5H6QB

Crystal structure of lsd1-corest in complex with peptide 11
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
131
structure length
131
Chain Sequence
b'KPPKGMFLSQEDVEAVSANATAATTVLRQLDMELVSVKRQIQNIKQTNSALKEKLDGGIEPYRLPEVIQKCNARWTTEEQLLAVQAIRKYGRDFQAISDVIGNKSVVQVKNFFVNYRRRFNIDEVLQEWEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Lysine-specific histone demethylase 1A
publication title Development and crystallographic evaluation of histone H3 peptide with N-terminal serine substitution as a potent inhibitor of lysine-specific demethylase 1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/transcription/inhibitor
total genus 41
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2016-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00249 Myb_DNA-binding Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1880 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5h6qB00
5LGUB 5L3GB 5LGNB 4XBFB 3ZMZB 5L3BB 5H6QB 2UXNB 4CZZB 3ZMUB 4UV9B 3ZMVB 2Y48B 2XAHB 4UVAB 5H6RB 3ZMTB 3ZMSB 2XASB 5LHHB 5L3FB 4BAYB 2UXXB 2V1DB 2XAQB 4UV8B 3ZN0B 4UXNB 3ZN1B 4KUMB 2X0LB 5L3EB 2XAGB 5LGTB 2XAFB 2XAJB 4UVCB 5L3CB 5LBQB 4UVBB 2IW5B 5L3DB 5LHGB 5LHIB
chains in the Genus database with same CATH superfamily
4X1YE 4ISTA 3Q5DA 3PUXF 4LMJA 1SE7A 1SA0E 1J5WA 3SOLA 4COFA 2BG9E 4JI5T 3AE1A 5LMNT 2XQAA 3C4ZA 3PUZF 5HWXA 2JQQA 4TWFA 1OXZA 3MA9A 2UXNB 4DR3T 3EDUA 4XZCA 2XM1A 3LJCA 3UQ7A 2XQ8A 5ABGA 5JR9B 4GKJT 2YKSA 2KWIB 2UU9T 4JYAT 2W0GA 1GQEA 3PUQA 3AXJA 3LFMA 4EGWA 1N33T 5FVKA 1SHZC 4LFAT 4YSZA 5TAOA 1Z0PA 3PUAA 2XQ9A 2IIUA 4NUVA 4O2BE 1WLXA 4LMLA 5AQPB 3ANWB 4JI2T 2L9QA 5AQJB 4QXCB 3P4WA 1XNQT 4UF0B 3ZT5A 2BKNA 3AA1B 3PE0A 4WBOA 2VURA 5EK3A 2UXXB 1U4QA 3O9XA 2C0SA 4ILCA 2JPFA 4HEAA 3OJAA 3N2KE 2I6HA 3CWZB 5LA6E 2BKPA 3N9OA 3PDYA 2V7MA 3FB2A 4LF7T 4UXNB 3PUGA 5LP6E 3L8RA 5DQVA 5GONE 4BJNA 3Q9DA 3L39A 1LVFA 5LG3A 2QRXA 5F5WA 3WI3A 1IBMT 4YJ3E 4A5XA 4IDNA 2XQ4A 2XQ7A 3EAMA 2LSIA 4UELA 3H3MA 2CHNA 4XAXB 3RQUA 5HXRA 2V1DB 2H7VC 2W63A 3AEGA 1LRZA 3RQWA 4OK0A 3G06A 4AQFC 3RC8A 1FMVA 2ZM8A 3ZT7A 4YSYA 4IE6A 5ETWA 4KX6A 4EYYR 1X9BA 4I55E 4JI1T 3E22E 3VR8A 2BBHA 4F8HA 5CFBA 3FBLA 1BR0A 3IEEA 2BDEA 5C8YE 4UIGA 4DVDA 4O4LE 2D9DA 3NVOA 3N2GE 5LMUT 3K8PC 2YDSA 4L0RA 4LF6T 2BS2A 2ODUA 3NZQA 3P4PA 1HNWT 2FJEA 4ZI3D 4G2AA 4AKIA 3FBZA 4IREA 2BG9B 1DU2A 3C4XA 4UV9B 4I4TE 4AQFA 3NRXA 3ZMTB 2HN2A 3E08A 4CQIA 2B76A 3BQLA 3C51A 5FP3A 4U2YA 4ILUA 2UXDT 4I0UA 3FXDB 4X65T 2WU5A 3RYHE 3CMLA 5C3JA 2X0YA 2XAHB 2N1GA 1ZOYA 4DO0A 4Q25A 2LSGA 1KK7A 3Q5XA 3PUYF 1HX1B 1J1JA 2ACXA 1T7SA 2M67A 3J7Yq 2V5CA 1MMGA 5L3BB 3P4QA 2OV9A 4QH1A 2D0TA 3ZPOA 3PUVF 5FYMA 4O4HE 2FJBA 2BS3A 1HF8A 5CJ5A 4DV6T 3OBVE 5AQMB 3AAIA 4ADZA 5ABFA 5HAXA 5KDMC 2WY2A 2XPKA 1XZYA 2W62A 1ZEEA 4NXNT 2CHOA 1E1HB 2XQ5A 1R8IA 3UU4A 2E5VA 2WU2A 2ZLYA 2M6IA 3M65A 4E7SA 3W15B 4KHZF 3JC6C 2JIWA 3IHRA 3KFWX 3TKLB 3ESLA 2WDVA 4TNWA 3RRCA 3T1YT 2LOPA 4UVCB 4ZZBA 2YU1A 4HFIA 3ZMUB 2X9WA 3ZMVB 1UURA 5HWYA 1WR0A 4IDZA 1HNZT 4QX7B 4MFRA 4DR7T 2WBLA 4IE0A 3VU7H 2YEVC 3N2OA 2A3DA 2W2UA 2OLTA 2LOSA 4QHOA 5AQGB 3RIUC 5JREA 1XMQT 4HFEA 1FIOA 1US7B 2V6YA 3CIRA 2RA1A 3N9LA 2A72A 2WQYA 2PG8A 4CI3B 3H3AA 4B3RT 5LXTE 2CE7A 5CGMA 3SFEA 1XMOT 3I9YA 5LB7B 5ABEA 4OFZA 4A98A 4CXWA 2KT9A 3PU3A 1S35A 5FXWA 3TLVA 3OYZA 5LBQB 3LBXB 2CLYC 3F57A 3RF1A 5LOVE 2RPAA 4ZI2C 3JADA 3LG7A 5IUXA 2F4VT 5DABA 4I50E 3R6NA 3RIUA 4DR1T 5EK2A 1HFAA 4TZ4C 2VASA 1T72A 5LHGB 3KV6A 2KINB 5JQGE 2J47A 3SWHA 3HKBE 2VKJA 3CX6B 2JQHA 3U3IA 3KDSE 3FHNA 3ZJ1A 2D5UA 4ZS2A 5IYZE 3AXJB 4WZXA 4DV0T 2CPTA 3IA3A 2VWAA 4HN9A 5M4YA 2X66A 4N78D 2KXPB 2LM2A 3C4WA 4AXPA 2XQYA 4DV7T 3UFEA 3AEBA 5H6RB 3ZSSA 5IHYA 4U72A 2V7KA 4C91A 4X64T 2NOXA 2J62A 3BK9A 1OWAA 2YINA 5A1LA 4U33A 3K3NA 1KFYA 5AQNB 2IMLA 5JDQA 3PV0F 5ADXL 4DV5T 4QX8B 4UR9A 4CI1B 4YJ2E 4KUMB 2LEHA 1O3XA 2JMHA 3GWHA 3MZKB 4GYRA 2AE9A 5L3DB 4DR6T 5J1GA 4IE5A 3TLUA 4G63A 4C90A 3B57A 4H9QC 3S4UA 2QGSA 3PUSA 4YHHT 1YKEB 5EK4A 2EHOA 1MMAA 4CN4A 3K3QC 3RKGA 2YN6A 2D2SA 1JNRA 2ACZA 5BR8T 3AA7B 4TV9E 2MYSA 4U3CA 1VCSA 4H9RC 4JBWF 4ISSA 3ZJ2A 3N5LA 2K3WA 3VRBA 3AAAB 4BJMA 2DNXA 4P0BA 4YFSA 3EHZA 5JRCB 1S94A 1W0AA 4PK4A 2VVSA 3AE2A 3OKQA 4GYSA 4OYKA 3GA8A 2K48A 2XHEB 1QUUA 2KNDA 3MKDA 2G0UA 1AJ3A 1CUNA 3KVAA 4B3TT 3NBXX 3RIFA 5L3EB 2LE8A 3ZYLA 2MBGA 3RKOA 3ZLIA 3D0TA 3NWIA 3AE3A 3KINB 3EDVA 3EVYA 4EZ4A 4I43B 5L4EA 2CM0A 4IGUA 1W0BA 3FZFB 3UUBA 1NWMX 1ZP0A 4HWCA 4AIUA 3B13A 4CI2B 4IE4A 5LBMA 4U7IA 2H88A 3A7MA 4JEUB 1IJ6A 2DCFA 2CBJA 1YW0A 3P8CD 2XZEA 3ETVA 4KMCA 3ZN0B 1HG5A 2E9XC 2IC6A 3LK42 4JI8T 2X9HA 4DR2T 4LF4T 2K24A 2SPCA 1HNXT 2H7OA 3FZHB 1FMWA 2K9AA 2A2FX 3ZEFB 4H63V 5ABFB 3KV9A 4CN1A 3ZT6A 4X5TA 1QSDA 4QXBB 2N2NA 2CWOA 4YTNA 4ZZCA 1KNPA 4HTEA 3TLWA 4U7YA 3GN5B 2PJQA 2BVMA 5BMVE 4YTPA 3RX6A 1U5PA 3IF8B 5DJQC 2JQKA 4YXDA 3QC9A 2W61A 2E9XA 2B1EA 4PW8A 1VCTA 4Z90A 2DI4A 3UU8A 3JCFA 3RYCE 4AQGA 4JEHB 4KI0F 3QOFA 5LG4A 5HCJA 2XQ3A 2VQFT 3RYFE 3QB5K 1D0YA 2WZHA 4AKRB 1W9RA 3MXZA 2XM2A 2W67A 4AISA 1YKHB 4MHCA 3CQCB 3AVSA 4QKNA 2L8KA 1JNZA 2OA5A 4HWFA 1J5ET 4KHPT 4NPPA 5C2TA 5FNVE 5AQIB 2XAJB 5L2LA 4QWNB 1BR2A 3HL6A 4ILBA 5FXXA 2LSJA 3N9PA 4ZI3C 3T8OA 1Z8UA 2V6YB 3UFGA 4UF0A 1N32T 2LM9A 4EIWA 4TV8E 2W00A 4P0AA 3P7IA 3AEDA 5FY1A 2N9DA 2WAUA 2IDOB 3UUMA 4TX5A 1E7PA 2LHNA 2K5BB 4WYVA 3UUXB 4JUYA 3ONJA 1MMNA 5L4HA 3NKZA 3VKGA 5DQWA 2CEAA 1OEDC 2WS3A 3EABA 4NXMT 2KZ7B 4P09A 4HFBA 3LK2B 2V5DA 1T8BA 5FVLA 2WM9A 3MACA 4PFOA 4P1NA 2I59A 3ZSTA 1BR1A 2VL0A 3BQIA 3I0OA 4PJMA 3RI5A 3TLTA 4H9PC 4HWIB 3RGLA 5AQLB 3ZN1B 2YDQA 4HKAA 3HKCE 3I9WA 3AEAA 2CXLA 2ES0A 2RP4A 1WFDA 3ZYKA 4ZI7E 5HYAA 1I94T 3AEFA 4JI6T 1OEDA 5FY7A 2X68A 2CXFA 2CLYB 4HFHA 2CCQA 4GOUA 2IW5B 1NAFA 3AA6B 4OX9T 5JDMA 3CQGB 1XDPA 3O4XE 1HS7A 4KP3C 2CA5A 3AE8A 4LF5T 2NP9A 2KWHA 4CZZB 4IHJE 2DWKA 3HKDE 3O1IA 2UXCT 3LSVA 2JRKA 2Z6EA 2BKOA 2VKOA 2YU2A 3J9X1 4ZXLA 2LKHA 4IE7A 2C5IT 2BZBA 1T98A 3ZCIA 2EHOB 2ZMAA 1H7CA 3UUNA 3NZPA 3FZKB 3ABVA 4EXTA 2FJDA 3Q2MA 2LJLA 4EEBA 3AE9A 1YQ4A 3PUWF 5FL1A 5ABHA 3DP7A 3ZC0A 3OYXA 3QB5A 1YXRA 4DUZT 1WR6A 2YOEA 4AKGA 2WMOA 1M7KA 3L3PA 2W4XA 3FXEB 4IDPA 2C5KT 3P4SA 4KBMB 4EAHA 1N34T 3KV4A 1XWMA 2WWVA 4EOZB 2X9XA 1KNZA 2NW8A 1LVKA 2DL1A 5AQUB 3VR9A 3AA0B 2IC9A 4ZOLE 2KMFA 3N9NA 1HG2A 4U31A 4PNIA 2EHOD 3FZMB 3QUJA 5FXVA 3R84B 1ZHCA 4UVAB 5L3FB 2Q9QC 2KLQA 1UX5A 2WDRA 2H3RA 5HCMA 1NENA 5AQQB 2LRKA 3AE6A 4GK5E 2X51A 2X67A 2WSSV 5JH7E 2Y6XA 1MIVA 4DBRA 4TUYE 4Z91A 4ANJA 5JTGA 2NR4A 2VL8A 5IWAT 2QVAA 4JI3T 3PJAA 3OPCA 1MIYA 2HH7A 2E2AA 1G73A 5LHHB 2BBJA 4A97A 2HPJA 2Q9QA 4TWDA 1OEDE 3H37A 4BA9A 2BVLA 2JMKA 4M1PA 4LF8T 3UU6A 2XQ6A 3RHWA 4UV8B 1N36T 4LFBT 4ERRA 1Y64B 5HEJA 5LGTB 2W66A 1M62A 5CB4E 4WBNE 2DWGA 2QA7A 4H9SE 1HX8A 1WYCA 4PFPA 3ETUA 4TN7B 1L0VA 3LBXA 4FI5A 4E7ZA 5JDNA 1UX4A 5FKYA 4MLKA 2UUCT 2X9YA 2E9XB 2VKHA 3A5XA 2WB5A 5J2TE 2NW7A 3OTOT 3RC3A 3EUHA 1HTJF 2JQ9A 2WCAA 3ZCJA 4DR5T 1WRDA 3CX8B 2VVNA 2H89A 2L3LA 3Q5EA 2XAGB 3JAEA 3QK6A 4J2CA 3PU8A 2MPKA 1XNRT 1I6ZA 4H63H 5FY0A 4PJJA 4O8SA 4GKKT 5CA1E 4A56A 3CK6A 3UTKA 4OYJA 2IUBA 1X79A 4LF9T 3F2EA 3AE5A 4DV3T 2LRLA 2LHRA 1D1BA 3RH3A 2XTLA 3KV5A 2LLYA 4GIWA 2HHHT 2E9XD 2ODVA 3RYIE 3C64A 2VB6A 1D1AA 5HEOA 4HGAA 2MOZA 4O4JE 2WMNA 4JI4T 4CN6A 1E2AA 3ONLC 2CMRA 2FJAA 5LHIB 3OVUA 1QLBA 1LKXA 5FL0A 2PFVA 4PJLA 3Q5WA 4U74A 3FZLB 1UGOA 5JDFA 3P4RA 4O4IE 5JR9C 4QH4A 5HXHA 4YT0A 5HEUA 5JVDE 3A8YC 4L5GA 4EEDA 3ZKRA 5LGNB 5HXCA 2BS4A 4K0UA 5JDHA 4B6XA 3ZMSB 1D1CA 4ASKA 5HXEA 3CX7B 4X1IE 3F31A 2X0LB 3ONXA 5E0OA 1MMDA 3SS1A 3AECA 2P9BA 3PURA 4GK0E 2WWUA 4X20E 2HN1A 1OEDB 5FXZA 3P50A 5FMNA 1ZKEA 1KNRA 2KSRA 2MTQA 2YK0A 1VRBA 5LNKA 3LDQB 4DNDA 5JRCA 1MNEA 5JR9A 4UVBB 2XUEA 4ILAA 1Y01A 2FBWA 3I1AA 4JI0T 5AQRB 5J0ZA 2PBIA 4ZHQE 3HR0A 4IIJE 2WDQA 4HFVA 5AQKB 1D0XA 1IBKT 4QXHB 2MAWA 3ANWA 1FEWA 3BQKA 5AQFB 4YY3T 1WYBA 4YTMA 2ZM0A 3PTRB 2V7LA 4UEMA 3N9QA 5LJNA 1XDOA 2PTFA 5JDLA 2NW9A 2NTXA 3X1DA 2XSBA 2LSYA 4HFCA 5KX5E 5JDGA 3K1SA 3EI0A 3UU5A 1UCUA 2WZIA 5F8PA 2Y8DA 4FJOA 1UK5A 4OHFA 3AB3B 2CXDA 4V1Av 3CVRA 5KMGP 1HCIA 3V5SA 2J4GA 2NTYA 2IHR1 4EB6E 3WAKA 5AQHB 4F6RC 2VQET 4B3ST 3RLFF 3I0QA 2E8IA 3SRZA 1SUMB 4U2ZA 4EZHA 4WNKA 4AKHA 3UQ4A 3JC6D 1IZNB 1V9DA 4ZEYA 2A9UA 2CWYA 2R6GF 3AVRA 3T1HT 1KEYA 4EYUA 3DTOA 2BG9C 4ZS3A 4YHJA 2XASB 3ZYMA 3GN5A 4CXXA 4IDQA 2AXDS 1WCRA 1G8XA 3NRYA 5CA0E 2UXBT 2E5LT 2V26A 2HPLA 2XAQB 2CRBA 2V7JA 3KVBA 5HEHA 3VRAA 4LMKA 3DJBA 3CKDA 1IAPA 5L3GB 4DV1T 1ZV4X 4JV5T 5LYJE 4MBQA 4HE8A 3ZMZB 3N9MA 2V6XA 5AQVB 5L47A 2IAKA 4K0KT 2BG9A 2C5JA 2XJ7A 3B5MA 2X0HA 2XAFB 3KBTA 3VHLA 4WW0A 2DHRA 2I0MA 2CBIA 3HI2A 1B7TA 2V7IA 4DUYT 5H6QB 5HEGA 4QH5A 2Q9QB 4EV6A 3WAJA 3U78A 4JLEA 3ZC1A 2NWBA 4HWHA 4JI7T 4ZI2D 4IL9A 3HKEE 1MNDA 3C50A 4PAGA 1D0ZA 3AAEB 4X62T 4PK5A 5AFUL 3UT5E 3RPUA 4X66T 3M3ZB 4IT4A 2ZM6T 4DBQA 5AQTB 4H9NC 2LSKA 3MJXA 4DIDB 4AKLA 1NEKA 1YQ3A 1HR0T 1UUSA 1CHUA 5J2UE 2UUBT 3QNUA 3C98B 5LJMA 2WP9A 5LCYA 3AE7A 3UULA 3MK7C 1KF6A 1YD8G 5F3JA 3E0ZA 3JAFA 4MALA 2D0UA 4LFCT 3K3OA 4XBFB 2Q9QD 2XSAA 3SFDA 4YLHA 4TWHA 1IBLT 4HFDA 2VKDA 4X1KE 2LKGA 2ZM2A 5AQSB 3TLSA 3IBPA 2YDRA 2J1DG 3LK3B 4NUUA 4IDOA 1MIWA 5EZYE 1VOMA 4L9IA 3RIAA 3KBUA 4HWDA 3GMIA 4AI6A 3L09A 4B3MT 4AQYT 2EHOC 3PJAJ 4Z8XA 4DR4T 2JJ9A 4IL4A 3CPZA 4DMWA 3UU3A 3O1HA 3HA4A 5LGUB 2V8SV 2FUPA 3AEEA 4PJNA 1BR4A 2VK9A 4CXYA 2GK9A 5KXJA 2DLRA 2XY8B 4O2AE 2M6BA 4DV4T 1W09A 4YSXA 3CQXC 4DMVA 4PK6A 2QYWA 4DV2T 3RRWA 5AQOB 1EZ3A 2Y48B 3AE4A 4H9OC 4BAYB 3V5UA 4NIQA 1IJ5A 4TNVA 3VKHA 2UUAT 3O1JA 5HXSA 5L3CB 1FJGT 2LT3A
chains in the Genus database with same CATH topology
1BR1A 4X1YE 5LGNB 5HXCA 4ISTA 4ZI2C 3BQIA 3I0OA 4K0UA 3LG7A 5JDHA 4B6XA 3ZMSB 1D1CA 4PJMA 4ASKA 5DABA 5HXEA 1SA0E 3CX7B 4H9PC 3F31A 4X1IE 4I50E 3R6NA 3SOLA 3ZN1B 2X0LB 3ONXA 4HKAA 5E0OA 5EK2A 1HFAA 4TZ4C 1MMDA 2VASA 3SS1A 3C4ZA 5HWXA 5LHGB 2P9BA 3PURA 3KV6A 2JQQA 3HKCE 3I9WA 2WWUA 2CXLA 4GK0E 2KINB 2ES0A 1OXZA 5JQGE 3MA9A 4X20E 2UXNB 3SWHA 3EDUA 4XZCA 3HKBE 5FXZA 3LJCA 2RP4A 2VKJA 3CX6B 5FMNA 3U3IA 1ZKEA 3ZYKA 4ZI7E 3KDSE 3FHNA 3ZJ1A 5JR9B 2MTQA 2YK0A 5HYAA 2D5UA 1VRBA 4ZS2A 5IYZE 5LNKA 2KWIB 5FY7A 2W0GA 4DNDA 2X68A 2CXFA 2CLYB 5JRCA 1MNEA 2VWAA 4HN9A 5JR9A 2CCQA 5M4YA 2X66A 4GOUA 3PUQA 4UVBB 2IW5B 4N78D 2KXPB 2XUEA 1NAFA 3AA6B 3LFMA 3C4WA 5JDMA 4AXPA 3I1AA 3CQGB 2XQYA 1SHZC 1HS7A 3O4XE 2PBIA 3UFEA 5H6RB 4ZHQE 4KP3C 5TAOA 3HR0A 1Z0PA 3PUAA 4IIJE 4NUVA 4O2BE 2CA5A 5IHYA 4HFVA 2V7KA 4U72A 1WLXA 4C91A 1D0XA 3ANWB 2L9QA 2NOXA 4QXCB 3BK9A 1OWAA 2YINA 4QXHB 5A1LA 4UF0B 2NP9A 3ANWA 3K3NA 2KWHA 1FEWA 3BQKA 3AA1B 3PE0A 4CZZB 4WBOA 1WYBA 2ZM0A 3PTRB 2V7LA 4UEMA 5JDQA 4IHJE 5ADXL 2DWKA 3HKDE 3N9QA 4QX8B 3O1IA 5EK3A 5LJNA 4CI1B 2UXXB 5JDLA 4YJ2E 1U4QA 3O9XA 2JRKA 2C0SA 4KUMB 2NW9A 2LEHA 2NTXA 2Z6EA 1O3XA 2JPFA 2JMHA 2VKOA 4HEAA 3OJAA 2YU2A 3J9X1 3N2KE 3GWHA 3MZKB 4IE7A 3CWZB 4GYRA 2LSYA 2C5IT 5KX5E 5L3DB 5LA6E 2BZBA 5JDGA 1UCUA 5J1GA 4IE5A 5F8PA 2Y8DA 4FJOA 4G63A 3N9OA 3PDYA 4OHFA 1T98A 3AB3B 2CXDA 2EHOB 2V7MA 2ZMAA 4V1Av 3ZCIA 3FB2A 4C90A 3B57A 1H7CA 4H9QC 3CVRA 3S4UA 3NZPA 3UUNA 4UXNB 4EXTA 3PUGA 3Q2MA 2LJLA 5KMGP 2QGSA 3PUSA 1YKEB 5LP6E 1HCIA 3V5SA 5EK4A 5DQVA 2EHOA 5GONE 4BJNA 1MMAA 2NTYA 3DP7A 3Q9DA 4EB6E 1LVFA 3OYXA 3WAKA 3ZC0A 3K3QC 2D2SA 3WI3A 4F6RC 4YJ3E 3I0QA 2E8IA 1WR6A 3AA7B 3SRZA 2LSIA 4UELA 4TV9E 2MYSA 4AKGA 4XAXB 2WMOA 5HXRA 2V1DB 2H7VC 2W63A 4EZHA 1LRZA 3L3PA 4H9RC 4ISSA 4WNKA 3FXEB 3ZJ2A 4OK0A 4AKHA 3JC6D 3N5LA 1IZNB 1V9DA 2C5KT 4KBMB 3AAAB 2CWYA 4EAHA 4BJMA 4AQFC 3AVRA 3KV4A 2DNXA 3RC8A 1FMVA 2ZM8A 4P0BA 4YFSA 3DTOA 4EYUA 4IE6A 5ETWA 4ZS3A 5JRCB 4YHJA 2XASB 3ZYMA 3GN5A 4EOZB 2X9XA 4EYYR 1KNZA 4I55E 2NW8A 4CXXA 1S94A 3E22E 1LVKA 4PK4A 3AA0B 2IC9A 3FBLA 1G8XA 1BR0A 3OKQA 4GYSA 3IEEA 2BDEA 3GA8A 4OYKA 2K48A 3NRYA 4ZOLE 2KMFA 3N9NA 4UIGA 4DVDA 5C8YE 5CA0E 2XHEB 1QUUA 1HG2A 2KNDA 3MKDA 4PNIA 2EHOD 4O4LE 2V26A 3QUJA 2G0UA 5FXVA 1ZHCA 4UVAB 3R84B 2HPLA 1AJ3A 5L3FB 1CUNA 2Q9QC 3KVAA 3N2GE 3NBXX 2XAQB 2KLQA 3K8PC 1UX5A 5L3EB 2LE8A 3ZYLA 2MBGA 3RKOA 4L0RA 2H3RA 2V7JA 3ZLIA 3KVBA 2ODUA 3NZQA 3D0TA 3DJBA 4ZI3D 4GK5E 3CKDA 2X51A 1IAPA 2X67A 3KINB 2WSSV 4G2AA 5JH7E 5L3GB 4AKIA 1ZV4X 3FBZA 3EDVA 2Y6XA 5LYJE 4MBQA 4HE8A 3ZMZB 3EVYA 1MIVA 3C4XA 4DBRA 3N9MA 4UV9B 4TUYE 4EZ4A 4I4TE 4AQFA 4I43B 3NRXA 2CM0A 2IAKA 4IGUA 3ZMTB 3E08A 4ANJA 4CQIA 3BQLA 1NWMX 3C51A 2VL8A 5FP3A 4ILUA 2C5JA 2XAFB 3KBTA 3FXDB 3VHLA 4WW0A 2DHRA 3HI2A 3B13A 1B7TA 4CI2B 4IE4A 5LBMA 2V7IA 3RYHE 5H6QB 4JEUB 1IJ6A 1MIYA 2DCFA 3CMLA 2HH7A 2Q9QB 2XAHB 2N1GA 1YW0A 3WAJA 3P8CD 4DO0A 1G73A 3ETVA 5LHHB 2LSGA 4KMCA 3U78A 4JLEA 3ZN0B 1KK7A 3ZC1A 1HG5A 2HPJA 3Q5XA 2NWBA 2E9XC 2Q9QA 2IC6A 4ZI2D 2ACXA 3HKEE 1MNDA 3C50A 3LK42 4PAGA 2X9HA 2M67A 3J7Yq 1MMGA 2K24A 2SPCA 3H37A 5L3BB 4BA9A 1D0ZA 2BVLA 2H7OA 2JMKA 4M1PA 2D0TA 3ZPOA 3AAEB 1FMWA 2K9AA 4PK5A 5FYMA 5AFUL 4O4HE 3UT5E 3RPUA 2A2FX 3ZEFB 4H63V 4UV8B 1HF8A 4DBQA 3KV9A 4ERRA 1Y64B 3OBVE 5LGTB 3AAIA 1QSDA 4QXBB 2N2NA 5CB4E 4WBNE 4H9NC 2DWGA 4ADZA 2CWOA 2QA7A 4H9SE 2LSKA 3MJXA 1WYCA 1HX8A 5HAXA 4HTEA 4AKLA 5KDMC 3GN5B 4PFPA 2W62A 1ZEEA 3ETUA 2PJQA 4TN7B 5J2UE 3LBXA 4FI5A 4E7ZA 3C98B 2BVMA 5JDNA 1UX4A 5BMVE 4MLKA 5LJMA 2X9YA 2E9XB 2VKHA 3A5XA 1E1HB 3RX6A 1U5PA 3IF8B 5LCYA 3UULA 3MK7C 1YD8G 5F3JA 5DJQC 3E0ZA 3QC9A 2W61A 2E9XA 2B1EA 2D0UA 4MALA 4PW8A 2ZLYA 5J2TE 2NW7A 3M65A 4E7SA 3RC3A 3K3OA 3W15B 4XBFB 2DI4A 2Q9QD 3JC6C 3EUHA 1HTJF 3RYCE 3IHRA 3KFWX 3TKLB 4AQGA 4YLHA 4JEHB 3ESLA 3ZCJA 5LG4A 1WRDA 3CX8B 3RYFE 4X1KE 2VKDA 3RRCA 2ZM2A 2L3LA 1D0YA 3IBPA 2XAGB 2J1DG 2LOPA 3LK3B 4AKRB 4NUUA 3QK6A 4J2CA 4UVCB 3PU8A 3MXZA 4H63H 5FY0A 1MIWA 5EZYE 4PJJA 4O8SA 1VOMA 1YKHB 2YU1A 4MHCA 5CA1E 4L9IA 3CQCB 4A56A 3AVSA 3KBUA 4QKNA 3GMIA 2X9WA 3ZMUB 2L8KA 3ZMVB 4AI6A 3UTKA 4OYJA 5HWYA 1X79A 4IDZA 3L09A 2OA5A 3F2EA 4QX7B 4MFRA 2EHOC 2LHRA 1D1BA 2WBLA 4IE0A 3VU7H 5FNVE 2YEVC 4Z8XA 2JJ9A 2XAJB 3N2OA 5L2LA 3CPZA 3RH3A 4DMWA 4QWNB 2A3DA 3O1HA 3HA4A 1BR2A 2XTLA 3HL6A 5LGUB 5FXXA 2LOSA 3KV5A 2LSJA 4QHOA 3N9PA 4ZI3C 3T8OA 4GIWA 4PJNA 4UF0A 2E9XD 2LM9A 5JREA 4EIWA 4TV8E 2W00A 2ODVA 4P0AA 3RYIE 1BR4A 3C64A 3P7IA 2VB6A 1D1AA 1FIOA 2VK9A 5FY1A 2N9DA 1US7B 4CXYA 4HGAA 2MOZA 2WAUA 4O4JE 2GK9A 2DLRA 2WMNA 3UUMA 4TX5A 4O2AE 2RA1A 3N9LA 2A72A 2K5BB 2LHNA 3UUXB 2CMRA 2PG8A 4JUYA 4CI3B 3H3AA 3CQXC 4DMVA 5LHIB 4PK6A 5LXTE 1LKXA 3RRWA 2CE7A 1MMNA 3VKGA 2PFVA 1EZ3A 2Y48B 5DQWA 3I9YA 4PJLA 2CEAA 3Q5WA 4H9OC 4U74A 3V5UA 4BAYB 4OFZA 1IJ5A 5JDFA 2KZ7B 4O4IE 4CXWA 5JR9C 3VKHA 4P09A 2KT9A 3PU3A 1S35A 3LK2B 3O1JA 5FXWA 5HXSA 5L3CB 3OYZA 5LBQB 5HXHA 2WM9A 3MACA 3LBXB 2CLYC 4PFOA 2I59A 5JVDE 3F57A 5LOVE 2LT3A 4L5GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LGU B;  5L3G B;  5LGN B;  4XBF B;  3ZMZ B;  5L3B B;  5H6Q B;  2UXN B;  4CZZ B;  3ZMU B;  4UV9 B;  3ZMV B;  2Y48 B;  2XAH B;  4UVA B;  5H6R B;  3ZMT B;  3ZMS B;  2XAS B;  5LHH B;  5L3F B;  4BAY B;  2UXX B;  2V1D B;  2XAQ B;  4UV8 B;  3ZN0 B;  4UXN B;  3ZN1 B;  4KUM B;  2X0L B;  5L3E B;  2XAG B;  5LGT B;  2XAF B;  2XAJ B;  4UVC B;  5L3C B;  5LBQ B;  4UVB B;  2IW5 B;  5L3D B;  5LHG B;  5LHI B; 
#chains in the Genus database with same CATH topology
 4X1Y E;  4IST A;  3Q5D A;  3PUX F;  4LMJ A;  1SE7 A;  1SA0 E;  1J5W A;  3SOL A;  4COF A;  2BG9 E;  4JI5 T;  3AE1 A;  5LMN T;  2XQA A;  3C4Z A;  3PUZ F;  5HWX A;  2JQQ A;  4TWF A;  1OXZ A;  3MA9 A;  2UXN B;  4DR3 T;  3EDU A;  4XZC A;  2XM1 A;  3LJC A;  3UQ7 A;  2XQ8 A;  5ABG A;  5JR9 B;  4GKJ T;  2YKS A;  2KWI B;  2UU9 T;  4JYA T;  2W0G A;  1GQE A;  3PUQ A;  3AXJ A;  3LFM A;  4EGW A;  1N33 T;  5FVK A;  1SHZ C;  4LFA T;  4YSZ A;  5TAO A;  1Z0P A;  3PUA A;  2XQ9 A;  2IIU A;  4NUV A;  4O2B E;  1WLX A;  4LML A;  5AQP B;  3ANW B;  4JI2 T;  2L9Q A;  5AQJ B;  4QXC B;  3P4W A;  1XNQ T;  4UF0 B;  3ZT5 A;  2BKN A;  3AA1 B;  3PE0 A;  4WBO A;  2VUR A;  5EK3 A;  2UXX B;  1U4Q A;  3O9X A;  2C0S A;  4ILC A;  2JPF A;  4HEA A;  3OJA A;  3N2K E;  2I6H A;  3CWZ B;  5LA6 E;  2BKP A;  3N9O A;  3PDY A;  2V7M A;  3FB2 A;  4LF7 T;  4UXN B;  3PUG A;  5LP6 E;  3L8R A;  5DQV A;  5GON E;  4BJN A;  3Q9D A;  3L39 A;  1LVF A;  5LG3 A;  2QRX A;  5F5W A;  3WI3 A;  1IBM T;  4YJ3 E;  4A5X A;  4IDN A;  2XQ4 A;  2XQ7 A;  3EAM A;  2LSI A;  4UEL A;  3H3M A;  2CHN A;  4XAX B;  3RQU A;  5HXR A;  2V1D B;  2H7V C;  2W63 A;  3AEG A;  1LRZ A;  3RQW A;  4OK0 A;  3G06 A;  4AQF C;  3RC8 A;  1FMV A;  2ZM8 A;  3ZT7 A;  4YSY A;  4IE6 A;  5ETW A;  4KX6 A;  4EYY R;  1X9B A;  4I55 E;  4JI1 T;  3E22 E;  3VR8 A;  2BBH A;  4F8H A;  5CFB A;  3FBL A;  1BR0 A;  3IEE A;  2BDE A;  5C8Y E;  4UIG A;  4DVD A;  4O4L E;  2D9D A;  3NVO A;  3N2G E;  5LMU T;  3K8P C;  2YDS A;  4L0R A;  4LF6 T;  2BS2 A;  2ODU A;  3NZQ A;  3P4P A;  1HNW T;  2FJE A;  4ZI3 D;  4G2A A;  4AKI A;  3FBZ A;  4IRE A;  2BG9 B;  1DU2 A;  3C4X A;  4UV9 B;  4I4T E;  4AQF A;  3NRX A;  3ZMT B;  2HN2 A;  3E08 A;  4CQI A;  2B76 A;  3BQL A;  3C51 A;  5FP3 A;  4U2Y A;  4ILU A;  2UXD T;  4I0U A;  3FXD B;  4X65 T;  2WU5 A;  3RYH E;  3CML A;  5C3J A;  2X0Y A;  2XAH B;  2N1G A;  1ZOY A;  4DO0 A;  4Q25 A;  2LSG A;  1KK7 A;  3Q5X A;  3PUY F;  1HX1 B;  1J1J A;  2ACX A;  1T7S A;  2M67 A;  3J7Y q;  2V5C A;  1MMG A;  5L3B B;  3P4Q A;  2OV9 A;  4QH1 A;  2D0T A;  3ZPO A;  3PUV F;  5FYM A;  4O4H E;  2FJB A;  2BS3 A;  1HF8 A;  5CJ5 A;  4DV6 T;  3OBV E;  5AQM B;  3AAI A;  4ADZ A;  5ABF A;  5HAX A;  5KDM C;  2WY2 A;  2XPK A;  1XZY A;  2W62 A;  1ZEE A;  4NXN T;  2CHO A;  1E1H B;  2XQ5 A;  1R8I A;  3UU4 A;  2E5V A;  2WU2 A;  2ZLY A;  2M6I A;  3M65 A;  4E7S A;  3W15 B;  4KHZ F;  3JC6 C;  2JIW A;  3IHR A;  3KFW X;  3TKL B;  3ESL A;  2WDV A;  4TNW A;  3RRC A;  3T1Y T;  2LOP A;  4UVC B;  4ZZB A;  2YU1 A;  4HFI A;  3ZMU B;  2X9W A;  3ZMV B;  1UUR A;  5HWY A;  1WR0 A;  4IDZ A;  1HNZ T;  4QX7 B;  4MFR A;  4DR7 T;  2WBL A;  4IE0 A;  3VU7 H;  2YEV C;  3N2O A;  2A3D A;  2W2U A;  2OLT A;  2LOS A;  4QHO A;  5AQG B;  3RIU C;  5JRE A;  1XMQ T;  4HFE A;  1FIO A;  1US7 B;  2V6Y A;  3CIR A;  2RA1 A;  3N9L A;  2A72 A;  2WQY A;  2PG8 A;  4CI3 B;  3H3A A;  4B3R T;  5LXT E;  2CE7 A;  5CGM A;  3SFE A;  1XMO T;  3I9Y A;  5LB7 B;  5ABE A;  4OFZ A;  4A98 A;  4CXW A;  2KT9 A;  3PU3 A;  1S35 A;  5FXW A;  3TLV A;  3OYZ A;  5LBQ B;  3LBX B;  2CLY C;  3F57 A;  3RF1 A;  5LOV E;  2RPA A;  4ZI2 C;  3JAD A;  3LG7 A;  5IUX A;  2F4V T;  5DAB A;  4I50 E;  3R6N A;  3RIU A;  4DR1 T;  5EK2 A;  1HFA A;  4TZ4 C;  2VAS A;  1T72 A;  5LHG B;  3KV6 A;  2KIN B;  5JQG E;  2J47 A;  3SWH A;  3HKB E;  2VKJ A;  3CX6 B;  2JQH A;  3U3I A;  3KDS E;  3FHN A;  3ZJ1 A;  2D5U A;  4ZS2 A;  5IYZ E;  3AXJ B;  4WZX A;  4DV0 T;  2CPT A;  3IA3 A;  2VWA A;  4HN9 A;  5M4Y A;  2X66 A;  4N78 D;  2KXP B;  2LM2 A;  3C4W A;  4AXP A;  2XQY A;  4DV7 T;  3UFE A;  3AEB A;  5H6R B;  3ZSS A;  5IHY A;  4U72 A;  2V7K A;  4C91 A;  4X64 T;  2NOX A;  2J62 A;  3BK9 A;  1OWA A;  2YIN A;  5A1L A;  4U33 A;  3K3N A;  1KFY A;  5AQN B;  2IML A;  5JDQ A;  3PV0 F;  5ADX L;  4DV5 T;  4QX8 B;  4UR9 A;  4CI1 B;  4YJ2 E;  4KUM B;  2LEH A;  1O3X A;  2JMH A;  3GWH A;  3MZK B;  4GYR A;  2AE9 A;  5L3D B;  4DR6 T;  5J1G A;  4IE5 A;  3TLU A;  4G63 A;  4C90 A;  3B57 A;  4H9Q C;  3S4U A;  2QGS A;  3PUS A;  4YHH T;  1YKE B;  5EK4 A;  2EHO A;  1MMA A;  4CN4 A;  3K3Q C;  3RKG A;  2YN6 A;  2D2S A;  1JNR A;  2ACZ A;  5BR8 T;  3AA7 B;  4TV9 E;  2MYS A;  4U3C A;  1VCS A;  4H9R C;  4JBW F;  4ISS A;  3ZJ2 A;  3N5L A;  2K3W A;  3VRB A;  3AAA B;  4BJM A;  2DNX A;  4P0B A;  4YFS A;  3EHZ A;  5JRC B;  1S94 A;  1W0A A;  4PK4 A;  2VVS A;  3AE2 A;  3OKQ A;  4GYS A;  4OYK A;  3GA8 A;  2K48 A;  2XHE B;  1QUU A;  2KND A;  3MKD A;  2G0U A;  1AJ3 A;  1CUN A;  3KVA A;  4B3T T;  3NBX X;  3RIF A;  5L3E B;  2LE8 A;  3ZYL A;  2MBG A;  3RKO A;  3ZLI A;  3D0T A;  3NWI A;  3AE3 A;  3KIN B;  3EDV A;  3EVY A;  4EZ4 A;  4I43 B;  5L4E A;  2CM0 A;  4IGU A;  1W0B A;  3FZF B;  3UUB A;  1NWM X;  1ZP0 A;  4HWC A;  4AIU A;  3B13 A;  4CI2 B;  4IE4 A;  5LBM A;  4U7I A;  2H88 A;  3A7M A;  4JEU B;  1IJ6 A;  2DCF A;  2CBJ A;  1YW0 A;  3P8C D;  2XZE A;  3ETV A;  4KMC A;  3ZN0 B;  1HG5 A;  2E9X C;  2IC6 A;  3LK4 2;  4JI8 T;  2X9H A;  4DR2 T;  4LF4 T;  2K24 A;  2SPC A;  1HNX T;  2H7O A;  3FZH B;  1FMW A;  2K9A A;  2A2F X;  3ZEF B;  4H63 V;  5ABF B;  3KV9 A;  4CN1 A;  3ZT6 A;  4X5T A;  1QSD A;  4QXB B;  2N2N A;  2CWO A;  4YTN A;  4ZZC A;  1KNP A;  4HTE A;  3TLW A;  4U7Y A;  3GN5 B;  2PJQ A;  2BVM A;  5BMV E;  4YTP A;  3RX6 A;  1U5P A;  3IF8 B;  5DJQ C;  2JQK A;  4YXD A;  3QC9 A;  2W61 A;  2E9X A;  2B1E A;  4PW8 A;  1VCT A;  4Z90 A;  2DI4 A;  3UU8 A;  3JCF A;  3RYC E;  4AQG A;  4JEH B;  4KI0 F;  3QOF A;  5LG4 A;  5HCJ A;  2XQ3 A;  2VQF T;  3RYF E;  3QB5 K;  1D0Y A;  2WZH A;  4AKR B;  1W9R A;  3MXZ A;  2XM2 A;  2W67 A;  4AIS A;  1YKH B;  4MHC A;  3CQC B;  3AVS A;  4QKN A;  2L8K A;  1JNZ A;  2OA5 A;  4HWF A;  1J5E T;  4KHP T;  4NPP A;  5C2T A;  5FNV E;  5AQI B;  2XAJ B;  5L2L A;  4QWN B;  1BR2 A;  3HL6 A;  4ILB A;  5FXX A;  2LSJ A;  3N9P A;  4ZI3 C;  3T8O A;  1Z8U A;  2V6Y B;  3UFG A;  4UF0 A;  1N32 T;  2LM9 A;  4EIW A;  4TV8 E;  2W00 A;  4P0A A;  3P7I A;  3AED A;  5FY1 A;  2N9D A;  2WAU A;  2IDO B;  3UUM A;  4TX5 A;  1E7P A;  2LHN A;  2K5B B;  4WYV A;  3UUX B;  4JUY A;  3ONJ A;  1MMN A;  5L4H A;  3NKZ A;  3VKG A;  5DQW A;  2CEA A;  1OED C;  2WS3 A;  3EAB A;  4NXM T;  2KZ7 B;  4P09 A;  4HFB A;  3LK2 B;  2V5D A;  1T8B A;  5FVL A;  2WM9 A;  3MAC A;  4PFO A;  4P1N A;  2I59 A;  3ZST A;  1BR1 A;  2VL0 A;  3BQI A;  3I0O A;  4PJM A;  3RI5 A;  3TLT A;  4H9P C;  4HWI B;  3RGL A;  5AQL B;  3ZN1 B;  2YDQ A;  4HKA A;  3HKC E;  3I9W A;  3AEA A;  2CXL A;  2ES0 A;  2RP4 A;  1WFD A;  3ZYK A;  4ZI7 E;  5HYA A;  1I94 T;  3AEF A;  4JI6 T;  1OED A;  5FY7 A;  2X68 A;  2CXF A;  2CLY B;  4HFH A;  2CCQ A;  4GOU A;  2IW5 B;  1NAF A;  3AA6 B;  4OX9 T;  5JDM A;  3CQG B;  1XDP A;  3O4X E;  1HS7 A;  4KP3 C;  2CA5 A;  3AE8 A;  4LF5 T;  2NP9 A;  2KWH A;  4CZZ B;  4IHJ E;  2DWK A;  3HKD E;  3O1I A;  2UXC T;  3LSV A;  2JRK A;  2Z6E A;  2BKO A;  2VKO A;  2YU2 A;  3J9X 1;  4ZXL A;  2LKH A;  4IE7 A;  2C5I T;  2BZB A;  1T98 A;  3ZCI A;  2EHO B;  2ZMA A;  1H7C A;  3UUN A;  3NZP A;  3FZK B;  3ABV A;  4EXT A;  2FJD A;  3Q2M A;  2LJL A;  4EEB A;  3AE9 A;  1YQ4 A;  3PUW F;  5FL1 A;  5ABH A;  3DP7 A;  3ZC0 A;  3OYX A;  3QB5 A;  1YXR A;  4DUZ T;  1WR6 A;  2YOE A;  4AKG A;  2WMO A;  1M7K A;  3L3P A;  2W4X A;  3FXE B;  4IDP A;  2C5K T;  3P4S A;  4KBM B;  4EAH A;  1N34 T;  3KV4 A;  1XWM A;  2WWV A;  4EOZ B;  2X9X A;  1KNZ A;  2NW8 A;  1LVK A;  2DL1 A;  5AQU B;  3VR9 A;  3AA0 B;  2IC9 A;  4ZOL E;  2KMF A;  3N9N A;  1HG2 A;  4U31 A;  4PNI A;  2EHO D;  3FZM B;  3QUJ A;  5FXV A;  3R84 B;  1ZHC A;  4UVA B;  5L3F B;  2Q9Q C;  2KLQ A;  1UX5 A;  2WDR A;  2H3R A;  5HCM A;  1NEN A;  5AQQ B;  2LRK A;  3AE6 A;  4GK5 E;  2X51 A;  2X67 A;  2WSS V;  5JH7 E;  2Y6X A;  1MIV A;  4DBR A;  4TUY E;  4Z91 A;  4ANJ A;  5JTG A;  2NR4 A;  2VL8 A;  5IWA T;  2QVA A;  4JI3 T;  3PJA A;  3OPC A;  1MIY A;  2HH7 A;  2E2A A;  1G73 A;  5LHH B;  2BBJ A;  4A97 A;  2HPJ A;  2Q9Q A;  4TWD A;  1OED E;  3H37 A;  4BA9 A;  2BVL A;  2JMK A;  4M1P A;  4LF8 T;  3UU6 A;  2XQ6 A;  3RHW A;  4UV8 B;  1N36 T;  4LFB T;  4ERR A;  1Y64 B;  5HEJ A;  5LGT B;  2W66 A;  1M62 A;  5CB4 E;  4WBN E;  2DWG A;  2QA7 A;  4H9S E;  1HX8 A;  1WYC A;  4PFP A;  3ETU A;  4TN7 B;  1L0V A;  3LBX A;  4FI5 A;  4E7Z A;  5JDN A;  1UX4 A;  5FKY A;  4MLK A;  2UUC T;  2X9Y A;  2E9X B;  2VKH A;  3A5X A;  2WB5 A;  5J2T E;  2NW7 A;  3OTO T;  3RC3 A;  3EUH A;  1HTJ F;  2JQ9 A;  2WCA A;  3ZCJ A;  4DR5 T;  1WRD A;  3CX8 B;  2VVN A;  2H89 A;  2L3L A;  3Q5E A;  2XAG B;  3JAE A;  3QK6 A;  4J2C A;  3PU8 A;  2MPK A;  1XNR T;  1I6Z A;  4H63 H;  5FY0 A;  4PJJ A;  4O8S A;  4GKK T;  5CA1 E;  4A56 A;  3CK6 A;  3UTK A;  4OYJ A;  2IUB A;  1X79 A;  4LF9 T;  3F2E A;  3AE5 A;  4DV3 T;  2LRL A;  2LHR A;  1D1B A;  3RH3 A;  2XTL A;  3KV5 A;  2LLY A;  4GIW A;  2HHH T;  2E9X D;  2ODV A;  3RYI E;  3C64 A;  2VB6 A;  1D1A A;  5HEO A;  4HGA A;  2MOZ A;  4O4J E;  2WMN A;  4JI4 T;  4CN6 A;  1E2A A;  3ONL C;  2CMR A;  2FJA A;  5LHI B;  3OVU A;  1QLB A;  1LKX A;  5FL0 A;  2PFV A;  4PJL A;  3Q5W A;  4U74 A;  3FZL B;  1UGO A;  5JDF A;  3P4R A;  4O4I E;  5JR9 C;  4QH4 A;  5HXH A;  4YT0 A;  5HEU A;  5JVD E;  3A8Y C;  4L5G A;  4EED A;  3ZKR A;  5LGN B;  5HXC A;  2BS4 A;  4K0U A;  5JDH A;  4B6X A;  3ZMS B;  1D1C A;  4ASK A;  5HXE A;  3CX7 B;  4X1I E;  3F31 A;  2X0L B;  3ONX A;  5E0O A;  1MMD A;  3SS1 A;  3AEC A;  2P9B A;  3PUR A;  4GK0 E;  2WWU A;  4X20 E;  2HN1 A;  1OED B;  5FXZ A;  3P50 A;  5FMN A;  1ZKE A;  1KNR A;  2KSR A;  2MTQ A;  2YK0 A;  1VRB A;  5LNK A;  3LDQ B;  4DND A;  5JRC A;  1MNE A;  5JR9 A;  4UVB B;  2XUE A;  4ILA A;  1Y01 A;  2FBW A;  3I1A A;  4JI0 T;  5AQR B;  5J0Z A;  2PBI A;  4ZHQ E;  3HR0 A;  4IIJ E;  2WDQ A;  4HFV A;  5AQK B;  1D0X A;  1IBK T;  4QXH B;  2MAW A;  3ANW A;  1FEW A;  3BQK A;  5AQF B;  4YY3 T;  1WYB A;  4YTM A;  2ZM0 A;  3PTR B;  2V7L A;  4UEM A;  3N9Q A;  5LJN A;  1XDO A;  2PTF A;  5JDL A;  2NW9 A;  2NTX A;  3X1D A;  2XSB A;  2LSY A;  4HFC A;  5KX5 E;  5JDG A;  3K1S A;  3EI0 A;  3UU5 A;  1UCU A;  2WZI A;  5F8P A;  2Y8D A;  4FJO A;  1UK5 A;  4OHF A;  3AB3 B;  2CXD A;  4V1A v;  3CVR A;  5KMG P;  1HCI A;  3V5S A;  2J4G A;  2NTY A;  2IHR 1;  4EB6 E;  3WAK A;  5AQH B;  4F6R C;  2VQE T;  4B3S T;  3RLF F;  3I0Q A;  2E8I A;  3SRZ A;  1SUM B;  4U2Z A;  4EZH A;  4WNK A;  4AKH A;  3UQ4 A;  3JC6 D;  1IZN B;  1V9D A;  4ZEY A;  2A9U A;  2CWY A;  2R6G F;  3AVR A;  3T1H T;  1KEY A;  4EYU A;  3DTO A;  2BG9 C;  4ZS3 A;  4YHJ A;  2XAS B;  3ZYM A;  3GN5 A;  4CXX A;  4IDQ A;  2AXD S;  1WCR A;  1G8X A;  3NRY A;  5CA0 E;  2UXB T;  2E5L T;  2V26 A;  2HPL A;  2XAQ B;  2CRB A;  2V7J A;  3KVB A;  5HEH A;  3VRA A;  4LMK A;  3DJB A;  3CKD A;  1IAP A;  5L3G B;  4DV1 T;  1ZV4 X;  4JV5 T;  5LYJ E;  4MBQ A;  4HE8 A;  3ZMZ B;  3N9M A;  2V6X A;  5AQV B;  5L47 A;  2IAK A;  4K0K T;  2BG9 A;  2C5J A;  2XJ7 A;  3B5M A;  2X0H A;  2XAF B;  3KBT A;  3VHL A;  4WW0 A;  2DHR A;  2I0M A;  2CBI A;  3HI2 A;  1B7T A;  2V7I A;  4DUY T;  5H6Q B;  5HEG A;  4QH5 A;  2Q9Q B;  4EV6 A;  3WAJ A;  3U78 A;  4JLE A;  3ZC1 A;  2NWB A;  4HWH A;  4JI7 T;  4ZI2 D;  4IL9 A;  3HKE E;  1MND A;  3C50 A;  4PAG A;  1D0Z A;  3AAE B;  4X62 T;  4PK5 A;  5AFU L;  3UT5 E;  3RPU A;  4X66 T;  3M3Z B;  4IT4 A;  2ZM6 T;  4DBQ A;  5AQT B;  4H9N C;  2LSK A;  3MJX A;  4DID B;  4AKL A;  1NEK A;  1YQ3 A;  1HR0 T;  1UUS A;  1CHU A;  5J2U E;  2UUB T;  3QNU A;  3C98 B;  5LJM A;  2WP9 A;  5LCY A;  3AE7 A;  3UUL A;  3MK7 C;  1KF6 A;  1YD8 G;  5F3J A;  3E0Z A;  3JAF A;  4MAL A;  2D0U A;  4LFC T;  3K3O A;  4XBF B;  2Q9Q D;  2XSA A;  3SFD A;  4YLH A;  4TWH A;  1IBL T;  4HFD A;  2VKD A;  4X1K E;  2LKG A;  2ZM2 A;  5AQS B;  3TLS A;  3IBP A;  2YDR A;  2J1D G;  3LK3 B;  4NUU A;  4IDO A;  1MIW A;  5EZY E;  1VOM A;  4L9I A;  3RIA A;  3KBU A;  4HWD A;  3GMI A;  4AI6 A;  3L09 A;  4B3M T;  4AQY T;  2EHO C;  3PJA J;  4Z8X A;  4DR4 T;  2JJ9 A;  4IL4 A;  3CPZ A;  4DMW A;  3UU3 A;  3O1H A;  3HA4 A;  5LGU B;  2V8S V;  2FUP A;  3AEE A;  4PJN A;  1BR4 A;  2VK9 A;  4CXY A;  2GK9 A;  5KXJ A;  2DLR A;  2XY8 B;  4O2A E;  2M6B A;  4DV4 T;  1W09 A;  4YSX A;  3CQX C;  4DMV A;  4PK6 A;  2QYW A;  4DV2 T;  3RRW A;  5AQO B;  1EZ3 A;  2Y48 B;  3AE4 A;  4H9O C;  4BAY B;  3V5U A;  4NIQ A;  1IJ5 A;  4TNV A;  3VKH A;  2UUA T;  3O1J A;  5HXS A;  5L3C B;  1FJG T;  2LT3 A; 
#chains in the Genus database with same CATH homology
 1BR1 A;  4X1Y E;  5LGN B;  5HXC A;  4IST A;  4ZI2 C;  3BQI A;  3I0O A;  4K0U A;  3LG7 A;  5JDH A;  4B6X A;  3ZMS B;  1D1C A;  4PJM A;  4ASK A;  5DAB A;  5HXE A;  1SA0 E;  3CX7 B;  4H9P C;  3F31 A;  4X1I E;  4I50 E;  3R6N A;  3SOL A;  3ZN1 B;  2X0L B;  3ONX A;  4HKA A;  5E0O A;  5EK2 A;  1HFA A;  4TZ4 C;  1MMD A;  2VAS A;  3SS1 A;  3C4Z A;  5HWX A;  5LHG B;  2P9B A;  3PUR A;  3KV6 A;  2JQQ A;  3HKC E;  3I9W A;  2WWU A;  2CXL A;  4GK0 E;  2KIN B;  2ES0 A;  1OXZ A;  5JQG E;  3MA9 A;  4X20 E;  2UXN B;  3SWH A;  3EDU A;  4XZC A;  3HKB E;  5FXZ A;  3LJC A;  2RP4 A;  2VKJ A;  3CX6 B;  5FMN A;  3U3I A;  1ZKE A;  3ZYK A;  4ZI7 E;  3KDS E;  3FHN A;  3ZJ1 A;  5JR9 B;  2MTQ A;  2YK0 A;  5HYA A;  2D5U A;  1VRB A;  4ZS2 A;  5IYZ E;  5LNK A;  2KWI B;  5FY7 A;  2W0G A;  4DND A;  2X68 A;  2CXF A;  2CLY B;  5JRC A;  1MNE A;  2VWA A;  4HN9 A;  5JR9 A;  2CCQ A;  5M4Y A;  2X66 A;  4GOU A;  3PUQ A;  4UVB B;  2IW5 B;  4N78 D;  2KXP B;  2XUE A;  1NAF A;  3AA6 B;  3LFM A;  3C4W A;  5JDM A;  4AXP A;  3I1A A;  3CQG B;  2XQY A;  1SHZ C;  1HS7 A;  3O4X E;  2PBI A;  3UFE A;  5H6R B;  4ZHQ E;  4KP3 C;  5TAO A;  3HR0 A;  1Z0P A;  3PUA A;  4IIJ E;  4NUV A;  4O2B E;  2CA5 A;  5IHY A;  4HFV A;  2V7K A;  4U72 A;  1WLX A;  4C91 A;  1D0X A;  3ANW B;  2L9Q A;  2NOX A;  4QXC B;  3BK9 A;  1OWA A;  2YIN A;  4QXH B;  5A1L A;  4UF0 B;  2NP9 A;  3ANW A;  3K3N A;  2KWH A;  1FEW A;  3BQK A;  3AA1 B;  3PE0 A;  4CZZ B;  4WBO A;  1WYB A;  2ZM0 A;  3PTR B;  2V7L A;  4UEM A;  5JDQ A;  4IHJ E;  5ADX L;  2DWK A;  3HKD E;  3N9Q A;  4QX8 B;  3O1I A;  5EK3 A;  5LJN A;  4CI1 B;  2UXX B;  5JDL A;  4YJ2 E;  1U4Q A;  3O9X A;  2JRK A;  2C0S A;  4KUM B;  2NW9 A;  2LEH A;  2NTX A;  2Z6E A;  1O3X A;  2JPF A;  2JMH A;  2VKO A;  4HEA A;  3OJA A;  2YU2 A;  3J9X 1;  3N2K E;  3GWH A;  3MZK B;  4IE7 A;  3CWZ B;  4GYR A;  2LSY A;  2C5I T;  5KX5 E;  5L3D B;  5LA6 E;  2BZB A;  5JDG A;  1UCU A;  5J1G A;  4IE5 A;  5F8P A;  2Y8D A;  4FJO A;  4G63 A;  3N9O A;  3PDY A;  4OHF A;  1T98 A;  3AB3 B;  2CXD A;  2EHO B;  2V7M A;  2ZMA A;  4V1A v;  3ZCI A;  3FB2 A;  4C90 A;  3B57 A;  1H7C A;  4H9Q C;  3CVR A;  3S4U A;  3NZP A;  3UUN A;  4UXN B;  4EXT A;  3PUG A;  3Q2M A;  2LJL A;  5KMG P;  2QGS A;  3PUS A;  1YKE B;  5LP6 E;  1HCI A;  3V5S A;  5EK4 A;  5DQV A;  2EHO A;  5GON E;  4BJN A;  1MMA A;  2NTY A;  3DP7 A;  3Q9D A;  4EB6 E;  1LVF A;  3OYX A;  3WAK A;  3ZC0 A;  3K3Q C;  2D2S A;  3WI3 A;  4F6R C;  4YJ3 E;  3I0Q A;  2E8I A;  1WR6 A;  3AA7 B;  3SRZ A;  2LSI A;  4UEL A;  4TV9 E;  2MYS A;  4AKG A;  4XAX B;  2WMO A;  5HXR A;  2V1D B;  2H7V C;  2W63 A;  4EZH A;  1LRZ A;  3L3P A;  4H9R C;  4ISS A;  4WNK A;  3FXE B;  3ZJ2 A;  4OK0 A;  4AKH A;  3JC6 D;  3N5L A;  1IZN B;  1V9D A;  2C5K T;  4KBM B;  3AAA B;  2CWY A;  4EAH A;  4BJM A;  4AQF C;  3AVR A;  3KV4 A;  2DNX A;  3RC8 A;  1FMV A;  2ZM8 A;  4P0B A;  4YFS A;  3DTO A;  4EYU A;  4IE6 A;  5ETW A;  4ZS3 A;  5JRC B;  4YHJ A;  2XAS B;  3ZYM A;  3GN5 A;  4EOZ B;  2X9X A;  4EYY R;  1KNZ A;  4I55 E;  2NW8 A;  4CXX A;  1S94 A;  3E22 E;  1LVK A;  4PK4 A;  3AA0 B;  2IC9 A;  3FBL A;  1G8X A;  1BR0 A;  3OKQ A;  4GYS A;  3IEE A;  2BDE A;  3GA8 A;  4OYK A;  2K48 A;  3NRY A;  4ZOL E;  2KMF A;  3N9N A;  4UIG A;  4DVD A;  5C8Y E;  5CA0 E;  2XHE B;  1QUU A;  1HG2 A;  2KND A;  3MKD A;  4PNI A;  2EHO D;  4O4L E;  2V26 A;  3QUJ A;  2G0U A;  5FXV A;  1ZHC A;  4UVA B;  3R84 B;  2HPL A;  1AJ3 A;  5L3F B;  1CUN A;  2Q9Q C;  3KVA A;  3N2G E;  3NBX X;  2XAQ B;  2KLQ A;  3K8P C;  1UX5 A;  5L3E B;  2LE8 A;  3ZYL A;  2MBG A;  3RKO A;  4L0R A;  2H3R A;  2V7J A;  3ZLI A;  3KVB A;  2ODU A;  3NZQ A;  3D0T A;  3DJB A;  4ZI3 D;  4GK5 E;  3CKD A;  2X51 A;  1IAP A;  2X67 A;  3KIN B;  2WSS V;  4G2A A;  5JH7 E;  5L3G B;  4AKI A;  1ZV4 X;  3FBZ A;  3EDV A;  2Y6X A;  5LYJ E;  4MBQ A;  4HE8 A;  3ZMZ B;  3EVY A;  1MIV A;  3C4X A;  4DBR A;  3N9M A;  4UV9 B;  4TUY E;  4EZ4 A;  4I4T E;  4AQF A;  4I43 B;  3NRX A;  2CM0 A;  2IAK A;  4IGU A;  3ZMT B;  3E08 A;  4ANJ A;  4CQI A;  3BQL A;  1NWM X;  3C51 A;  2VL8 A;  5FP3 A;  4ILU A;  2C5J A;  2XAF B;  3KBT A;  3FXD B;  3VHL A;  4WW0 A;  2DHR A;  3HI2 A;  3B13 A;  1B7T A;  4CI2 B;  4IE4 A;  5LBM A;  2V7I A;  3RYH E;  5H6Q B;  4JEU B;  1IJ6 A;  1MIY A;  2DCF A;  3CML A;  2HH7 A;  2Q9Q B;  2XAH B;  2N1G A;  1YW0 A;  3WAJ A;  3P8C D;  4DO0 A;  1G73 A;  3ETV A;  5LHH B;  2LSG A;  4KMC A;  3U78 A;  4JLE A;  3ZN0 B;  1KK7 A;  3ZC1 A;  1HG5 A;  2HPJ A;  3Q5X A;  2NWB A;  2E9X C;  2Q9Q A;  2IC6 A;  4ZI2 D;  2ACX A;  3HKE E;  1MND A;  3C50 A;  3LK4 2;  4PAG A;  2X9H A;  2M67 A;  3J7Y q;  1MMG A;  2K24 A;  2SPC A;  3H37 A;  5L3B B;  4BA9 A;  1D0Z A;  2BVL A;  2H7O A;  2JMK A;  4M1P A;  2D0T A;  3ZPO A;  3AAE B;  1FMW A;  2K9A A;  4PK5 A;  5FYM A;  5AFU L;  4O4H E;  3UT5 E;  3RPU A;  2A2F X;  3ZEF B;  4H63 V;  4UV8 B;  1HF8 A;  4DBQ A;  3KV9 A;  4ERR A;  1Y64 B;  3OBV E;  5LGT B;  3AAI A;  1QSD A;  4QXB B;  2N2N A;  5CB4 E;  4WBN E;  4H9N C;  2DWG A;  4ADZ A;  2CWO A;  2QA7 A;  4H9S E;  2LSK A;  3MJX A;  1WYC A;  1HX8 A;  5HAX A;  4HTE A;  4AKL A;  5KDM C;  3GN5 B;  4PFP A;  2W62 A;  1ZEE A;  3ETU A;  2PJQ A;  4TN7 B;  5J2U E;  3LBX A;  4FI5 A;  4E7Z A;  3C98 B;  2BVM A;  5JDN A;  1UX4 A;  5BMV E;  4MLK A;  5LJM A;  2X9Y A;  2E9X B;  2VKH A;  3A5X A;  1E1H B;  3RX6 A;  1U5P A;  3IF8 B;  5LCY A;  3UUL A;  3MK7 C;  1YD8 G;  5F3J A;  5DJQ C;  3E0Z A;  3QC9 A;  2W61 A;  2E9X A;  2B1E A;  2D0U A;  4MAL A;  4PW8 A;  2ZLY A;  5J2T E;  2NW7 A;  3M65 A;  4E7S A;  3RC3 A;  3K3O A;  3W15 B;  4XBF B;  2DI4 A;  2Q9Q D;  3JC6 C;  3EUH A;  1HTJ F;  3RYC E;  3IHR A;  3KFW X;  3TKL B;  4AQG A;  4YLH A;  4JEH B;  3ESL A;  3ZCJ A;  5LG4 A;  1WRD A;  3CX8 B;  3RYF E;  4X1K E;  2VKD A;  3RRC A;  2ZM2 A;  2L3L A;  1D0Y A;  3IBP A;  2XAG B;  2J1D G;  2LOP A;  3LK3 B;  4AKR B;  4NUU A;  3QK6 A;  4J2C A;  4UVC B;  3PU8 A;  3MXZ A;  4H63 H;  5FY0 A;  1MIW A;  5EZY E;  4PJJ A;  4O8S A;  1VOM A;  1YKH B;  2YU1 A;  4MHC A;  5CA1 E;  4L9I A;  3CQC B;  4A56 A;  3AVS A;  3KBU A;  4QKN A;  3GMI A;  2X9W A;  3ZMU B;  2L8K A;  3ZMV B;  4AI6 A;  3UTK A;  4OYJ A;  5HWY A;  1X79 A;  4IDZ A;  3L09 A;  2OA5 A;  3F2E A;  4QX7 B;  4MFR A;  2EHO C;  2LHR A;  1D1B A;  2WBL A;  4IE0 A;  3VU7 H;  5FNV E;  2YEV C;  4Z8X A;  2JJ9 A;  2XAJ B;  3N2O A;  5L2L A;  3CPZ A;  3RH3 A;  4DMW A;  4QWN B;  2A3D A;  3O1H A;  3HA4 A;  1BR2 A;  2XTL A;  3HL6 A;  5LGU B;  5FXX A;  2LOS A;  3KV5 A;  2LSJ A;  4QHO A;  3N9P A;  4ZI3 C;  3T8O A;  4GIW A;  4PJN A;  4UF0 A;  2E9X D;  2LM9 A;  5JRE A;  4EIW A;  4TV8 E;  2W00 A;  2ODV A;  4P0A A;  3RYI E;  1BR4 A;  3C64 A;  3P7I A;  2VB6 A;  1D1A A;  1FIO A;  2VK9 A;  5FY1 A;  2N9D A;  1US7 B;  4CXY A;  4HGA A;  2MOZ A;  2WAU A;  4O4J E;  2GK9 A;  2DLR A;  2WMN A;  3UUM A;  4TX5 A;  4O2A E;  2RA1 A;  3N9L A;  2A72 A;  2K5B B;  2LHN A;  3UUX B;  2CMR A;  2PG8 A;  4JUY A;  4CI3 B;  3H3A A;  3CQX C;  4DMV A;  5LHI B;  4PK6 A;  5LXT E;  1LKX A;  3RRW A;  2CE7 A;  1MMN A;  3VKG A;  2PFV A;  1EZ3 A;  2Y48 B;  5DQW A;  3I9Y A;  4PJL A;  2CEA A;  3Q5W A;  4H9O C;  4U74 A;  3V5U A;  4BAY B;  4OFZ A;  1IJ5 A;  5JDF A;  2KZ7 B;  4O4I E;  4CXW A;  5JR9 C;  3VKH A;  4P09 A;  2KT9 A;  3PU3 A;  1S35 A;  3LK2 B;  3O1J A;  5FXW A;  5HXS A;  5L3C B;  3OYZ A;  5LBQ B;  5HXH A;  2WM9 A;  3MAC A;  3LBX B;  2CLY C;  4PFO A;  2I59 A;  5JVD E;  3F57 A;  5LOV E;  2LT3 A;  4L5G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...