A 5FXWA 1HNZT 2MOZA 4ZHQE 1IAPA 1VRBA 5LGNB 2UXDT 3RLFF 1UCUA 1ZV4X 3RPUA 4ILBA 2V7MA 2N2NA 1OXZA 5L3GB 2D2SA 3KDSE 3CVRA 4HKAA 3R84B 3AXJB 3FXDB 4QHOA 1WYCA 2C5JA 2ZLYA 3ZC0A 2X0HA 3PUGA 4O4LE 2XAHB 2CLYB 4Q25A 3AA7B 3QK6A 4PK5A 4OYJA 2XSBA 4DV3T 4X1IE 3UULA 1L0VA 3CQCB 4JI2T 2ODUA 3RGLA 3K3NA 3P4WA 3T1YT 5ETWA 3PJAA 3PJAJ 2BZBA 4IDZA 1HS7A 4QKNA 2NTXA 2KINB 2YDRA 1MMNA 5HEHA 3RYIE 5L4EA 2OV9A 4X1KE 2V7LA 2XPKA 4H9OC 4U31A 4UR9A 2CRBA 5LB7B 4JI6T 1WYBA 4LF5T 4GK0E 1HFAA 1HX8A 1V9DA 1X79A 4ERRA 2L3LA 2M6IA 1SHZC 4TN7B 2FJAA 2K24A 2V6YB 3AAAB 5JH7E 2WU5A 2CHNA 4X66T 4P0AA 2KT9A 5AQGB 2YDQA 2DL1A 2NW9A 5CGMA 4HEAA 3AE7A 1CUNA 2I6HA 3WAKA 3LG7A 1XDOA 5JR9C 4DV5T 3ZLIA 4DNDA 2UXNB 2LSJA 3I0OA 2FJBA 3CX7B 3D0TA 4YSZA 1UK5A 5JDMA 3AEGA 2JQQA 2PFVA 2LT3A 4JI5T 5HYAA 2YK0A 1T7SA 3J9X1 1HF8A 2B76A 4X62T 4ISTA 2LRKA 3V5UA 2CLYC 2V26A 4L0RA 4H63V 1UX5A 5AQVB 2W62A 5AQLB 4NXNT 2YU1A 3AE3A 2VL0A 2JQHA 2WM9A 5CFBA 4PFOA 2UUAT 4Z8XA 1YD8G 3FBLA 3N9LA 4PFPA 5LCYA 2G0UA 2QGSA 2RA1A 2XQ4A 1HX1B 3AVSA 3E08A 4U33A 5LG4A 2BG9E 4DBRA 2HPJA 3NRXA 1MNEA 2KZ7B 2WSSV 3EUHA 3C4ZA 5GONE 2WBLA 3AE8A 1N32T 4TZ4C 2J1DG 3Q5XA 5JRCA 3LDQB 3O1HA 2WZIA 3NZQA 4BJNA 5L4HA 4UVCB 2JQ9A 1HG5A 2RP4A 3N9MA 4KUMB 5L3DB 4ZS3A 1FMVA 4UEMA 4UIGA 1YKEB 2D9DA 4YHJA 1W0BA 5EK3A 3RC3A 4CN6A 1O3XA 1WR6A 5HXHA 5AQTB 1Z0PA 4KI0F 2XQ7A 2KXPB 2X9YA 4ZI7E 4IE5A 1MNDA 3TLSA 5LNKA 4AKIA 3RIUC 4DR3T 2LKGA 3WI3A 1S35A 3UQ7A 4DIDB 2VURA 3MZKB 4KHZF 5EZYE 5LHIB 3EABA 4YT0A 5AQRB 3AEEA 3Q9DA 5AQFB 4X65T 3KFWX 3A5XA 1UURA 4WZXA 1KK7A 4LF7T 3HKCE 2E9XC 4HTEA 3A7MA 4UELA 5FKYA 1NEKA 2DLRA 3C4XA 2JIWA 2H88A 1T8BA 3I1AA 3RHWA 1JNRA 2XAFB 3RQUA 1ZHCA 4B3ST 1U4QA 2I59A 4HFVA 5EK2A 5F5WA 2XJ7A 4HE8A 1XZYA 3ESLA 1I6ZA 3VR9A 4B3TT 4ISSA 4YFSA 5KMGP 4JI4T 3GWHA 2XY8B 2CWOA 3FBZA 5J1GA 1UX4A 2I0MA 2J4GA 4P1NA 1WCRA 2DWGA 2IUBA 2ZM2A 5AQQB 2VKOA 2MTQA 2IMLA 2VK9A 1OEDB 2A3DA 2VKHA 1WRDA 4JEHB 4ASKA 2IHR1 3P8CD 5LG3A 3ETVA 2VQET 1IBMT 3Q5DA 1WLXA 2LJLA 4IIJE 3W15B 1HTJF 4IHJE 4WNKA 3FXEB 2WCAA 3ZEFB 2DWKA 2WAUA 3F31A 4HN9A 3VRBA 3T1HT 2Q9QA 4ILCA 2A72A 2XQYA 4JI3T 2M67A 2IW5B 4AKHA 2V6YA 3LK3B 3PDYA 4KX6A 1IZNB 2MBGA 2E9XB 4UVAB 3UU4A 2PJQA 4TNVA 4IT4A 2WY2A 2V5CA 4GOUA 2X68A 3S4UA 3MXZA 4EAHA 4EV6A 4PK6A 5JDGA 5LGTB 2XQ8A 3RX6A 4HWHA 3KINB 3EVYA 5HEGA 4HGAA 2LKHA 1YXRA 4WW0A 3ZJ2A 3ANWB 3JCFA 4YXDA 4LF6T 4XBFB 1HCIA 4HFIA 3UQ4A 4LF9T 2E9XD 2CBIA 1GQEA 1YQ4A 2KNDA 2L8KA 2VB6A 2D0TA 3MK7C 2C5IT 2ES0A 5AQUB 4DR2T 1XWMA 3CIRA 3LK2B 3F57A 3ZMUB 4OYKA 4TV9E 3AE6A 5JREA 2N9DA 1KFYA 1QUUA 2H7OA 2LM2A 4YLHA 3VRAA 3ZYLA 2BS4A 3BQKA 1SA0E 2W67A 3DJBA 5AQNB 3FZFB 1XNRT 2VVNA 5FNVE 3RF1A 4EGWA 5ABGA 4MALA 3KVAA 5ABEA 3JADA 1ZOYA 4TV8E 4LFAT 4G2AA 4LMLA 4UV9B 4AIUA 5JDQA 4DUYT 3QC9A 3VKHA 3TLUA 2FJEA 3CX8B 2XM1A 2K48A 3PUQA 5AQHB 5JRCB 2HH7A 4EB6E 4NXMT 3B13A 1YQ3A 5AQPB 4DV1T 2WB5A 4JEUB 3ETUA 1Y64B 4MFRA 2UXXB 3PURA 3AE5A 5JTGA 5C3JA 3FZMB 2XQAA 4O8SA 2SPCA 5C2TA 4O4HE 5LHHB 3EAMA 1XMQT 4JUYA 1SE7A 3N9PA 2LM9A 3FZHB 1W09A 4PJMA 1OEDE 5HEUA 3ZMSB 1NWMX 4HWIB 3HKDE 2WWVA 3TKLB 5ABFB 5LJMA 2LRLA 2LHRA 5LMUT 3PE0A 3DTOA 4PW8A 3N9OA 5DABA 2Q9QC 3L8RA 4B3MT 3E0ZA 1MIVA 3RYHE 4AQYT 2C5KT 3OBVE 2A9UA 2NP9A 2BDEA 2W0GA 1LVFA 2WDRA 1LVKA 3NKZA 3P4QA 4U72A 2D0UA 3L09A 3VHLA 4KBMB 3LJCA 3ZT5A 2UUBT 3AAIA 3ZPOA 2JPFA 2EHOA 1KF6A 2LEHA 2IC6A 4XAXB 5H6RB 1M62A 4ZXLA 3QOFA 3V5SA 3ZMZB 3WAJA 3VKGA 5FMNA 4X1YE 3P50A 2FJDA 2W66A 3EI0A 3P7IA 2JQKA 4O2BE 2M6BA 4YTPA 4WBOA 1LRZA 5ABFA 5JDNA 5CA0E 2E2AA 4X5TA 3ONJA 4LF8T 3RYCE 4ZEYA 2BVMA 3UUXB 3C98B 4H9SE 3LBXA 5EK4A 3PUYF 3PUZF 4K0UA 4ZZBA 4GKJT 3UUMA 4IE4A 2WZHA 2CCQA 5F8PA 4EXTA 1IJ6A 3P4SA 4E7SA 2EHOD 3N2OA 4AQGA 5FXXA 1MMAA 3L39A 4PAGA 3SS1A 2FBWA 3ZYMA 4EOZB 2JRKA 2W63A 2CXLA 1D0XA 4KHPT 2W61A 3QB5K 3RRCA 4HWDA 4EEDA 3ZC1A 2XSAA 3B57A 5L47A 2XQ3A 2CA5A 2Y8DA 3HI2A 4H9NC 4AISA 4B3RT 4CXXA 5HEOA 2EHOB 4CQIA 1JNZA 2KLQA 1QSDA 3G06A 3EDUA 4QH4A 3CWZB 2LSIA 3LK42 1E7PA 3ZCIA 2UXCT 5LXTE 3PU8A 2X0YA 4UVBB 2GK9A 3AE2A 2CEAA 3AXJA 3JC6D 3K8PC 4HFHA 3JAEA 3MA9A 1VOMA 4JBWF 2QYWA 5LYJE 4OX9T 4DV2T 5LJNA 4DV7T 3RYFE 2L9QA 5FY1A 1XNQT 5JR9B 3UU6A 3FZKB 1I94T 3L3PA 3N9NA 2BBJA 3AE9A 2XAQB 3CPZA 5HXRA 4COFA 2X9HA 1Z8UA 4L9IA 2MPKA 2XASB 3O4XE 1KEYA 1J5WA 5KDMC 2NWBA 3AEFA 4QH1A 4Z91A 4AI6A 3AE1A 2UU9T 1D1AA 1UUSA 3PUSA 5BMVE 2X66A 4I50E 2XUEA 3RI5A 5JDLA 3J7Yq 3AE4A 3QUJA 3SWHA 3NRYA 4F6RC 4A97A 4C91A 4YHHT 2IIUA 2X0LB 4CI2B 4FJOA 2YEVC 1YW0A 1VCTA 3RKOA 4AQFA 1MMGA 3AVRA 3B5MA 5JR9A 4GK5E 2BKPA 2WDQA 3UT5E 5FXZA 3ZJ1A 3LFMA 4LMJA 4TWFA 3ZN0B 1WR0A 4IDPA 1WFDA 4A56A 4IDQA 5AFUL 4V1Av 4U2YA 4ZI3C 1N36T 4CXYA 4CI1B 4QWNB 2R6GF 2KWHA 2CPTA 3OJAA 2XQ5A 4QX7B 4ZI2D 3JC6C 3IF8B 2WS3A 3X1DA 5FYMA 1BR2A 1G8XA 1D1BA 3IBPA 4YJ3E 5E0OA 4YSXA 5LP6E 4X64T 2BG9C 3NBXX 5LGUB 4IL9A 4EEBA 4CZZB 3OYXA 3H3AA 4ZI3D 2LOSA 5DJQC 3BQIA 3O1IA 2DI4A 2JMKA 2OA5A 3HR0A 3DP7A 3KBUA 4I4TE 4PNIA 2FUPA 1KNPA 2YKSA 1X9BA 3N2GE 2XM2A 2MYSA 4O2AE 2VASA 5DQVA 2BS2A 3QNUA 2Y6XA 5J2UE 5J0ZA 4IDNA 3ZN1B 2V7IA 2Y48B 3ZYKA 4DR7T 3O9XA 4JI1T 3HKEE 5LOVE 4NIQA 4PJLA 3OYZA 4CI3B 4DMWA 2OLTA 4EYUA 3KVBA 5FXVA 2CMRA 5LHGB 2X9WA 4JV5T 4MLKA 5FVKA 1E2AA 5HXCA 4HWCA 3BK9A 4H9QC 5AQOB 5IHYA 2IAKA 2IC9A 2V7KA 2WU2A 4AKRB 4CXWA 4DO0A 2NR4A 2WDVA 2WMOA 4YSYA 1U5PA 4KP3C 1M7KA 3CKDA 5AQKB 2K5BB 2CWYA 5JVDE 3HA4A 2V8SV 4GYSA 1W0AA 4DVDA 5ABHA 4OFZA 5ADXL 2ZM6T 2KMFA 1OWAA 3ZMVB 1KNRA 4DV4T 2YDSA 4KMCA 2JJ9A 1G73A 3AEAA 3IHRA 4H9PC 1J1JA 3EDVA 4U2ZA 1KNZA 2UXBT 2BVLA 5IWAT 3RH3A 2HHHT 5C8YE 5J2TE 4FI5A 4IDOA 1W9RA 3ZCJA 5LA6E 5BR8T 2NW7A 2A2FX 2XTLA 4ZOLE 4NPPA 4DR4T 2NOXA 4IE0A 3PU3A 3PUAA 4U7IA 4C90A 3GMIA 3ZT7A 3C51A 3GN5B 3K1SA 1S94A 3LSVA 5CB4E 5JDFA 1FMWA 4IREA 2W00A 4QH5A 4UF0A 3ABVA 2X67A 4OHFA 3RKGA 3SFEA 3AEBA 4ADZA 4EYYR 4ILUA 4LFCT 3Q5EA 3NVOA 3I9YA 5A1LA 1UGOA 2DCFA 1IJ5A 2XQ6A 3O1JA 3OVUA 3FB2A 4QXCB 2XAGB 5KX5E 2LSYA 1E1HB
chains in the Genus database with same CATH topology
3RRWA 2NTYA 2H7VC 2EHOC 4JLEA 3CMLA 5FY7A 1FIOA 3VU7H 5HWYA 2YINA 2LOPA 2K9AA 2P9BA 3MJXA 1US7B 4MHCA 3GA8A 5LBQB 3M65A 1BR4A 4QXHB 2DNXA 4UF0B 1FEWA 1B7TA 2Q9QB 3K3OA 3GN5A 3KV5A 4B6XA 4AXPA 2LE8A 3KBTA 3N5LA 1NAFA 2CXFA 2LHNA 2QA7A 4IGUA 2WMNA 4CI2B 3AB3B 4IE7A 1HG2A 5HXSA 5IYZE 2X9XA 2VKJA 4X20E 2Q9QD 2V7JA 1D0ZA 1ZEEA 2CXDA 2H3RA 2ACXA 3ONXA 3C50A 4H9RC 3AA1B 3BQLA 2Z6EA 5TAOA 3CQGB 5LBMA 1D1CA 2PG8A 5HAXA 4AKGA 2B1EA 4TUYE 3E22E 3K3QC 3ANWA 4G63A 3KV9A 4UV8B 1BR0A 3N9QA 4PJJA 4QXBB 3R6NA 3UTKA 2CM0A 4P0BA 4UXNB 4AKLA 4L5GA 3U3IA 4YJ2E 2D5UA 3C4WA 3AA6B 4NUVA 1LKXA 2JMHA 3HKBE 3LBXB 2LSKA 2XAJB 3C64A 2NW8A 1YKHB 1MIYA 2XHEB 4H9OC 3NZPA 4ZS2A 4GYRA 5FP3A 3PTRB 4I43B 3UFEA 3FHNA 2HPLA 2KWIB 5L3EB 4IE6A 1AJ3A 3H37A 4J2CA 3I9WA 2ZM8A 4H63H 5H6QB 2PBIA 3RC8A 4N78D 4AQFC 4ZI2C 3U78A 3F2EA 1D0YA 4OK0A 4M1PA 3ZMTB 4MBQA 4P09A 4BA9A 2VKDA 1ZKEA 4GIWA 4EZHA 4EZ4A 5FY0A 3CQXC 2V1DB 2YU2A 2X51A 4EIWA 1EZ3A 3AAEB 3I0QA 2ODVA 2CE7A 5CA1E 4ANJA 4BJMA 1MMDA 4TX5A 4U74A 1H7CA 3N2KE 5HXEA 5L2LA 2DHRA 3HL6A 2VWAA 2C0SA 2VL8A 3CX6B 4I55E 2ZMAA 3SRZA 4PJNA 2E9XA 2E8IA 3KV6A 4DBQA 3OKQA 2LSGA 5DQWA 5L3FB 3UUNA 4O4JE 5L3CB 2N1GA 3Q5WA 2WWUA 4XZCA 1T98A 3Q2MA 1BR1A 4PK4A 3AA0B 4NUUA 4QX8B 3SOLA 3KV4A 3MACA 3MKDA 1MIWA 3T8OA 4E7ZA 5HWXA 5JDHA 5L3BB 5M4YA 3IEEA 3VKGA 4O4IE 2ZM0A 5JQGE 5F3JA 4BAYB 5FXWA 2MOZA 4ZHQE 1IAPA 1VRBA 5LGNB 1UCUA 1ZV4X 3RPUA 2V7MA 2N2NA 1OXZA 5L3GB 2D2SA 3KDSE 3CVRA 4HKAA 3R84B 4QHOA 3FXDB 1WYCA 2C5JA 2ZLYA 3ZC0A 3PUGA 4O4LE 2XAHB 2CLYB 3AA7B 3QK6A 4PK5A 4OYJA 4X1IE 3UULA 3CQCB 2ODUA 3K3NA 5ETWA 2BZBA 4IDZA 1HS7A 4QKNA 2NTXA 2KINB 5J2TE 1MMNA 3RYIE 4X1KE 2V7LA 1WYBA 4GK0E 1HFAA 1HX8A 1V9DA 1X79A 4ERRA 2L3LA 1SHZC 4TN7B 2K24A 3AAAB 4P0AA 2KT9A 2NW9A 4HEAA 1CUNA 3WAKA 3LG7A 5JR9C 3ZLIA 4DNDA 2UXNB 2LSJA 3I0OA 3CX7B 3D0TA 5JDMA 2JQQA 2PFVA 2LT3A 5HYAA 2YK0A 3J9X1 1HF8A 4ISTA 3V5UA 2CLYC 2V26A 4L0RA 4H63V 1UX5A 2W62A 2YU1A 2WM9A 4PFOA 4Z8XA 1YD8G 3FBLA 3N9LA 4PFPA 5LCYA 2G0UA 2QGSA 2RA1A 3E08A 5LG4A 3AVSA 4DBRA 2HPJA 3NRXA 1MNEA 2KZ7B 2WSSV 3EUHA 3C4ZA 5GONE 2WBLA 4TZ4C 2J1DG 3Q5XA 5JRCA 3O1HA 3NZQA 4BJNA 4UVCB 5L3DB 1HG5A 2RP4A 3N9MA 4KUMB 4ZS3A 1FMVA 4UEMA 4UIGA 1YKEB 4YHJA 5EK3A 3RC3A 1O3XA 1WR6A 5HXHA 1Z0PA 2KXPB 2X9YA 4ZI7E 4IE5A 1MNDA 5LNKA 4AKIA 3WI3A 1S35A 3MZKB 5EZYE 5LHIB 3Q9DA 3KFWX 3A5XA 1KK7A 3HKCE 2E9XC 4HTEA 4UELA 2DLRA 3C4XA 3I1AA 2XAFB 1ZHCA 1U4QA 2I59A 4HFVA 5EK2A 4HE8A 3ESLA 4ISSA 4YFSA 5KMGP 3GWHA 2CWOA 3FBZA 5J1GA 1UX4A 2DWGA 2ZM2A 2VKOA 2MTQA 4JEHB 2VK9A 2A3DA 2VKHA 1WRDA 4ASKA 3P8CD 3ETVA 1WLXA 2LJLA 4IIJE 3W15B 1HTJF 4IHJE 4WNKA 3FXEB 3ZEFB 2DWKA 2WAUA 3F31A 4HN9A 2Q9QA 2A72A 2XQYA 2M67A 2IW5B 4AKHA 3LK3B 3PDYA 2MBGA 1IZNB 2E9XB 4UVAB 2PJQA 4GOUA 2X68A 3S4UA 3MXZA 4EAHA 4PK6A 5JDGA 5LGTB 3RX6A 3ZJ2A 3KINB 3EVYA 4HGAA 4WW0A 3ANWB 4XBFB 1HCIA 2E9XD 2KNDA 2L8KA 2VB6A 2D0TA 3MK7C 2C5IT 2ES0A 3LK2B 3F57A 3ZMUB 4OYKA 4TV9E 5JREA 1QUUA 2N9DA 2H7OA 4YLHA 3ZYLA 3BQKA 1SA0E 3DJBA 5FNVE 4MALA 3KVAA 4TV8E 4G2AA 4UV9B 5JDQA 3QC9A 3VKHA 3CX8B 2K48A 3PUQA 5JRCB 2HH7A 4EB6E 3B13A 4JEUB 3ETUA 1Y64B 4MFRA 2UXXB 3PURA 4O8SA 2SPCA 4O4HE 5LHHB 4JUYA 3N9PA 2LM9A 4PJMA 3ZMSB 1NWMX 3TKLB 3HKDE 5LJMA 2LHRA 3PE0A 3DTOA 4PW8A 3N9OA 5DABA 2Q9QC 3E0ZA 1MIVA 3RYHE 2C5KT 3OBVE 2NP9A 2W0GA 2BDEA 4U72A 1LVFA 3VHLA 1LVKA 4DMVA 2D0UA 3L09A 4KBMB 3LJCA 3AAIA 3ZPOA 2JPFA 2EHOA 2IC6A 2LEHA 4XAXB 5H6RB 3ZMZB 3V5SA 3WAJA 5FMNA 4X1YE 3P7IA 4O2BE 4WBOA 1LRZA 5JDNA 5CA0E 3RYCE 2BVMA 3UUXB 3C98B 4H9SE 3LBXA 5EK4A 4K0UA 3UUMA 4IE4A 2CCQA 5F8PA 4EXTA 1IJ6A 4E7SA 2EHOD 3N2OA 4AQGA 5FXXA 1MMAA 4PAGA 3SS1A 4EOZB 3ZYMA 2JRKA 2W63A 2CXLA 1D0XA 2W61A 3RRCA 3ZC1A 3B57A 2CA5A 2Y8DA 3HI2A 4H9NC 4CXXA 2EHOB 4CQIA 2KLQA 1QSDA 3EDUA 3CWZB 2LSIA 3LK42 3ZCIA 5LXTE 3PU8A 4UVBB 2GK9A 2CEAA 3JC6D 3K8PC 3MA9A 1VOMA 5LYJE 5LJNA 3RYFE 2L9QA 5FY1A 5JR9B 3L3PA 3N9NA 2XAQB 3CPZA 5HXRA 2X9HA 4L9IA 2XASB 3O4XE 5KDMC 2NWBA 4AI6A 1D1AA 3PUSA 5BMVE 2X66A 4I50E 2XUEA 5JDLA 3J7Yq 3QUJA 3SWHA 3NRYA 4F6RC 4C91A 2X0LB 4FJOA 2YEVC 1YW0A 3RKOA 4AQFA 1MMGA 3AVRA 5JR9A 4GK5E 3UT5E 5FXZA 3ZJ1A 3LFMA 3ZN0B 4A56A 5AFUL 4V1Av 4ZI3C 4CXYA 4CI1B 4QWNB 2KWHA 3OJAA 4QX7B 4ZI2D 3JC6C 3IF8B 5FYMA 1BR2A 1G8XA 1D1BA 3IBPA 4YJ3E 5E0OA 5LP6E 5LGUB 3NBXX 4CZZB 3OYXA 3H3AA 4ZI3D 2LOSA 5DJQC 3BQIA 3O1IA 2DI4A 2JMKA 2OA5A 3HR0A 3DP7A 3KBUA 4I4TE 4PNIA 4O2AE 3N2GE 5DQVA 2MYSA 2VASA 5J2UE 2Y6XA 3ZN1B 2V7IA 2Y48B 3ZYKA 3O9XA 3HKEE 5LOVE 4PJLA 3OYZA 4CI3B 4DMWA 4EYUA 3KVBA 5FXVA 2CMRA 5LHGB 2X9WA 4MLKA 5HXCA 3BK9A 4H9QC 5IHYA 2IAKA 2IC9A 2V7KA 4AKRB 4CXWA 4DO0A 2WMOA 1U5PA 4KP3C 3CKDA 5JVDE 2K5BB 2CWYA 3HA4A 4GYSA 4DVDA 5ADXL 4OFZA 2KMFA 1OWAA 3ZMVB 4KMCA 2JJ9A 1G73A 4H9PC 3IHRA 3EDVA 1KNZA 2BVLA 3RH3A 5C8YE 4FI5A 3ZCJA 5LA6E 2NW7A 2A2FX 2XTLA 4ZOLE 2NOXA 4IE0A 3PU3A 3PUAA 4C90A 5JH7E 3GMIA 3C51A 3GN5B 5CB4E 1S94A 5JDFA 1FMWA 4WBNE 2W00A 4UF0A 4OHFA 2X67A 4ADZA 4EYYR 4ILUA 3I9YA 5A1LA 3O1JA 2DCFA 1IJ5A 3FB2A 4QXCB 2XAGB 5KX5E 2LSYA 1E1HB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZMU B;  2XAJ B;  5LHI B;  2X0L B;  5LHH B;  5L3B B;  4UVB B;  3ZN1 B;  2Y48 B;  3ZMS B;  4BAY B;  5LBQ B;  2IW5 B;  5L3E B;  5LGN B;  2XAF B;  3ZN0 B;  4UV9 B;  4UVA B;  5H6Q B;  5L3G B;  3ZMT B;  5LHG B;  5L3F B;  2XAH B;  2XAQ B;  4UV8 B;  4UVC B;  5L3D B;  5LGT B;  2UXN B;  4KUM B;  2XAS B;  5L3C B;  5H6R B;  3ZMZ B;  4XBF B;  2V1D B;  5LGU B;  4UXN B;  4CZZ B;  2UXX B;  2XAG B;  3ZMV B; 
#chains in the Genus database with same CATH topology
 3RRW A;  5HXS A;  2BBH A;  2NTY A;  1XDP A;  3PUV F;  2H7V C;  2EHO C;  1Y01 A;  2BG9 A;  2WP9 A;  4HFD A;  4JLE A;  5AQJ B;  3CML A;  5FY7 A;  1FIO A;  3VU7 H;  5HWY A;  2YIN A;  2PTF A;  3OTO T;  2LOP A;  2K9A A;  2P9B A;  3MJX A;  5LMN T;  1HNW T;  4JI7 T;  1US7 B;  4MHC A;  3GA8 A;  5LBQ B;  3ZST A;  3M65 A;  1BR4 A;  4QXH B;  2DNX A;  2E5V A;  3OPC A;  4UF0 B;  1FEW A;  3SFD A;  4HFC A;  1CHU A;  1B7T A;  2Q9Q B;  3P4P A;  3K3O A;  3UU3 A;  3GN5 A;  1J5E T;  1ZP0 A;  3KV5 A;  3TLW A;  4CN4 A;  4B6X A;  1FJG T;  1VCS A;  4AXP A;  2LE8 A;  3KBT A;  3N5L A;  1NAF A;  2CXF A;  2LHN A;  2QA7 A;  3PV0 F;  2WMN A;  4IGU A;  3AB3 B;  4IE7 A;  1HG2 A;  1QLB A;  3ZKR A;  5FL1 A;  5IYZ E;  2X9X A;  2VKJ A;  3UU8 A;  4X20 E;  5AQI B;  3UUB A;  4CN1 A;  1N34 T;  5HEJ A;  2Q9Q D;  2V7J A;  3AED A;  1D0Z A;  1ZEE A;  2CXD A;  5IUX A;  2H3R A;  4WYV A;  2ACX A;  4LMK A;  4YY3 T;  1OED A;  1HNX T;  2BKO A;  3ONX A;  3FZL B;  4IL4 A;  2CHO A;  3RQW A;  3C50 A;  4H9R C;  2W2U A;  3AA1 B;  3BQL A;  2Z6E A;  5TAO A;  3CQG B;  2F4V T;  5LBM A;  4DV6 T;  1D1C A;  2PG8 A;  5HAX A;  1IBL T;  4K0K T;  3ZSS A;  4AKG A;  2B1E A;  4TUY E;  4JI8 T;  3E22 E;  3K3Q C;  4F8H A;  3ANW A;  4LFB T;  3CK6 A;  2XQ9 A;  5HCM A;  4G63 A;  3KV9 A;  4Z90 A;  3UFG A;  4UV8 B;  1BR0 A;  2BG9 B;  3N9Q A;  4TWH A;  4WBN E;  4PJJ A;  4ZZC A;  4QXB B;  3PUX F;  3R6N A;  3UTK A;  4ILA A;  2CM0 A;  2V6X A;  4P0B A;  3RIF A;  4UXN B;  4AKL A;  3TLT A;  4L5G A;  3U3I A;  4YJ2 E;  2D5U A;  3C4W A;  3AA6 B;  4NUV A;  1LKX A;  2WQY A;  2JMH A;  3ZT6 A;  3HKB E;  3LBX B;  2LSK A;  2HN1 A;  2XAJ B;  2NW8 A;  1YKH B;  1MIY A;  2XHE B;  3C64 A;  3M3Z B;  2AE9 A;  4U3C A;  3NZP A;  4LF4 T;  3EHZ A;  4ZS2 A;  3UU5 A;  4GYR A;  2HN2 A;  2MAW A;  5FP3 A;  1XMO T;  3PTR B;  4JI0 T;  4I43 B;  3UFE A;  3FHN A;  3TLV A;  2HPL A;  2IDO B;  2KWI B;  5L3E B;  2V5D A;  4IE6 A;  1AJ3 A;  3H37 A;  4J2C A;  3I9W A;  2ZM8 A;  4H63 H;  1OED C;  2PBI A;  5H6Q B;  4DMV A;  4N78 D;  4AQF C;  3RC8 A;  4ZI2 C;  3U78 A;  3F2E A;  1D0Y A;  4OK0 A;  4M1P A;  5AQS B;  3ZMT B;  4MBQ A;  4P09 A;  4TNW A;  4DV0 T;  4BA9 A;  2VKD A;  1ZKE A;  3P4R A;  4GIW A;  4EZH A;  3VR8 A;  2XZE A;  4EZ4 A;  4DR5 T;  4DR6 T;  5KXJ A;  5FY0 A;  3CQX C;  2V1D B;  2YU2 A;  2LLY A;  2X51 A;  2K3W A;  2CBJ A;  5FVL A;  1EZ3 A;  3AAE B;  3I0Q A;  4A5X A;  4EIW A;  1IBK T;  2ODV A;  2CE7 A;  5CA1 E;  4GKK T;  4ANJ A;  2E5L T;  4BJM A;  1MMD A;  4TX5 A;  4U74 A;  1H7C A;  3N2K E;  5HXE A;  5L2L A;  3RIA A;  2DHR A;  2QVA A;  2J47 A;  3H3M A;  2VWA A;  2C0S A;  3HL6 A;  2KSR A;  2VL8 A;  3JAF A;  3ONL C;  5CJ5 A;  3CX6 B;  4HFB A;  4I55 E;  1N33 T;  3AEC A;  1HR0 T;  2ZMA A;  2YN6 A;  3A8Y C;  2H89 A;  3SRZ A;  4YTN A;  4PJN A;  2UUC T;  2E9X A;  2E8I A;  3IA3 A;  3KV6 A;  4HFE A;  3OKQ A;  4DBQ A;  4JYA T;  1DU2 A;  2LSG A;  2BKN A;  5DQW A;  4U7Y A;  4DR1 T;  4A98 A;  5L3F B;  2AXD S;  3UUN A;  4O4J E;  2BS3 A;  3RIU A;  5L3C B;  2N1G A;  3Q5W A;  2WWU A;  4XZC A;  5FL0 A;  3PUW F;  1T98 A;  2J62 A;  4YTM A;  2QRX A;  4I0U A;  2ACZ A;  3Q2M A;  1BR1 A;  4PK4 A;  3AA0 B;  4DUZ T;  2RPA A;  1T72 A;  4NUU A;  4QX8 B;  4HWF A;  3SOL A;  3KV4 A;  3MAC A;  3MKD A;  1MIW A;  3T8O A;  4E7Z A;  5HWX A;  5JDH A;  5L3B B;  5M4Y A;  1NEN A;  1SUM B;  2W4X A;  2VVS A;  2YOE A;  1R8I A;  2ZM0 A;  3IEE A;  4O4I E;  5AQM B;  5HCJ A;  4TWD A;  5F3J A;  3NWI A;  5JQG E;  2VQF T;  4BAY B;  3QB5 A;  5FXW A;  1HNZ T;  2MOZ A;  4ZHQ E;  1IAP A;  1VRB A;  5LGN B;  2UXD T;  3RLF F;  1UCU A;  1ZV4 X;  3RPU A;  4ILB A;  2V7M A;  2N2N A;  1OXZ A;  5L3G B;  2D2S A;  3KDS E;  3CVR A;  4HKA A;  3R84 B;  3AXJ B;  3FXD B;  4QHO A;  1WYC A;  2C5J A;  2ZLY A;  3ZC0 A;  2X0H A;  3PUG A;  4O4L E;  2XAH B;  2CLY B;  4Q25 A;  3AA7 B;  3QK6 A;  4PK5 A;  4OYJ A;  2XSB A;  4DV3 T;  4X1I E;  3UUL A;  1L0V A;  3CQC B;  4JI2 T;  2ODU A;  3RGL A;  3K3N A;  3P4W A;  3T1Y T;  5ETW A;  3PJA A;  3PJA J;  2BZB A;  4IDZ A;  1HS7 A;  4QKN A;  2NTX A;  2KIN B;  2YDR A;  1MMN A;  5HEH A;  3RYI E;  5L4E A;  2OV9 A;  4X1K E;  2V7L A;  2XPK A;  4H9O C;  4U31 A;  4UR9 A;  2CRB A;  5LB7 B;  4JI6 T;  1WYB A;  4LF5 T;  4GK0 E;  1HFA A;  1HX8 A;  1V9D A;  1X79 A;  4ERR A;  2L3L A;  2M6I A;  1SHZ C;  4TN7 B;  2FJA A;  2K24 A;  2V6Y B;  3AAA B;  5JH7 E;  2WU5 A;  2CHN A;  4X66 T;  4P0A A;  2KT9 A;  5AQG B;  2YDQ A;  2DL1 A;  2NW9 A;  5CGM A;  4HEA A;  3AE7 A;  1CUN A;  2I6H A;  3WAK A;  3LG7 A;  1XDO A;  5JR9 C;  4DV5 T;  3ZLI A;  4DND A;  2UXN B;  2LSJ A;  3I0O A;  2FJB A;  3CX7 B;  3D0T A;  4YSZ A;  1UK5 A;  5JDM A;  3AEG A;  2JQQ A;  2PFV A;  2LT3 A;  4JI5 T;  5HYA A;  2YK0 A;  1T7S A;  3J9X 1;  1HF8 A;  2B76 A;  4X62 T;  4IST A;  2LRK A;  3V5U A;  2CLY C;  2V26 A;  4L0R A;  4H63 V;  1UX5 A;  5AQV B;  2W62 A;  5AQL B;  4NXN T;  2YU1 A;  3AE3 A;  2VL0 A;  2JQH A;  2WM9 A;  5CFB A;  4PFO A;  2UUA T;  4Z8X A;  1YD8 G;  3FBL A;  3N9L A;  4PFP A;  5LCY A;  2G0U A;  2QGS A;  2RA1 A;  2XQ4 A;  1HX1 B;  3AVS A;  3E08 A;  4U33 A;  5LG4 A;  2BG9 E;  4DBR A;  2HPJ A;  3NRX A;  1MNE A;  2KZ7 B;  2WSS V;  3EUH A;  3C4Z A;  5GON E;  2WBL A;  3AE8 A;  1N32 T;  4TZ4 C;  2J1D G;  3Q5X A;  5JRC A;  3LDQ B;  3O1H A;  2WZI A;  3NZQ A;  4BJN A;  5L4H A;  4UVC B;  2JQ9 A;  1HG5 A;  2RP4 A;  3N9M A;  4KUM B;  5L3D B;  4ZS3 A;  1FMV A;  4UEM A;  4UIG A;  1YKE B;  2D9D A;  4YHJ A;  1W0B A;  5EK3 A;  3RC3 A;  4CN6 A;  1O3X A;  1WR6 A;  5HXH A;  5AQT B;  1Z0P A;  4KI0 F;  2XQ7 A;  2KXP B;  2X9Y A;  4ZI7 E;  4IE5 A;  1MND A;  3TLS A;  5LNK A;  4AKI A;  3RIU C;  4DR3 T;  2LKG A;  3WI3 A;  1S35 A;  3UQ7 A;  4DID B;  2VUR A;  3MZK B;  4KHZ F;  5EZY E;  5LHI B;  3EAB A;  4YT0 A;  5AQR B;  3AEE A;  3Q9D A;  5AQF B;  4X65 T;  3KFW X;  3A5X A;  1UUR A;  4WZX A;  1KK7 A;  4LF7 T;  3HKC E;  2E9X C;  4HTE A;  3A7M A;  4UEL A;  5FKY A;  1NEK A;  2DLR A;  3C4X A;  2JIW A;  2H88 A;  1T8B A;  3I1A A;  3RHW A;  1JNR A;  2XAF B;  3RQU A;  1ZHC A;  4B3S T;  1U4Q A;  2I59 A;  4HFV A;  5EK2 A;  5F5W A;  2XJ7 A;  4HE8 A;  1XZY A;  3ESL A;  1I6Z A;  3VR9 A;  4B3T T;  4ISS A;  4YFS A;  5KMG P;  4JI4 T;  3GWH A;  2XY8 B;  2CWO A;  3FBZ A;  5J1G A;  1UX4 A;  2I0M A;  2J4G A;  4P1N A;  1WCR A;  2DWG A;  2IUB A;  2ZM2 A;  5AQQ B;  2VKO A;  2MTQ A;  2IML A;  2VK9 A;  1OED B;  2A3D A;  2VKH A;  1WRD A;  4JEH B;  4ASK A;  2IHR 1;  3P8C D;  5LG3 A;  3ETV A;  2VQE T;  1IBM T;  3Q5D A;  1WLX A;  2LJL A;  4IIJ E;  3W15 B;  1HTJ F;  4IHJ E;  4WNK A;  3FXE B;  2WCA A;  3ZEF B;  2DWK A;  2WAU A;  3F31 A;  4HN9 A;  3VRB A;  3T1H T;  2Q9Q A;  4ILC A;  2A72 A;  2XQY A;  4JI3 T;  2M67 A;  2IW5 B;  4AKH A;  2V6Y A;  3LK3 B;  3PDY A;  4KX6 A;  1IZN B;  2MBG A;  2E9X B;  4UVA B;  3UU4 A;  2PJQ A;  4TNV A;  4IT4 A;  2WY2 A;  2V5C A;  4GOU A;  2X68 A;  3S4U A;  3MXZ A;  4EAH A;  4EV6 A;  4PK6 A;  5JDG A;  5LGT B;  2XQ8 A;  3RX6 A;  4HWH A;  3KIN B;  3EVY A;  5HEG A;  4HGA A;  2LKH A;  1YXR A;  4WW0 A;  3ZJ2 A;  3ANW B;  3JCF A;  4YXD A;  4LF6 T;  4XBF B;  1HCI A;  4HFI A;  3UQ4 A;  4LF9 T;  2E9X D;  2CBI A;  1GQE A;  1YQ4 A;  2KND A;  2L8K A;  2VB6 A;  2D0T A;  3MK7 C;  2C5I T;  2ES0 A;  5AQU B;  4DR2 T;  1XWM A;  3CIR A;  3LK2 B;  3F57 A;  3ZMU B;  4OYK A;  4TV9 E;  3AE6 A;  5JRE A;  2N9D A;  1KFY A;  1QUU A;  2H7O A;  2LM2 A;  4YLH A;  3VRA A;  3ZYL A;  2BS4 A;  3BQK A;  1SA0 E;  2W67 A;  3DJB A;  5AQN B;  3FZF B;  1XNR T;  2VVN A;  5FNV E;  3RF1 A;  4EGW A;  5ABG A;  4MAL A;  3KVA A;  5ABE A;  3JAD A;  1ZOY A;  4TV8 E;  4LFA T;  4G2A A;  4LML A;  4UV9 B;  4AIU A;  5JDQ A;  4DUY T;  3QC9 A;  3VKH A;  3TLU A;  2FJE A;  3CX8 B;  2XM1 A;  2K48 A;  3PUQ A;  5AQH B;  5JRC B;  2HH7 A;  4EB6 E;  4NXM T;  3B13 A;  1YQ3 A;  5AQP B;  4DV1 T;  2WB5 A;  4JEU B;  3ETU A;  1Y64 B;  4MFR A;  2UXX B;  3PUR A;  3AE5 A;  5JTG A;  5C3J A;  3FZM B;  2XQA A;  4O8S A;  2SPC A;  5C2T A;  4O4H E;  5LHH B;  3EAM A;  1XMQ T;  4JUY A;  1SE7 A;  3N9P A;  2LM9 A;  3FZH B;  1W09 A;  4PJM A;  1OED E;  5HEU A;  3ZMS B;  1NWM X;  4HWI B;  3HKD E;  2WWV A;  3TKL B;  5ABF B;  5LJM A;  2LRL A;  2LHR A;  5LMU T;  3PE0 A;  3DTO A;  4PW8 A;  3N9O A;  5DAB A;  2Q9Q C;  3L8R A;  4B3M T;  3E0Z A;  1MIV A;  3RYH E;  4AQY T;  2C5K T;  3OBV E;  2A9U A;  2NP9 A;  2BDE A;  2W0G A;  1LVF A;  2WDR A;  1LVK A;  3NKZ A;  3P4Q A;  4U72 A;  2D0U A;  3L09 A;  3VHL A;  4KBM B;  3LJC A;  3ZT5 A;  2UUB T;  3AAI A;  3ZPO A;  2JPF A;  2EHO A;  1KF6 A;  2LEH A;  2IC6 A;  4XAX B;  5H6R B;  1M62 A;  4ZXL A;  3QOF A;  3V5S A;  3ZMZ B;  3WAJ A;  3VKG A;  5FMN A;  4X1Y E;  3P50 A;  2FJD A;  2W66 A;  3EI0 A;  3P7I A;  2JQK A;  4O2B E;  2M6B A;  4YTP A;  4WBO A;  1LRZ A;  5ABF A;  5JDN A;  5CA0 E;  2E2A A;  4X5T A;  3ONJ A;  4LF8 T;  3RYC E;  4ZEY A;  2BVM A;  3UUX B;  3C98 B;  4H9S E;  3LBX A;  5EK4 A;  3PUY F;  3PUZ F;  4K0U A;  4ZZB A;  4GKJ T;  3UUM A;  4IE4 A;  2WZH A;  2CCQ A;  5F8P A;  4EXT A;  1IJ6 A;  3P4S A;  4E7S A;  2EHO D;  3N2O A;  4AQG A;  5FXX A;  1MMA A;  3L39 A;  4PAG A;  3SS1 A;  2FBW A;  3ZYM A;  4EOZ B;  2JRK A;  2W63 A;  2CXL A;  1D0X A;  4KHP T;  2W61 A;  3QB5 K;  3RRC A;  4HWD A;  4EED A;  3ZC1 A;  2XSA A;  3B57 A;  5L47 A;  2XQ3 A;  2CA5 A;  2Y8D A;  3HI2 A;  4H9N C;  4AIS A;  4B3R T;  4CXX A;  5HEO A;  2EHO B;  4CQI A;  1JNZ A;  2KLQ A;  1QSD A;  3G06 A;  3EDU A;  4QH4 A;  3CWZ B;  2LSI A;  3LK4 2;  1E7P A;  3ZCI A;  2UXC T;  5LXT E;  3PU8 A;  2X0Y A;  4UVB B;  2GK9 A;  3AE2 A;  2CEA A;  3AXJ A;  3JC6 D;  3K8P C;  4HFH A;  3JAE A;  3MA9 A;  1VOM A;  4JBW F;  2QYW A;  5LYJ E;  4OX9 T;  4DV2 T;  5LJN A;  4DV7 T;  3RYF E;  2L9Q A;  5FY1 A;  1XNQ T;  5JR9 B;  3UU6 A;  3FZK B;  1I94 T;  3L3P A;  3N9N A;  2BBJ A;  3AE9 A;  2XAQ B;  3CPZ A;  5HXR A;  4COF A;  2X9H A;  1Z8U A;  4L9I A;  2MPK A;  2XAS B;  3O4X E;  1KEY A;  1J5W A;  5KDM C;  2NWB A;  3AEF A;  4QH1 A;  4Z91 A;  4AI6 A;  3AE1 A;  2UU9 T;  1D1A A;  1UUS A;  3PUS A;  5BMV E;  2X66 A;  4I50 E;  2XUE A;  3RI5 A;  5JDL A;  3J7Y q;  3AE4 A;  3QUJ A;  3SWH A;  3NRY A;  4F6R C;  4A97 A;  4C91 A;  4YHH T;  2IIU A;  2X0L B;  4CI2 B;  4FJO A;  2YEV C;  1YW0 A;  1VCT A;  3RKO A;  4AQF A;  1MMG A;  3AVR A;  3B5M A;  5JR9 A;  4GK5 E;  2BKP A;  2WDQ A;  3UT5 E;  5FXZ A;  3ZJ1 A;  3LFM A;  4LMJ A;  4TWF A;  3ZN0 B;  1WR0 A;  4IDP A;  1WFD A;  4A56 A;  4IDQ A;  5AFU L;  4V1A v;  4U2Y A;  4ZI3 C;  1N36 T;  4CXY A;  4CI1 B;  4QWN B;  2R6G F;  2KWH A;  2CPT A;  3OJA A;  2XQ5 A;  4QX7 B;  4ZI2 D;  3JC6 C;  3IF8 B;  2WS3 A;  3X1D A;  5FYM A;  1BR2 A;  1G8X A;  1D1B A;  3IBP A;  4YJ3 E;  5E0O A;  4YSX A;  5LP6 E;  4X64 T;  2BG9 C;  3NBX X;  5LGU B;  4IL9 A;  4EEB A;  4CZZ B;  3OYX A;  3H3A A;  4ZI3 D;  2LOS A;  5DJQ C;  3BQI A;  3O1I A;  2DI4 A;  2JMK A;  2OA5 A;  3HR0 A;  3DP7 A;  3KBU A;  4I4T E;  4PNI A;  2FUP A;  1KNP A;  2YKS A;  1X9B A;  3N2G E;  2XM2 A;  2MYS A;  4O2A E;  2VAS A;  5DQV A;  2BS2 A;  3QNU A;  2Y6X A;  5J2U E;  5J0Z A;  4IDN A;  3ZN1 B;  2V7I A;  2Y48 B;  3ZYK A;  4DR7 T;  3O9X A;  4JI1 T;  3HKE E;  5LOV E;  4NIQ A;  4PJL A;  3OYZ A;  4CI3 B;  4DMW A;  2OLT A;  4EYU A;  3KVB A;  5FXV A;  2CMR A;  5LHG B;  2X9W A;  4JV5 T;  4MLK A;  5FVK A;  1E2A A;  5HXC A;  4HWC A;  3BK9 A;  4H9Q C;  5AQO B;  5IHY A;  2IAK A;  2IC9 A;  2V7K A;  2WU2 A;  4AKR B;  4CXW A;  4DO0 A;  2NR4 A;  2WDV A;  2WMO A;  4YSY A;  1U5P A;  4KP3 C;  1M7K A;  3CKD A;  5AQK B;  2K5B B;  2CWY A;  5JVD E;  3HA4 A;  2V8S V;  4GYS A;  1W0A A;  4DVD A;  5ABH A;  4OFZ A;  5ADX L;  2ZM6 T;  2KMF A;  1OWA A;  3ZMV B;  1KNR A;  4DV4 T;  2YDS A;  4KMC A;  2JJ9 A;  1G73 A;  3AEA A;  3IHR A;  4H9P C;  1J1J A;  3EDV A;  4U2Z A;  1KNZ A;  2UXB T;  2BVL A;  5IWA T;  3RH3 A;  2HHH T;  5C8Y E;  5J2T E;  4FI5 A;  4IDO A;  1W9R A;  3ZCJ A;  5LA6 E;  5BR8 T;  2NW7 A;  2A2F X;  2XTL A;  4ZOL E;  4NPP A;  4DR4 T;  2NOX A;  4IE0 A;  3PU3 A;  3PUA A;  4U7I A;  4C90 A;  3GMI A;  3ZT7 A;  3C51 A;  3GN5 B;  3K1S A;  1S94 A;  3LSV A;  5CB4 E;  5JDF A;  1FMW A;  4IRE A;  2W00 A;  4QH5 A;  4UF0 A;  3ABV A;  2X67 A;  4OHF A;  3RKG A;  3SFE A;  3AEB A;  4ADZ A;  4EYY R;  4ILU A;  4LFC T;  3Q5E A;  3NVO A;  3I9Y A;  5A1L A;  1UGO A;  2DCF A;  1IJ5 A;  2XQ6 A;  3O1J A;  3OVU A;  3FB2 A;  4QXC B;  2XAG B;  5KX5 E;  2LSY A;  1E1H B; 
#chains in the Genus database with same CATH homology
 3RRW A;  2NTY A;  2H7V C;  2EHO C;  4JLE A;  3CML A;  5FY7 A;  1FIO A;  3VU7 H;  5HWY A;  2YIN A;  2LOP A;  2K9A A;  2P9B A;  3MJX A;  1US7 B;  4MHC A;  3GA8 A;  5LBQ B;  3M65 A;  1BR4 A;  4QXH B;  2DNX A;  4UF0 B;  1FEW A;  1B7T A;  2Q9Q B;  3K3O A;  3GN5 A;  3KV5 A;  4B6X A;  4AXP A;  2LE8 A;  3KBT A;  3N5L A;  1NAF A;  2CXF A;  2LHN A;  2QA7 A;  4IGU A;  2WMN A;  4CI2 B;  3AB3 B;  4IE7 A;  1HG2 A;  5HXS A;  5IYZ E;  2X9X A;  2VKJ A;  4X20 E;  2Q9Q D;  2V7J A;  1D0Z A;  1ZEE A;  2CXD A;  2H3R A;  2ACX A;  3ONX A;  3C50 A;  4H9R C;  3AA1 B;  3BQL A;  2Z6E A;  5TAO A;  3CQG B;  5LBM A;  1D1C A;  2PG8 A;  5HAX A;  4AKG A;  2B1E A;  4TUY E;  3E22 E;  3K3Q C;  3ANW A;  4G63 A;  3KV9 A;  4UV8 B;  1BR0 A;  3N9Q A;  4PJJ A;  4QXB B;  3R6N A;  3UTK A;  2CM0 A;  4P0B A;  4UXN B;  4AKL A;  4L5G A;  3U3I A;  4YJ2 E;  2D5U A;  3C4W A;  3AA6 B;  4NUV A;  1LKX A;  2JMH A;  3HKB E;  3LBX B;  2LSK A;  2XAJ B;  3C64 A;  2NW8 A;  1YKH B;  1MIY A;  2XHE B;  4H9O C;  3NZP A;  4ZS2 A;  4GYR A;  5FP3 A;  3PTR B;  4I43 B;  3UFE A;  3FHN A;  2HPL A;  2KWI B;  5L3E B;  4IE6 A;  1AJ3 A;  3H37 A;  4J2C A;  3I9W A;  2ZM8 A;  4H63 H;  5H6Q B;  2PBI A;  3RC8 A;  4N78 D;  4AQF C;  4ZI2 C;  3U78 A;  3F2E A;  1D0Y A;  4OK0 A;  4M1P A;  3ZMT B;  4MBQ A;  4P09 A;  4BA9 A;  2VKD A;  1ZKE A;  4GIW A;  4EZH A;  4EZ4 A;  5FY0 A;  3CQX C;  2V1D B;  2YU2 A;  2X51 A;  4EIW A;  1EZ3 A;  3AAE B;  3I0Q A;  2ODV A;  2CE7 A;  5CA1 E;  4ANJ A;  4BJM A;  1MMD A;  4TX5 A;  4U74 A;  1H7C A;  3N2K E;  5HXE A;  5L2L A;  2DHR A;  3HL6 A;  2VWA A;  2C0S A;  2VL8 A;  3CX6 B;  4I55 E;  2ZMA A;  3SRZ A;  4PJN A;  2E9X A;  2E8I A;  3KV6 A;  4DBQ A;  3OKQ A;  2LSG A;  5DQW A;  5L3F B;  3UUN A;  4O4J E;  5L3C B;  2N1G A;  3Q5W A;  2WWU A;  4XZC A;  1T98 A;  3Q2M A;  1BR1 A;  4PK4 A;  3AA0 B;  4NUU A;  4QX8 B;  3SOL A;  3KV4 A;  3MAC A;  3MKD A;  1MIW A;  3T8O A;  4E7Z A;  5HWX A;  5JDH A;  5L3B B;  5M4Y A;  3IEE A;  3VKG A;  4O4I E;  2ZM0 A;  5JQG E;  5F3J A;  4BAY B;  5FXW A;  2MOZ A;  4ZHQ E;  1IAP A;  1VRB A;  5LGN B;  1UCU A;  1ZV4 X;  3RPU A;  2V7M A;  2N2N A;  1OXZ A;  5L3G B;  2D2S A;  3KDS E;  3CVR A;  4HKA A;  3R84 B;  4QHO A;  3FXD B;  1WYC A;  2C5J A;  2ZLY A;  3ZC0 A;  3PUG A;  4O4L E;  2XAH B;  2CLY B;  3AA7 B;  3QK6 A;  4PK5 A;  4OYJ A;  4X1I E;  3UUL A;  3CQC B;  2ODU A;  3K3N A;  5ETW A;  2BZB A;  4IDZ A;  1HS7 A;  4QKN A;  2NTX A;  2KIN B;  5J2T E;  1MMN A;  3RYI E;  4X1K E;  2V7L A;  1WYB A;  4GK0 E;  1HFA A;  1HX8 A;  1V9D A;  1X79 A;  4ERR A;  2L3L A;  1SHZ C;  4TN7 B;  2K24 A;  3AAA B;  4P0A A;  2KT9 A;  2NW9 A;  4HEA A;  1CUN A;  3WAK A;  3LG7 A;  5JR9 C;  3ZLI A;  4DND A;  2UXN B;  2LSJ A;  3I0O A;  3CX7 B;  3D0T A;  5JDM A;  2JQQ A;  2PFV A;  2LT3 A;  5HYA A;  2YK0 A;  3J9X 1;  1HF8 A;  4IST A;  3V5U A;  2CLY C;  2V26 A;  4L0R A;  4H63 V;  1UX5 A;  2W62 A;  2YU1 A;  2WM9 A;  4PFO A;  4Z8X A;  1YD8 G;  3FBL A;  3N9L A;  4PFP A;  5LCY A;  2G0U A;  2QGS A;  2RA1 A;  3E08 A;  5LG4 A;  3AVS A;  4DBR A;  2HPJ A;  3NRX A;  1MNE A;  2KZ7 B;  2WSS V;  3EUH A;  3C4Z A;  5GON E;  2WBL A;  4TZ4 C;  2J1D G;  3Q5X A;  5JRC A;  3O1H A;  3NZQ A;  4BJN A;  4UVC B;  5L3D B;  1HG5 A;  2RP4 A;  3N9M A;  4KUM B;  4ZS3 A;  1FMV A;  4UEM A;  4UIG A;  1YKE B;  4YHJ A;  5EK3 A;  3RC3 A;  1O3X A;  1WR6 A;  5HXH A;  1Z0P A;  2KXP B;  2X9Y A;  4ZI7 E;  4IE5 A;  1MND A;  5LNK A;  4AKI A;  3WI3 A;  1S35 A;  3MZK B;  5EZY E;  5LHI B;  3Q9D A;  3KFW X;  3A5X A;  1KK7 A;  3HKC E;  2E9X C;  4HTE A;  4UEL A;  2DLR A;  3C4X A;  3I1A A;  2XAF B;  1ZHC A;  1U4Q A;  2I59 A;  4HFV A;  5EK2 A;  4HE8 A;  3ESL A;  4ISS A;  4YFS A;  5KMG P;  3GWH A;  2CWO A;  3FBZ A;  5J1G A;  1UX4 A;  2DWG A;  2ZM2 A;  2VKO A;  2MTQ A;  4JEH B;  2VK9 A;  2A3D A;  2VKH A;  1WRD A;  4ASK A;  3P8C D;  3ETV A;  1WLX A;  2LJL A;  4IIJ E;  3W15 B;  1HTJ F;  4IHJ E;  4WNK A;  3FXE B;  3ZEF B;  2DWK A;  2WAU A;  3F31 A;  4HN9 A;  2Q9Q A;  2A72 A;  2XQY A;  2M67 A;  2IW5 B;  4AKH A;  3LK3 B;  3PDY A;  2MBG A;  1IZN B;  2E9X B;  4UVA B;  2PJQ A;  4GOU A;  2X68 A;  3S4U A;  3MXZ A;  4EAH A;  4PK6 A;  5JDG A;  5LGT B;  3RX6 A;  3ZJ2 A;  3KIN B;  3EVY A;  4HGA A;  4WW0 A;  3ANW B;  4XBF B;  1HCI A;  2E9X D;  2KND A;  2L8K A;  2VB6 A;  2D0T A;  3MK7 C;  2C5I T;  2ES0 A;  3LK2 B;  3F57 A;  3ZMU B;  4OYK A;  4TV9 E;  5JRE A;  1QUU A;  2N9D A;  2H7O A;  4YLH A;  3ZYL A;  3BQK A;  1SA0 E;  3DJB A;  5FNV E;  4MAL A;  3KVA A;  4TV8 E;  4G2A A;  4UV9 B;  5JDQ A;  3QC9 A;  3VKH A;  3CX8 B;  2K48 A;  3PUQ A;  5JRC B;  2HH7 A;  4EB6 E;  3B13 A;  4JEU B;  3ETU A;  1Y64 B;  4MFR A;  2UXX B;  3PUR A;  4O8S A;  2SPC A;  4O4H E;  5LHH B;  4JUY A;  3N9P A;  2LM9 A;  4PJM A;  3ZMS B;  1NWM X;  3TKL B;  3HKD E;  5LJM A;  2LHR A;  3PE0 A;  3DTO A;  4PW8 A;  3N9O A;  5DAB A;  2Q9Q C;  3E0Z A;  1MIV A;  3RYH E;  2C5K T;  3OBV E;  2NP9 A;  2W0G A;  2BDE A;  4U72 A;  1LVF A;  3VHL A;  1LVK A;  4DMV A;  2D0U A;  3L09 A;  4KBM B;  3LJC A;  3AAI A;  3ZPO A;  2JPF A;  2EHO A;  2IC6 A;  2LEH A;  4XAX B;  5H6R B;  3ZMZ B;  3V5S A;  3WAJ A;  5FMN A;  4X1Y E;  3P7I A;  4O2B E;  4WBO A;  1LRZ A;  5JDN A;  5CA0 E;  3RYC E;  2BVM A;  3UUX B;  3C98 B;  4H9S E;  3LBX A;  5EK4 A;  4K0U A;  3UUM A;  4IE4 A;  2CCQ A;  5F8P A;  4EXT A;  1IJ6 A;  4E7S A;  2EHO D;  3N2O A;  4AQG A;  5FXX A;  1MMA A;  4PAG A;  3SS1 A;  4EOZ B;  3ZYM A;  2JRK A;  2W63 A;  2CXL A;  1D0X A;  2W61 A;  3RRC A;  3ZC1 A;  3B57 A;  2CA5 A;  2Y8D A;  3HI2 A;  4H9N C;  4CXX A;  2EHO B;  4CQI A;  2KLQ A;  1QSD A;  3EDU A;  3CWZ B;  2LSI A;  3LK4 2;  3ZCI A;  5LXT E;  3PU8 A;  4UVB B;  2GK9 A;  2CEA A;  3JC6 D;  3K8P C;  3MA9 A;  1VOM A;  5LYJ E;  5LJN A;  3RYF E;  2L9Q A;  5FY1 A;  5JR9 B;  3L3P A;  3N9N A;  2XAQ B;  3CPZ A;  5HXR A;  2X9H A;  4L9I A;  2XAS B;  3O4X E;  5KDM C;  2NWB A;  4AI6 A;  1D1A A;  3PUS A;  5BMV E;  2X66 A;  4I50 E;  2XUE A;  5JDL A;  3J7Y q;  3QUJ A;  3SWH A;  3NRY A;  4F6R C;  4C91 A;  2X0L B;  4FJO A;  2YEV C;  1YW0 A;  3RKO A;  4AQF A;  1MMG A;  3AVR A;  5JR9 A;  4GK5 E;  3UT5 E;  5FXZ A;  3ZJ1 A;  3LFM A;  3ZN0 B;  4A56 A;  5AFU L;  4V1A v;  4ZI3 C;  4CXY A;  4CI1 B;  4QWN B;  2KWH A;  3OJA A;  4QX7 B;  4ZI2 D;  3JC6 C;  3IF8 B;  5FYM A;  1BR2 A;  1G8X A;  1D1B A;  3IBP A;  4YJ3 E;  5E0O A;  5LP6 E;  5LGU B;  3NBX X;  4CZZ B;  3OYX A;  3H3A A;  4ZI3 D;  2LOS A;  5DJQ C;  3BQI A;  3O1I A;  2DI4 A;  2JMK A;  2OA5 A;  3HR0 A;  3DP7 A;  3KBU A;  4I4T E;  4PNI A;  4O2A E;  3N2G E;  5DQV A;  2MYS A;  2VAS A;  5J2U E;  2Y6X A;  3ZN1 B;  2V7I A;  2Y48 B;  3ZYK A;  3O9X A;  3HKE E;  5LOV E;  4PJL A;  3OYZ A;  4CI3 B;  4DMW A;  4EYU A;  3KVB A;  5FXV A;  2CMR A;  5LHG B;  2X9W A;  4MLK A;  5HXC A;  3BK9 A;  4H9Q C;  5IHY A;  2IAK A;  2IC9 A;  2V7K A;  4AKR B;  4CXW A;  4DO0 A;  2WMO A;  1U5P A;  4KP3 C;  3CKD A;  5JVD E;  2K5B B;  2CWY A;  3HA4 A;  4GYS A;  4DVD A;  5ADX L;  4OFZ A;  2KMF A;  1OWA A;  3ZMV B;  4KMC A;  2JJ9 A;  1G73 A;  4H9P C;  3IHR A;  3EDV A;  1KNZ A;  2BVL A;  3RH3 A;  5C8Y E;  4FI5 A;  3ZCJ A;  5LA6 E;  2NW7 A;  2A2F X;  2XTL A;  4ZOL E;  2NOX A;  4IE0 A;  3PU3 A;  3PUA A;  4C90 A;  5JH7 E;  3GMI A;  3C51 A;  3GN5 B;  5CB4 E;  1S94 A;  5JDF A;  1FMW A;  4WBN E;  2W00 A;  4UF0 A;  4OHF A;  2X67 A;  4ADZ A;  4EYY R;  4ILU A;  3I9Y A;  5A1L A;  3O1J A;  2DCF A;  1IJ5 A;  3FB2 A;  4QXC B;  2XAG B;  5KX5 E;  2LSY A;  1E1H B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...