5H7XA

Crystal structure of the complex of phosphopantetheine adenylyltransferase from acinetobacter baumannii with 2-hydroxy-1,2,3-propane tricarboxylate at 1.76 a resolution
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
163
structure length
163
Chain Sequence
MSKTRVIYPGTFDPITNGHVDLVTRASRMFDEVVVAIAIGHHKNPLFSLEERVALAQSSLGHLSNVEFVGFDGLLVNFFKEQKATAVLRGLRAVSDFEYEFQLANMNRQLDPHFEAVFLTPSEQYSFISSTLIREIARLKGDVTKFVPQAVVEAFERKHQQGW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and binding studies of phosphopantetheine adenylyl transferase from Acinetobacter baumannii.
pubmed doi rcsb
source organism Acinetobacter baumannii
molecule tags Transferase
molecule keywords Phosphopantetheine adenylyltransferase
total genus 57
structure length 163
sequence length 163
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.7.3: Pantetheine-phosphate adenylyltransferase.
pdb deposition date 2016-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 5h7xA00
2RD2A 3CLRC 1M8GA 2YY5A 4R2MA 2X1MA 3FG9A 3KT6A 4WSOA 2IP1A 3RHSA 3CLSD 3ZXIA 1MAWA 1PG2A 1JHDA 1OBHA 5DB4A 4MUNA 4TS1A 3FDXA 4MWBA 1M83A 4OUDA 3ZXSA 2A1UA 1GPMA 3KT8A 3N8HA 3AL0C 1GLNA 1IRXA 1WZ2A 2EJCA 3VGJA 2J4DA 1PFYA 2YWCA 1QRUA 1IQRA 1OWPA 4JXZA 1JIJA 1DNPA 3MUEA 3MXTA 1WKBA 3Q4GA 2DXIA 4PY2A 1G8HA 2CV1A 2GKSA 1U7DA 4ZT5A 1MOPA 3OTWA 1S4MA 1V8FA 1Q15A 4F4HA 4P2BA 5FNZA 4ZCSA 5TEVA 1U3CA 3FIUA 4KPUA 4MQ6A 1MC1A 5H16A 1J20A 3QE4A 2QTRA 3Q12A 1O96B 3ND5A 4AS1A 2DETA 3A4IA 1N78A 1YI8A 2YXNA 1MRZA 1J09A 1IFXA 1TYDE 1LI5A 1NURA 4CDMA 1H3FA 5HG0A 1KKUA 1IH8A 1M8FA 4MWCA 4X0EA 2R5WA 1T9GR 3ZGZA 3JXEA 1EFPB 3SEQA 4NDAA 1PG0A 2YWBA 3H99A 1H3EA 1WXIA 4K03A 1EFVB 2I1LA 3TZLA 2A88A 3CLTD 1M8KA 1PFUA 1QJCA 1ZH0A 1VBNA 1NYLA 4MW5A 2CYAA 4MVCA 1Q77A 1X6VA 3CVXA 3FWKA 5TGTA 3ZUGA 3G5AA 4MW7A 5K0SA 1NUUA 4OJMX 4MW2A 1NUSA 2A1TS 4KPUB 3C8ZA 2GOYA 2DUMA 2ZUEA 2XRYA 4UZEA 4ND7A 2XRZA 4UZFA 3MLAA 1O95D 3U1VA 2DERA 2CUZA 3KT3A 4G5FA 1K4MA 1QRTA 1KORA 3AKZA 1BS2A 1KH2A 4JXXA 4NX2A 2O5RA 4ZCRA 2AKEA 1N77A 4KR7A 1TYAE 1G59A 4AQ7A 1KH3A 4XFJA 1JECA 4S1OA 1JMVA 3SYTA 3FETA 1KP3A 1VLHA 4EG1A 3X1KA 4GU5A 4YMIA 1JIIA 1QNFA 1UFVA 3LCJA 5EKDA 3FH0A 1O0CA 3HV0A 1I6KA 2TS1A 3QTTA 4CQNA 1OWOA 3MMXA 1O97C 3SZGA 2NZ2A 4YP5A 3UMVA 3PRHA 3NV7A 4NZPA 3CVUA 3H97A 3ZJVA 4JYZA 3QTBA 5TEWA 2CV0A 3H9CA 4MLPA 3A04A 3IVCA 2CFOA 2VTBA 1EE1A 3DV2A 1QU2A 2X1LA 5F23A 2QUHA 2QJFA 1G8GA 1I6MA 3HL4A 1F9AA 5J58A 1WQ4A 1KQPA 3INNA 4ZT7A 4MUHA 2HGZA 4ND6A 2ZP1A 3KFLA 4RPIA 4EF6A 1N1DA 2CT8A 1D2RA 3K9WA 1KAMA 3CVWA 1JEDA 3N05A 1G8FA 4DDMA 1U3DA 1N2IA 3IMGA 2Z3VA 4OUDB 4EGAA 3ZIUA 1JIKA 3L92A 1GAXA 1NSYA 1P7PA 1NI5A 1WXFA 1M8JA 4BWVA 5LFAA 4JFAA 1F4LA 3IMEA 1GTRA 4Q16A 2QUKA 3N2YA 4WNYA 1Q19A 3GUZA 3ZJTA 2VXOA 4GRIA 1U7XA 3UK2A 2GM3A 2PZBA 1H1TA 2QUIA 4MUJA 1O5TA 1NUTA 1B6TA 3G6KA 4U63A 1NP7A 1WY5A 1N3LA 3AG6A 3PNVA 3CLUC 3CLUD 1WOYA 3FHJA 5LLTA 3COYA 5H7XA 3RBAA 5K0TA 3HZRA 3AG5A 2H2AA 3P0JA 1EJ2A 1X8XA 1YUMA 1EUQA 1T6ZA 3P0HA 4MUFA 4NATA 3MLBA 4XSVA 1KH1A 4MW9A 5J5AA 2AG6A 1KR2A 5DASA 2V0GA 2HMAA 4PBRA 4MAFA 4EFKA 2NSYA 4DDHA 1GTSA 5TS2A 1JGTA 1TYCA 1M8PA 4ZT2A 4MUIA 4EG6A 4EG4A 3DO8A 4MVYA 2WQ7A 2QJOA 3N9IA 4EG7A 1EFPA 2PG3A 2X0KA 1IVSA 5HUJA 1TEZA 1N2GA 1EFVA 4ZCTA 1MB2A 2Z08A 3ELBA 3ISJA 3LE8A 5LM3A 3H05A 3COWA 2CSXA 1OBCA 1T9GS 4DLPA 1IHOA 2WSIA 1FFYA 3A2KA 1K4KA 1T6YA 1VBKA 3ND6A 4DE5A 4ZT4A 1ZUNA 1N2JA 4ZCQA 4G5YA 1KQOA 4ZT3A 4MWEA 4QRDA 3G59A 3IVGA 2A1TR 1JZSA 1R6TA 1COZA 5BNZA 3IMCA 4XFDA 2E21A 1U0BB 4L2IB 1RQGA 1TQ8A 4QREA 1N2BA 2DEUA 3TQIA 5DK4A 3CVVA 5AHWA 1K97A 1WJGA 3S3TA 3RFFA 2DLCX 3HFJA 3IVXA 3IDFA 5IHXA 4MWDA 3KT0A 1KAQA 3F3MA 1J1UA 2HZ7A 4G6ZA 1O95C 2A7XA 4R0NA 5FO1A 1A8HA 2Z09A 3PNYA 2DPLA 1TYBE 1QTQA 2PXHA 2C5SA 1F7UA 1M1ZA 1J21A 1K92A 2A84A 1Q11A 3SEZA 3I05A 1I6LA 1J1ZA 4R2LA 1XNJA 1VBMA 1NZJA 1SURA 2G36A 3ZJUA 1MJHA 3D6VA 4PBTA 5HUHA 1WXEA 4EG5A 2JA2A 2AZXA 3L93A 2OV4A 5KCMA 2WB2A 2E0IA 1O0BA 1T6XA 3IODA 4RUKA 1O94D 1IQUA 4MW1A 3RK1A 3FOCA 3IUEA 3K32A 5KHAA 1GN8A 2H29A 1O96A 3M5WA 4YP7A 3COVA 3IUBA 5IJXA 3TZEA 4K0RA 4MW6A 4J76A 3TNJA 4KR9A 1PFWA 3BL5A 4YBRA 4NAUA 4HPWA 3VRHA 1ULHA 4HJXA 1OD6A 2B7LA 3CVYA 4MVWA 1LW7A 2EL7A 3D6UA 3ILVA 1TFUA 1WXHA 1YULA 1R6XA 2IELA 3GLVA 2V0CA 1NUQA 2CV2A 2JAXA 3AIIA 3RK0A 3COZA 2D13A 3VU8A 1OWNA 4H3SA 4DNXA 1MB9A 2QUJA 3E27A 3AFHA 2CYCA 3TQOA 1MAUA 3Q10A 3IOCA 4PBSA 1YIDA 2QTNA 2J5BA 2VTBB 1QQTA 4HK4A 3UOWA 1WXGA 2A4MA 3NBKA 2IJGX 1KQNA 3PXUA 4Q93A 4EG8A 4JZYA 1O6BA 1I2DA 4CT0A 1CT9A 2O8VA 4ARCA 3FI0A 4ARIA 4EG3A 1EXDA 3CLSC 4MW0A 1O94C 5FO0A 1EUYA 3P0IA 2J08A 2D54A 1H3NA 3A05A 2X3FA 2QTMA 4MVXA 3CA8A 3CLRD 1NUPA 5J59A 4E1AA 2A1UB 4U8HA 4F3RA 5KWVA 3CLTC 4I6GA 3IOEA 3SZ3A 4ZT6A 3P52A 2D5BA 2CYBA 2DR2A 3X1JA 3GMIA 1JEEA 3UC5A 1JILA 2QJTA 2BYTA 1OWMA 2PFSA 3TS1A 1XNHA 1OWLA 1ZJWA 1JZQA 1O97D 4MUEA 3X1MA 1VL2A 1WQ3A 2JANA 3UY4A 4MULA 3H9BA 1F7VA 1FYDA 3RJZA 2E18A 3FNRA 1Y42X 4NAHA 4MUKA 3LOQA 3SP1A 1HYBA 2J09A 4I6EA 3NBAA 1V47A 4DJAA 4MUGA 4L2IA 1ILEA 2PIDA 4KKVA 3SDBA 4CDNA 3HGMA 1ZH6A 4U7JA 1KP2A 4DDKA 2RE8A 4KR6A 1R6UA 2A86A 1N2EA 2PZAA 4FZJA 4A91A 1QU3A 1IQ0A 1PFVA 1LI7A 1N2OA 1N75A 2BTEA 1J70A 1YIAA 3IH5A 2PZ8A 4I6JA 3IOBA 3DLAA 2ZUFA 4YP6A 3PNBA 4MW4A 1QRSA 2OQ2A 3OP1A 1GZUA 4J75A 4QBTA 3FY4A 3DPIA 2WQ6A 1XJQA 4HJRA 1MBZA 3HMQA 1XNGA 5JBNA 2J07A 2E89A 1N2HA 4ZCPA 5DEOA 3ND7A 3CR8A 1YUNA
chains in the Genus database with same CATH superfamily
1SHJA 1D5WA 1K63A 2W6QA 3P1JA 4Y67A 4UTZA 3BMNB 4AZWA 3FPLA 2O5CA 1R88A 1ZISA 4KUGA 1GZ4A 1BQ3A 3G89A 2DVMA 5H4GA 3MAJA 4R41A 4YJGA 4XRRA 5F1YA 5HUQA 1YQEA 3MW8A 3DOHA 4FEAA 3TRHA 3UJHA 1EH5A 1PW5A 3SIRA 4HNVA 4TM8A 5AKKA 3KWLA 5IVKA 1X1BA 3F7TA 3PRKE 4MWBA 2IU0A 3GU3A 3GFVA 3D6MA 4AECA 2C7PA 2HSDA 4KL8S 1L3BA 3VNBA 3L7CA 4OL0A 4NMXB 4DJ5X 5IWAB 4WKCA 1ZUNB 3EIXA 1BEZA 4RKRA 2QP4A 4MUYA 5EMMA 2YWCA 3I0MA 2G1AA 4DWVA 1JFSA 3UT5B 2LE0A 1JR4A 2IYZA 3NIFB 1BFKA 1E79D 2C4WA 4I4TB 4LXTA 4CN8A 4RD4A 2XTMA 4KVFA 4PAMA 3EW7A 4PG7A 1FNMA 1QP8A 1NT2A 2XA9A 1GGFA 4ZWNA 1OGIA 1PUXA 1GADO 1ENPA 2OY0A 1C3VA 1EBUA 4WNCA 4EVSA 4Y1GA 2BLLA 1I2BA 3G2KA 4X7MA 2NU9B 3VGPA 3KDSE 5KCZA 2KB0A 5COQA 5DK6A 4FE3A 2GARA 2GERA 3H84A 4D6PA 2XJ4A 1SXGA 5ITSA 2Q5EA 5K0BA 2HT6A 3MFQA 1M3SA 3PJFA 1Z75A 4GBGA 4F3NA 3A1EA 1VGVA 1Q84A 3NEAA 3ONNA 1O96B 4IHKA 2B34A 3OT5A 1OTYA 4V3BA 4F2WA 2QRUA 1NVVR 4LJLA 3H0CA 5KYXA 1JH9A 5EZYF 5EJ6A 1A77A 3OEEA 1F9EA 1A3CA 1J09A 2LW7A 4E2FA 1U94A 3CUUA 4BNLA 1E2QA 2AFIB 2PO7A 2C8KA 3WKBA 4BO0A 5KSWB 2DFPA 3KQPA 1TZMA 2B2CA 4CDMA 3FNBA 1AOXA 1R2QA 1KKUA 4HB0A 4RL6A 3ZU6A 2BC9A 1E1QA 2J3KA 3JQ9C 3IR6A 1GSIA 2Q1YA 2NPFA 4BKRA 5IF9A 3M6XA 5FRDA 4KNWA 1UJ2A 1NVKA 3AOGA 2P62A 2ZZNA 4K03A 1PT7A 2I9PA 3TJMA 5A4KA 1AKRA 3WRYC 3HRIA 1JSLA 4DMHA 3E84A 2GZDA 2V97A 1RQPA 2AZTA 1JSZA 3QVUA 3HO1A 1W5BA 3ZUGA 10MHA 1YZLA 1UK9A 4OYRA 4IJWA 2WM9B 5B5SA 5ALMA 3WGYA 1AGNA 4HDKA 2DERA 4BQPA 2CUZA 4UEQA 3S2GA 2F7SA 1NMEA 3ZBQA 3HCAA 2Z2IA 3MWGA 4EFLA 1Y4AE 3DMDA 1X8JA 4WBXC 1RR6A 1XCOA 5IP5A 4H17A 3WGUA 1K88A 1Z88A 5GONB 3DEIA 2CW5A 1Y33E 3WLMA 5C31A 2D2EA 1VB5A 1O2DA 3Q8KA 5ELXA 3M6FA 3QF7A 3T1NA 3SYMA 1JIUA 2DRIA 3F49S 4M1WA 3KJEA 5GJWC 4ABTA 3L1HA 3AETA 3TNLA 4YMIA 2NUAA 3VC1A 1TTPB 3WSWA 3GPIA 5CHEA 3STUA 2GJ8A 4QQFA 4I9UA 2GPBA 1THMA 5B1DA 2P9TA 4W82A 5JNSA 2HXGA 3N2EA 2ZUBA 3K0FA 1RXEA 1ZMTA 3PJGA 4GQAA 3KR1A 5D85A 3H9EO 3HKCA 5CFOA 3M8KA 5AM5A 2OGTA 3SYLA 2Q6TA 1GGVA 1ZL0A 2J9XB 4K81B 4N5IX 4NFYA 3SZGA 3GWGA 3ZDRA 2NNWB 4CBVA 5IT5A 5K8CA 1VCMA 5IBQA 2K2QB 2LZ0A 5KYVA 1EYZA 2ZB2A 4JI0B 3Q3CA 7MHTA 2ZRQA 3HCEA 4R16A 1H2RS 1E1KA 5IM4A 3T3EA 2FW6A 3KSAC 2XGGA 3KXKA 4ZXFA 4QBGB 4JCOA 4MYRA 5E38A 5DDIP 3H9CA 2HLDA 3L6RA 5TEWA 1H4QA 3IVCA 4FR2A 4WGFA 3DPSA 3PD1A 4E7OA 3L4BA 2GPYA 3WLJA 1SC4A 2HUPA 2PV0A 3UICA 5EFZA 2GPSA 2G6BA 3AFIA 1RQXA 3SZRA 3WV5A 5KOJB 1FW6A 3UW1A 3IAUA 4E7PA 4NMHA 1ZINA 1B3BA 4ZALA 5K4HA 2BKVA 4G2TA 5J58A 4P86A 1M33A 5EMLA 5BSWA 1DAOA 4LF8B 5K6RA 1GUZA 1LXCA 4GM1A 1Q14A 1PK7A 1XDWA 1I32A 3DZDA 4FOOA 3GJQA 5A7GA 3TL3A 1KO7A 2NYVA 4B83A 2XWJI 4WLOA 4E94A 3Q8MA 1QK5A 1MZPA 1PL6A 3UMJA 2HPVA 4LZZA 3CVWA 2OC9A 4C2TA 4QARA 5PNTA 3TVYA 3WGGA 2JVIA 1U3DA 3HB1A 3IMGA 4EGQA 3CY6A 2GZRA 4G5OA 2PL3A 4NYJR 4NZ9A 2R0QC 2A5JA 1D4OA 4A3SA 4ZEVA 1GQYA 4P58A 1VI2A 3FAKA 4QODA 4CM5A 1HEYA 3JALA 5JZ9A 2C3OA 1J6UA 2XUPA 3K6SB 1RQNA 1ST3A 3RTGA 4F5WA 3IIJA 2WSSD 3SX4A 1ABFA 4LSMA 4ZZ0A 4QJ5A 2GYVA 4HFNA 4AX8A 3HR4A 4IDQA 2KLBA 3PC8A 4EWLA 2WD7B 5IZCA 2G0TA 3H17A 4ZI3A 3WAJA 2W4QA 2JIBA 1WMSA 2ZBUA 4OA8A 2OV1A 3RASA 3WZMA 4MUJA 1HDIA 1NF8A 1XP8A 1O5TA 1YKGA 3FDZB 3FLEA 3GW8A 1W49A 4TXJA 1ATIA 4NJOA 4IMJB 4EEXA 4HNQA 1JAHA 1EK5A 3GP3A 1W94A 1W96A 2I4NA 4QUDA 2XWQA 1MENA 1KYWA 1DO2A 1OXTA 1VIAA 3ADPA 3C70A 3GJ5A 1E69A 4RMIA 3UTCA 5BWOA 3GCXA 3QWFA 3WP0A 3P0JA 4ZOAA 1EVKA 2LR0A 4BNMA 3RT9A 1RCFA 2CVFA 2PD4A 1X8XA 4HB4A 1K5HA 4RZUA 3L1VA 4G4SO 4D5GA 5HCUA 2HK6A 1SHTX 1BE0A 5G1NA 1K5PA 1OVMA 1YC5A 2OM2A 3QFHA 4AJ9A 4B4DA 4CKEB 4FGWA 1I5RA 2CJWB 2IS4A 5C1PA 1MR3F 4W1QA 5AW4A 4KG7A 1M0TA 2HJ9A 5T3UA 3WRYA 4DV2B 4B87A 4RLHA 5FL3A 1GL9B 1VLMA 3U16A 1KQ3A 4MV6A 1NBHA 2BL4A 3IXQA 1C9MA 1MFZA 4H16A 3G82C 4KN9S 1N2GA 5HUJA 1AH2A 3C4QA 1EDDA 1MB2A 4Y9RA 2CLHB 4LGCA 5FT9A 1Z8HA 3D31A 2PXXA 3OKFA 1HNNA 3PP8A 3FFWA 5B7QA 3ZGOA 3A4MA 3PJEA 3EEOA 4HVAA 1OXKB 1VYVA 2AF4C 1DC5A 4L7VA 2OYSA 2E5LB 2YWFA 1JG2A 1U9IA 2NO5A 4MICA 2OAP1 4ENSA 2FN7A 1YBVA 2X7HA 4R2HA 2GETA 4XGQA 1FS4A 3AHCA 2WNSA 2YQ4A 1IVNA 3H1EA 3PHGA 5CYFA 5I7FA 2IXAA 2X3YA 1GTZA 1L4GA 1UOQA 3C7CB 1JHPA 1G18A 2W2KA 1XF9A 2XJ9A 3JAWB 1ES9A 2C8VA 1MC8A 3KAJA 4LTMA 5KYYA 1QHGA 1ZM9A 4TWJA 3VHRA 3EIFA 1QOZA 5ARDA 3BYZA 4UBLA 2CN1A 3SGLA 5FQNA 1RIFA 2C5GA 2W37A 4YJDA 1C80A 3F0TA 4E07A 5C1IA 2OO5A 3NETA 1SUDA 3ABIA 2UV8A 4HFJA 4UNNA 4W5JA 5CVCA 5ENZA 4AL4A 4D7AA 1G8AA 4LQLA 1Y63A 1GZSA 1RJWA 4IGAA 1BIFA 2W6OA 3PXAA 2IY7A 4LHSA 4XIYA 3RRMA 4C7MA 3ZVKA 3ETLA 5HKOA 3ER6A 3KZXA 4HYTA 4RS3A 8AT1A 3NKFA 7GPBA 4RKFA 2J9FA 5E7JA 5J2TA 1C9EA 2IHVA 2GPTA 3VO8A 3QX8A 2GKOA 4JVOA 4OO3A 2EQ5A 2ZPTX 1NN1A 2HI0A 3B1XA 3ITEA 1B0UA 3F4KA 4P33A 3B6MA 1U5AA 2AN1A 2WYWA 3DZBA 1E3LA 4AMYA 3TKYA 5CA1B 4LY9A 1KJJA 2ZIZA 1E96A 2OBBA 3CLVA 1W46A 2MU1A 4M76B 4UW9A 4RQAA 1CY7A 1GV0A 1T0JB 4FQ7A 3W5VA 1U2GC 3GLHE 3ZV5A 3AUYA 2A84A 5JRDS 1G8SA 5I8WA 3NV9A 4HY3A 3ILHA 3TMKA 1YKFA 3C6ZA 2CKDA 2V9CA 4XIGS 3CJTA 3E9MA 3G2JA 2JIPA 1NFFA 1M66A 2PTGA 3KQMA 4H9GA 2HJGA 2IHBA 5EOVA 2XBLA 3ETEA 1Z4IA 5DZSA 2JA2A 2VP0A 1UPUA 5AK5A 3L93A 1DUSA 3TIFA 5LZ5A 5JYDA 1S6YA 3UAWA 1FDSA 4ZI7F 3VH1A 5JZBA 1LA2A 2GM5A 2ASEA 3W6NA 1GFSA 2AOVA 2PUBA 1CCWA 2XWPA 3VVMA 1LJUA 3G5TA 4XTCS 1TMYA 1V1MB 3OQIA 3VSBA 1NW4A 3OMXA 4LXUA 4Y7CA 1W88A 4M0KA 5IKEA 4L74A 2YWHA 3CLHA 4F2GA 4BO4A 2C78A 2QTWB 1QUFA 4S1WA 1OXVA 4YP7A 2BHNA 2WF7A 5B55A 1FL9A 3U09A 4I4CA 4YRTA 5FBQB 1ESDA 3GROA 3GC6A 2ZXEA 3I6QA 3WBJA 4LJ7A 2NVUB 2FPWA 4BO3A 3NW9A 1Q2UA 1JDVA 3WLOA 1HSOA 4MKHA 1UXGA 1J0AA 1KP9A 5JI3E 1UBHS 4IDDA 3V1TC 3W8FA 3HHEA 1K75A 2ZJYA 3D0KA 1A9PA 1GPDG 1E2PA 1NW6A 2CCJA 3QQ5A 4J90A 4JR2A 4N7RA 4NH0A 3R7DA 5F2EA 4D8TA 5A3QA 2CDAA 2O52A 1LPBB 3SYKA 4M1KA 4NFLA 4U9IS 4EMUA 5KZMB 1RZRA 4EHAA 2P6RA 2D1RA 4FVTA 4KYVA 5B2ZA 4ZGGA 2NAFA 4BXOA 4OGKA 3LKBA 4ZJUA 3C7KA 4HWOA 2C2OA 2CLDX 1F12A 4X1OA 5JPIA 1XE3A 2NTJA 2VJAA 2A33A 1J2YA 5U4XA 1GAEO 2FPXA 3MCTA 5CNJA 5K4GA 1U63A 3ICQB 2FF5A 3OOEA 1L4MA 3ZLBA 5KWJA 4HQOA 2PQ2A 3GT0A 4YAKA 4JBXA 3TQOA 3K9FC 3Q10A 4BNHA 3IHLA 2MSKA 5LBTA 1UJMA 2AFHA 1TT5B 2XHZA 3KAKA 1NVFA 2BRUA 1BDBA 2VHZA 2WJGA 4Q7MB 3SLKA 1Y8CA 3L0ZA 3QFTA 2XUZA 2Q29A 1GA1A 1T36B 1X77A 3OUZA 4BVFA 1KFCB 3VKVA 3AYZB 1E59A 4CM3A 3B78A 3PITA 1WU8A 3JQ8A 5AI6A 3SMVA 3A3NA 3CNOA 4CF3A 3OKPA 4UUAA 1AGPA 2XDAA 3PFHA 4R1NA 4RY8A 1VMKA 1ZP6A 2M1ZA 3CB4A 4PRZA 1H8ED 1OGJA 4RVDA 4UUOA 3STHA 4FYJA 4D6XA 2HJRA 4EY8A 3OZVA 4HEJA 3L82B 4MYCA 1ZHHA 3PWSA 2EEZA 2ZS9A 2YFYA 4KXYA 4P4UA 1F60A 1U1DA 1AK9A 3BBLA 4FZ5A 1AX9A 4ER7A 2FPOA 1DV1A 2RGGA 3M6UA 3WLQA 5JNTA 4DZRA 3BTUA 3VKUA 3NHRA 3FYSA 2IOHA 4FKZA 4KP7A 3OBIA 2L17A 4OD0A 3I53A 5ED4A 4XW2A 2PRIA 1HZZC 2J85A 1FRQA 3GMDA 5F77A 3WQBA 4CIAA 1SD5A 5LYYA 5F1OA 4QYWA 1UJNA 5JMTA 1ZCFA 1YFKA 3KDPA 3NVDA 2FJPA 2EYUA 4EKGA 3FNHA 3ZWWA 4Y3UA 5I9IA 1RKBA 3WX0A 4LF9B 4LYHA 4AJPA 2M1XA 3C7TA 2FR8A 1W35A 2AMFA 2GZ3A 2PGAA 3HCDA 3I64A 3R1IA 3SCZA 4CFZA 1AS3A 1PHPA 2NO4A 2ODAA 3BTSA 3C6KA 1PCXA 3D64A 4L4XA 2QXTA 3DTNA 4C78A 2PFSA 2FQYA 4AP5A 1XNHA 1LQUA 4Q0MA 5ELMA 5D2CA 1KZ7B 3DLTA 1QAOA 4OU5A 3T54A 1X3SA 1JYSA 1IB0A 1QE3A 3HSSA 3UOGA 3WJAA 2PZGA 5BYKA 5IJ0A 1UXOA 1ZEMA 3OBBA 5AM4A 3A2MA 4FEEA 3QXHA 4KGVA 2BHLA 2E18A 2W2MA 4MVJD 2ZJ5A 5TY0A 1Q57A 4OOFA 1L7MA 2F43B 2YCLA 2PJUA 3FWPA 4WLVA 5NLLA 1GU0A 1Q7EA 2Y0EA 4DIEA 4TMWA 2V6MA 1UPAA 4CCYA 2FG7C 1MMFB 3HB4X 3LGSA 1PJZA 3F5SA 3KUDA 2QS9A 4TXLA 1Z4OA 3E3NA 5AJUA 3RIMA 5F9FA 5K09A 1RP1A 2PH5A 1SKQA 2QTZA 3QG1A 4G5SA 4LWQA 3RS2A 4EI7A 3LQ4A 2F4VB 4ICIA 2ZRKA 3AESA 2O7QA 4BFYA 2Y8EA 2CBGA 1VHTA 1AUVA 2MINB 5FWAA 1XQ6A 4UOEA 3LMKA 2DYKA 3NAZA 4G37A 1BDJA 3PUWA 1BXGA 1RAFA 4WFIA 3PR1A 4KMMA 2C2WA 3TCKA 1Y3CE 2ZOSA 2D0DA 2YXDA 4KFRA 1RM0A 3OLZA 3ZHQA 4OHWA 1K06A 1PS0A 4QBTA 1KQGA 2FW9A 4Q9NA 4G1MB 3JD4A 1X13A 1ZL2A 3A27A 3KKQA 5FBLB 1XNGA 4DOMA 5JBNA 1N0VC 1UDAA 2BDUA 1L5FA 4EGJA 1XA4A 2ES4A 3JVVA 3Q7IA 2VNAA 3QY9A 3ZY4A 3S1AB 5F4ZA 3FKSA 2I22A 3P9QA 1NSFA 4GZ3A 4ZEOA 4X7BA 3UAZA 4PLZA 1GXSB 2H7YA 4KRXA 2AJTA 1C7JA 4ZQEA 1RQ7A 2WTBA 2ONJA 4NEQA 4UCXA 3BXZA 1SWWA 2PD3A 3L8ZA 3OFSA 4UBJA 5KYUA 3IIEA 1P3Y1 3UAGA 4EENA 4YUYA 3NAGA 2BWJA 2CE2X 4DBVO 3HSKA 1Y6QA 3PA6A 3PLRA 4G65A 3QJ5A 5LMCA 3TMAA 2BMFA 3TQTA 5GZ6A 2ZVJA 4RA6B 4G0NA 3OU6A 5JQGF 3D3WB 2JEYA 4E1BA 1TF5A 4JGGA 3U9TA 3GJSA 4B6FA 1MDBA 2IS2A 2B8WA 1P7ZA 4UCWA 3H2ZA 1UM9B 2ILVA 1U0NA 4KE8A 3QE0A 4Q37A 3MUEA 1PJ3A 4L4RA 2R8EA 3KOUA 5CLGA 2FN8A 3JSAA 3KAQA 4PG6A 3WO1A 2COEA 3I9JA 1RYFA 3Q4GA 1UP4A 2ZATA 4OHUA 1QFYA 3HUTA 3E5HA 1OU4A 1OZHA 1RBQA 1Z12A 1P18A 4FI3C 2CUTA 2I6SA 4B09A 1JDPA 3G1UA 2RMKA 2YN0A 4F4HA 4LMRA 3W9UA 5HCIA 4EO9A 1NW5A 1ZBDA 3N3BC 1BN6A 1C14A 3WP1B 1W4BA 3JQBC 3JYOA 4RANA 2Z2KA 3WLNA 1OI7A 4UU8A 2DUWA 3ZCXA 4KHPB 1TJNA 4FMCB 2BGRA 1V9CA 3LA6A 4JKYA 3B89A 3L46A 4UBKA 5ALWA 3KKZA 2YXNA 4UHKA 4DHEA 4EI2A 1QORA 4KDEA 3GLKA 4LZOA 4RTMA 2VZLA 3UJAA 2WDPA 4UXJA 1I24A 2HMSA 3G0BA 3QHQA 2YS7A 1M0EA 3GMTA 1M2HA 1M8FA 4MWCA 2QNRA 1DPFA 2BMVA 4R9UC 3AF1A 4XJVA 3UT5A 3WMXA 4EZBA 4A73A 4IYRA 3VHXB 4NXNB 3WL7A 1R5JA 1GGMA 4L22A 5AOVA 3VOTA 2YWBA 1NA5A 1U8ZA 1YH3A 4B7XA 4YQFA 1X7GA 9MHTA 4TKUA 4KREA 1KYVA 3V3KA 1TKCA 1L5HA 4RDHA 2LXNA 1PQ4A 3OPNA 2XZPA 3RSLA 1HWYA 4IYJA 2CWWA 2QMQA 3EW9A 3TRKA 5J40A 1QB8A 1YZ3A 3QLJA 4OJMX 2IU3A 3LLMA 3LDUA 2DPGA 3T5AA 2H1VA 2AZMA 2DUMA 3HZOA 4P4SB 5B12A 3SSOA 1K6IA 1Z37A 2FUG6 4JB0A 4PGHA 4UARA 1UMCB 1WUHS 5AXDA 1G5IA 3ZCRA 1NLUA 1LLCA 2FZEA 3GVHA 4QUIA 1F4PA 1PZEA 3IP3A 3L05A 4NOMA 3DBRB 1FP6A 4WXHA 3T35A 3U3KA 2O5RA 2V9PA 1F51E 1XAIA 1T8WA 3UK6A 2G9UA 1ZU5A 2AEJA 1CR2A 1T2UA 3DZKA 2A3RA 2YWJA 1R6AA 3E9EA 1JECA 4M88A 2VVTA 4G1EB 2QVGA 3V8BA 1J7JA 2A9FA 5IM4F 5IMBA 1BYIA 3SXUB 4RVOA 2HEGA 1P44A 4LYAA 3NCTA 1QZTA 4Z2YA 3ZIDA 3PGVA 2DH6A 4ZO9A 4V0KA 3RVLA 3GFFA 1E1RD 3KOOA 4KKXB 1DKRA 4L7QA 5DMHA 3U3XA 4BNKA 4KTTE 2R00A 1N9GA 2X2PA 4UBOA 4Y2TA 5DGIA 4BVKA 4JN6B 3TRIA 4AQDA 1PNTA 5E3IA 5IVIA 1X7ZB 1N5DA 2VSNA 4HQRA 2O50A 1OASA 4ZQHA 3W6UA 1J90A 1EBBA 1D2MA 5JADA 2JLYA 2VDQB 2HQOA 3K92A 3SQDA 4V0ME 2NN3C 4OJKA 1WL8A 1P29A 2R7NA 5IC4A 4ZVVA 4YIHA 2GXAA 2WKQA 3PU6A 4PYMA 4MB0A 1GV1A 2WOOA 2GSWA 2JDIA 4WL0A 3RC7A 3VU9B 4BJ1A 1NVVQ 2HA6A 3R4VA 5DP2A 2CFOA 1AZWA 1KKMA 2X1LA 1UBJS 3SHVA 2JF0A 1EG7A 3UGJA 3KZ1E 4Q21A 4G9GA 3WE7A 4C43A 3MFYA 1DQPA 4BVBA 4Q7EA 2GAFA 1MFPA 1POXA 2EX1A 1GTG1 1VKHA 4O2BB 1LLFA 2P2GA 3O4GA 2W93A 3NDIA 2HHAA 1NNLA 2YYSA 2WW8A 1HK7A 3GOHA 3K7EA 4MUHA 4ND6A 4RJLA 3ZK8A 5K7SA 2XLBA 3R7SA 4DRXA 4DLUA 1NKSA 1N1DA 2ZBVA 3AY7A 2NYAA 5EXXA 2PK3A 2W6CX 3EGIA 4AO8A 1JEDA 3ZHVA 3QH4A 5FPYA 3GLHA 2FMUA 4NESA 1KI9A 5AJYA 3R5HA 1M2JA 2HPAA 4FGZA 1D0IA 3M4XA 4JZKA 4MI9A 4GOJA 3ESQA 4OQLA 5AJWA 3ZZ1A 1HZJA 1L4EA 1RRMA 2EATA 3BXPA 3PDWA 3N8DA 3CTPA 4R8RA 5AW6A 1GPKA 1WXDA 1UC8A 1MDFA 1Y7IA 1NBMD 3C7AA 4RPHA 1CDOA 4N54A 1ZU4A 3V8VA 4D3SA 5LFAA 2QRNA 4HEQA 4Y2HA 1E62A 3T95A 5JH7F 1OE0A 4HYEA 2HT1A 5C51B 1HNZB 3O90A 4GP6A 1YS9A 5A05A 3BL8A 5CVEA 1O1YA 2ZZKA 4G56A 4H27A 2GCGA 2JJYA 1DX9A 1GT91 3A7DA 3OT4A 3HDTA 3Q2IA 4GSYA 3AB3A 5EKXA 4BIMA 2C5AA 4MV9A 4BV3A 2B82A 4FFVA 4YJGB 2J8ZA 5HBRA 1V5WA 1H2HA 4UD6A 1G0OA 3T3PB 4EGCB 3EDRA 1Q0HA 3C4VA 4PFSA 5FYDA 3CU5A 3FTFA 4XDYA 2DAPA 2GB4A 3R24A 3LY8A 3RBAA 2C2HA 4CLEA 4J9VA 4ARZA 1UXIA 4M9XA 4EJSB 1RHKA 2QGNA 1WXWA 1YUMA 4OBXA 1T6ZA 4OAQA 1U81A 5GM1A 2QTCA 2A5GA 5K45A 4LCBA 1JYFA 3E53A 3QE2A 4KE9A 3T9AA 2A5DA 1T1EA 2C83A 4MQBA 3CNQS 1S2DA 1QKIA 4EA9A 3O31A 4ZAWA 3G8BA 2L18A 3N59A 4EFKA 5DM70 2X2EA 1GTSA 3NWJA 4PC3A 5C1DA 5SY9A 5I7SA 1E7YA 1W5AA 5JS6A 4LRXA 1Z5VA 4MK4A 1XJ5A 4MUIA 3ORHA 4JUDX 4O4LB 4Q5IA 2WWGA 2FZGA 3RPEA 2QQ5A 4BDSA 5F3WB 1OV4A 2X0KA 3FVQA 2RIRA 4RH0A 5D84A 3AJAA 3UUEA 1S0UA 3B3AA 2IHZA 5G0TA 1T0PA 4ASUD 5LM3A 4WZBB 3VJKA 4ILKA 1SIOA 1TCUA 3GMSA 1K7CA 1T9GS 5KNCD 2IX9A 3C5VA 2GHRA 5HZKA 3KALA 1W4LA 3VPXA 4JODA 5EXSA 2W6MA 4JKOA 1HL7A 5K99A 5EC8A 1K4KA 2QVYX 1I2AA 3L7NA 5LQMA 4XPZA 1KIAA 4RIEA 4U1RA 4ZYYA 2B7CA 1Z62A 3KXIA 4I5FA 1G20A 2WZDA 1UT8A 1D6JA 1Z22A 1M1YE 2P7HA 4CU5A 2JLWA 4RM2A 3EG9B 5ILOA 1CIPA 4BTEA 2QMEA 3PK0A 2GD0A 3IAEA 1J8VA 1Q83A 5F9HA 3G0IA 4U7DA 4TV8F 1JSRA 3NHJA 3EFBA 3QRWA 3TIGA 4AURA 3JD2A 1EVLA 1XZNA 3KQYA 5KNCH 2WWFA 1D4ZA 2O8DA 1D2GA 5E6SB 1U3WA 3AUJB 2PUJA 3LUBA 1JHRA 4LG1A 4GICA 4KBGA 3TSZA 4B6OA 3VV3A 2HA0A 1QB7A 1EK2A 3QFFA 1U1IA 3NDPA 1A7KA 5KQPA 1M34A 2GEUA 4O4IF 4AN1A 3L7KA 4JWTA 1RXUA 3RRYA 1QIGA 1NJ2A 2OZLB 3AU8A 5AXAA 1O4VA 3FUVA 1HLFA 3QUQA 4ZKEA 2I8CA 1V48A 2P7IA 2PXHA 3REOA 1JAXA 3AIMA 4I4TF 3VSAA 1KTVA 2CSUA 1OTHA 2IZ0A 3A4YA 4UAJA 2SHKA 2WIGA 2VHCA 2X22A 3I05A 5K8JB 4YAGA 3DAPA 1ICIA 2JGEA 2X8LA 4NICA 3DH0A 3THYA 1VBMA 4YMSA 2BI7A 2D8MA 2ZEJA 5AKEA 2ZYRA 2YQZA 3S1AA 3E23A 3DTTA 3IAS1 4F4UA 4EEZA 1PLJA 2WEKA 3N7UA 4IIBA 3F9IA 4QO8A 1K98A 1Q5PA 2ZAMA 4DQDA 5GIOE 3DVQX 3A28A 4AW9A 2MT9A 3OOJA 4OTZA 1QTIA 4AY6A 1J2UA 2P79A 4LUCA 1SOUA 1UBSB 3DV9A 1QS0B 1WMFA 2FF7A 3P94A 4RU1A 3WGJA 4Z1MA 3VKFA 5B6IA 2VYVA 1QF6A 4ATNA 1JAYA 3F4LA 2RK4A 1E99A 2WLSA 3MBIA 1KYTA 2E3JA 4YRKA 3KJQA 3DC7A 1JQBA 2JCGA 3P97A 3RBZA 4AT1A 1WCIB 1NW7A 1QHYA 4G9EA 3I2KA 1DJMA 1E9BA 3KFXA 3ZE8A 3QSYA 1A95A 3BL5A 3GGDA 3QU2A 3JQAB 1ZHFA 4RV5A 3UJ3X 4OBEA 4B48A 1P4RA 4NXMB 1XJCA 1ZJJA 5T4EA 4Z4IA 4LDZA 1FLNA 3T5BA 3LJKA 3QPCA 3WHLA 1JTFA 1MO2A 2HZBA 4LZWA 3OZFA 2F1RA 1BWSA 3JWIA 2VRCA 4UUQA 4AZ3A 4BZXA 1W8IA 1J2JA 4YVFA 4HWPA 3A4NA 2GRUA 4CG0A 4PC1A 4X7PA 3TBHA 4NCBA 4BMSA 2E4XA 3ILYA 1BOOA 4TSKA 4DNXA 4DNPA 4QOGA 3OWXA 2HK9A 2Z8ZA 1RJEA 2HLHA 5CNKA 2CJXA 3L1IA 3CE9A 4LISA 1E2GA 1AXRA 3PDUA 4RGQA 1PZNA 4WI1A 1UP6A 3EFHA 2PUHA 3ZKAA 1AK1A 3SM9A 1WABA 4ALLA 5FHQA 1XMJA 2RH9B 3IOCA 4K9OA 4PQFA 2ZYDA 3HKDA 4CR8A 2EGHA 2R60A 4HK4A 2J59A 1ENOA 2A4MA 3UOWA 3WLSA 4CMIA 1A7JA 1I3KA 1NR1A 2XDQA 4FPXA 4HWRA 5BOSA 1Z45A 4TYPA 4AF7A 2P4UA 2D5AA 3BXOA 3I2GA 4CR7A 4DDVA 1MB3A 3ZGYA 4DM3A 3H9QA 3TTTA 4OHPA 2JI8A 4F3KA 3UV6A 2AS0A 1DKNA 2CL0X 2NZVG 4B2IA 1O5OA 4BU1A 1Z0SA 2CL7X 3RYFA 5HFAA 1SZJG 1KI8A 2WM3A 1EXDA 5GM2A 1II8B 4TS4A 4Q7JB 4LDJA 2Q3JA 4LHVA 4H6WA 1OB5A 3L0SA 1AE1A 2JGJA 3FKQA 2QPAA 1TM4E 3SX0A 4XWKA 1DOAA 3GAMA 5B1IA 2J33A 2JARA 3QPDA 3VR2A 2QQEA 4RK0A 2JIOA 2AVNA 1MF7A 2XNJA 1CY2A 2QD5A 4I4NA 5G0WA 2ZETA 4F3RA 3RTEA 3LNCA 4PLHA 4AYTA 1JHXA 1I36A 3EFOB 4UU1A 1JEYB 3R6DA 1VE6A 2OBMA 2WE7A 2YHBA 2CUNA 1TNDA 3ROTA 1IEQA 2FP3A 5HM6A 2P3QA 3WYEA 3ZWXA 3ECAA 4GZ6A 4IUBS 2ZSDA 3CX4A 4FOSA 4AVYA 3LY9A 1NRXA 4HMPA 3PX3A 4ZVPA 4HAUA 1E3MA 2XGSA 2QZPA 4FC6A 4P4TA 1MUUA 1KSFX 1UKEA 1QVVA 1G21E 1RWQA 1II9A 2GLUA 4UBMA 4J7CA 3S2EA 4X8OA 2BKUA 1A97A 2F4NA 3GQBB 4RTKA 4NNPA 2GTPA 1VJRA 2IEAA 2OZLA 4MV7A 5E7IA 3REGA 1BU5A 2W2OA 3D3JA 5IU6A 2VCEA 5K51A 2XTNA 4X41A 3PWKA 1XRLA 2JZCA 3DHVA 4HL6A 3KLPX 2C1ZA 1ZM2A 1IHXA 3PFGA 2BF7A 3OO1A 2DM6A 3A11A 2C94A 1I7PA 1W93A 1PWZA 2EX0A 2VDLB 3AVOA 1HQDA 1YXMA 3D7SA 3EXFA 2C59A 2EP7A 3M4NA 4FYIA 3RC8A 5J2TF 1XWWA 2PZLA 2PJDA 3W2HA 4U7JA 1ETHA 3W3AH 2WVAA 3V2IA 5F5NA 5E7QA 1U0SY 1QHHA 2J45A 4BP8A 4YAIA 2AFHE 5F7JA 2HXSA 2ZRPA 4HS9A 4D2IA 3PI7A 1RLUA 4I6JA 1Z0KA 1P19A 3IQIX 3F6RA 4GVPA 4FZVA 1P1JA 4OQQA 4RKYA 5CXQA 4KSYA 2XRMA 1UUFA 2GPAA 1T8TA 5AVZA 1ODTC 4RZ2A 3AB8A 2WY2D 2OQ2A 2WYUA 5HEKA 4CEIB 3WGTA 1HBJA 5C8ZA 5FTLA 3G0CA 2RI6A 3ASUA 2H07A 2YIJA 4BFTA 5AI5A 5LLDA 5REQA 2C2ZA 4JD5A 4HVTA 4J16A 4R0MA 3I2FA 4YMVA 2BOVA 4FFBB 3M1LA 4NZNA 1TJPB 3GDOA 1S9DA 2ST1A 3E8MA 1C7IA 3FPFA 4I99A 5SZIA 3QGMA 3UHJA 5I9BA 4AQYB 1OUMA 1WCXA 3NEPX 3T9EA 1M8GA 2NU8B 2I54A 1CQZA 4R2MA 5DCYA 4DV5B 2CLLB 5AVRA 5JD4A 1QIDA 2HA4A 4QLAA 4RVSA 1Q12A 4XJSA 3IX7A 4HTFA 2BSQA 5EHZA 2WC1A 4IDAA 3U9SA 1IIRA 2BGKA 1EM8B 2ZYVX 2O05A 4FZRA 4ISCA 1RJ9A 3QKWA 2WTXA 2GI4A 3MJFA 3F97A 1WF6A 3IP5A 2SECE 1JBEA 2QRJA 4P4NA 3ZXSA 3E05A 4YUXA 1GPMA 1I4DD 4G5HA 4LOHA 1T4CA 4YASA 2V55B 2H9AA 4KO1S 3RAJA 1P5HA 4ZN6A 5L8VA 8MHTA 2B1GA 5A6SB 5KOIA 1DBQA 2EW8A 4RESA 5EY5B 3RUPA 1QRUA 1NXQA 1QIHA 2A67A 4H31A 2MMCA 4D0SA 4HD8A 3KSMA 1X7YB 2P65A 1W59A 1ZC3A 2FVXA 4YRJA 2QB5A 1Z3CA 2HV8A 2MIIA 3DLIA 4PY2A 3WNZA 1C4OA 4ZT5A 4C1NA 1CUEA 4EY3A 1JKFA 2JAHA 3AF2A 1J0EA 1S4MA 4IRUB 1Z47A 4KFSA 1E0AA 4TV8A 4JENA 3GVPA 3ILXA 4P2BA 3G68A 2Q3MA 4Z53A 4GM4A 1PSWA 1BNCA 3GEDA 4RF5A 3WWDA 5H9VA 3OJ0A 3H1PA 2CK3D 3GVCA 2N3ZA 2W2TA 2ZROA 4RHEA 3SZMA 3C3YA 4KPEC 3DEYX 1DL5A 2H1OA 2JFUA 2FSVC 4R8SA 3H42B 4BRUA 2CEKA 4JGIA 1EK0A 2EX4A 2GRJA 2CC2A 3ZI4A 4E22A 1KXJA 1IH8A 4DJDC 5CDHA 1ZJZA 3CF4G 4L5BA 3U37A 3JXEA 1C9YA 1RHQA 4DAEA 1UBNA 3WYNA 4D4IA 3CQ9A 4KSBA 1QH1B 1XD2B 1NQVA 3M70A 3T7EA 2QTHA 2ZAYA 1Y5IA 3NMUF 1WXIA 1XCMA 1XHEA 2Q8PA 3RUIA 4KQ6A 4RIFA 5DX0A 2AUNA 3AM4A 5MN5A 1ZJYA 2D59A 2VZEA 1MJFA 3DFZA 3MMSA 1M1NA 4IDPA 1G5PA 4JL8A 1THGA 3O47A 1LDGA 3CR7A 2E4WA 3F98A 4MW7A 4HAXA 4CG2A 2GLXA 2L0XA 4ENWA 4ZHQB 3GLGA 4MW2A 2ZI3A 1WPRA 3C8ZA 3E1SA 1ISHA 3EXHC 2Z2YA 4RFSA 4YJFB 5HOEA 2ZUEA 2G5CA 2XRYA 4R2JA 2C2BA 1YIOA 2DHEA 2WWWA 2X77A 4KQMA 5EE1A 2MSWA 2J9ZB 3DEHA 5CCBA 4J0HA 2FU5C 1YDMA 4NV3A 1RXVA 3GRZA 1ZQ1A 3R74A 1DC8A 5DN6A 5KYKA 1KPHA 2AKEA 3A6HA 2HNBA 4INZA 4LX8A 4OOEA 3ZWVA 2ILTA 4JB8A 4OG2A 3VO2A 3ZDBA 5CJ2A 1Z5ZA 3STXA 4XVUA 4J6FA 2B20A 4QPJC 1LS6A 2XYPA 5FEMA 2XCRB 1R0WA 1YF3A 2EYQA 3VYSB 1ULTA 3HJUA 4R68A 4DQ0A 3Q41A 1Y3BE 4JOBA 2ZBDA 3KTAA 1ZGAA 4XX0B 2SCUB 2V4UA 4U02A 3CT6A 3DGEC 2OV8A 4LNUA 3VTKA 4BLTA 4C6TA 3SD7A 2JATA 2TS1A 3UHFA 4LMAA 5AWFC 3IUSA 5HRUA 1PU2A 2DQKA 2O4CA 2X4IA 3AVWA 1ETUA 2FUEA 2OBLA 2NZ2A 3W4JA 1NF2A 3AX6A 4B7UA 2WPDA 3MTIA 4NJMA 3H5NA 4EYOA 1I4EB 3NV7A 1Z33A 4HH1A 5SYAA 2KWIA 3N28A 3NTLA 5ARCA 5AW8A 2QE6A 3JATA 1JJFA 3PI6A 3ONEA 2VEDA 1ORHA 2QORA 3N0TA 3O8OB 4YB8A 4UMVA 4MI1A 4QG7A 1C7QA 2P0EA 1ZCZA 2R2GA 1G7TA 2ECFA 2FWIA 3B3FA 1UK8A 2BGJA 4Y2UA 3PNQA 3K1AB 1LZLA 3LPMA 2I3BA 1R4AA 2O3UA 1DKLA 2YYZA 4LRUA 4R69A 1F9AA 1L5HB 4WCDA 3UJBA 2VPTA 1U9IC 2VJQA 1CUGA 1GNPA 1H23A 4JEHA 4XUEA 3TPCA 3KLNA 2P8SA 1M67A 2WA1A 2FI1A 4GEKA 1JVSA 1Y1KE 4EKYA 4FWTA 4CKZA 5IVHA 4YALA 1YOVA 2B5WA 4EMBA 1HTBA 3K73O 1B0PA 4EAQA 1S8FA 1FCJA 4LDAA 1GEEA 3MZ0A 4LI3X 3V7WA 1JI0A 4U2GA 2Q46A 1P2UA 3I6YA 3PGA1 4XD7A 3WRWA 5ICEA 2C5FA 1TGVA 3ONDA 1QLJA 3DMFA 1FRVA 1P9OA 2Z5VA 3MWEB 3V1KA 4F4FA 1CUZA 2QUKA 3IAS6 3N2YA 5L4NA 3GLFA 4IF4A 3HWWA 2IYXA 4JUFA 5E4JA 3N2GA 4O3FA 3VPCA 2O19A 1V0JA 1AZLA 1HPLA 2IDZA 4MRRA 4DIFA 2WSBA 4L3OA 1TM1E 4G1UC 1ZM7A 4EA7A 1RW4A 2NOAA 1G41A 2IZOA 4G89A 3WO0A 1NUTA 4WOCA 4HN4B 2R44A 4FFSA 1SUIA 4ZCLA 2HSWA 3SK0A 3WNBA 1YDFA 2YUIA 4R8MA 3I83A 3UCEA 5J4HA 5LLTA 4JEMA 1LU9A 1Z4KA 1GJRA 2JFQA 2WYOA 3K2QA 4EB3A 1M2VB 1VPDA 1Z39A 3IOYA 4UOQA 1FFXB 1FRNA 4FGUA 2O3SA 4FFOA 1XCJA 2HA5A 3WGNA 4DM7A 5FBZA 3RHTA 2NXJA 4GLLA 1O89A 4KB5A 4Q3LA 2KHZA 4CHTA 1NN5A 4L51A 3HU1A 1GD1O 3P0HA 1P75A 4MUFA 5AICA 1ZHOA 4XSVA 2XT9A 3PFBA 4CMCA 5KSYA 2GD2A 4M86A 1CZOA 2BSXA 2JI7A 3TQFA 3H4VA 2H1WA 3K9BA 3B36A 3ETNA 4MITA 1L7XA 1KVQA 1WVIA 1OI2A 2HCRA 2PYZA 2PU7A 1W0KD 3OIGA 4JT2A 4MV0A 3HE3A 1ZONA 3DKRA 1G9XA 4EB8A 4EHIA 4M7WA 1HT1E 2I6FA 3OTOB 1YVDA 3DOEA 3OE7D 4IDOA 2FZWA 5A4FS 1Z5UA 4D57A 2QWXA 4ZV4A 3U5TA 4BO5A 3DOUA 3SSNA 3ZWQA 2YOGA 3EG5A 4R7GA 2PKYX 4OK3A 1KY2A 2C84A 2WTEA 3CNNA 3LH5A 3RUAA 3OZSA 3K09C 2ZE6A 1AF4A 2NX2A 3V80A 1CQJB 4N39A 4DLPA 2JKZA 2RAFA 2ASVA 4GR9A 2D2IA 2ESRA 2X14A 3DDHA 4PPFA 1LTHR 2SKCA 1VSUA 1X9GA 1Y7TA 1OHHA 1JN0A 1ORTA 3VU1A 2FKNA 5KAMA 1GN9A 1T2FA 3AP2A 3OFND 4C3VA 4QOSA 1N7GA 1WDWB 5EFOA 2QK4A 2AN5A 4YT8A 2Q5IA 4JH0A 1GCOA 1WTAA 2BY4A 1RWOA 2GN2A 5ETJA 1GZHB 3IBTA 3R41A 2J31A 3ZWAA 5FAKA 4YACA 2DFVA 1E0JA 1KPGA 3HU5A 2BGTA 2IH2A 3IVGA 2PWYA 4KUEA 3TXXA 5BY2A 3X44A 4Y6GB 1O7JA 3SXUA 2B35A 1ZN7A 4PCVA 4V1CA 2VPQA 1U0BB 4L2IB 1MEOA 3PXDA 2ZBGA 3WFIA 2IHNA 5G3ZA 1EVYA 1K3FA 2VPXA 2YWRA 4GE3A 2R8YA 3SJZA 3U7QA 1BDHA 3PRJA 3C3BA 1SD2A 3FBGA 2P5YA 5ABPA 5F98A 4JJ6A 4ZICA 3I6ZA 1P39A 3PSHA 3QOWA 1JKXA 1MQAA 3M4YA 4RH3A 1UMCA 4LJSA 1NHGA 2AW3A 3QY0A 3MF4A 1ST2A 4W7SA 3G02A 2HZ7A 3R75A 1GKIA 1KJIA 3NZEA 5U4QA 1QOPB 3GAFA 2YV2A 1TYBE 3GV0A 4DCUA 2QRVB 1XV5A 1L7AA 1PLLA 2BELA 1K2VN 4UPDA 5JH7B 1ZGZA 2CNKA 4H0CA 3OHPA 3V1UA 8LDHA 1U7UA 5AHXA 3EPKA 3QKRB 2VAVA 4R2LA 1QIIA 3C87A 3X1ZA 2ORVA 1BOFA 2QLBA 2WWVD 3BCSA 2GGSA 2H2IA 1QZZA 3QE9Y 1S4QA 5K2MA 3QOFA 4AMZA 4EG5A 3ZG6A 1E92A 1KI6A 2WB2A 3IODA 1US8A 2HW8A 2RGEA 4REOA 1UMBB 2I2FA 2O06A 2R6R1 2VJMB 2UVPB 3ND9A 4E33A 2V6FA 1SQSA 2GEDA 3I2YX 4CU2A 1G1MA 3K32A 4KNYA 1SUWA 5KHAA 5JD6A 3UWPA 4F3CA 3O1JC 4IY1A 4X1IB 3JZAA 1VJGA 2YNMA 4IW3B 1XZPA 4JXKA 2Z9DA 4UHBA 1U2GA 1X15A 1YAHA 5CBPA 1FSFA 4YJ3B 3ONWA 1X1EA 1U3GA 5GQSA 1EXNA 4PX9A 3H0EA 4YBRA 3U39A 1EHCA 3RGWS 3P9XA 4BVGA 1VI5A 2XOEA 3D6AA 1XC7A 2WTMA 3NTXA 3PL1A 5DRYA 4ZZ1A 1Z6ZA 3SKYA 3IP6A 1R66A 5CP8A 2EFEB 2EL7A 1IN6A 1N0IA 2VS1A 1CS4C 1O6GA 4JNCA 5FUMA 1BCRB 3Q6MA 1WXHA 2QU8A 3AHGA 3IJPA 4KVZA 5HMLA 4CETA 4NYMQ 4B7ZA 1M1YA 4FDMA 4EPYA 4AJKA 1K4YA 1T2VA 1N6OA 2OESA 3AKYA 1UBLS 3FMVA 4UEKA 4PEVA 5AJHA 4IIVA 4MCJA 5JISA 4JI2B 3NXSA 3INRA 3VTFA 4PIMA 1VIMA 3C1TA 1KARA 1NJ1A 1N57A 4TTTS 5HMMA 1RHRA 3PJDA 3OEYA 4G0MA 1YS7A 3W06A 3ZE1B 1I2MA 3TLKA 5KNBA 2HWUA 3FCUB 1CY4A 1Z5PA 2Q6IA 1T5IA 2OXFA 1CJMA 1KFBB 2XKJE 3JQRA 3O03A 3W2FA 5F35A 2OFOA 2PMBA 2D3WA 4LCJA 4C0XA 5TIIA 2B8EA 4K5QA 2FUCA 3GZNB 4TWAA 2OYRA 2OFFA 3GK3A 1MZVA 1QPGA 1T26A 3A36A 2FJUA 2KBEA 3TRJA 3HL0A 5LZ9A 4L57A 1EVJA 4EX6A 5ERYA 2OV2A 1G5RA 1KDPA 4Z5XA 1P61B 1NF3A 1VKNA 2AYYA 4RIHA 1LSSA 3MWDB 4BO7A 2GBCA 3GRAA 4P32A 2BEKA 4QGAA 1TEXA 3H6HA 3H7IA 1QP0A 1D03A 4JJ7A 1TZCA 4NKRA 4MQFB 2IT1A 3HN6A 4LY3A 4XCVA 1XRSB 3QPVA 4N5LA 5CX4A 3RAFC 1HXHA 1TM3E 2CXNA 4DLNA 1QYRA 4UTPA 2KE5A 2A0XA 1VJ5A 2R1ZA 1NI3A 3VYUB 4KGZA 2SKEA 4ZVRA 5JXGA 1U1EA 3QV1A 1A9QA 3NBFA 3WTBA 4RZ3A 1N4AA 2C29D 4NENB 4IZOA 1HDGO 3W5AA 1LX7A 5KWSA 2VHVA 4G85A 4WCVA 4L6AA 4E13A 4DPMA 1YRQA 2VOJA 3MUNA 4TSFD 2FSFA 2P90A 3A1SA 4XYMA 3EXG1 4YRZA 5JSFA 1TJ4A 2O1XA 4N8SA 5BNIA 2UUAB 3RANA 2DLNA 3A1FA 3GRCA 4HAWA 4NBSA 4KMSA 1TPYA 4A6EA 2RK3A 1DX4A 1VZ2A 1XK7A 5DLQC 5JJIA 4DWWA 3TEJA 2QMZA 1SH7A 3CIOA 2WTNA 3CSDA 5KYWB 1XIVA 3JQBA 1N4DA 4ZPXA 1GZ5A 2IHJA 2VL7A 5BSRA 4RHYA 2ZM5A 4OHOA 4KBYA 4FN4A 4Q6WA 1VL2A 4D44A 1O3YA 4CM8B 3AMVA 4NZOA 4NS1A 2OHXA 1CB0A 2KMLA 4EJ0A 3PZBA 1E1CB 1KEEA 2Z95A 2HHCA 2VDUE 3MIIA 1NVGA 4FHDA 4XWAA 2LCIA 4P82A 4EUHA 2SNIE 1P5JA 3D81A 1G8MA 1XZ8A 1NVWQ 1TIPA 3NBAA 2GM4A 4DBZA 3CGGA 3TLXA 3EZNA 3HWRA 1IEVA 3P0FA 2CHGA 4F4CA 3OA0A 4WE3A 2Y1DA 2CZQA 4D9BA 3HGMA 3DDNA 2E1PA 2BEWB 4DJFC 2CVZA 3U3OA 1UFKA 1IQ0A 1ENZA 3DAFA 3H5VA 1L7RA 2JD1A 3LM8A 4HB3A 5CVUA 2PL1A 3DTYA 3UMGA 2TECE 4ZAXA 3KV3O 1E77A 4ZVSA 4DIDA 1UT5A 4DRYA 5J23A 4XCQA 4OXKA 4ND1A 1KO1A 4L0MA 4MW4A 4IV0A 1HLPA 1VMIA 3O9MA 3DS8A 4BCCA 3IE0A 5C1OA 2HY7A 4J0DA 1NXTA 1KI4A 1TKBA 4RHTA 4J3NA 3ENVA 1XJQA 2XUKA 2OB1A 3DYVA 3KL4A 3TW8A 1ZCJA 5KTTA 1Z4NA 1OX5A 4A2PA 4LFBB 1P74A 1YZTA 1W0JA 2ZLBA 4GHWA 4L3WA 3LNTA 4BPBA 4PZLA 3GCGA 3W90A 4LSZA 1G21B 3QOXA 3S70A 3B1YA 1CZLA 1ULUA 2R3SA 2VHYA 3R76A 4WDQA 3CKMA 1CULC 3U4GA 2JGNA 4AO6A 4ER3A 3CYFA 2D1TA 3KT6A 1PR2A 3KG2A 5I7OA 1LF5A 4Z6KA 3QX3A 3CLSD 1B23P 4BCDA 1QV7A 3FMOB 1NGSA 4J1TA 5EIBC 1JQJC 1I0LA 5HZHA 2ZRHA 1OAKA 2AJ8A 2BM8A 2EKPA 4J49A 5DB4A 1EK6A 2X9QA 4LYEA 4R9SA 5T6MA 2X13A 2WA2A 3NIGB 2H0AA 4J1SA 3K4QA 2YJTD 4U2DA 5AVTA 2WWIA 4GKVA 1P0CA 2QSJA 1VG1A 2OXRA 5G1PA 1OSNA 3F8WA 3AL0C 1GLNA 3QMVA 4Q1AA 1J9EA 2J48A 2GBLA 4CF6A 1SEPA 1P2VA 2J3LA 3U4QA 5JT1A 1QCZA 4GXRA 4EVIA 1NLMA 2PUAA 3F5MA 3BZUA 1PD1A 4URUR 3BMCA 1GDTA 3M33A 5FPPA 4EQ6A 3BM5A 1OLSA 3CXUA 3K0AB 1J23A 2VQFB 5DNWA 1MOPA 1TAHA 3OCVA 2JCXA 4FI3F 3OTWA 3F5DA 3R2JA 4ZIRA 3TB6A 1TJ5A 3ZLVA 1G64A 5TDHA 3N0WA 2WU8A 2HJSA 5IFKA 3G2LA 3THRA 4KPUA 2GA9A 5EXEA 4UD2A 4OQNA 4HNUA 4D9FA 1JHZA 1TI7A 1R12A 1RRGA 1UAYA 2H2FA 5LU9A 3ZIAD 3HY3A 1JJIA 3OO0A 1DV2A 1YI8A 1OREA 2ZT5A 2DQSA 1UADA 2P9BA 3AO0B 4W4TA 5B64A 4FT2A 4HX2A 5JXIA 1KI3A 1BW9B 4K6HA 4WTOA 1KBQA 1YVEI 3I30X 3MT8A 1WMBA 3B6JA 5I9TA 1QDLB 3P9NA 1R64A 4HADA 3F6PA 2R5WA 2O2EA 5D1NA 3JQ6A 1QVZA 3U49A 2WIJA 3EY4A 3RREA 1QZ3A 1HH4A 2ON6A 2QP9X 2IDKA 2X5JO 3V2HA 3OM0A 1QDEA 4FYMA 5CYGA 1XI2A 1A8UA 4CLDA 1W52X 4Q9JA 2WMDA 2JAPA 3E9NA 4JBLA 4ZJZA 1XRJA 4MW5A 4O1IA 4MMZB 4RMGA 4XUGB 5A4DA 5LQUA 4D80A 1X6VA 4XQCA 5A7HA 1DU4A 1M6VA 4F5EA 3EH2A 4RW0A 2Q3FA 1OBFO 3AEQA 3CM0A 2H4ZA 1NUSA 1US8B 2RONA 4GOOD 1WM1A 4KIFA 1SC1A 4AY4A 2PZFA 4BJHB 5K0ZA 3OTQA 2DHQA 4GKBA 4XD7D 4BYGA 3KQTA 3DE5X 3MLAA 2RIPA 3A6JA 1X7DA 1XHFA 1K4MA 1JE1A 1V5IA 4HDSB 4R8KA 4MUMA 1QGYA 1BS2A 2EJBA 2NSHA 3MJHA 2ODNA 3H5WA 1RC1A 3K2BA 4HNHA 1GCGA 3I5XA 4Z4EA 3IPYA 1PWHA 4AMBA 3LOUA 2KLHA 2QLJA 3OIFA 4OXNA 3UMBA 1EUQA 4OMDA 5L6MB 2ZSUA 3GFOA 1ESNA 1JX6A 1X92A 1EFRD 1PT9A 5AK6A 3H3JA 3LCJA 2IPMA 1AUPA 2AYZA 3AI2A 3DZHA 3MJEA 4C0BA 4BQIA 1OH6A 5ADHA 1T2EA 2Q99A 3DT8A 3H5LA 3AJEA 5CXSA 4LZAA 5LZ2A 2G07A 2GCPA 1GPYA 4OQZA 4XSGA 3QWIA 2I3DA 3PC4A 1ZVVA 5JS1A 1JBKA 3WNQA 3CO0S 2XXJA 1EFDN 4HDMA 1PEYA 1RJDA 2ZRCA 3LT5A 3VR5D 4DR4B 4AFNA 4RK5A 4EHLA 3VAYA 1MH1A 1D7AA 3UC9A 4CM7A 5KHLB 1X7XA 2XECA 4KIUA 3TBFA 3MMNA 4J2OA 4AZVA 2PANA 1PG5A 1RPJA 1G291 3L41A 2QMUA 4ZYZA 1DO0A 1G17A 2C82A 1RQ2A 1N8KA 4M8LA 3ZCVA 1AB5A 3BFPA 4FXPA 1LQ2A 3O7MA 2BFBB 4M21A 5DU2A 1GLVA 2FEMA 2IV3A 3HM2A 3ZHRA 2PX3A 4P7BA 2HPHA 4TX1A 2NUPA 1QR6A 3M6WA 3NHLA 3U44B 4WJZA 1NMQA 3G88A 5GV8A 3A10A 4RVHA 4WK2B 5D5QA 1HT3A 4ZT7A 4DLSA 4A03A 2IXTA 4GQIA 4MQMA 2I76A 1XROA 4JBWA 2WSLA 2PT6A 2ZB3A 4UAVA 4NK4A 3X1WA 3NANA 2FCRA 3NB0A 4MWSA 1E1NA 3KPVA 2O7RA 3DWIA 4E11A 3FOEC 5B30A 2BKLA 4N7BA 3UMCA 2GVNA 1AUQA 1Q21A 3LFUA 5FA8A 4NMLA 4A5SA 2X9LA 2I7XA 2QVBA 4E12A 1NSYA 1XK6A 1E9RA 5AJTA 1U6KA 3DBVO 1CY6A 2W6PA 1UM8A 1Z73A 5BQOA 3FHLA 1JDZA 1ZMRA 3QI2A 4QFCA 4OJYA 3LBIA 3VOBA 2RG1A 2YX1A 2V7WA 3NC1C 3JQGA 2XEXA 4LRQA 1Q17A 4I9NA 4DLVA 3V7UA 4ZVNA 4WNYA 4UFOA 2ATIA 1EX9A 1SBIA 1DWUA 4K9KA 1BD3A 1SWVA 1AG9A 3CB2A 3QA3E 5KQRA 3O8QB 5KX5A 1DRVA 2WKSA 2JBAB 2VJKA 2ZYGA 4V24A 5ER9A 4WZAB 6LDHA 1B6TA 4YRQA 4YT4A 3EOAI 4E5NA 1UOOA 1V3VA 3CLUD 5K6AA 1WE2A 3K8ZA 3SBOA 1J8DA 2ZJ1A 3SM3A 3BB3A 2JZOA 3M6MD 1QYXA 1V4VA 2F3RA 3HNOA 3RS7A 2H2AA 5HF6A 2JLQA 3EDCA 3LWNA 3IBGA 1IEWA 4CCWA 1OCEA 5E8JA 3MRXA 3U13A 4WESB 4PZUA 4I1OA 1LF0A 4W6ZA 1G4HA 4ACBA 1JQLB 1UAGA 3CKKA 4WZAE 5IYZA 4RK1A 4YTEA 1YK1A 1V5FA 2WFAA 3IAXA 3O7WA 1Q50A 3L7BA 2QRVA 3ZH2A 4HPJB 2GESA 3MBKA 4MAFA 2O6HA 3QBEA 1RYNA 1NXXA 2P2DA 5AW5A 4C06A 2IC5A 5ALXA 2VYNA 2JHPA 1TYCA 4QFBA 2GMWA 4ZT2A 2FFHA 2HDHA 2DKOA 3IDQA 1H1LA 1I3OA 3TJRA 3R5KA 3S8EA 2QW0X 3BCUA 2MSDB 2R85A 1R9JA 3FD8A 2H51A 4LNUB 4M4SA 4C6TB 4ESOA 3O1LA 1YC2A 2IYNA 4ARSA 2P27A 2EFDB 2AMVA 2ZT6A 3HR8A 4HDRA 2XUGA 4FLEA 5DKFA 3DE3X 2YUTA 2R6AA 4AMGA 4K88A 1P4GA 1TPZA 2ZQZA 1SUSA 2FK7A 1VLZA 1YQUA 3E4DA 3PPVA 4OB8A 5DHFA 4KLNA 4IDEA 4D46A 3CG0A 3HCFA 3T3MB 2G25A 1RXSA 4Q4JB 1VBKA 5E6UA 3GRFA 2Q0HA 4G86A 2GPNA 3EUEA 1CNMA 3OMLA 3RJ9A 2XBUA 3MTQA 3TUZC 4QRDA 4QKQA 2QYSA 3EXIB 3FPCA 4GXNA 3L6DA 1G2QA 3IC5A 2HIMA 3AETB 4KWHA 3IQZA 5E1OA 5GAJA 5JLJA 3QTLA 4MV8A 4RQUA 4YMUA 4YONB 1T6BY 4QOJA 2YMMA 1YDEA 1Z82A 3DA8A 1VE1A 5IJ9A 2YN4A 2CNOA 1GZ3A 1JZTA 4K0KB 1EFRA 5HJ7A 3UFBA 4ZQFA 2A9QA 3TNYA 1CJTC 4KLAA 3MJCA 2PX2A 1VIDA 2V5UA 2PLRA 2P5TB 1HX7A 4CF4A 4KK3A 2HN9A 1MG0A 2A0YA 2ISSD 2R47A 3CR3C 3HR7A 1PX2A 3QUSA 1OX4A 4I19A 4V02A 3S4YA 4G4GA 2I1WA 3QNWA 1BXGB 2NXWA 4P3OA 2H1CA 2QVCA 1NTRA 2Z6UA 1VKZA 4A10A 2OECA 1U8AA 4KV9A 2CDRA 1PZHA 2PUWA 1VL5A 3OZWA 5P8WA 2WTUA 5GJBA 4IOKA 2ECQA 3N7AA 5A04A 5JG7A 1FYXA 3HO6A 4N3CA 5LB2A 4ZYTA 2P4SA 4Z0NA 1ZJ6A 3DVSX 5HKKA 4J7UA 4GMHA 3H65A 4HRAA 5JAZA 2NMVA 1N36B 1U4SA 2HBYA 3C5WP 3V00A 1V5GA 3OCXA 3OQ1A 4OGGA 1YBFA 2HBZA 4G1VA 1CJBA 1V95A 3QVGB 3TEMA 4BLVA 1ZY2A 3UAYA 1Y3IA 5LIRA 4MGEA 2OAQ1 1ISIA 1D2NA 3CF2A 3ORRA 5IYZF 3KZNA 5FA5A 1NIPA 1E6UA 5DNCA 2E5FA 3B5JA 4O08A 4RAOA 4C5BA 1KE1A 2JAUA 1XDBA 3L18A 1VRVA 1Z0JA 5DNDA 5ICFA 4X54A 1W9MA 1R4MB 2GEBA 3C1UA 3GGPA 3IHKA 4E6PA 3COVA 3RYTC 4AKEA 1XZFA 1DJOA 4BPRA 3DAHA 5MN4A 4LCEA 4PC6A 4K0RA 4XM2A 2CVPA 2O7NA 1LK5A 3R5SA 3UO8B 5CB4B 4CZ2A 2PZMA 3WFJA 5K05A 4K7JA 4DXHA 3D0QA 3N3AC 2Q2WA 5LP6A 5D6NA 5M5BA 2VP5A 4XOIA 4NAUA 4D74A 5FR1A 1T2NA 4JUAA 2UUOA 4O63O 1KTIA 1NONA 3X3HA 3CVYA 3DOCA 1SZPA 1Y3HA 4XB2A 3NTVA 4ZVLA 1VRWA 1YQWA 4GC5A 5BUQA 1U4NA 1WDTA 3I3SR 3PFNA 1TCBA 5ENDA 3PQ7A 3RFXA 1J5EB 2HMUA 1MOQA 1L4BA 1S2LA 1Y8QB 2A8YA 2V1XA 4UCFA 3AIIA 5JCJD 1SXJC 5G0SA 1QIKA 4GE0A 5FTKA 3PNLA 3HRKA 3MUOA 3R20A 3LGXA 1HO3A 4X97A 2BHRA 2XNKA 5DSTA 1OLXB 3LPLA 1NJ5A 3NKLA 1Q6YA 1L8QA 4R9VA 1DCFA 4KVAA 5F1KA 3SYRA 4Y9DA 3K31A 5DBHX 3FHTA 3EUWA 1G9TA 4EO7A 1YCFA 2QOEA 1AKTA 4JKIA 1WXGA 3MK31 4OQFA 2CNBA 1MOZA 1SCUA 2IZ1A 1U04A 1ECLA 2VWPA 3FWYA 3IV6A 2CXOA 4LHXA 3TLCA 3RE1A 1NQUA 1UOEA 3KOXA 3FAZA 4YDHB 4DKXA 1N2SA 2O2CA 3PVSA 5DMXA 2BJHA 3FTDA 3L8YA 1JIXA 5HILA 3WXBA 4X45A 4DEYA 3O8NA 3KTAB 1FYEA 2BFCA 3KM0A 3R3ZA 4XX0A 3ADKA 1W34A 3VC7A 3OWHA 3P0IA 2VSYA 4OXYA 3VSDA 4BOYA 1V5EA 1WS6A 3I5AA 1BG6A 1TADA 1FFBA 2DPMA 3EIQA 3ROQA 4CM4A 1PF7E 3AILA 3OX3A 2OGZA 1Y34E 3AZPA 3BRSA 2OUIA 4P92A 3A9CA 3CLRD 1L5RA 4Q4JA 1IXRC 4MKZA 4WFKA 3TBKA 4WXMA 5EWLA 5K3DA 4ZCIA 3B52X 1C4WA 3CUWA 3DV0B 3JQ9A 3TPFA 1OV6A 3AR7A 4JC5A 4LBYA 9GPBA 1UMDA 3SE7A 1ZVQA 3HTXA 4JJ8A 2OSBA 2K4MA 3DL7A 4FGJA 1HYEA 1PHRA 1RHJA 2A14A 2VNKA 1X74A 3LUFA 2PMKA 2QPLA 3I6BA 4J1QA 2REXB 5K8UA 1I5EA 1KVSA 2QENA 2RH5A 2G71A 3RNOA 1AGRA 2H48A 4PHHA 3DR3A 3SWWA 1VGRA 1IXKA 3IESA 4KO4S 3O8DA 3V4FA 3T99A 1XZAA 5AJZA 1EZZA 4LY0A 4P98A 3B2EA 1JMYA 4ZDIA 2DUNA 3A3YA 4DF3A 1I1HA 1ADBA 1PGQA 3I12A 4N6NA 3NO4A 1GFWA 2ABWA 3R3JA 4IDCA 1MW8X 1O8BA 5DT9A 1RFGE 3CCCA 1NATA 3RU7A 2QG9A 1E6MA 5DOVA 2IUSA 5LQSA 3E35A 3U4HA 4CQLB 3KVVA 4ZO6A 1YQ9A 2Y1FA 4NCNA 2C54A 4RVFA 3KYIB 1HORA 3LVRE 2Y0CA 1R18A 1V2HE 1X94A 2OQVA 3EC1A 3LU1A 3B82A 1L5WA 2DOKA 3COSA 4HFMA 1Z74A 4DANA 4DNOA 5G02A 4ZJYA 2FW7A 4CDNA 4ALIA 3EY9A 1ZH6A 2PZJA 3DXXA 2A0UA 5G40A 3TI9A 5H82A 4DDKA 1YSCA 3BJZA 5TGDA 3AF5A 2C1XA 3BCHA 1QU3A 2EGGA 4O2LA 1PQYA 2Q6VA 4IAOA 1UMKA 5AW9A 5M7EA 1Y3FE 5C4MA 2R62A 2UZ1B 3D7LA 4TV8B 3VV2A 1C4XA 4MRMB 1LUAA 3PNOA 3LUAA 2ZJ6A 2OQRA 4QPDA 3PNBA 3ROPA 2B1RA 1H5QA 2GPWA 3JWHA 3BJRA 4X85A 4AAYA 3OCUA 4G8CA 3B5EA 2IW1A 3TNDA 3F71A 3OFJA 4WKPA 2P67A 1A50B 4HJRA 3F9CA 4KYUA 1IOWA 3LHFA 4Z0HO 4LC1A 5BN4B 3QLUA 5A6SA 3HMQA 1ZGCA 5AW3A 3UAVA 2ZI6A 1AV7A 5BV7A 3G49A 4W1SA 2NGRA 1P2BA 2HD4A 4J07A 2TMKA 3BHJA 1KY4A 4Y2XA 3R7NA 4L0CA 3RYHB 5L6LB 4MEAA 1JS1X 1R5NA 3ZOKA 2A5FA 1UCFA 1Z7YA 4WLFA 4B33A 4B6QA 2XNSA 5F33A 3UWMA 5EJ7A 5LQDA 4N0MA 1XRNA 4QJIA 4P9NA 1R0SA 1T4MA 1OBHA 1U7HA 4F86A 5D7BA 2PRKA 4RJJA 3CRVA 4KLRA 4L50A 2TMGA 1A7AA 1H8HD 2BV3A 1JA1A 3ZI7A 3O26A 3WNDA 221PA 3ZGVA 1AMUA 1AXGA 2ZUUA 4B17A 1ZXBA 3U5ZB 1E3DA 1M5TA 1F2UA 2OBXA 5KNDH 2V7QD 4C0JA 3LF2A 4AJ2A 4ZZ3A 1JSCA 3IVRA 4UHHA 1BJTA 3Q7RA 4MV1A 2NVWA 4JU9A 3RRFA 2X8BA 3J80A 4E21A 3NFRA 3PCXA 3HXLA 2XEDA 4RPKA 4BMZA 1AQJA 2DH5A 2BEJA 3P20A 3LUDA 5LUBA 2YJGA 3AJDA 2JZNA 3N2GB 3FHCB 4QYXA 4II3A 3JQ7B 4L4SA 1SVUA 1U0JA 1OGYA 2VRWA 3GRPA 2BGGA 3QLTA 1RWBA 2W7TA 2ZXUA 2WMYA 3REQB 5AVUA 1URPA 1JU4A 2B8NA 1TQHA 2R5NA 4G0PA 4IGEA 2BFMA 3T61A 2J4CA 4DXAA 4F11A 1ZIXA 2XVZA 1VFPA 4HVLA 1AKVA 2F3TA 3JQAD 1LK7A 4BL5A 1SUAA 2ZXFA 4KMOA 3D7MA 4K26A 3QE4A 3D3NA 2VT3A 3AJ8A 1FUYB 3HO8A 4E4YA 5C8YB 2WFZA 4REQA 1IOLA 5DTRA 1VP3A 4DDTA 1KWKA 2H1SA 2ZWAA 3HFSA 5FUBA 3HA2A 2GAAA 1WX1A 1Z2AA 4EMTA 1MAVA 2F1JA 5HJ5A 5DBEX 4NOKA 4D4MA 1X19A 3HEBA 4Z9YA 3LBHA 3NTOA 3Q9LA 4HGPA 4X0EA 5PGMA 3E18A 4UTNA 4D0NA 4MS4A 1H6CA 1KOFA 4HNGA 3BWCA 2B36A 2BFPA 4H15A 1L5NA 3ZUPA 2CJPA 1NDQA 4BFCA 1NYQA 1UFRA 2QN6A 1DBIA 2VSXA 3IHTA 4MGIR 1U0RA 1GKLA 4HKTA 4P81A 4PIPA 1FEZA 2ZAIA 4QGGA 2HLPA 3D7RA 3FWKA 3Q6NA 2E4ZA 3TSYA 4D8YA 4EYSA 2PWZA 3A1NA 5L3SA 2YHIA 2G7ZA 1FSGA 3EXEA 3H3XA 3QA9A 4QVKA 1RACA 4AKGA 3K0SA 3EJWA 5AVQA 4RZHA 4C4TA 1AURA 5F3DA 2XUQA 2LDXA 2W2NA 5M29A 3GA7A 1MB4A 1N6IA 4Q4AB 1H2ZA 4HN2A 4U00A 2AFHB 1ORIA 1Y6GA 5F2OA 2EKZA 4HAYA 3WJ2A 4GVLA 4X1IA 3IEMA 1N77A 1G59A 1LS1A 4B5KA 4E5VA 5BVGB 3LRPA 1ZVKA 3F96A 1Y4UA 1EDOA 2OHGA 1V8BA 2H8GA 4C5AA 1KP3A 4WDRA 4EG1A 4DCPA 1FU4A 3E9RA 4R3NA 1EPUA 2HDOA 1W4CA 2HO4A 4OPMA 4QT0A 3L1UA 4JQOA 1AS2A 4QM6A 3STYA 3GPCA 1PR6A 4MO2A 3WL8A 3TQHA 3PQ4A 4QNNA 1EJ6A 1SAYA 1O0CA 2AMJA 2CFIA 1SUEA 3KHKA 4GLJA 1R0YA 1GL7A 4MXDA 4BZQA 4C87A 3AVQA 3WLTA 1RC8A 4X60A 1K3TA 3U7FB 4CQNA 1RHUA 3AF0A 4Q00A 2Z43A 4B3IA 5KQGA 1QANA 3I6MA 3M81A 1EFAA 3UB3A 5EP4A 5FPSA 3TTUA 1X0VA 2I0FA 2PS1A 3NEJA 4HQ0A 3UMSA 2GQ0A 3VA7A 2REQB 2JFFA 3OHMA 4BNNA 3KTOA 1CD5A 1CJUC 3BH0A 5CFRA 1E3IA 2BI8A 4H7HA 2QROA 1CERA 4RHXA 5FWXA 2JK1A 4MTLA 3MCWA 1P1RA 4FNMA 1X1AA 1Y4SA 2QLLA 1KEKA 2DFLA 4UMDA 5F23A 1YZYA 2AVDA 2C7GA 3U1TA 2AW5A 5T4BA 4D4LA 1IN7A 1P6QA 2EF1A 3OAAD 4NR0A 1BCSB 1E79A 1HNWB 1JALA 5B3LA 3SEAA 5C5EA 1G7SA 5JJBA 5C52B 3BSSA 2VH1A 3UWSA 2P2LA 3AY0A 3ICPA 3JARA 4FGSA 1HRDA 1E1QD 1FOEB 2ZIAA 4YP0A 2OBFA 3RTCA 1QP7A 2F48A 2FG5A 3RYFB 4JU8A 4S24A 1B93A 3W78A 1D2RA 5CIWA 4PSVA 2FMTA 3VNQA 1W19A 4BKPA 3BF7A 3KYDB 3KYDA 2EOAA 2BEUB 1RPNA 1XQWA 3N05A 3PQFA 4G1CA 4FLFA 4MV4A 4B34A 4EKNB 1HFWA 1FY2A 1PZXA 1WSWA 1KVUA 1ZK1A 3G85A 4OXRA 3PEEA 5IAKA 2R4TA 4AJOA 1CUBA 5FFMA 4INPA 1SUPA 3RS0A 4EUNA 1F17A 5C53B 4R51A 4PYKA 3E03A 1Y3AA 2WWXA 1ZCBA 1Q91A 4JFAA 3IB6A 4CQMD 5EP3A 3IMEA 1EEHA 1C3EA 4NL4H 2P6UA 3SYNA 2OT3B 3W6PA 1GPUA 1X7WB 5CK4A 2QTVB 1HQKA 3GJ6A 2JJ8A 4R1OA 2X6RA 2ID4A 1AD2A 3JY6A 1NNUA 4YJ3F 4GRIA 3VPBA 1PV4A 4RMJA 1KYIA 2FPIA 5KQLA 1R8QA 1G6HA 1P1BA 4X63A 5B6PA 4CMHA 4CW7A 4NDZA 4TOIA 2O2DA 3DBHA 5CX1A 4YJ2A 2I2WA 1ORDA 1XA3A 3L0YA 4FMDF 5ULLA 2C5LA 3ASYA 2BCJQ 2WU3A 3K2EA 1AHPA 1NP7A 2R84A 2ZI7A 3MOIA 3AG6A 4EKEA 1G8PA 1H6DA 2ZBQA 4UUBA 2VAXA 4JI5B 3UF0A 4ZDKA 3MIZA 1DAHA 1D6MA 4S05A 3FVTA 1PQWA 3BREA 1JLHA 3G2MA 3O95A 1WZUA 4I9FA 4JVMA 4P3PA 5B3JA 1GZDA 4Z3DA 4DLRA 5NULA 1U8YA 3HPRA 4R05A 1OIVA 4NATA 2E4YA 4UDOA 1MX9A 3NG1A 3KU4A 4ETIA 5BYBA 1NYTA 5B1HA 3DDZX 3NOVA 1I80A 4R7TA 3V8NA 1JT2A 3HY6A 3GG2A 3KQQA 4MVJM 4AUEA 1PUIA 2HBQA 1SU8A 2OLKA 3E81A 2NU8A 4A9AA 1W5SA 3SHQA 2OVBA 3GZNA 4OHKA 4E3ZA 2R8ZA 4EG4A 3GFPA 1EM6A 3KEQA 3VR4A 4IVNA 2HK7A 1ZGGA 1BD4A 1FPQA 5L9AA 4WKGA 3TLJA 3NBXX 2IYUA 3KFVA 2H5EA 4CMJA 3C5CA 3T3HA 3AR3A 3GZ4A 4KN5A 4QYIA 3PE3A 3UG6A 3ABQB 3COWA 3HDYA 1E1MA 4KQ2A 5G3YA 1J42A 3WZ2A 4KXFB 5K20A 3HJAA 1PTJC 4PSKA 4RTSA 4ETWA 4C3ZA 3HACA 2OHIA 1VKRA 1PYOA 4YJKA 4BO2A 4EW6A 1T6YA 4BLOA 3I9KA 3CEMA 3IO5A 1HYQA 4ZT4A 2X8JA 4XDHA 3HYRA 5DIFA 4PQEA 5GOTA 2MDTA 3WKCA 5FDFA 2H08A 2RAUA 1G20B 4JB2A 4TUYF 1E9EA 4CFYA 1DSSG 1KQOA 4LFCB 3WKDA 4IJVA 1GWNA 1Z0DA 3EFEA 3FRJA 3K53A 1JWBB 1XTVA 2RB4A 3PHIA 3HP7A 1C50A 4BJ6A 4UFPA 5C4IA 1EAYA 5AJVB 5C7LO 1QRAA 3EGDA 4WX2B 2XHEA 4ZU6X 4H1WA 1RQGA 3KB6A 3VISA 1TQ8A 1MORA 3LLSA 1Z4PX 2GCEA 2WYIA 3RHZA 1BJRE 3ZY5A 4TZKA 1E2FA 3H8VA 4YWJA 1UC4B 4LBVA 4NI5A 1RYZA 3BWVA 1XTSA 3THWB 3VR3D 3ZU4A 1H9BA 1G5FA 1WB5A 2ZUDA 3RCBA 4DR6B 2I1QA 3CZAA 1U2EA 4UM9D 5ALIA 5HK8A 4LXIA 1BWPA 5FCDA 1TMOA 5LDDC 4II7A 4IIDA 5K0JA 2OQIA 4B2LA 4W63A 1A8HA 4BHTA 1YQTA 4FCVA 3QVVA 4LV5B 4U5QA 4B3JA 1GQSA 3TMYA 1G3MA 3LGAA 3PENA 2HMWA 3MWYW 4P5DA 4RJTA 4FHCA 4LA4A 4G1FA 1P3DA 3OZGA 5IK2A 2XE4A 4TXNA 5ENVA 2DFTA 2WUEA 1JR3A 5GV7A 2PE5A 3R44A 4TZ6A 1SURA 2ATVA 1EXMA 4TQUS 3OETA 4NULA 4JMPA 3D6VA 1JA0A 3FBWA 1YUBA 1E3SA 3I9NA 3OAAA 4JC4A 4Q1CA 3W5DA 2H2GA 2R4UA 4B8YA 4PLGA 3OLVA 2QBYB 1ZSVA 4UM8B 5AW7A 5BUZA 1S1CA 3KNZA 3BDAA 3FNGA 2QAGB 1QG0A 2C07A 1QYWA 2RARA 4H59A 5JFTA 2IS6A 3OUUA 5AM0A 3HB9A 4G0ZA 3M5WA 2GD1O 5BR1A 1MD9A 1KZ4A 5TQJA 1AKMA 2OCLA 3V1YA 1PGPA 1ONPA 2F1KA 5ERXA 4XEHA 4BATA 1T5LA 4U7TB 1ABEA 1SUFA 5JEDA 4ZVOA 3M5CA 4J76A 4NYJQ 5LA6A 5FTMA 4HNAB 3UHOA 3BFKA 4J4HA 1NSTA 2PX0A 2H9YA 4QLOA 3ZHZA 2PUVA 3WQHA 2E1RA 1T8YA 2W6IA